PT1576132E - Ácidos nucleicos e proteínas correspondentes designadas 273p4b7 úteis no tratamento e deteção de cancro - Google Patents
Ácidos nucleicos e proteínas correspondentes designadas 273p4b7 úteis no tratamento e deteção de cancro Download PDFInfo
- Publication number
- PT1576132E PT1576132E PT03788558T PT03788558T PT1576132E PT 1576132 E PT1576132 E PT 1576132E PT 03788558 T PT03788558 T PT 03788558T PT 03788558 T PT03788558 T PT 03788558T PT 1576132 E PT1576132 E PT 1576132E
- Authority
- PT
- Portugal
- Prior art keywords
- cancer
- protein
- quot
- seq
- expression
- Prior art date
Links
- 206010028980 Neoplasm Diseases 0.000 title claims description 192
- 201000011510 cancer Diseases 0.000 title claims description 124
- 150000007523 nucleic acids Chemical class 0.000 title description 51
- 102000039446 nucleic acids Human genes 0.000 title description 36
- 108020004707 nucleic acids Proteins 0.000 title description 36
- 238000001514 detection method Methods 0.000 title description 31
- 102000040430 polynucleotide Human genes 0.000 claims description 137
- 108091033319 polynucleotide Proteins 0.000 claims description 137
- 239000002157 polynucleotide Substances 0.000 claims description 137
- 238000000034 method Methods 0.000 claims description 106
- 210000001519 tissue Anatomy 0.000 claims description 92
- 125000003729 nucleotide group Chemical group 0.000 claims description 80
- 108020004999 messenger RNA Proteins 0.000 claims description 73
- 239000002299 complementary DNA Substances 0.000 claims description 69
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 45
- 239000013598 vector Substances 0.000 claims description 45
- 238000012360 testing method Methods 0.000 claims description 42
- 238000009739 binding Methods 0.000 claims description 25
- 210000004072 lung Anatomy 0.000 claims description 22
- 210000001072 colon Anatomy 0.000 claims description 15
- 210000001672 ovary Anatomy 0.000 claims description 15
- 210000000496 pancreas Anatomy 0.000 claims description 15
- 210000000481 breast Anatomy 0.000 claims description 12
- 238000000338 in vitro Methods 0.000 claims description 9
- 210000003932 urinary bladder Anatomy 0.000 claims description 9
- 210000003734 kidney Anatomy 0.000 claims description 8
- 210000000988 bone and bone Anatomy 0.000 claims description 7
- 210000002784 stomach Anatomy 0.000 claims description 7
- 210000004291 uterus Anatomy 0.000 claims description 5
- 210000003679 cervix uteri Anatomy 0.000 claims description 4
- 208000032839 leukemia Diseases 0.000 claims description 4
- 201000001514 prostate carcinoma Diseases 0.000 claims description 3
- 230000001926 lymphatic effect Effects 0.000 claims description 2
- 238000010839 reverse transcription Methods 0.000 claims description 2
- 210000003491 skin Anatomy 0.000 claims description 2
- 210000004907 gland Anatomy 0.000 claims 1
- 108090000623 proteins and genes Proteins 0.000 description 351
- 102000004169 proteins and genes Human genes 0.000 description 227
- 235000018102 proteins Nutrition 0.000 description 218
- 235000001014 amino acid Nutrition 0.000 description 158
- 230000014509 gene expression Effects 0.000 description 138
- 210000004027 cell Anatomy 0.000 description 135
- 229940024606 amino acid Drugs 0.000 description 124
- 150000001413 amino acids Chemical class 0.000 description 122
- 108090000765 processed proteins & peptides Proteins 0.000 description 99
- 125000003275 alpha amino acid group Chemical group 0.000 description 79
- 239000000523 sample Substances 0.000 description 60
- 239000013615 primer Substances 0.000 description 59
- 102000004196 processed proteins & peptides Human genes 0.000 description 54
- 238000011282 treatment Methods 0.000 description 52
- 239000002773 nucleotide Substances 0.000 description 46
- 239000000047 product Substances 0.000 description 45
- 108020004414 DNA Proteins 0.000 description 43
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 42
- 206010060862 Prostate cancer Diseases 0.000 description 42
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 42
- 239000012634 fragment Substances 0.000 description 42
- 241000282414 Homo sapiens Species 0.000 description 41
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 40
- 229920001184 polypeptide Polymers 0.000 description 32
- 210000002307 prostate Anatomy 0.000 description 32
- 201000010099 disease Diseases 0.000 description 29
- 206010061535 Ovarian neoplasm Diseases 0.000 description 26
- 108020004705 Codon Proteins 0.000 description 25
- 206010033128 Ovarian cancer Diseases 0.000 description 25
- 102000007066 Prostate-Specific Antigen Human genes 0.000 description 25
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 25
- 239000012472 biological sample Substances 0.000 description 25
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 24
- 210000004962 mammalian cell Anatomy 0.000 description 23
- 108091034117 Oligonucleotide Proteins 0.000 description 22
- 230000003321 amplification Effects 0.000 description 22
- 238000003199 nucleic acid amplification method Methods 0.000 description 22
- 206010027476 Metastases Diseases 0.000 description 21
- 108700026244 Open Reading Frames Proteins 0.000 description 20
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 20
- 238000004458 analytical method Methods 0.000 description 20
- 239000000203 mixture Substances 0.000 description 20
- 206010005003 Bladder cancer Diseases 0.000 description 19
- 206010009944 Colon cancer Diseases 0.000 description 19
- 201000005112 urinary bladder cancer Diseases 0.000 description 19
- 230000000295 complement effect Effects 0.000 description 18
- 108010049041 glutamylalanine Proteins 0.000 description 18
- 238000009396 hybridization Methods 0.000 description 18
- 230000001225 therapeutic effect Effects 0.000 description 18
- 208000029742 colonic neoplasm Diseases 0.000 description 17
- 230000034994 death Effects 0.000 description 17
- 231100000517 death Toxicity 0.000 description 17
- 238000003745 diagnosis Methods 0.000 description 17
- 230000006870 function Effects 0.000 description 17
- 238000003757 reverse transcription PCR Methods 0.000 description 17
- 208000026310 Breast neoplasm Diseases 0.000 description 16
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 16
- 238000006243 chemical reaction Methods 0.000 description 16
- 208000020816 lung neoplasm Diseases 0.000 description 16
- 238000006467 substitution reaction Methods 0.000 description 16
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 15
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 15
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 15
- 230000000692 anti-sense effect Effects 0.000 description 15
- 230000010261 cell growth Effects 0.000 description 15
- 238000012217 deletion Methods 0.000 description 15
- 230000037430 deletion Effects 0.000 description 15
- 201000005202 lung cancer Diseases 0.000 description 15
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 15
- 201000002528 pancreatic cancer Diseases 0.000 description 15
- 208000008443 pancreatic carcinoma Diseases 0.000 description 15
- 102000007469 Actins Human genes 0.000 description 14
- 108010085238 Actins Proteins 0.000 description 14
- 206010006187 Breast cancer Diseases 0.000 description 14
- 108091028043 Nucleic acid sequence Proteins 0.000 description 14
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 14
- 238000004422 calculation algorithm Methods 0.000 description 14
- 239000013612 plasmid Substances 0.000 description 14
- 206010005949 Bone cancer Diseases 0.000 description 13
- 208000018084 Bone neoplasm Diseases 0.000 description 13
- ITYRYNUZHPNCIK-GUBZILKMSA-N Glu-Ala-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O ITYRYNUZHPNCIK-GUBZILKMSA-N 0.000 description 13
- 238000000636 Northern blotting Methods 0.000 description 13
- 108010077245 asparaginyl-proline Proteins 0.000 description 13
- 208000035475 disorder Diseases 0.000 description 13
- 108700028369 Alleles Proteins 0.000 description 12
- 206010008342 Cervix carcinoma Diseases 0.000 description 12
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 12
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 12
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 12
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 12
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 12
- 201000010881 cervical cancer Diseases 0.000 description 12
- 238000010367 cloning Methods 0.000 description 12
- 230000009401 metastasis Effects 0.000 description 12
- 108010056582 methionylglutamic acid Proteins 0.000 description 12
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 12
- 238000001356 surgical procedure Methods 0.000 description 12
- IQACOVZVOMVILH-FXQIFTODSA-N Glu-Glu-Ser Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O IQACOVZVOMVILH-FXQIFTODSA-N 0.000 description 11
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 11
- XMBSYZWANAQXEV-UHFFFAOYSA-N N-alpha-L-glutamyl-L-phenylalanine Natural products OC(=O)CCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XMBSYZWANAQXEV-UHFFFAOYSA-N 0.000 description 11
- 210000004556 brain Anatomy 0.000 description 11
- 238000002512 chemotherapy Methods 0.000 description 11
- 108010034529 leucyl-lysine Proteins 0.000 description 11
- 210000001165 lymph node Anatomy 0.000 description 11
- 108010003700 lysyl aspartic acid Proteins 0.000 description 11
- 239000000463 material Substances 0.000 description 11
- 238000012544 monitoring process Methods 0.000 description 11
- 238000003753 real-time PCR Methods 0.000 description 11
- 238000013518 transcription Methods 0.000 description 11
- 230000035897 transcription Effects 0.000 description 11
- 108091026890 Coding region Proteins 0.000 description 10
- 108020004635 Complementary DNA Proteins 0.000 description 10
- 239000011543 agarose gel Substances 0.000 description 10
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 10
- 230000002759 chromosomal effect Effects 0.000 description 10
- 230000000694 effects Effects 0.000 description 10
- 230000001965 increasing effect Effects 0.000 description 10
- 210000004185 liver Anatomy 0.000 description 10
- 230000037361 pathway Effects 0.000 description 10
- 239000002987 primer (paints) Substances 0.000 description 10
- 230000001105 regulatory effect Effects 0.000 description 10
- 241000701022 Cytomegalovirus Species 0.000 description 9
- 241000588724 Escherichia coli Species 0.000 description 9
- KFKWRHQBZQICHA-STQMWFEESA-N L-leucyl-L-phenylalanine Natural products CC(C)C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 KFKWRHQBZQICHA-STQMWFEESA-N 0.000 description 9
- 108010002311 N-glycylglutamic acid Proteins 0.000 description 9
- 108010087924 alanylproline Proteins 0.000 description 9
- 229960000723 ampicillin Drugs 0.000 description 9
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 9
- 230000004927 fusion Effects 0.000 description 9
- 230000012010 growth Effects 0.000 description 9
- 108010044056 leucyl-phenylalanine Proteins 0.000 description 9
- 238000004519 manufacturing process Methods 0.000 description 9
- 239000002609 medium Substances 0.000 description 9
- 230000002018 overexpression Effects 0.000 description 9
- 230000026731 phosphorylation Effects 0.000 description 9
- 238000006366 phosphorylation reaction Methods 0.000 description 9
- 108010090894 prolylleucine Proteins 0.000 description 9
- 238000001959 radiotherapy Methods 0.000 description 9
- 108010026333 seryl-proline Proteins 0.000 description 9
- 238000002560 therapeutic procedure Methods 0.000 description 9
- YFSLJHLQOALGSY-ZPFDUUQYSA-N Asp-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)O)N YFSLJHLQOALGSY-ZPFDUUQYSA-N 0.000 description 8
- NKLRYVLERDYDBI-FXQIFTODSA-N Glu-Glu-Asp Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O NKLRYVLERDYDBI-FXQIFTODSA-N 0.000 description 8
- 102000005720 Glutathione transferase Human genes 0.000 description 8
- 108010070675 Glutathione transferase Proteins 0.000 description 8
- 101000702559 Homo sapiens Probable global transcription activator SNF2L2 Proteins 0.000 description 8
- 101000702545 Homo sapiens Transcription activator BRG1 Proteins 0.000 description 8
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 8
- 206010025323 Lymphomas Diseases 0.000 description 8
- BYPMOIFBQPEWOH-CIUDSAMLSA-N Lys-Asn-Asp Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N BYPMOIFBQPEWOH-CIUDSAMLSA-N 0.000 description 8
- LDSOBEJVGGVWGD-DLOVCJGASA-N Phe-Asp-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 LDSOBEJVGGVWGD-DLOVCJGASA-N 0.000 description 8
- MCIXMYKSPQUMJG-SRVKXCTJSA-N Phe-Ser-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O MCIXMYKSPQUMJG-SRVKXCTJSA-N 0.000 description 8
- 102100031027 Transcription activator BRG1 Human genes 0.000 description 8
- 239000000427 antigen Substances 0.000 description 8
- 108091007433 antigens Proteins 0.000 description 8
- 102000036639 antigens Human genes 0.000 description 8
- 230000006907 apoptotic process Effects 0.000 description 8
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 8
- 230000008859 change Effects 0.000 description 8
- 108010016616 cysteinylglycine Proteins 0.000 description 8
- 238000002955 isolation Methods 0.000 description 8
- 239000003446 ligand Substances 0.000 description 8
- 230000036210 malignancy Effects 0.000 description 8
- 229930182817 methionine Natural products 0.000 description 8
- -1 nucleoside phosphorothioates Chemical class 0.000 description 8
- 238000011363 radioimmunotherapy Methods 0.000 description 8
- 230000019491 signal transduction Effects 0.000 description 8
- 230000004083 survival effect Effects 0.000 description 8
- 210000001550 testis Anatomy 0.000 description 8
- 230000002103 transcriptional effect Effects 0.000 description 8
- 230000014616 translation Effects 0.000 description 8
- 238000013519 translation Methods 0.000 description 8
- 102000053602 DNA Human genes 0.000 description 7
- YQAQQKPWFOBSMU-WDCWCFNPSA-N Glu-Thr-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O YQAQQKPWFOBSMU-WDCWCFNPSA-N 0.000 description 7
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 7
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 7
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 7
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 7
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 7
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 7
- 108010062166 Lys-Asn-Asp Proteins 0.000 description 7
- 208000002193 Pain Diseases 0.000 description 7
- LVVBAKCGXXUHFO-ZLUOBGJFSA-N Ser-Ala-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O LVVBAKCGXXUHFO-ZLUOBGJFSA-N 0.000 description 7
- NLQUOHDCLSFABG-GUBZILKMSA-N Ser-Arg-Arg Chemical compound NC(N)=NCCC[C@H](NC(=O)[C@H](CO)N)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O NLQUOHDCLSFABG-GUBZILKMSA-N 0.000 description 7
- GYDFRTRSSXOZCR-ACZMJKKPSA-N Ser-Ser-Glu Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O GYDFRTRSSXOZCR-ACZMJKKPSA-N 0.000 description 7
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 239000003153 chemical reaction reagent Substances 0.000 description 7
- 239000003795 chemical substances by application Substances 0.000 description 7
- 108010063718 gamma-glutamylaspartic acid Proteins 0.000 description 7
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 7
- 108010050848 glycylleucine Proteins 0.000 description 7
- 238000007901 in situ hybridization Methods 0.000 description 7
- 238000003780 insertion Methods 0.000 description 7
- 230000037431 insertion Effects 0.000 description 7
- 201000010982 kidney cancer Diseases 0.000 description 7
- 108010031719 prolyl-serine Proteins 0.000 description 7
- 108010070643 prolylglutamic acid Proteins 0.000 description 7
- 238000000746 purification Methods 0.000 description 7
- 108010048818 seryl-histidine Proteins 0.000 description 7
- 241000701447 unidentified baculovirus Species 0.000 description 7
- 238000010200 validation analysis Methods 0.000 description 7
- 239000004474 valine Substances 0.000 description 7
- FUSPCLTUKXQREV-ACZMJKKPSA-N Ala-Glu-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O FUSPCLTUKXQREV-ACZMJKKPSA-N 0.000 description 6
- KMFPQTITXUKJOV-DCAQKATOSA-N Arg-Ser-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O KMFPQTITXUKJOV-DCAQKATOSA-N 0.000 description 6
- ZPMNECSEJXXNBE-CIUDSAMLSA-N Asn-Cys-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(O)=O ZPMNECSEJXXNBE-CIUDSAMLSA-N 0.000 description 6
- DVUFTQLHHHJEMK-IMJSIDKUSA-N Asp-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O DVUFTQLHHHJEMK-IMJSIDKUSA-N 0.000 description 6
- UMHUHHJMEXNSIV-CIUDSAMLSA-N Asp-Leu-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(O)=O UMHUHHJMEXNSIV-CIUDSAMLSA-N 0.000 description 6
- LIVXPXUVXFRWNY-CIUDSAMLSA-N Asp-Lys-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O LIVXPXUVXFRWNY-CIUDSAMLSA-N 0.000 description 6
- IDDMGSKZQDEDGA-SRVKXCTJSA-N Asp-Phe-Asn Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(O)=O)CC1=CC=CC=C1 IDDMGSKZQDEDGA-SRVKXCTJSA-N 0.000 description 6
- 108010078791 Carrier Proteins Proteins 0.000 description 6
- 208000031404 Chromosome Aberrations Diseases 0.000 description 6
- GZWOBWMOMPFPCD-CIUDSAMLSA-N Glu-Asp-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)N GZWOBWMOMPFPCD-CIUDSAMLSA-N 0.000 description 6
- CKOFNWCLWRYUHK-XHNCKOQMSA-N Glu-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)N)C(=O)O CKOFNWCLWRYUHK-XHNCKOQMSA-N 0.000 description 6
- ILGFBUGLBSAQQB-GUBZILKMSA-N Glu-Glu-Arg Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O ILGFBUGLBSAQQB-GUBZILKMSA-N 0.000 description 6
- BUZMZDDKFCSKOT-CIUDSAMLSA-N Glu-Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O BUZMZDDKFCSKOT-CIUDSAMLSA-N 0.000 description 6
- OPAINBJQDQTGJY-JGVFFNPUSA-N Glu-Gly-Pro Chemical compound C1C[C@@H](N(C1)C(=O)CNC(=O)[C@H](CCC(=O)O)N)C(=O)O OPAINBJQDQTGJY-JGVFFNPUSA-N 0.000 description 6
- MXJYXYDREQWUMS-XKBZYTNZSA-N Glu-Thr-Ser Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O MXJYXYDREQWUMS-XKBZYTNZSA-N 0.000 description 6
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 description 6
- SJLVSMMIFYTSGY-GRLWGSQLSA-N Ile-Ile-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N SJLVSMMIFYTSGY-GRLWGSQLSA-N 0.000 description 6
- CAHCWMVNBZJVAW-NAKRPEOUSA-N Ile-Pro-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)O)N CAHCWMVNBZJVAW-NAKRPEOUSA-N 0.000 description 6
- 208000008839 Kidney Neoplasms Diseases 0.000 description 6
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 6
- ZDSNOSQHMJBRQN-SRVKXCTJSA-N Leu-Asp-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N ZDSNOSQHMJBRQN-SRVKXCTJSA-N 0.000 description 6
- OXRLYTYUXAQTHP-YUMQZZPRSA-N Leu-Gly-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(O)=O OXRLYTYUXAQTHP-YUMQZZPRSA-N 0.000 description 6
- RZXLZBIUTDQHJQ-SRVKXCTJSA-N Leu-Lys-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O RZXLZBIUTDQHJQ-SRVKXCTJSA-N 0.000 description 6
- RGUXWMDNCPMQFB-YUMQZZPRSA-N Leu-Ser-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O RGUXWMDNCPMQFB-YUMQZZPRSA-N 0.000 description 6
- KCXUCYYZNZFGLL-SRVKXCTJSA-N Lys-Ala-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O KCXUCYYZNZFGLL-SRVKXCTJSA-N 0.000 description 6
- GAOJCVKPIGHTGO-UWVGGRQHSA-N Lys-Arg-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O GAOJCVKPIGHTGO-UWVGGRQHSA-N 0.000 description 6
- DCRWPTBMWMGADO-AVGNSLFASA-N Lys-Glu-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O DCRWPTBMWMGADO-AVGNSLFASA-N 0.000 description 6
- WGLAORUKDGRINI-WDCWCFNPSA-N Lys-Glu-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O WGLAORUKDGRINI-WDCWCFNPSA-N 0.000 description 6
- DIBZLYZXTSVGLN-CIUDSAMLSA-N Lys-Ser-Ser Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O DIBZLYZXTSVGLN-CIUDSAMLSA-N 0.000 description 6
- 241000124008 Mammalia Species 0.000 description 6
- SODXFJOPSCXOHE-IHRRRGAJSA-N Met-Leu-Leu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O SODXFJOPSCXOHE-IHRRRGAJSA-N 0.000 description 6
- LGSANCBHSMDFDY-GARJFASQSA-N Pro-Glu-Pro Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CCC(=O)O)C(=O)N2CCC[C@@H]2C(=O)O LGSANCBHSMDFDY-GARJFASQSA-N 0.000 description 6
- POQFNPILEQEODH-FXQIFTODSA-N Pro-Ser-Ala Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O POQFNPILEQEODH-FXQIFTODSA-N 0.000 description 6
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 6
- 108010076504 Protein Sorting Signals Proteins 0.000 description 6
- 108020004511 Recombinant DNA Proteins 0.000 description 6
- 206010038389 Renal cancer Diseases 0.000 description 6
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 6
- 238000012300 Sequence Analysis Methods 0.000 description 6
- SQBLRDDJTUJDMV-ACZMJKKPSA-N Ser-Glu-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O SQBLRDDJTUJDMV-ACZMJKKPSA-N 0.000 description 6
- PCJLFYBAQZQOFE-KATARQTJSA-N Ser-Thr-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N)O PCJLFYBAQZQOFE-KATARQTJSA-N 0.000 description 6
- ZSDXEKUKQAKZFE-XAVMHZPKSA-N Ser-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N)O ZSDXEKUKQAKZFE-XAVMHZPKSA-N 0.000 description 6
- YOOAQCZYZHGUAZ-KATARQTJSA-N Thr-Leu-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YOOAQCZYZHGUAZ-KATARQTJSA-N 0.000 description 6
- QJBWZNTWJSZUOY-UWJYBYFXSA-N Tyr-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N QJBWZNTWJSZUOY-UWJYBYFXSA-N 0.000 description 6
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 6
- 125000000539 amino acid group Chemical group 0.000 description 6
- 239000003098 androgen Substances 0.000 description 6
- 230000033115 angiogenesis Effects 0.000 description 6
- 108010018691 arginyl-threonyl-arginine Proteins 0.000 description 6
- 108010068380 arginylarginine Proteins 0.000 description 6
- 108010038633 aspartylglutamate Proteins 0.000 description 6
- 230000015572 biosynthetic process Effects 0.000 description 6
- 108010006025 bovine growth hormone Proteins 0.000 description 6
- 230000022131 cell cycle Effects 0.000 description 6
- 238000002405 diagnostic procedure Methods 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 230000013595 glycosylation Effects 0.000 description 6
- 238000006206 glycosylation reaction Methods 0.000 description 6
- 108010015792 glycyllysine Proteins 0.000 description 6
- 239000012528 membrane Substances 0.000 description 6
- 230000011987 methylation Effects 0.000 description 6
- 238000007069 methylation reaction Methods 0.000 description 6
- 108010051242 phenylalanylserine Proteins 0.000 description 6
- 238000004393 prognosis Methods 0.000 description 6
- 230000035755 proliferation Effects 0.000 description 6
- 230000005855 radiation Effects 0.000 description 6
- 210000002966 serum Anatomy 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- ZSLUVFAKFWKJRC-OIOBTWANSA-N thorium-229 Chemical compound [229Th] ZSLUVFAKFWKJRC-OIOBTWANSA-N 0.000 description 6
- 238000003325 tomography Methods 0.000 description 6
- 108010079202 tyrosyl-alanyl-cysteine Proteins 0.000 description 6
- PMQXMXAASGFUDX-SRVKXCTJSA-N Ala-Lys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@H](C)N)CCCCN PMQXMXAASGFUDX-SRVKXCTJSA-N 0.000 description 5
- MSWSRLGNLKHDEI-ACZMJKKPSA-N Ala-Ser-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O MSWSRLGNLKHDEI-ACZMJKKPSA-N 0.000 description 5
- OGUPCHKBOKJFMA-SRVKXCTJSA-N Arg-Glu-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCCN=C(N)N OGUPCHKBOKJFMA-SRVKXCTJSA-N 0.000 description 5
- AIFHRTPABBBHKU-RCWTZXSCSA-N Arg-Thr-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O AIFHRTPABBBHKU-RCWTZXSCSA-N 0.000 description 5
- LEFKSBYHUGUWLP-ACZMJKKPSA-N Asn-Ala-Glu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O LEFKSBYHUGUWLP-ACZMJKKPSA-N 0.000 description 5
- YXVAESUIQFDBHN-SRVKXCTJSA-N Asn-Phe-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O YXVAESUIQFDBHN-SRVKXCTJSA-N 0.000 description 5
- VILLWIDTHYPSLC-PEFMBERDSA-N Asp-Glu-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O VILLWIDTHYPSLC-PEFMBERDSA-N 0.000 description 5
- 241000894006 Bacteria Species 0.000 description 5
- SBMGKDLRJLYZCU-BIIVOSGPSA-N Cys-Asn-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CS)N)C(=O)O SBMGKDLRJLYZCU-BIIVOSGPSA-N 0.000 description 5
- OGNJZUXUTPQVBR-BQBZGAKWSA-N Glu-Gly-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O OGNJZUXUTPQVBR-BQBZGAKWSA-N 0.000 description 5
- YBAFDPFAUTYYRW-YUMQZZPRSA-N Glu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CCC(O)=O YBAFDPFAUTYYRW-YUMQZZPRSA-N 0.000 description 5
- MYXNLWDWWOTERK-BHNWBGBOSA-N Gly-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN)O MYXNLWDWWOTERK-BHNWBGBOSA-N 0.000 description 5
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 5
- GLYJPWIRLBAIJH-UHFFFAOYSA-N Ile-Lys-Pro Natural products CCC(C)C(N)C(=O)NC(CCCCN)C(=O)N1CCCC1C(O)=O GLYJPWIRLBAIJH-UHFFFAOYSA-N 0.000 description 5
- JNLSTRPWUXOORL-MMWGEVLESA-N Ile-Ser-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@@H]1C(=O)O)N JNLSTRPWUXOORL-MMWGEVLESA-N 0.000 description 5
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 5
- FJUKMPUELVROGK-IHRRRGAJSA-N Leu-Arg-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N FJUKMPUELVROGK-IHRRRGAJSA-N 0.000 description 5
- DLFAACQHIRSQGG-CIUDSAMLSA-N Leu-Asp-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O DLFAACQHIRSQGG-CIUDSAMLSA-N 0.000 description 5
- LXKNSJLSGPNHSK-KKUMJFAQSA-N Leu-Leu-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)O)N LXKNSJLSGPNHSK-KKUMJFAQSA-N 0.000 description 5
- RXGLHDWAZQECBI-SRVKXCTJSA-N Leu-Leu-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O RXGLHDWAZQECBI-SRVKXCTJSA-N 0.000 description 5
- DRWMRVFCKKXHCH-BZSNNMDCSA-N Leu-Phe-Leu Chemical compound CC(C)C[C@H]([NH3+])C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C([O-])=O)CC1=CC=CC=C1 DRWMRVFCKKXHCH-BZSNNMDCSA-N 0.000 description 5
- AMSSKPUHBUQBOQ-SRVKXCTJSA-N Leu-Ser-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)O)N AMSSKPUHBUQBOQ-SRVKXCTJSA-N 0.000 description 5
- 208000007433 Lymphatic Metastasis Diseases 0.000 description 5
- WSXTWLJHTLRFLW-SRVKXCTJSA-N Lys-Ala-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(O)=O WSXTWLJHTLRFLW-SRVKXCTJSA-N 0.000 description 5
- CRNNMTHBMRFQNG-GUBZILKMSA-N Lys-Glu-Cys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N CRNNMTHBMRFQNG-GUBZILKMSA-N 0.000 description 5
- WYBVBIHNJWOLCJ-UHFFFAOYSA-N N-L-arginyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCCN=C(N)N WYBVBIHNJWOLCJ-UHFFFAOYSA-N 0.000 description 5
- FRKBNXCFJBPJOL-GUBZILKMSA-N Pro-Glu-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O FRKBNXCFJBPJOL-GUBZILKMSA-N 0.000 description 5
- 208000006265 Renal cell carcinoma Diseases 0.000 description 5
- XNCUYZKGQOCOQH-YUMQZZPRSA-N Ser-Leu-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O XNCUYZKGQOCOQH-YUMQZZPRSA-N 0.000 description 5
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 5
- YLXAMFZYJTZXFH-OLHMAJIHSA-N Thr-Asn-Asp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N)O YLXAMFZYJTZXFH-OLHMAJIHSA-N 0.000 description 5
- 108091023040 Transcription factor Proteins 0.000 description 5
- 102000040945 Transcription factor Human genes 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 238000013459 approach Methods 0.000 description 5
- 210000001367 artery Anatomy 0.000 description 5
- 108010093581 aspartyl-proline Proteins 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- 210000004899 c-terminal region Anatomy 0.000 description 5
- 230000001086 cytosolic effect Effects 0.000 description 5
- 230000003247 decreasing effect Effects 0.000 description 5
- 239000013604 expression vector Substances 0.000 description 5
- 102000037865 fusion proteins Human genes 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 102000054766 genetic haplotypes Human genes 0.000 description 5
- 108010013768 glutamyl-aspartyl-proline Proteins 0.000 description 5
- 210000002216 heart Anatomy 0.000 description 5
- 235000014304 histidine Nutrition 0.000 description 5
- 108010064235 lysylglycine Proteins 0.000 description 5
- 238000012423 maintenance Methods 0.000 description 5
- 238000013507 mapping Methods 0.000 description 5
- 239000003550 marker Substances 0.000 description 5
- 239000011159 matrix material Substances 0.000 description 5
- 206010061289 metastatic neoplasm Diseases 0.000 description 5
- 208000010658 metastatic prostate carcinoma Diseases 0.000 description 5
- 238000010369 molecular cloning Methods 0.000 description 5
- 230000035772 mutation Effects 0.000 description 5
- 230000008488 polyadenylation Effects 0.000 description 5
- 102000054765 polymorphisms of proteins Human genes 0.000 description 5
- 230000003449 preventive effect Effects 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 238000011160 research Methods 0.000 description 5
- 208000037803 restenosis Diseases 0.000 description 5
- 206010039073 rheumatoid arthritis Diseases 0.000 description 5
- 239000001509 sodium citrate Substances 0.000 description 5
- 108010072986 threonyl-seryl-lysine Proteins 0.000 description 5
- 108010073969 valyllysine Proteins 0.000 description 5
- 238000001262 western blot Methods 0.000 description 5
- GWFSQQNGMPGBEF-GHCJXIJMSA-N Ala-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)N GWFSQQNGMPGBEF-GHCJXIJMSA-N 0.000 description 4
- FOHXUHGZZKETFI-JBDRJPRFSA-N Ala-Ile-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](C)N FOHXUHGZZKETFI-JBDRJPRFSA-N 0.000 description 4
- OKIKVSXTXVVFDV-MMWGEVLESA-N Ala-Ile-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](C)N OKIKVSXTXVVFDV-MMWGEVLESA-N 0.000 description 4
- YXXPVUOMPSZURS-ZLIFDBKOSA-N Ala-Trp-Leu Chemical compound C1=CC=C2C(C[C@@H](C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)[C@H](C)N)=CNC2=C1 YXXPVUOMPSZURS-ZLIFDBKOSA-N 0.000 description 4
- HULHGJZIZXCPLD-FXQIFTODSA-N Arg-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N HULHGJZIZXCPLD-FXQIFTODSA-N 0.000 description 4
- NABSCJGZKWSNHX-RCWTZXSCSA-N Arg-Arg-Thr Chemical compound NC(N)=NCCC[C@@H](C(=O)N[C@@H]([C@H](O)C)C(O)=O)NC(=O)[C@@H](N)CCCN=C(N)N NABSCJGZKWSNHX-RCWTZXSCSA-N 0.000 description 4
- HPSVTWMFWCHKFN-GARJFASQSA-N Arg-Glu-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O HPSVTWMFWCHKFN-GARJFASQSA-N 0.000 description 4
- UHFUZWSZQKMDSX-DCAQKATOSA-N Arg-Leu-Asn Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N UHFUZWSZQKMDSX-DCAQKATOSA-N 0.000 description 4
- 239000004475 Arginine Substances 0.000 description 4
- DAPLJWATMAXPPZ-CIUDSAMLSA-N Asn-Asn-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CC(N)=O DAPLJWATMAXPPZ-CIUDSAMLSA-N 0.000 description 4
- GNKVBRYFXYWXAB-WDSKDSINSA-N Asn-Glu-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O GNKVBRYFXYWXAB-WDSKDSINSA-N 0.000 description 4
- FTSAJSADJCMDHH-CIUDSAMLSA-N Asn-Lys-Asp Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CC(=O)N)N FTSAJSADJCMDHH-CIUDSAMLSA-N 0.000 description 4
- COWITDLVHMZSIW-CIUDSAMLSA-N Asn-Lys-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O COWITDLVHMZSIW-CIUDSAMLSA-N 0.000 description 4
- SZNGQSBRHFMZLT-IHRRRGAJSA-N Asn-Pro-Phe Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O SZNGQSBRHFMZLT-IHRRRGAJSA-N 0.000 description 4
- SBHUBSDEZQFJHJ-CIUDSAMLSA-N Asp-Asp-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC(O)=O SBHUBSDEZQFJHJ-CIUDSAMLSA-N 0.000 description 4
- XAJRHVUUVUPFQL-ACZMJKKPSA-N Asp-Glu-Asp Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O XAJRHVUUVUPFQL-ACZMJKKPSA-N 0.000 description 4
- JUWZKMBALYLZCK-WHFBIAKZSA-N Asp-Gly-Asn Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O JUWZKMBALYLZCK-WHFBIAKZSA-N 0.000 description 4
- VIRHEUMYXXLCBF-WDSKDSINSA-N Asp-Gly-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O VIRHEUMYXXLCBF-WDSKDSINSA-N 0.000 description 4
- PZXPWHFYZXTFBI-YUMQZZPRSA-N Asp-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC(O)=O PZXPWHFYZXTFBI-YUMQZZPRSA-N 0.000 description 4
- AHWRSSLYSGLBGD-CIUDSAMLSA-N Asp-Pro-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O AHWRSSLYSGLBGD-CIUDSAMLSA-N 0.000 description 4
- ZQFRDAZBTSFGGW-SRVKXCTJSA-N Asp-Ser-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O ZQFRDAZBTSFGGW-SRVKXCTJSA-N 0.000 description 4
- HRVQDZOWMLFAOD-BIIVOSGPSA-N Asp-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)N)C(=O)O HRVQDZOWMLFAOD-BIIVOSGPSA-N 0.000 description 4
- 201000001320 Atherosclerosis Diseases 0.000 description 4
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 4
- WVLZTXGTNGHPBO-SRVKXCTJSA-N Cys-Leu-Leu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O WVLZTXGTNGHPBO-SRVKXCTJSA-N 0.000 description 4
- 108700024394 Exon Proteins 0.000 description 4
- 241000282326 Felis catus Species 0.000 description 4
- CYHBMLHCQXXCCT-AVGNSLFASA-N Glu-Asp-Tyr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O CYHBMLHCQXXCCT-AVGNSLFASA-N 0.000 description 4
- MUSGDMDGNGXULI-DCAQKATOSA-N Glu-Glu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O MUSGDMDGNGXULI-DCAQKATOSA-N 0.000 description 4
- SWQALSGKVLYKDT-UHFFFAOYSA-N Gly-Ile-Ala Natural products NCC(=O)NC(C(C)CC)C(=O)NC(C)C(O)=O SWQALSGKVLYKDT-UHFFFAOYSA-N 0.000 description 4
- WNGHUXFWEWTKAO-YUMQZZPRSA-N Gly-Ser-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)CN WNGHUXFWEWTKAO-YUMQZZPRSA-N 0.000 description 4
- JQFILXICXLDTRR-FBCQKBJTSA-N Gly-Thr-Gly Chemical compound NCC(=O)N[C@@H]([C@H](O)C)C(=O)NCC(O)=O JQFILXICXLDTRR-FBCQKBJTSA-N 0.000 description 4
- 102100028972 HLA class I histocompatibility antigen, A alpha chain Human genes 0.000 description 4
- 108010075704 HLA-A Antigens Proteins 0.000 description 4
- ZUPVLBAXUUGKKN-VHSXEESVSA-N His-Gly-Pro Chemical compound C1C[C@@H](N(C1)C(=O)CNC(=O)[C@H](CC2=CN=CN2)N)C(=O)O ZUPVLBAXUUGKKN-VHSXEESVSA-N 0.000 description 4
- UWNUQPZUSRFIIN-JUKXBJQTSA-N His-Tyr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CC2=CN=CN2)N UWNUQPZUSRFIIN-JUKXBJQTSA-N 0.000 description 4
- 101000950669 Homo sapiens Mitogen-activated protein kinase 9 Proteins 0.000 description 4
- AQCUAZTZSPQJFF-ZKWXMUAHSA-N Ile-Ala-Gly Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O AQCUAZTZSPQJFF-ZKWXMUAHSA-N 0.000 description 4
- NULSANWBUWLTKN-NAKRPEOUSA-N Ile-Arg-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)O)N NULSANWBUWLTKN-NAKRPEOUSA-N 0.000 description 4
- TWYOYAKMLHWMOJ-ZPFDUUQYSA-N Ile-Leu-Asn Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O TWYOYAKMLHWMOJ-ZPFDUUQYSA-N 0.000 description 4
- OUUCIIJSBIBCHB-ZPFDUUQYSA-N Ile-Leu-Asp Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O OUUCIIJSBIBCHB-ZPFDUUQYSA-N 0.000 description 4
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 4
- CPONGMJGVIAWEH-DCAQKATOSA-N Leu-Met-Ala Chemical compound CSCC[C@H](NC(=O)[C@@H](N)CC(C)C)C(=O)N[C@@H](C)C(O)=O CPONGMJGVIAWEH-DCAQKATOSA-N 0.000 description 4
- BTEMNFBEAAOGBR-BZSNNMDCSA-N Leu-Tyr-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCCN)C(=O)O)N BTEMNFBEAAOGBR-BZSNNMDCSA-N 0.000 description 4
- 108060001084 Luciferase Proteins 0.000 description 4
- 239000005089 Luciferase Substances 0.000 description 4
- ZXEUFAVXODIPHC-GUBZILKMSA-N Lys-Glu-Asn Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O ZXEUFAVXODIPHC-GUBZILKMSA-N 0.000 description 4
- PBIPLDMFHAICIP-DCAQKATOSA-N Lys-Glu-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O PBIPLDMFHAICIP-DCAQKATOSA-N 0.000 description 4
- RFQATBGBLDAKGI-VHSXEESVSA-N Lys-Gly-Pro Chemical compound C1C[C@@H](N(C1)C(=O)CNC(=O)[C@H](CCCCN)N)C(=O)O RFQATBGBLDAKGI-VHSXEESVSA-N 0.000 description 4
- DYJOORGDQIGZAS-DCAQKATOSA-N Lys-Ser-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)N DYJOORGDQIGZAS-DCAQKATOSA-N 0.000 description 4
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 4
- 108060004795 Methyltransferase Proteins 0.000 description 4
- 102100037809 Mitogen-activated protein kinase 9 Human genes 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 4
- 108010079364 N-glycylalanine Proteins 0.000 description 4
- YTILBRIUASDGBL-BZSNNMDCSA-N Phe-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 YTILBRIUASDGBL-BZSNNMDCSA-N 0.000 description 4
- KPEIBEPEUAZWNS-ULQDDVLXSA-N Phe-Leu-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 KPEIBEPEUAZWNS-ULQDDVLXSA-N 0.000 description 4
- SNGZLPOXVRTNMB-LPEHRKFASA-N Pro-Ser-Pro Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CO)C(=O)N2CCC[C@@H]2C(=O)O SNGZLPOXVRTNMB-LPEHRKFASA-N 0.000 description 4
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 4
- IUXGJEIKJBYKOO-SRVKXCTJSA-N Ser-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CO)N IUXGJEIKJBYKOO-SRVKXCTJSA-N 0.000 description 4
- HEUVHBXOVZONPU-BJDJZHNGSA-N Ser-Leu-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O HEUVHBXOVZONPU-BJDJZHNGSA-N 0.000 description 4
- VZQRNAYURWAEFE-KKUMJFAQSA-N Ser-Leu-Phe Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 VZQRNAYURWAEFE-KKUMJFAQSA-N 0.000 description 4
- SDFUZKIAHWRUCS-QEJZJMRPSA-N Ser-Trp-Glu Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CO)N SDFUZKIAHWRUCS-QEJZJMRPSA-N 0.000 description 4
- 108091081024 Start codon Proteins 0.000 description 4
- 208000024313 Testicular Neoplasms Diseases 0.000 description 4
- 206010057644 Testis cancer Diseases 0.000 description 4
- ASJDFGOPDCVXTG-KATARQTJSA-N Thr-Cys-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(O)=O ASJDFGOPDCVXTG-KATARQTJSA-N 0.000 description 4
- XSTGOZBBXFKGHA-YJRXYDGGSA-N Thr-His-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N)O XSTGOZBBXFKGHA-YJRXYDGGSA-N 0.000 description 4
- WPSKTVVMQCXPRO-BWBBJGPYSA-N Thr-Ser-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O WPSKTVVMQCXPRO-BWBBJGPYSA-N 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- OFCKFBGRYHOKFP-IHPCNDPISA-N Trp-Asp-Tyr Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)N OFCKFBGRYHOKFP-IHPCNDPISA-N 0.000 description 4
- JXCOEPXCBVCTRD-JYJNAYRXSA-N Val-Tyr-Arg Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N JXCOEPXCBVCTRD-JYJNAYRXSA-N 0.000 description 4
- 230000001594 aberrant effect Effects 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 238000000246 agarose gel electrophoresis Methods 0.000 description 4
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 4
- 108010036533 arginylvaline Proteins 0.000 description 4
- 108010068265 aspartyltyrosine Proteins 0.000 description 4
- 230000033228 biological regulation Effects 0.000 description 4
- JCXGWMGPZLAOME-AKLPVKDBSA-N bismuth-212 Chemical compound [212Bi] JCXGWMGPZLAOME-AKLPVKDBSA-N 0.000 description 4
- 108010004073 cysteinylcysteine Proteins 0.000 description 4
- 230000002074 deregulated effect Effects 0.000 description 4
- 208000028715 ductal breast carcinoma in situ Diseases 0.000 description 4
- 238000011156 evaluation Methods 0.000 description 4
- 238000010195 expression analysis Methods 0.000 description 4
- 230000002068 genetic effect Effects 0.000 description 4
- 108010057083 glutamyl-aspartyl-leucine Proteins 0.000 description 4
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 4
- 108010020688 glycylhistidine Proteins 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 229960000310 isoleucine Drugs 0.000 description 4
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 4
- 108010051673 leucyl-glycyl-phenylalanine Proteins 0.000 description 4
- 108010009298 lysylglutamic acid Proteins 0.000 description 4
- 230000003211 malignant effect Effects 0.000 description 4
- 201000001441 melanoma Diseases 0.000 description 4
- 108010016686 methionyl-alanyl-serine Proteins 0.000 description 4
- 108010029020 prolylglycine Proteins 0.000 description 4
- 108010015796 prolylisoleucine Proteins 0.000 description 4
- 238000011321 prophylaxis Methods 0.000 description 4
- 230000001177 retroviral effect Effects 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 230000035882 stress Effects 0.000 description 4
- 201000003120 testicular cancer Diseases 0.000 description 4
- ZSLUVFAKFWKJRC-AHCXROLUSA-N thorium-228 Chemical compound [228Th] ZSLUVFAKFWKJRC-AHCXROLUSA-N 0.000 description 4
- 108010031491 threonyl-lysyl-glutamic acid Proteins 0.000 description 4
- 238000011277 treatment modality Methods 0.000 description 4
- 210000004881 tumor cell Anatomy 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- WUAPFZMCVAUBPE-NJFSPNSNSA-N 188Re Chemical compound [188Re] WUAPFZMCVAUBPE-NJFSPNSNSA-N 0.000 description 3
- NLQUOHDCLSFABG-UHFFFAOYSA-N 2-[[2-[(2-amino-3-hydroxypropanoyl)amino]-5-(diaminomethylideneamino)pentanoyl]amino]-5-(diaminomethylideneamino)pentanoic acid Chemical compound NC(N)=NCCCC(NC(=O)C(CO)N)C(=O)NC(CCCN=C(N)N)C(O)=O NLQUOHDCLSFABG-UHFFFAOYSA-N 0.000 description 3
- GSCLWXDNIMNIJE-ZLUOBGJFSA-N Ala-Asp-Asn Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O GSCLWXDNIMNIJE-ZLUOBGJFSA-N 0.000 description 3
- MNZHHDPWDWQJCQ-YUMQZZPRSA-N Ala-Leu-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O MNZHHDPWDWQJCQ-YUMQZZPRSA-N 0.000 description 3
- VQAVBBCZFQAAED-FXQIFTODSA-N Ala-Pro-Asn Chemical compound C[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)N)C(=O)O)N VQAVBBCZFQAAED-FXQIFTODSA-N 0.000 description 3
- VJVQKGYHIZPSNS-FXQIFTODSA-N Ala-Ser-Arg Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCN=C(N)N VJVQKGYHIZPSNS-FXQIFTODSA-N 0.000 description 3
- KLALXKYLOMZDQT-ZLUOBGJFSA-N Ala-Ser-Asn Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC(N)=O KLALXKYLOMZDQT-ZLUOBGJFSA-N 0.000 description 3
- VRTOMXFZHGWHIJ-KZVJFYERSA-N Ala-Thr-Arg Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O VRTOMXFZHGWHIJ-KZVJFYERSA-N 0.000 description 3
- YNOCMHZSWJMGBB-GCJQMDKQSA-N Ala-Thr-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O YNOCMHZSWJMGBB-GCJQMDKQSA-N 0.000 description 3
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 3
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 3
- KWKQGHSSNHPGOW-BQBZGAKWSA-N Arg-Ala-Gly Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)NCC(O)=O KWKQGHSSNHPGOW-BQBZGAKWSA-N 0.000 description 3
- NONSEUUPKITYQT-BQBZGAKWSA-N Arg-Asn-Gly Chemical compound C(C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)NCC(=O)O)N)CN=C(N)N NONSEUUPKITYQT-BQBZGAKWSA-N 0.000 description 3
- BVBKBQRPOJFCQM-DCAQKATOSA-N Arg-Asn-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O BVBKBQRPOJFCQM-DCAQKATOSA-N 0.000 description 3
- NKBQZKVMKJJDLX-SRVKXCTJSA-N Arg-Glu-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O NKBQZKVMKJJDLX-SRVKXCTJSA-N 0.000 description 3
- FRMQITGHXMUNDF-GMOBBJLQSA-N Arg-Ile-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N FRMQITGHXMUNDF-GMOBBJLQSA-N 0.000 description 3
- LVMUGODRNHFGRA-AVGNSLFASA-N Arg-Leu-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O LVMUGODRNHFGRA-AVGNSLFASA-N 0.000 description 3
- NPAVRDPEFVKELR-DCAQKATOSA-N Arg-Lys-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O NPAVRDPEFVKELR-DCAQKATOSA-N 0.000 description 3
- MNBHKGYCLBUIBC-UFYCRDLUSA-N Arg-Phe-Phe Chemical compound C([C@H](NC(=O)[C@H](CCCNC(N)=N)N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 MNBHKGYCLBUIBC-UFYCRDLUSA-N 0.000 description 3
- UVTGNSWSRSCPLP-UHFFFAOYSA-N Arg-Tyr Natural products NC(CCNC(=N)N)C(=O)NC(Cc1ccc(O)cc1)C(=O)O UVTGNSWSRSCPLP-UHFFFAOYSA-N 0.000 description 3
- RJUHZPRQRQLCFL-IMJSIDKUSA-N Asn-Asn Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(O)=O RJUHZPRQRQLCFL-IMJSIDKUSA-N 0.000 description 3
- UBKOVSLDWIHYSY-ACZMJKKPSA-N Asn-Glu-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O UBKOVSLDWIHYSY-ACZMJKKPSA-N 0.000 description 3
- WIDVAWAQBRAKTI-YUMQZZPRSA-N Asn-Leu-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O WIDVAWAQBRAKTI-YUMQZZPRSA-N 0.000 description 3
- FBODFHMLALOPHP-GUBZILKMSA-N Asn-Lys-Glu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O FBODFHMLALOPHP-GUBZILKMSA-N 0.000 description 3
- PBFXCUOEGVJTMV-QXEWZRGKSA-N Asn-Met-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(O)=O PBFXCUOEGVJTMV-QXEWZRGKSA-N 0.000 description 3
- YUOXLJYVSZYPBJ-CIUDSAMLSA-N Asn-Pro-Glu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O YUOXLJYVSZYPBJ-CIUDSAMLSA-N 0.000 description 3
- NJSNXIOKBHPFMB-GMOBBJLQSA-N Asn-Pro-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(=O)N)N NJSNXIOKBHPFMB-GMOBBJLQSA-N 0.000 description 3
- OOXUBGLNDRGOKT-FXQIFTODSA-N Asn-Ser-Arg Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O OOXUBGLNDRGOKT-FXQIFTODSA-N 0.000 description 3
- MKJBPDLENBUHQU-CIUDSAMLSA-N Asn-Ser-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O MKJBPDLENBUHQU-CIUDSAMLSA-N 0.000 description 3
- AMGQTNHANMRPOE-LKXGYXEUSA-N Asn-Thr-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O AMGQTNHANMRPOE-LKXGYXEUSA-N 0.000 description 3
- VFUXXFVCYZPOQG-WDSKDSINSA-N Asp-Glu-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O VFUXXFVCYZPOQG-WDSKDSINSA-N 0.000 description 3
- QCLHLXDWRKOHRR-GUBZILKMSA-N Asp-Glu-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)N QCLHLXDWRKOHRR-GUBZILKMSA-N 0.000 description 3
- HSPSXROIMXIJQW-BQBZGAKWSA-N Asp-His Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CNC=N1 HSPSXROIMXIJQW-BQBZGAKWSA-N 0.000 description 3
- OGTCOKZFOJIZFG-CIUDSAMLSA-N Asp-His-Asp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(O)=O OGTCOKZFOJIZFG-CIUDSAMLSA-N 0.000 description 3
- 201000009030 Carcinoma Diseases 0.000 description 3
- 108010077544 Chromatin Proteins 0.000 description 3
- 206010008805 Chromosomal abnormalities Diseases 0.000 description 3
- 102100038385 Coiled-coil domain-containing protein R3HCC1L Human genes 0.000 description 3
- 108091035707 Consensus sequence Proteins 0.000 description 3
- 102000008130 Cyclic AMP-Dependent Protein Kinases Human genes 0.000 description 3
- XTHUKRLJRUVVBF-WHFBIAKZSA-N Cys-Gly-Ser Chemical compound SC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O XTHUKRLJRUVVBF-WHFBIAKZSA-N 0.000 description 3
- OXOQBEVULIBOSH-ZDLURKLDSA-N Cys-Gly-Thr Chemical compound [H]N[C@@H](CS)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(O)=O OXOQBEVULIBOSH-ZDLURKLDSA-N 0.000 description 3
- JIVJQYNNAYFXDG-LKXGYXEUSA-N Cys-Thr-Asn Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(O)=O JIVJQYNNAYFXDG-LKXGYXEUSA-N 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 108091060211 Expressed sequence tag Proteins 0.000 description 3
- BPDVTFBJZNBHEU-HGNGGELXSA-N Glu-Ala-His Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 BPDVTFBJZNBHEU-HGNGGELXSA-N 0.000 description 3
- MXOODARRORARSU-ACZMJKKPSA-N Glu-Ala-Ser Chemical compound C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CCC(=O)O)N MXOODARRORARSU-ACZMJKKPSA-N 0.000 description 3
- JVSBYEDSSRZQGV-GUBZILKMSA-N Glu-Asp-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CCC(O)=O JVSBYEDSSRZQGV-GUBZILKMSA-N 0.000 description 3
- JRCUFCXYZLPSDZ-ACZMJKKPSA-N Glu-Asp-Ser Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O JRCUFCXYZLPSDZ-ACZMJKKPSA-N 0.000 description 3
- AUTNXSQEVVHSJK-YVNDNENWSA-N Glu-Glu-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O AUTNXSQEVVHSJK-YVNDNENWSA-N 0.000 description 3
- ZWABFSSWTSAMQN-KBIXCLLPSA-N Glu-Ile-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O ZWABFSSWTSAMQN-KBIXCLLPSA-N 0.000 description 3
- JJSVALISDCNFCU-SZMVWBNQSA-N Glu-Leu-Trp Chemical compound CC(C)C[C@H](NC(=O)[C@@H](N)CCC(O)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O JJSVALISDCNFCU-SZMVWBNQSA-N 0.000 description 3
- BBBXWRGITSUJPB-YUMQZZPRSA-N Glu-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CCC(O)=O BBBXWRGITSUJPB-YUMQZZPRSA-N 0.000 description 3
- SWRVAQHFBRZVNX-GUBZILKMSA-N Glu-Lys-Asn Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O SWRVAQHFBRZVNX-GUBZILKMSA-N 0.000 description 3
- BCYGDJXHAGZNPQ-DCAQKATOSA-N Glu-Lys-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O BCYGDJXHAGZNPQ-DCAQKATOSA-N 0.000 description 3
- RBXSZQRSEGYDFG-GUBZILKMSA-N Glu-Lys-Ser Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O RBXSZQRSEGYDFG-GUBZILKMSA-N 0.000 description 3
- JDUKCSSHWNIQQZ-IHRRRGAJSA-N Glu-Phe-Glu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O JDUKCSSHWNIQQZ-IHRRRGAJSA-N 0.000 description 3
- DXVOKNVIKORTHQ-GUBZILKMSA-N Glu-Pro-Glu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O DXVOKNVIKORTHQ-GUBZILKMSA-N 0.000 description 3
- RXJFSLQVMGYQEL-IHRRRGAJSA-N Glu-Tyr-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCC(O)=O)C(O)=O)CC1=CC=C(O)C=C1 RXJFSLQVMGYQEL-IHRRRGAJSA-N 0.000 description 3
- ZQIMMEYPEXIYBB-IUCAKERBSA-N Gly-Glu-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CN ZQIMMEYPEXIYBB-IUCAKERBSA-N 0.000 description 3
- PTIIBFKSLCYQBO-NHCYSSNCSA-N Gly-Lys-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)CN PTIIBFKSLCYQBO-NHCYSSNCSA-N 0.000 description 3
- PCPOYRCAHPJXII-UWVGGRQHSA-N Gly-Lys-Met Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(O)=O PCPOYRCAHPJXII-UWVGGRQHSA-N 0.000 description 3
- IGOYNRWLWHWAQO-JTQLQIEISA-N Gly-Phe-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)CN)CC1=CC=CC=C1 IGOYNRWLWHWAQO-JTQLQIEISA-N 0.000 description 3
- IRJWAYCXIYUHQE-WHFBIAKZSA-N Gly-Ser-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)CN IRJWAYCXIYUHQE-WHFBIAKZSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 3
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 3
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 3
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 3
- 108010086377 HLA-A3 Antigen Proteins 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- ZFDKSLBEWYCOCS-BZSNNMDCSA-N His-Phe-Lys Chemical compound C([C@@H](C(=O)N[C@@H](CCCCN)C(O)=O)NC(=O)[C@@H](N)CC=1NC=NC=1)C1=CC=CC=C1 ZFDKSLBEWYCOCS-BZSNNMDCSA-N 0.000 description 3
- UOYGZBIPZYKGSH-SRVKXCTJSA-N His-Ser-Lys Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)O)N UOYGZBIPZYKGSH-SRVKXCTJSA-N 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101000743767 Homo sapiens Coiled-coil domain-containing protein R3HCC1L Proteins 0.000 description 3
- VSZALHITQINTGC-GHCJXIJMSA-N Ile-Ala-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)O)N VSZALHITQINTGC-GHCJXIJMSA-N 0.000 description 3
- HERITAGIPLEJMT-GVARAGBVSA-N Ile-Ala-Tyr Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 HERITAGIPLEJMT-GVARAGBVSA-N 0.000 description 3
- IPYVXYDYLHVWHU-GMOBBJLQSA-N Ile-Asn-Met Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCSC)C(=O)O)N IPYVXYDYLHVWHU-GMOBBJLQSA-N 0.000 description 3
- NKRJALPCDNXULF-BYULHYEWSA-N Ile-Asp-Gly Chemical compound [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O NKRJALPCDNXULF-BYULHYEWSA-N 0.000 description 3
- ADDYYRVQQZFIMW-MNXVOIDGSA-N Ile-Lys-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N ADDYYRVQQZFIMW-MNXVOIDGSA-N 0.000 description 3
- GLYJPWIRLBAIJH-FQUUOJAGSA-N Ile-Lys-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@@H]1C(=O)O)N GLYJPWIRLBAIJH-FQUUOJAGSA-N 0.000 description 3
- XVUAQNRNFMVWBR-BLMTYFJBSA-N Ile-Trp-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)N XVUAQNRNFMVWBR-BLMTYFJBSA-N 0.000 description 3
- 108010065920 Insulin Lispro Proteins 0.000 description 3
- 208000037396 Intraductal Noninfiltrating Carcinoma Diseases 0.000 description 3
- 206010073094 Intraductal proliferative breast lesion Diseases 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- 101710128836 Large T antigen Proteins 0.000 description 3
- 241000880493 Leptailurus serval Species 0.000 description 3
- CQQGCWPXDHTTNF-GUBZILKMSA-N Leu-Ala-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(O)=O CQQGCWPXDHTTNF-GUBZILKMSA-N 0.000 description 3
- MLTRLIITQPXHBJ-BQBZGAKWSA-N Leu-Asn Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(O)=O)CC(N)=O MLTRLIITQPXHBJ-BQBZGAKWSA-N 0.000 description 3
- IWTBYNQNAPECCS-AVGNSLFASA-N Leu-Glu-His Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 IWTBYNQNAPECCS-AVGNSLFASA-N 0.000 description 3
- WQWSMEOYXJTFRU-GUBZILKMSA-N Leu-Glu-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O WQWSMEOYXJTFRU-GUBZILKMSA-N 0.000 description 3
- HYMLKESRWLZDBR-WEDXCCLWSA-N Leu-Gly-Thr Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(O)=O HYMLKESRWLZDBR-WEDXCCLWSA-N 0.000 description 3
- USLNHQZCDQJBOV-ZPFDUUQYSA-N Leu-Ile-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(O)=O USLNHQZCDQJBOV-ZPFDUUQYSA-N 0.000 description 3
- QNBVTHNJGCOVFA-AVGNSLFASA-N Leu-Leu-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCC(O)=O QNBVTHNJGCOVFA-AVGNSLFASA-N 0.000 description 3
- FAELBUXXFQLUAX-AJNGGQMLSA-N Leu-Leu-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(C)C FAELBUXXFQLUAX-AJNGGQMLSA-N 0.000 description 3
- IEWBEPKLKUXQBU-VOAKCMCISA-N Leu-Leu-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IEWBEPKLKUXQBU-VOAKCMCISA-N 0.000 description 3
- WXZOHBVPVKABQN-DCAQKATOSA-N Leu-Met-Asp Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)O)N WXZOHBVPVKABQN-DCAQKATOSA-N 0.000 description 3
- BJWKOATWNQJPSK-SRVKXCTJSA-N Leu-Met-Glu Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N BJWKOATWNQJPSK-SRVKXCTJSA-N 0.000 description 3
- LQUIENKUVKPNIC-ULQDDVLXSA-N Leu-Met-Tyr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LQUIENKUVKPNIC-ULQDDVLXSA-N 0.000 description 3
- IRMLZWSRWSGTOP-CIUDSAMLSA-N Leu-Ser-Ala Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O IRMLZWSRWSGTOP-CIUDSAMLSA-N 0.000 description 3
- BRTVHXHCUSXYRI-CIUDSAMLSA-N Leu-Ser-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O BRTVHXHCUSXYRI-CIUDSAMLSA-N 0.000 description 3
- ZJZNLRVCZWUONM-JXUBOQSCSA-N Leu-Thr-Ala Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O ZJZNLRVCZWUONM-JXUBOQSCSA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- RVOMPSJXSRPFJT-DCAQKATOSA-N Lys-Ala-Arg Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O RVOMPSJXSRPFJT-DCAQKATOSA-N 0.000 description 3
- DNEJSAIMVANNPA-DCAQKATOSA-N Lys-Asn-Arg Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O DNEJSAIMVANNPA-DCAQKATOSA-N 0.000 description 3
- QYOXSYXPHUHOJR-GUBZILKMSA-N Lys-Asn-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O QYOXSYXPHUHOJR-GUBZILKMSA-N 0.000 description 3
- HKCCVDWHHTVVPN-CIUDSAMLSA-N Lys-Asp-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O HKCCVDWHHTVVPN-CIUDSAMLSA-N 0.000 description 3
- KWUKZRFFKPLUPE-HJGDQZAQSA-N Lys-Asp-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KWUKZRFFKPLUPE-HJGDQZAQSA-N 0.000 description 3
- KSFQPRLZAUXXPT-GARJFASQSA-N Lys-Cys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CS)NC(=O)[C@H](CCCCN)N)C(=O)O KSFQPRLZAUXXPT-GARJFASQSA-N 0.000 description 3
- LLSUNJYOSCOOEB-GUBZILKMSA-N Lys-Glu-Asp Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O LLSUNJYOSCOOEB-GUBZILKMSA-N 0.000 description 3
- DUTMKEAPLLUGNO-JYJNAYRXSA-N Lys-Glu-Phe Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O DUTMKEAPLLUGNO-JYJNAYRXSA-N 0.000 description 3
- XREQQOATSMMAJP-MGHWNKPDSA-N Lys-Ile-Tyr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O XREQQOATSMMAJP-MGHWNKPDSA-N 0.000 description 3
- NVGBPTNZLWRQSY-UWVGGRQHSA-N Lys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN NVGBPTNZLWRQSY-UWVGGRQHSA-N 0.000 description 3
- RIJCHEVHFWMDKD-SRVKXCTJSA-N Lys-Lys-Asn Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O RIJCHEVHFWMDKD-SRVKXCTJSA-N 0.000 description 3
- HVAUKHLDSDDROB-KKUMJFAQSA-N Lys-Lys-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O HVAUKHLDSDDROB-KKUMJFAQSA-N 0.000 description 3
- WBSCNDJQPKSPII-KKUMJFAQSA-N Lys-Lys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O WBSCNDJQPKSPII-KKUMJFAQSA-N 0.000 description 3
- YTJFXEDRUOQGSP-DCAQKATOSA-N Lys-Pro-Ser Chemical compound [H]N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O YTJFXEDRUOQGSP-DCAQKATOSA-N 0.000 description 3
- ZOKVLMBYDSIDKG-CSMHCCOUSA-N Lys-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCCN ZOKVLMBYDSIDKG-CSMHCCOUSA-N 0.000 description 3
- YCJCEMKOZOYBEF-OEAJRASXSA-N Lys-Thr-Phe Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O YCJCEMKOZOYBEF-OEAJRASXSA-N 0.000 description 3
- PPNCMJARTHYNEC-MEYUZBJRSA-N Lys-Tyr-Thr Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H]([C@H](O)C)C(O)=O)CC1=CC=C(O)C=C1 PPNCMJARTHYNEC-MEYUZBJRSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 102000043136 MAP kinase family Human genes 0.000 description 3
- 108091054455 MAP kinase family Proteins 0.000 description 3
- WXHHTBVYQOSYSL-FXQIFTODSA-N Met-Ala-Ser Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O WXHHTBVYQOSYSL-FXQIFTODSA-N 0.000 description 3
- OSZTUONKUMCWEP-XUXIUFHCSA-N Met-Leu-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC OSZTUONKUMCWEP-XUXIUFHCSA-N 0.000 description 3
- GWADARYJIJDYRC-XGEHTFHBSA-N Met-Thr-Ser Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O GWADARYJIJDYRC-XGEHTFHBSA-N 0.000 description 3
- 206010027459 Metastases to lymph nodes Diseases 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- AUEJLPRZGVVDNU-UHFFFAOYSA-N N-L-tyrosyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CC1=CC=C(O)C=C1 AUEJLPRZGVVDNU-UHFFFAOYSA-N 0.000 description 3
- 229930193140 Neomycin Natural products 0.000 description 3
- 244000061176 Nicotiana tabacum Species 0.000 description 3
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 3
- 241001195348 Nusa Species 0.000 description 3
- 238000010222 PCR analysis Methods 0.000 description 3
- MDHZEOMXGNBSIL-DLOVCJGASA-N Phe-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N MDHZEOMXGNBSIL-DLOVCJGASA-N 0.000 description 3
- BKWJQWJPZMUWEG-LFSVMHDDSA-N Phe-Ala-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=CC=C1 BKWJQWJPZMUWEG-LFSVMHDDSA-N 0.000 description 3
- LXVFHIBXOWJTKZ-BZSNNMDCSA-N Phe-Asn-Tyr Chemical compound N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O LXVFHIBXOWJTKZ-BZSNNMDCSA-N 0.000 description 3
- YCCUXNNKXDGMAM-KKUMJFAQSA-N Phe-Leu-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YCCUXNNKXDGMAM-KKUMJFAQSA-N 0.000 description 3
- ZUQACJLOHYRVPJ-DKIMLUQUSA-N Phe-Lys-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC1=CC=CC=C1 ZUQACJLOHYRVPJ-DKIMLUQUSA-N 0.000 description 3
- ROHDXJUFQVRDAV-UWVGGRQHSA-N Phe-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 ROHDXJUFQVRDAV-UWVGGRQHSA-N 0.000 description 3
- BONHGTUEEPIMPM-AVGNSLFASA-N Phe-Ser-Glu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O BONHGTUEEPIMPM-AVGNSLFASA-N 0.000 description 3
- FGWUALWGCZJQDJ-URLPEUOOSA-N Phe-Thr-Ile Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O FGWUALWGCZJQDJ-URLPEUOOSA-N 0.000 description 3
- FUVBEZJCRMHWEM-FXQIFTODSA-N Pro-Asn-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O FUVBEZJCRMHWEM-FXQIFTODSA-N 0.000 description 3
- LNOWDSPAYBWJOR-PEDHHIEDSA-N Pro-Ile-Ile Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O LNOWDSPAYBWJOR-PEDHHIEDSA-N 0.000 description 3
- LGMBKOAPPTYKLC-JYJNAYRXSA-N Pro-Phe-Arg Chemical compound C([C@@H](C(=O)N[C@@H](CCCNC(=N)N)C(O)=O)NC(=O)[C@H]1NCCC1)C1=CC=CC=C1 LGMBKOAPPTYKLC-JYJNAYRXSA-N 0.000 description 3
- BGWKULMLUIUPKY-BQBZGAKWSA-N Pro-Ser-Gly Chemical compound OC(=O)CNC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1 BGWKULMLUIUPKY-BQBZGAKWSA-N 0.000 description 3
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 3
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 3
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 3
- 208000015634 Rectal Neoplasms Diseases 0.000 description 3
- YQHZVYJAGWMHES-ZLUOBGJFSA-N Ser-Ala-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YQHZVYJAGWMHES-ZLUOBGJFSA-N 0.000 description 3
- TYYBJUYSTWJHGO-ZKWXMUAHSA-N Ser-Asn-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O TYYBJUYSTWJHGO-ZKWXMUAHSA-N 0.000 description 3
- SFTZTYBXIXLRGQ-JBDRJPRFSA-N Ser-Ile-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O SFTZTYBXIXLRGQ-JBDRJPRFSA-N 0.000 description 3
- HBTCFCHYALPXME-HTFCKZLJSA-N Ser-Ile-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O HBTCFCHYALPXME-HTFCKZLJSA-N 0.000 description 3
- JIPVNVNKXJLFJF-BJDJZHNGSA-N Ser-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N JIPVNVNKXJLFJF-BJDJZHNGSA-N 0.000 description 3
- ZOPISOXXPQNOCO-SVSWQMSJSA-N Ser-Ile-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](CO)N ZOPISOXXPQNOCO-SVSWQMSJSA-N 0.000 description 3
- FUMGHWDRRFCKEP-CIUDSAMLSA-N Ser-Leu-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O FUMGHWDRRFCKEP-CIUDSAMLSA-N 0.000 description 3
- IAORETPTUDBBGV-CIUDSAMLSA-N Ser-Leu-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CO)N IAORETPTUDBBGV-CIUDSAMLSA-N 0.000 description 3
- ZIFYDQAFEMIZII-GUBZILKMSA-N Ser-Leu-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O ZIFYDQAFEMIZII-GUBZILKMSA-N 0.000 description 3
- JCLAFVNDBJMLBC-JBDRJPRFSA-N Ser-Ser-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JCLAFVNDBJMLBC-JBDRJPRFSA-N 0.000 description 3
- BMKNXTJLHFIAAH-CIUDSAMLSA-N Ser-Ser-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O BMKNXTJLHFIAAH-CIUDSAMLSA-N 0.000 description 3
- OZPDGESCTGGNAD-CIUDSAMLSA-N Ser-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CO OZPDGESCTGGNAD-CIUDSAMLSA-N 0.000 description 3
- CUXJENOFJXOSOZ-BIIVOSGPSA-N Ser-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CO)N)C(=O)O CUXJENOFJXOSOZ-BIIVOSGPSA-N 0.000 description 3
- FVFUOQIYDPAIJR-XIRDDKMYSA-N Ser-Trp-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CO)N FVFUOQIYDPAIJR-XIRDDKMYSA-N 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- 238000002105 Southern blotting Methods 0.000 description 3
- 208000005718 Stomach Neoplasms Diseases 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- CEXFELBFVHLYDZ-XGEHTFHBSA-N Thr-Arg-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(O)=O CEXFELBFVHLYDZ-XGEHTFHBSA-N 0.000 description 3
- YOSLMIPKOUAHKI-OLHMAJIHSA-N Thr-Asp-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O YOSLMIPKOUAHKI-OLHMAJIHSA-N 0.000 description 3
- KZUJCMPVNXOBAF-LKXGYXEUSA-N Thr-Cys-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(O)=O)C(O)=O KZUJCMPVNXOBAF-LKXGYXEUSA-N 0.000 description 3
- AQAMPXBRJJWPNI-JHEQGTHGSA-N Thr-Gly-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O AQAMPXBRJJWPNI-JHEQGTHGSA-N 0.000 description 3
- BQBCIBCLXBKYHW-CSMHCCOUSA-N Thr-Leu Chemical compound CC(C)C[C@@H](C([O-])=O)NC(=O)[C@@H]([NH3+])[C@@H](C)O BQBCIBCLXBKYHW-CSMHCCOUSA-N 0.000 description 3
- AMXMBCAXAZUCFA-RHYQMDGZSA-N Thr-Leu-Arg Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O AMXMBCAXAZUCFA-RHYQMDGZSA-N 0.000 description 3
- FIFDDJFLNVAVMS-RHYQMDGZSA-N Thr-Leu-Met Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(O)=O FIFDDJFLNVAVMS-RHYQMDGZSA-N 0.000 description 3
- NCXVJIQMWSGRHY-KXNHARMFSA-N Thr-Leu-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N)O NCXVJIQMWSGRHY-KXNHARMFSA-N 0.000 description 3
- MGJLBZFUXUGMML-VOAKCMCISA-N Thr-Lys-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)N)O MGJLBZFUXUGMML-VOAKCMCISA-N 0.000 description 3
- ABWNZPOIUJMNKT-IXOXFDKPSA-N Thr-Phe-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O ABWNZPOIUJMNKT-IXOXFDKPSA-N 0.000 description 3
- MXDOAJQRJBMGMO-FJXKBIBVSA-N Thr-Pro-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O MXDOAJQRJBMGMO-FJXKBIBVSA-N 0.000 description 3
- IQPWNQRRAJHOKV-KATARQTJSA-N Thr-Ser-Lys Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCCN IQPWNQRRAJHOKV-KATARQTJSA-N 0.000 description 3
- BBPCSGKKPJUYRB-UVOCVTCTSA-N Thr-Thr-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O BBPCSGKKPJUYRB-UVOCVTCTSA-N 0.000 description 3
- YLGQHMHKAASRGJ-WDSOQIARSA-N Trp-Leu-Met Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N YLGQHMHKAASRGJ-WDSOQIARSA-N 0.000 description 3
- GFZQWWDXJVGEMW-ULQDDVLXSA-N Tyr-Arg-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(=O)O)N)O GFZQWWDXJVGEMW-ULQDDVLXSA-N 0.000 description 3
- SCZJKZLFSSPJDP-ACRUOGEOSA-N Tyr-Phe-Leu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(O)=O SCZJKZLFSSPJDP-ACRUOGEOSA-N 0.000 description 3
- NVZVJIUDICCMHZ-BZSNNMDCSA-N Tyr-Phe-Ser Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O NVZVJIUDICCMHZ-BZSNNMDCSA-N 0.000 description 3
- TYFLVOUZHQUBGM-IHRRRGAJSA-N Tyr-Ser-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 TYFLVOUZHQUBGM-IHRRRGAJSA-N 0.000 description 3
- 208000002495 Uterine Neoplasms Diseases 0.000 description 3
- XQVRMLRMTAGSFJ-QXEWZRGKSA-N Val-Asp-Arg Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N XQVRMLRMTAGSFJ-QXEWZRGKSA-N 0.000 description 3
- WBPFYNYTYASCQP-CYDGBPFRSA-N Val-Val-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)N WBPFYNYTYASCQP-CYDGBPFRSA-N 0.000 description 3
- 108010084455 Zeocin Proteins 0.000 description 3
- 229960003767 alanine Drugs 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 108010041407 alanylaspartic acid Proteins 0.000 description 3
- 108010005233 alanylglutamic acid Proteins 0.000 description 3
- 108010047495 alanylglycine Proteins 0.000 description 3
- 239000002246 antineoplastic agent Substances 0.000 description 3
- 108010013835 arginine glutamate Proteins 0.000 description 3
- 108010062796 arginyllysine Proteins 0.000 description 3
- JCXGWMGPZLAOME-RNFDNDRNSA-N bismuth-213 Chemical compound [213Bi] JCXGWMGPZLAOME-RNFDNDRNSA-N 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 238000004364 calculation method Methods 0.000 description 3
- 231100000504 carcinogenesis Toxicity 0.000 description 3
- 230000003197 catalytic effect Effects 0.000 description 3
- 210000003483 chromatin Anatomy 0.000 description 3
- 210000000349 chromosome Anatomy 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 230000002939 deleterious effect Effects 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- DVSDDICSXBCMQJ-UHFFFAOYSA-N diethyl 2-acetylbutanedioate Chemical compound CCOC(=O)CC(C(C)=O)C(=O)OCC DVSDDICSXBCMQJ-UHFFFAOYSA-N 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 201000007273 ductal carcinoma in situ Diseases 0.000 description 3
- 210000002889 endothelial cell Anatomy 0.000 description 3
- 230000010502 episomal replication Effects 0.000 description 3
- 238000009930 food irradiation Methods 0.000 description 3
- 206010017758 gastric cancer Diseases 0.000 description 3
- 238000003205 genotyping method Methods 0.000 description 3
- 108010077435 glycyl-phenylalanyl-glycine Proteins 0.000 description 3
- 108010077515 glycylproline Proteins 0.000 description 3
- 239000005090 green fluorescent protein Substances 0.000 description 3
- 108010092114 histidylphenylalanine Proteins 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- 238000002991 immunohistochemical analysis Methods 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 108010044374 isoleucyl-tyrosine Proteins 0.000 description 3
- 108010027338 isoleucylcysteine Proteins 0.000 description 3
- DVCSNHXRZUVYAM-BQBZGAKWSA-N leu-asp Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(O)=O)CC(O)=O DVCSNHXRZUVYAM-BQBZGAKWSA-N 0.000 description 3
- 108010054155 lysyllysine Proteins 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 229960004927 neomycin Drugs 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- KDLHZDBZIXYQEI-OIOBTWANSA-N palladium-103 Chemical compound [103Pd] KDLHZDBZIXYQEI-OIOBTWANSA-N 0.000 description 3
- 230000001575 pathological effect Effects 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 229940124531 pharmaceutical excipient Drugs 0.000 description 3
- CWCMIVBLVUHDHK-ZSNHEYEWSA-N phleomycin D1 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC[C@@H](N=1)C=1SC=C(N=1)C(=O)NCCCCNC(N)=N)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C CWCMIVBLVUHDHK-ZSNHEYEWSA-N 0.000 description 3
- 208000023958 prostate neoplasm Diseases 0.000 description 3
- 238000011002 quantification Methods 0.000 description 3
- 238000000163 radioactive labelling Methods 0.000 description 3
- 206010038038 rectal cancer Diseases 0.000 description 3
- 201000001275 rectum cancer Diseases 0.000 description 3
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 230000001954 sterilising effect Effects 0.000 description 3
- 238000004659 sterilization and disinfection Methods 0.000 description 3
- 201000011549 stomach cancer Diseases 0.000 description 3
- 230000001629 suppression Effects 0.000 description 3
- 230000005030 transcription termination Effects 0.000 description 3
- 230000014621 translational initiation Effects 0.000 description 3
- 230000005751 tumor progression Effects 0.000 description 3
- 229940035893 uracil Drugs 0.000 description 3
- 206010046766 uterine cancer Diseases 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- GJLXVWOMRRWCIB-MERZOTPQSA-N (2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-acetamido-5-(diaminomethylideneamino)pentanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanamide Chemical compound C([C@H](NC(=O)[C@H](CCCN=C(N)N)NC(=O)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CC=C(O)C=C1 GJLXVWOMRRWCIB-MERZOTPQSA-N 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 2
- PNDPGZBMCMUPRI-HVTJNCQCSA-N 10043-66-0 Chemical compound [131I][131I] PNDPGZBMCMUPRI-HVTJNCQCSA-N 0.000 description 2
- 241001556567 Acanthamoeba polyphaga mimivirus Species 0.000 description 2
- NHWYNIZWLJYZAG-XVYDVKMFSA-N Ala-Ser-His Chemical compound C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N NHWYNIZWLJYZAG-XVYDVKMFSA-N 0.000 description 2
- NCQMBSJGJMYKCK-ZLUOBGJFSA-N Ala-Ser-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O NCQMBSJGJMYKCK-ZLUOBGJFSA-N 0.000 description 2
- XQNRANMFRPCFFW-GCJQMDKQSA-N Ala-Thr-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](C)N)O XQNRANMFRPCFFW-GCJQMDKQSA-N 0.000 description 2
- JSLGXODUIAFWCF-WDSKDSINSA-N Arg-Asn Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(O)=O JSLGXODUIAFWCF-WDSKDSINSA-N 0.000 description 2
- NMRHDSAOIURTNT-RWMBFGLXSA-N Arg-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N NMRHDSAOIURTNT-RWMBFGLXSA-N 0.000 description 2
- DAQIJMOLTMGJLO-YUMQZZPRSA-N Arg-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCNC(N)=N DAQIJMOLTMGJLO-YUMQZZPRSA-N 0.000 description 2
- ACRYGQFHAQHDSF-ZLUOBGJFSA-N Asn-Asn-Asn Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O ACRYGQFHAQHDSF-ZLUOBGJFSA-N 0.000 description 2
- JRVABKHPWDRUJF-UBHSHLNASA-N Asn-Asn-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)N)N JRVABKHPWDRUJF-UBHSHLNASA-N 0.000 description 2
- UGXVKHRDGLYFKR-CIUDSAMLSA-N Asn-Asp-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC(N)=O UGXVKHRDGLYFKR-CIUDSAMLSA-N 0.000 description 2
- FFMIYIMKQIMDPK-BQBZGAKWSA-N Asn-His Chemical compound NC(=O)C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 FFMIYIMKQIMDPK-BQBZGAKWSA-N 0.000 description 2
- BXUHCIXDSWRSBS-CIUDSAMLSA-N Asn-Leu-Asp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O BXUHCIXDSWRSBS-CIUDSAMLSA-N 0.000 description 2
- BZWRLDPIWKOVKB-ZPFDUUQYSA-N Asn-Leu-Ile Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O BZWRLDPIWKOVKB-ZPFDUUQYSA-N 0.000 description 2
- NCXTYSVDWLAQGZ-ZKWXMUAHSA-N Asn-Ser-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O NCXTYSVDWLAQGZ-ZKWXMUAHSA-N 0.000 description 2
- XCBKBPRFACFFOO-AQZXSJQPSA-N Asn-Thr-Trp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CC(=O)N)N)O XCBKBPRFACFFOO-AQZXSJQPSA-N 0.000 description 2
- XBQSLMACWDXWLJ-GHCJXIJMSA-N Asp-Ala-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O XBQSLMACWDXWLJ-GHCJXIJMSA-N 0.000 description 2
- NJIKKGUVGUBICV-ZLUOBGJFSA-N Asp-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O NJIKKGUVGUBICV-ZLUOBGJFSA-N 0.000 description 2
- KVMPVNGOKHTUHZ-GCJQMDKQSA-N Asp-Ala-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KVMPVNGOKHTUHZ-GCJQMDKQSA-N 0.000 description 2
- ZEDBMCPXPIYJLW-XHNCKOQMSA-N Asp-Glu-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)N)C(=O)O ZEDBMCPXPIYJLW-XHNCKOQMSA-N 0.000 description 2
- YNCHFVRXEQFPBY-BQBZGAKWSA-N Asp-Gly-Arg Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCN=C(N)N YNCHFVRXEQFPBY-BQBZGAKWSA-N 0.000 description 2
- FAUPLTGRUBTXNU-FXQIFTODSA-N Asp-Pro-Ser Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O FAUPLTGRUBTXNU-FXQIFTODSA-N 0.000 description 2
- QSFHZPQUAAQHAQ-CIUDSAMLSA-N Asp-Ser-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O QSFHZPQUAAQHAQ-CIUDSAMLSA-N 0.000 description 2
- WAEDSQFVZJUHLI-BYULHYEWSA-N Asp-Val-Asp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O WAEDSQFVZJUHLI-BYULHYEWSA-N 0.000 description 2
- ZUNMTUPRQMWMHX-LSJOCFKGSA-N Asp-Val-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O ZUNMTUPRQMWMHX-LSJOCFKGSA-N 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 241000972773 Aulopiformes Species 0.000 description 2
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 2
- 208000003174 Brain Neoplasms Diseases 0.000 description 2
- 102000052052 Casein Kinase II Human genes 0.000 description 2
- 108010010919 Casein Kinase II Proteins 0.000 description 2
- 102000053642 Catalytic RNA Human genes 0.000 description 2
- 108090000994 Catalytic RNA Proteins 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 108010035532 Collagen Proteins 0.000 description 2
- 102000008186 Collagen Human genes 0.000 description 2
- 108091029523 CpG island Proteins 0.000 description 2
- 108091029430 CpG site Proteins 0.000 description 2
- 229920001076 Cutan Polymers 0.000 description 2
- 108010049894 Cyclic AMP-Dependent Protein Kinases Proteins 0.000 description 2
- NIPJKKSXHSBEMX-CIUDSAMLSA-N Cys-Asp-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CS)N NIPJKKSXHSBEMX-CIUDSAMLSA-N 0.000 description 2
- SDXQKJAWASHMIZ-CIUDSAMLSA-N Cys-Glu-Met Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(O)=O SDXQKJAWASHMIZ-CIUDSAMLSA-N 0.000 description 2
- 102100025287 Cytochrome b Human genes 0.000 description 2
- 108010075028 Cytochromes b Proteins 0.000 description 2
- 230000004544 DNA amplification Effects 0.000 description 2
- 206010051055 Deep vein thrombosis Diseases 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- JZDHUJAFXGNDSB-WHFBIAKZSA-N Glu-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(O)=O JZDHUJAFXGNDSB-WHFBIAKZSA-N 0.000 description 2
- JJKKWYQVHRUSDG-GUBZILKMSA-N Glu-Ala-Lys Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(O)=O JJKKWYQVHRUSDG-GUBZILKMSA-N 0.000 description 2
- PCBBLFVHTYNQGG-LAEOZQHASA-N Glu-Asn-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCC(=O)O)N PCBBLFVHTYNQGG-LAEOZQHASA-N 0.000 description 2
- KOSRFJWDECSPRO-WDSKDSINSA-N Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(O)=O KOSRFJWDECSPRO-WDSKDSINSA-N 0.000 description 2
- XMBSYZWANAQXEV-QWRGUYRKSA-N Glu-Phe Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 XMBSYZWANAQXEV-QWRGUYRKSA-N 0.000 description 2
- ITVBKCZZLJUUHI-HTUGSXCWSA-N Glu-Phe-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O ITVBKCZZLJUUHI-HTUGSXCWSA-N 0.000 description 2
- VNCNWQPIQYAMAK-ACZMJKKPSA-N Glu-Ser-Ser Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O VNCNWQPIQYAMAK-ACZMJKKPSA-N 0.000 description 2
- KRRMJKMGWWXWDW-STQMWFEESA-N Gly-Arg-Phe Chemical compound NC(=N)NCCC[C@H](NC(=O)CN)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 KRRMJKMGWWXWDW-STQMWFEESA-N 0.000 description 2
- MOJKRXIRAZPZLW-WDSKDSINSA-N Gly-Glu-Ala Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O MOJKRXIRAZPZLW-WDSKDSINSA-N 0.000 description 2
- MBOAPAXLTUSMQI-JHEQGTHGSA-N Gly-Glu-Thr Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O MBOAPAXLTUSMQI-JHEQGTHGSA-N 0.000 description 2
- FXGRXIATVXUAHO-WEDXCCLWSA-N Gly-Lys-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CCCCN FXGRXIATVXUAHO-WEDXCCLWSA-N 0.000 description 2
- SCJJPCQUJYPHRZ-BQBZGAKWSA-N Gly-Pro-Asn Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(O)=O SCJJPCQUJYPHRZ-BQBZGAKWSA-N 0.000 description 2
- ABPRMMYHROQBLY-NKWVEPMBSA-N Gly-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)CN)C(=O)O ABPRMMYHROQBLY-NKWVEPMBSA-N 0.000 description 2
- 108010035452 HLA-A1 Antigen Proteins 0.000 description 2
- 108010091938 HLA-B7 Antigen Proteins 0.000 description 2
- KAXZXLSXFWSNNZ-XVYDVKMFSA-N His-Ser-Ala Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O KAXZXLSXFWSNNZ-XVYDVKMFSA-N 0.000 description 2
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 2
- DPTBVFUDCPINIP-JURCDPSOSA-N Ile-Ala-Phe Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 DPTBVFUDCPINIP-JURCDPSOSA-N 0.000 description 2
- UKTUOMWSJPXODT-GUDRVLHUSA-N Ile-Asn-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N1CCC[C@@H]1C(=O)O)N UKTUOMWSJPXODT-GUDRVLHUSA-N 0.000 description 2
- HVWXAQVMRBKKFE-UGYAYLCHSA-N Ile-Asp-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N HVWXAQVMRBKKFE-UGYAYLCHSA-N 0.000 description 2
- WIZPFZKOFZXDQG-HTFCKZLJSA-N Ile-Ile-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O WIZPFZKOFZXDQG-HTFCKZLJSA-N 0.000 description 2
- AXNGDPAKKCEKGY-QPHKQPEJSA-N Ile-Ile-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N AXNGDPAKKCEKGY-QPHKQPEJSA-N 0.000 description 2
- CEPIAEUVRKGPGP-DSYPUSFNSA-N Ile-Lys-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)[C@@H](C)CC)C(O)=O)=CNC2=C1 CEPIAEUVRKGPGP-DSYPUSFNSA-N 0.000 description 2
- AGGIYSLVUKVOPT-HTFCKZLJSA-N Ile-Ser-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)N AGGIYSLVUKVOPT-HTFCKZLJSA-N 0.000 description 2
- HQLSBZFLOUHQJK-STECZYCISA-N Ile-Tyr-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N HQLSBZFLOUHQJK-STECZYCISA-N 0.000 description 2
- 206010061598 Immunodeficiency Diseases 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- 208000026350 Inborn Genetic disease Diseases 0.000 description 2
- 102100034343 Integrase Human genes 0.000 description 2
- SITWEMZOJNKJCH-UHFFFAOYSA-N L-alanine-L-arginine Natural products CC(N)C(=O)NC(C(O)=O)CCCNC(N)=N SITWEMZOJNKJCH-UHFFFAOYSA-N 0.000 description 2
- QOOWRKBDDXQRHC-BQBZGAKWSA-N L-lysyl-L-alanine Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN QOOWRKBDDXQRHC-BQBZGAKWSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- CUXRXAIAVYLVFD-ULQDDVLXSA-N Leu-Arg-Tyr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 CUXRXAIAVYLVFD-ULQDDVLXSA-N 0.000 description 2
- IGUOAYLTQJLPPD-DCAQKATOSA-N Leu-Asn-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N IGUOAYLTQJLPPD-DCAQKATOSA-N 0.000 description 2
- HYIFFZAQXPUEAU-QWRGUYRKSA-N Leu-Gly-Leu Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC(C)C HYIFFZAQXPUEAU-QWRGUYRKSA-N 0.000 description 2
- APFJUBGRZGMQFF-QWRGUYRKSA-N Leu-Gly-Lys Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCCN APFJUBGRZGMQFF-QWRGUYRKSA-N 0.000 description 2
- VGPCJSXPPOQPBK-YUMQZZPRSA-N Leu-Gly-Ser Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O VGPCJSXPPOQPBK-YUMQZZPRSA-N 0.000 description 2
- LIINDKYIGYTDLG-PPCPHDFISA-N Leu-Ile-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LIINDKYIGYTDLG-PPCPHDFISA-N 0.000 description 2
- OVZLLFONXILPDZ-VOAKCMCISA-N Leu-Lys-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OVZLLFONXILPDZ-VOAKCMCISA-N 0.000 description 2
- YRRCOJOXAJNSAX-IHRRRGAJSA-N Leu-Pro-Lys Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)O)N YRRCOJOXAJNSAX-IHRRRGAJSA-N 0.000 description 2
- IDGZVZJLYFTXSL-DCAQKATOSA-N Leu-Ser-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCN=C(N)N IDGZVZJLYFTXSL-DCAQKATOSA-N 0.000 description 2
- SBANPBVRHYIMRR-GARJFASQSA-N Leu-Ser-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@@H]1C(=O)O)N SBANPBVRHYIMRR-GARJFASQSA-N 0.000 description 2
- SBANPBVRHYIMRR-UHFFFAOYSA-N Leu-Ser-Pro Natural products CC(C)CC(N)C(=O)NC(CO)C(=O)N1CCCC1C(O)=O SBANPBVRHYIMRR-UHFFFAOYSA-N 0.000 description 2
- SVBJIZVVYJYGLA-DCAQKATOSA-N Leu-Ser-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O SVBJIZVVYJYGLA-DCAQKATOSA-N 0.000 description 2
- UCRJTSIIAYHOHE-ULQDDVLXSA-N Leu-Tyr-Arg Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N UCRJTSIIAYHOHE-ULQDDVLXSA-N 0.000 description 2
- FDBTVENULFNTAL-XQQFMLRXSA-N Leu-Val-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N FDBTVENULFNTAL-XQQFMLRXSA-N 0.000 description 2
- QUYCUALODHJQLK-CIUDSAMLSA-N Lys-Asp-Asp Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O QUYCUALODHJQLK-CIUDSAMLSA-N 0.000 description 2
- OVIVOCSURJYCTM-GUBZILKMSA-N Lys-Asp-Glu Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCC(O)=O OVIVOCSURJYCTM-GUBZILKMSA-N 0.000 description 2
- GCMWRRQAKQXDED-IUCAKERBSA-N Lys-Glu-Gly Chemical compound [NH3+]CCCC[C@H]([NH3+])C(=O)N[C@@H](CCC([O-])=O)C(=O)NCC([O-])=O GCMWRRQAKQXDED-IUCAKERBSA-N 0.000 description 2
- FMIIKPHLJKUXGE-GUBZILKMSA-N Lys-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCCN FMIIKPHLJKUXGE-GUBZILKMSA-N 0.000 description 2
- NJNRBRKHOWSGMN-SRVKXCTJSA-N Lys-Leu-Asn Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O NJNRBRKHOWSGMN-SRVKXCTJSA-N 0.000 description 2
- ZCWWVXAXWUAEPZ-SRVKXCTJSA-N Lys-Met-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(O)=O ZCWWVXAXWUAEPZ-SRVKXCTJSA-N 0.000 description 2
- HKXSZKJMDBHOTG-CIUDSAMLSA-N Lys-Ser-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCCN HKXSZKJMDBHOTG-CIUDSAMLSA-N 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 2
- 208000024556 Mendelian disease Diseases 0.000 description 2
- UYAKZHGIPRCGPF-CIUDSAMLSA-N Met-Glu-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCSC)N UYAKZHGIPRCGPF-CIUDSAMLSA-N 0.000 description 2
- VZBXCMCHIHEPBL-SRVKXCTJSA-N Met-Glu-Lys Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN VZBXCMCHIHEPBL-SRVKXCTJSA-N 0.000 description 2
- MYAPQOBHGWJZOM-UWVGGRQHSA-N Met-Gly-Leu Chemical compound CSCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC(C)C MYAPQOBHGWJZOM-UWVGGRQHSA-N 0.000 description 2
- LUYURUYVNYGKGM-RCWTZXSCSA-N Met-Pro-Thr Chemical compound CSCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O LUYURUYVNYGKGM-RCWTZXSCSA-N 0.000 description 2
- 206010027452 Metastases to bone Diseases 0.000 description 2
- 108090000143 Mouse Proteins Proteins 0.000 description 2
- 208000034578 Multiple myelomas Diseases 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 230000004988 N-glycosylation Effects 0.000 description 2
- 206010061309 Neoplasm progression Diseases 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- 108700020796 Oncogene Proteins 0.000 description 2
- 208000001132 Osteoporosis Diseases 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- CGOMLCQJEMWMCE-STQMWFEESA-N Phe-Arg-Gly Chemical compound NC(N)=NCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 CGOMLCQJEMWMCE-STQMWFEESA-N 0.000 description 2
- HTKNPQZCMLBOTQ-XVSYOHENSA-N Phe-Asn-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC1=CC=CC=C1)N)O HTKNPQZCMLBOTQ-XVSYOHENSA-N 0.000 description 2
- DJPXNKUDJKGQEE-BZSNNMDCSA-N Phe-Asp-Phe Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O DJPXNKUDJKGQEE-BZSNNMDCSA-N 0.000 description 2
- MQVFHOPCKNTHGT-MELADBBJSA-N Phe-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC2=CC=CC=C2)N)C(=O)O MQVFHOPCKNTHGT-MELADBBJSA-N 0.000 description 2
- AKJAKCBHLJGRBU-JYJNAYRXSA-N Phe-Glu-His Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N AKJAKCBHLJGRBU-JYJNAYRXSA-N 0.000 description 2
- OQTDZEJJWWAGJT-KKUMJFAQSA-N Phe-Lys-Asp Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O OQTDZEJJWWAGJT-KKUMJFAQSA-N 0.000 description 2
- PHJUFDQVVKVOPU-ULQDDVLXSA-N Phe-Lys-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC1=CC=CC=C1)N PHJUFDQVVKVOPU-ULQDDVLXSA-N 0.000 description 2
- QARPMYDMYVLFMW-KKUMJFAQSA-N Phe-Pro-Glu Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(O)=O)C1=CC=CC=C1 QARPMYDMYVLFMW-KKUMJFAQSA-N 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 208000037062 Polyps Diseases 0.000 description 2
- VCYJKOLZYPYGJV-AVGNSLFASA-N Pro-Arg-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(O)=O VCYJKOLZYPYGJV-AVGNSLFASA-N 0.000 description 2
- XUSDDSLCRPUKLP-QXEWZRGKSA-N Pro-Asp-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]1CCCN1 XUSDDSLCRPUKLP-QXEWZRGKSA-N 0.000 description 2
- MKGIILKDUGDRRO-FXQIFTODSA-N Pro-Ser-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1 MKGIILKDUGDRRO-FXQIFTODSA-N 0.000 description 2
- XSXABUHLKPUVLX-JYJNAYRXSA-N Pro-Ser-Trp Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)O XSXABUHLKPUVLX-JYJNAYRXSA-N 0.000 description 2
- 206010071019 Prostatic dysplasia Diseases 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 108010029485 Protein Isoforms Proteins 0.000 description 2
- 102000001708 Protein Isoforms Human genes 0.000 description 2
- 102000003923 Protein Kinase C Human genes 0.000 description 2
- 108090000315 Protein Kinase C Proteins 0.000 description 2
- 102000009516 Protein Serine-Threonine Kinases Human genes 0.000 description 2
- 108010009341 Protein Serine-Threonine Kinases Proteins 0.000 description 2
- 238000010240 RT-PCR analysis Methods 0.000 description 2
- BUGBHKTXTAQXES-AHCXROLUSA-N Selenium-75 Chemical compound [75Se] BUGBHKTXTAQXES-AHCXROLUSA-N 0.000 description 2
- RZEQTVHJZCIUBT-WDSKDSINSA-N Ser-Arg Chemical compound OC[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=N RZEQTVHJZCIUBT-WDSKDSINSA-N 0.000 description 2
- GXXTUIUYTWGPMV-FXQIFTODSA-N Ser-Arg-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O GXXTUIUYTWGPMV-FXQIFTODSA-N 0.000 description 2
- QFBNNYNWKYKVJO-DCAQKATOSA-N Ser-Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)CCCN=C(N)N QFBNNYNWKYKVJO-DCAQKATOSA-N 0.000 description 2
- QKQDTEYDEIJPNK-GUBZILKMSA-N Ser-Glu-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CO QKQDTEYDEIJPNK-GUBZILKMSA-N 0.000 description 2
- PPNPDKGQRFSCAC-CIUDSAMLSA-N Ser-Lys-Asp Chemical compound NCCCC[C@H](NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(O)=O)C(O)=O PPNPDKGQRFSCAC-CIUDSAMLSA-N 0.000 description 2
- QJKPECIAWNNKIT-KKUMJFAQSA-N Ser-Lys-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O QJKPECIAWNNKIT-KKUMJFAQSA-N 0.000 description 2
- NQZFFLBPNDLTPO-DLOVCJGASA-N Ser-Phe-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](CO)N NQZFFLBPNDLTPO-DLOVCJGASA-N 0.000 description 2
- GDUZTEQRAOXYJS-SRVKXCTJSA-N Ser-Phe-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CO)N GDUZTEQRAOXYJS-SRVKXCTJSA-N 0.000 description 2
- XVWDJUROVRQKAE-KKUMJFAQSA-N Ser-Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)CC1=CC=CC=C1 XVWDJUROVRQKAE-KKUMJFAQSA-N 0.000 description 2
- PYTKULIABVRXSC-BWBBJGPYSA-N Ser-Ser-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PYTKULIABVRXSC-BWBBJGPYSA-N 0.000 description 2
- AXKJPUBALUNJEO-UBHSHLNASA-N Ser-Trp-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(N)=O)C(O)=O AXKJPUBALUNJEO-UBHSHLNASA-N 0.000 description 2
- PCMZJFMUYWIERL-ZKWXMUAHSA-N Ser-Val-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O PCMZJFMUYWIERL-ZKWXMUAHSA-N 0.000 description 2
- 241000256251 Spodoptera frugiperda Species 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- GKLVYJBZJHMRIY-OUBTZVSYSA-N Technetium-99 Chemical compound [99Tc] GKLVYJBZJHMRIY-OUBTZVSYSA-N 0.000 description 2
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 2
- 102100036407 Thioredoxin Human genes 0.000 description 2
- CAGTXGDOIFXLPC-KZVJFYERSA-N Thr-Arg-Ala Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](C)C(O)=O)CCCN=C(N)N CAGTXGDOIFXLPC-KZVJFYERSA-N 0.000 description 2
- QGXCWPNQVCYJEL-NUMRIWBASA-N Thr-Asn-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O QGXCWPNQVCYJEL-NUMRIWBASA-N 0.000 description 2
- UDQBCBUXAQIZAK-GLLZPBPUSA-N Thr-Glu-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O UDQBCBUXAQIZAK-GLLZPBPUSA-N 0.000 description 2
- BDGBHYCAZJPLHX-HJGDQZAQSA-N Thr-Lys-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O BDGBHYCAZJPLHX-HJGDQZAQSA-N 0.000 description 2
- KZTLZZQTJMCGIP-ZJDVBMNYSA-N Thr-Val-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KZTLZZQTJMCGIP-ZJDVBMNYSA-N 0.000 description 2
- 208000024799 Thyroid disease Diseases 0.000 description 2
- VCGOTJGGBXEBFO-FDARSICLSA-N Trp-Pro-Ile Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(O)=O VCGOTJGGBXEBFO-FDARSICLSA-N 0.000 description 2
- BOBZBMOTRORUPT-XIRDDKMYSA-N Trp-Ser-Leu Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O)=CNC2=C1 BOBZBMOTRORUPT-XIRDDKMYSA-N 0.000 description 2
- ADBDQGBDNUTRDB-ULQDDVLXSA-N Tyr-Arg-Leu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(O)=O ADBDQGBDNUTRDB-ULQDDVLXSA-N 0.000 description 2
- KOVXHANYYYMBRF-IRIUXVKKSA-N Tyr-Glu-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N)O KOVXHANYYYMBRF-IRIUXVKKSA-N 0.000 description 2
- SZTTYWIUCGSURQ-AUTRQRHGSA-N Val-Glu-Glu Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O SZTTYWIUCGSURQ-AUTRQRHGSA-N 0.000 description 2
- PIFJAFRUVWZRKR-QMMMGPOBSA-N Val-Gly-Gly Chemical compound CC(C)[C@H]([NH3+])C(=O)NCC(=O)NCC([O-])=O PIFJAFRUVWZRKR-QMMMGPOBSA-N 0.000 description 2
- URIRWLJVWHYLET-ONGXEEELSA-N Val-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)C(C)C URIRWLJVWHYLET-ONGXEEELSA-N 0.000 description 2
- IJGPOONOTBNTFS-GVXVVHGQSA-N Val-Lys-Glu Chemical compound [H]N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O IJGPOONOTBNTFS-GVXVVHGQSA-N 0.000 description 2
- MHHAWNPHDLCPLF-ULQDDVLXSA-N Val-Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)CC1=CC=CC=C1 MHHAWNPHDLCPLF-ULQDDVLXSA-N 0.000 description 2
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 2
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 2
- 206010047249 Venous thrombosis Diseases 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- VWQVUPCCIRVNHF-OUBTZVSYSA-N Yttrium-90 Chemical compound [90Y] VWQVUPCCIRVNHF-OUBTZVSYSA-N 0.000 description 2
- 238000002679 ablation Methods 0.000 description 2
- 230000005856 abnormality Effects 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- QQINRWTZWGJFDB-IGMARMGPSA-N actinium-227 Chemical compound [227Ac] QQINRWTZWGJFDB-IGMARMGPSA-N 0.000 description 2
- 238000001261 affinity purification Methods 0.000 description 2
- 108010011559 alanylphenylalanine Proteins 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 230000009435 amidation Effects 0.000 description 2
- 238000007112 amidation reaction Methods 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 239000000074 antisense oligonucleotide Substances 0.000 description 2
- 238000012230 antisense oligonucleotides Methods 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 238000007622 bioinformatic analysis Methods 0.000 description 2
- 238000001574 biopsy Methods 0.000 description 2
- 210000005068 bladder tissue Anatomy 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 238000010804 cDNA synthesis Methods 0.000 description 2
- 208000035269 cancer or benign tumor Diseases 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 150000001720 carbohydrates Chemical group 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 239000013592 cell lysate Substances 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 230000005754 cellular signaling Effects 0.000 description 2
- 229920001436 collagen Polymers 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 238000004590 computer program Methods 0.000 description 2
- 238000012790 confirmation Methods 0.000 description 2
- 239000000470 constituent Substances 0.000 description 2
- RYGMFSIKBFXOCR-IGMARMGPSA-N copper-64 Chemical compound [64Cu] RYGMFSIKBFXOCR-IGMARMGPSA-N 0.000 description 2
- 208000029078 coronary artery disease Diseases 0.000 description 2
- YPHMISFOHDHNIV-FSZOTQKASA-N cycloheximide Chemical compound C1[C@@H](C)C[C@H](C)C(=O)[C@@H]1[C@H](O)CC1CC(=O)NC(=O)C1 YPHMISFOHDHNIV-FSZOTQKASA-N 0.000 description 2
- 230000017858 demethylation Effects 0.000 description 2
- 238000010520 demethylation reaction Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- SLPJGDQJLTYWCI-UHFFFAOYSA-N dimethyl-(4,5,6,7-tetrabromo-1h-benzoimidazol-2-yl)-amine Chemical compound BrC1=C(Br)C(Br)=C2NC(N(C)C)=NC2=C1Br SLPJGDQJLTYWCI-UHFFFAOYSA-N 0.000 description 2
- 108010054813 diprotin B Proteins 0.000 description 2
- KBQHZAAAGSGFKK-AKLPVKDBSA-N dysprosium-166 Chemical compound [166Dy] KBQHZAAAGSGFKK-AKLPVKDBSA-N 0.000 description 2
- 230000008482 dysregulation Effects 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- UYAHIZSMUZPPFV-NJFSPNSNSA-N erbium-169 Chemical compound [169Er] UYAHIZSMUZPPFV-NJFSPNSNSA-N 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- OGPBJKLSAFTDLK-NJFSPNSNSA-N europium-154 Chemical compound [154Eu] OGPBJKLSAFTDLK-NJFSPNSNSA-N 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 239000004744 fabric Substances 0.000 description 2
- UIWYJDYFSGRHKR-AHCXROLUSA-N gadolinium-153 Chemical compound [153Gd] UIWYJDYFSGRHKR-AHCXROLUSA-N 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 108010078326 glycyl-glycyl-valine Proteins 0.000 description 2
- 108010037850 glycylvaline Proteins 0.000 description 2
- PCHJSUWPFVWCPO-OUBTZVSYSA-N gold-198 Chemical compound [198Au] PCHJSUWPFVWCPO-OUBTZVSYSA-N 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 108010085325 histidylproline Proteins 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 238000001794 hormone therapy Methods 0.000 description 2
- 230000008073 immune recognition Effects 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 230000001024 immunotherapeutic effect Effects 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 230000009545 invasion Effects 0.000 description 2
- 238000011835 investigation Methods 0.000 description 2
- XMBWDFGMSWQBCA-YPZZEJLDSA-N iodane Chemical compound [125IH] XMBWDFGMSWQBCA-YPZZEJLDSA-N 0.000 description 2
- 210000002414 leg Anatomy 0.000 description 2
- 108010057821 leucylproline Proteins 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- OHSVLFRHMCKCQY-NJFSPNSNSA-N lutetium-177 Chemical compound [177Lu] OHSVLFRHMCKCQY-NJFSPNSNSA-N 0.000 description 2
- 108010017391 lysylvaline Proteins 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 238000007855 methylation-specific PCR Methods 0.000 description 2
- 230000005012 migration Effects 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 230000002297 mitogenic effect Effects 0.000 description 2
- 230000009826 neoplastic cell growth Effects 0.000 description 2
- 238000010606 normalization Methods 0.000 description 2
- 238000007899 nucleic acid hybridization Methods 0.000 description 2
- 210000004940 nucleus Anatomy 0.000 description 2
- 238000005457 optimization Methods 0.000 description 2
- SYQBFIAQOQZEGI-RNFDNDRNSA-N osmium-194 Chemical compound [194Os] SYQBFIAQOQZEGI-RNFDNDRNSA-N 0.000 description 2
- 230000001582 osteoblastic effect Effects 0.000 description 2
- 238000004806 packaging method and process Methods 0.000 description 2
- 239000013610 patient sample Substances 0.000 description 2
- 210000004197 pelvis Anatomy 0.000 description 2
- 210000005259 peripheral blood Anatomy 0.000 description 2
- 239000011886 peripheral blood Substances 0.000 description 2
- 210000001322 periplasm Anatomy 0.000 description 2
- 230000002974 pharmacogenomic effect Effects 0.000 description 2
- 108010073025 phenylalanylphenylalanine Proteins 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 230000035479 physiological effects, processes and functions Effects 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 108010053725 prolylvaline Proteins 0.000 description 2
- 230000004850 protein–protein interaction Effects 0.000 description 2
- 238000007634 remodeling Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000007894 restriction fragment length polymorphism technique Methods 0.000 description 2
- WUAPFZMCVAUBPE-IGMARMGPSA-N rhenium-186 Chemical compound [186Re] WUAPFZMCVAUBPE-IGMARMGPSA-N 0.000 description 2
- MHOVAHRLVXNVSD-NJFSPNSNSA-N rhodium-105 Chemical compound [105Rh] MHOVAHRLVXNVSD-NJFSPNSNSA-N 0.000 description 2
- 210000003705 ribosome Anatomy 0.000 description 2
- 108091092562 ribozyme Proteins 0.000 description 2
- 235000019515 salmon Nutrition 0.000 description 2
- KZUNJOHGWZRPMI-FTXFMUIASA-N samarium-145 Chemical compound [145Sm] KZUNJOHGWZRPMI-FTXFMUIASA-N 0.000 description 2
- SIXSYDAISGFNSX-NJFSPNSNSA-N scandium-47 Chemical compound [47Sc] SIXSYDAISGFNSX-NJFSPNSNSA-N 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 238000002603 single-photon emission computed tomography Methods 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 210000002027 skeletal muscle Anatomy 0.000 description 2
- 230000000391 smoking effect Effects 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 150000003431 steroids Chemical class 0.000 description 2
- 229910052717 sulfur Inorganic materials 0.000 description 2
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 229940056501 technetium 99m Drugs 0.000 description 2
- 108060008226 thioredoxin Proteins 0.000 description 2
- 108010061238 threonyl-glycine Proteins 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- 210000001685 thyroid gland Anatomy 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 230000002485 urinary effect Effects 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- VWQVUPCCIRVNHF-IGMARMGPSA-N yttrium-89 atom Chemical compound [89Y] VWQVUPCCIRVNHF-IGMARMGPSA-N 0.000 description 2
- VWQVUPCCIRVNHF-NJFSPNSNSA-N yttrium-91 Chemical compound [91Y] VWQVUPCCIRVNHF-NJFSPNSNSA-N 0.000 description 2
- HSINOMROUCMIEA-FGVHQWLLSA-N (2s,4r)-4-[(3r,5s,6r,7r,8s,9s,10s,13r,14s,17r)-6-ethyl-3,7-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]-2-methylpentanoic acid Chemical compound C([C@@]12C)C[C@@H](O)C[C@H]1[C@@H](CC)[C@@H](O)[C@@H]1[C@@H]2CC[C@]2(C)[C@@H]([C@H](C)C[C@H](C)C(O)=O)CC[C@H]21 HSINOMROUCMIEA-FGVHQWLLSA-N 0.000 description 1
- JUDOLRSMWHVKGX-UHFFFAOYSA-N 1,1-dioxo-1$l^{6},2-benzodithiol-3-one Chemical compound C1=CC=C2C(=O)SS(=O)(=O)C2=C1 JUDOLRSMWHVKGX-UHFFFAOYSA-N 0.000 description 1
- NCYCYZXNIZJOKI-IOUUIBBYSA-N 11-cis-retinal Chemical compound O=C/C=C(\C)/C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C NCYCYZXNIZJOKI-IOUUIBBYSA-N 0.000 description 1
- BYACHAOCSIPLCM-UHFFFAOYSA-N 2-[2-[bis(2-hydroxyethyl)amino]ethyl-(2-hydroxyethyl)amino]ethanol Chemical compound OCCN(CCO)CCN(CCO)CCO BYACHAOCSIPLCM-UHFFFAOYSA-N 0.000 description 1
- FDSYTWVNUJTPMA-UHFFFAOYSA-N 2-[3,9-bis(carboxymethyl)-3,6,9,15-tetrazabicyclo[9.3.1]pentadeca-1(15),11,13-trien-6-yl]acetic acid Chemical compound C1N(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC2=CC=CC1=N2 FDSYTWVNUJTPMA-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- YVOOPGWEIRIUOX-UHFFFAOYSA-N 2-azanyl-3-sulfanyl-propanoic acid Chemical compound SCC(N)C(O)=O.SCC(N)C(O)=O YVOOPGWEIRIUOX-UHFFFAOYSA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- WOVKYSAHUYNSMH-RRKCRQDMSA-N 5-bromodeoxyuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(Br)=C1 WOVKYSAHUYNSMH-RRKCRQDMSA-N 0.000 description 1
- ULECEJGNDHWSKD-UHFFFAOYSA-N 6-amino-2-[2-[(2-amino-3-phenylpropanoyl)amino]propanoylamino]hexanoic acid Chemical compound NCCCCC(C(O)=O)NC(=O)C(C)NC(=O)C(N)CC1=CC=CC=C1 ULECEJGNDHWSKD-UHFFFAOYSA-N 0.000 description 1
- FVFVNNKYKYZTJU-UHFFFAOYSA-N 6-chloro-1,3,5-triazine-2,4-diamine Chemical compound NC1=NC(N)=NC(Cl)=N1 FVFVNNKYKYZTJU-UHFFFAOYSA-N 0.000 description 1
- 108091005508 Acid proteases Proteins 0.000 description 1
- 208000003200 Adenoma Diseases 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- SVBXIUDNTRTKHE-CIUDSAMLSA-N Ala-Arg-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(O)=O SVBXIUDNTRTKHE-CIUDSAMLSA-N 0.000 description 1
- WXERCAHAIKMTKX-ZLUOBGJFSA-N Ala-Asp-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O WXERCAHAIKMTKX-ZLUOBGJFSA-N 0.000 description 1
- YSMPVONNIWLJML-FXQIFTODSA-N Ala-Asp-Pro Chemical compound C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(O)=O YSMPVONNIWLJML-FXQIFTODSA-N 0.000 description 1
- PAIHPOGPJVUFJY-WDSKDSINSA-N Ala-Glu-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O PAIHPOGPJVUFJY-WDSKDSINSA-N 0.000 description 1
- HXNNRBHASOSVPG-GUBZILKMSA-N Ala-Glu-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O HXNNRBHASOSVPG-GUBZILKMSA-N 0.000 description 1
- SHKGHIFSEAGTNL-DLOVCJGASA-N Ala-His-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CN=CN1 SHKGHIFSEAGTNL-DLOVCJGASA-N 0.000 description 1
- LBFXVAXPDOBRKU-LKTVYLICSA-N Ala-His-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LBFXVAXPDOBRKU-LKTVYLICSA-N 0.000 description 1
- CFPQUJZTLUQUTJ-HTFCKZLJSA-N Ala-Ile-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](C)N CFPQUJZTLUQUTJ-HTFCKZLJSA-N 0.000 description 1
- CCDFBRZVTDDJNM-GUBZILKMSA-N Ala-Leu-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O CCDFBRZVTDDJNM-GUBZILKMSA-N 0.000 description 1
- MFMDKJIPHSWSBM-GUBZILKMSA-N Ala-Lys-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O MFMDKJIPHSWSBM-GUBZILKMSA-N 0.000 description 1
- SUHLZMHFRALVSY-YUMQZZPRSA-N Ala-Lys-Gly Chemical compound NCCCC[C@H](NC(=O)[C@@H](N)C)C(=O)NCC(O)=O SUHLZMHFRALVSY-YUMQZZPRSA-N 0.000 description 1
- MMLHRUJLOUSRJX-CIUDSAMLSA-N Ala-Ser-Lys Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCCN MMLHRUJLOUSRJX-CIUDSAMLSA-N 0.000 description 1
- IOFVWPYSRSCWHI-JXUBOQSCSA-N Ala-Thr-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C)N IOFVWPYSRSCWHI-JXUBOQSCSA-N 0.000 description 1
- SAHQGRZIQVEJPF-JXUBOQSCSA-N Ala-Thr-Lys Chemical compound C[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@H](C(O)=O)CCCCN SAHQGRZIQVEJPF-JXUBOQSCSA-N 0.000 description 1
- ZJLORAAXDAJLDC-CQDKDKBSSA-N Ala-Tyr-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(O)=O ZJLORAAXDAJLDC-CQDKDKBSSA-N 0.000 description 1
- 108091093088 Amplicon Proteins 0.000 description 1
- 102100032187 Androgen receptor Human genes 0.000 description 1
- 108020004491 Antisense DNA Proteins 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 208000019901 Anxiety disease Diseases 0.000 description 1
- SGYSTDWPNPKJPP-GUBZILKMSA-N Arg-Ala-Arg Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SGYSTDWPNPKJPP-GUBZILKMSA-N 0.000 description 1
- OZNSCVPYWZRQPY-CIUDSAMLSA-N Arg-Asp-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O OZNSCVPYWZRQPY-CIUDSAMLSA-N 0.000 description 1
- HPKSHFSEXICTLI-CIUDSAMLSA-N Arg-Glu-Ala Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O HPKSHFSEXICTLI-CIUDSAMLSA-N 0.000 description 1
- QYLJIYOGHRGUIH-CIUDSAMLSA-N Arg-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCNC(N)=N QYLJIYOGHRGUIH-CIUDSAMLSA-N 0.000 description 1
- UAOSDDXCTBIPCA-QXEWZRGKSA-N Arg-Ile-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CCCN=C(N)N)N UAOSDDXCTBIPCA-QXEWZRGKSA-N 0.000 description 1
- FFEUXEAKYRCACT-PEDHHIEDSA-N Arg-Ile-Ile Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)CC)C(O)=O FFEUXEAKYRCACT-PEDHHIEDSA-N 0.000 description 1
- GXXWTNKNFFKTJB-NAKRPEOUSA-N Arg-Ile-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O GXXWTNKNFFKTJB-NAKRPEOUSA-N 0.000 description 1
- LXMKTIZAGIBQRX-HRCADAONSA-N Arg-Phe-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=CC=C2)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O LXMKTIZAGIBQRX-HRCADAONSA-N 0.000 description 1
- JOTRDIXZHNQYGP-DCAQKATOSA-N Arg-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCN=C(N)N)N JOTRDIXZHNQYGP-DCAQKATOSA-N 0.000 description 1
- LFWOQHSQNCKXRU-UFYCRDLUSA-N Arg-Tyr-Phe Chemical compound C([C@H](NC(=O)[C@H](CCCN=C(N)N)N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=C(O)C=C1 LFWOQHSQNCKXRU-UFYCRDLUSA-N 0.000 description 1
- WOZDCBHUGJVJPL-AVGNSLFASA-N Arg-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N WOZDCBHUGJVJPL-AVGNSLFASA-N 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- LXTGAOAXPSJWOU-DCAQKATOSA-N Asn-Arg-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(=O)N)N LXTGAOAXPSJWOU-DCAQKATOSA-N 0.000 description 1
- MEFGKQUUYZOLHM-GMOBBJLQSA-N Asn-Arg-Ile Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O MEFGKQUUYZOLHM-GMOBBJLQSA-N 0.000 description 1
- OLGCWMNDJTWQAG-GUBZILKMSA-N Asn-Glu-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC(N)=O OLGCWMNDJTWQAG-GUBZILKMSA-N 0.000 description 1
- UYXXMIZGHYKYAT-NHCYSSNCSA-N Asn-His-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CC(=O)N)N UYXXMIZGHYKYAT-NHCYSSNCSA-N 0.000 description 1
- PNHQRQTVBRDIEF-CIUDSAMLSA-N Asn-Leu-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)N)N PNHQRQTVBRDIEF-CIUDSAMLSA-N 0.000 description 1
- UBGGJTMETLEXJD-DCAQKATOSA-N Asn-Leu-Met Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(O)=O UBGGJTMETLEXJD-DCAQKATOSA-N 0.000 description 1
- QJMCHPGWFZZRID-BQBZGAKWSA-N Asn-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC(N)=O QJMCHPGWFZZRID-BQBZGAKWSA-N 0.000 description 1
- GIQCDTKOIPUDSG-GARJFASQSA-N Asn-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)N)N)C(=O)O GIQCDTKOIPUDSG-GARJFASQSA-N 0.000 description 1
- OMSMPWHEGLNQOD-UWVGGRQHSA-N Asn-Phe Chemical compound NC(=O)C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 OMSMPWHEGLNQOD-UWVGGRQHSA-N 0.000 description 1
- PLTGTJAZQRGMPP-FXQIFTODSA-N Asn-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC(N)=O PLTGTJAZQRGMPP-FXQIFTODSA-N 0.000 description 1
- SONUFGRSSMFHFN-IMJSIDKUSA-N Asn-Ser Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CO)C(O)=O SONUFGRSSMFHFN-IMJSIDKUSA-N 0.000 description 1
- CASGONAXMZPHCK-FXQIFTODSA-N Asp-Asn-Arg Chemical compound C(C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)N)CN=C(N)N CASGONAXMZPHCK-FXQIFTODSA-N 0.000 description 1
- WCFCYFDBMNFSPA-ACZMJKKPSA-N Asp-Asp-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCC(O)=O WCFCYFDBMNFSPA-ACZMJKKPSA-N 0.000 description 1
- ZCKYZTGLXIEOKS-CIUDSAMLSA-N Asp-Asp-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)N ZCKYZTGLXIEOKS-CIUDSAMLSA-N 0.000 description 1
- TVVYVAUGRHNTGT-UGYAYLCHSA-N Asp-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC(O)=O TVVYVAUGRHNTGT-UGYAYLCHSA-N 0.000 description 1
- TVIZQBFURPLQDV-DJFWLOJKSA-N Asp-His-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CC(=O)O)N TVIZQBFURPLQDV-DJFWLOJKSA-N 0.000 description 1
- UBPMOJLRVMGTOQ-GARJFASQSA-N Asp-His-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CN=CN2)NC(=O)[C@H](CC(=O)O)N)C(=O)O UBPMOJLRVMGTOQ-GARJFASQSA-N 0.000 description 1
- SEMWSADZTMJELF-BYULHYEWSA-N Asp-Ile-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(O)=O SEMWSADZTMJELF-BYULHYEWSA-N 0.000 description 1
- PYXXJFRXIYAESU-PCBIJLKTSA-N Asp-Ile-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O PYXXJFRXIYAESU-PCBIJLKTSA-N 0.000 description 1
- DWOGMPWRQQWPPF-GUBZILKMSA-N Asp-Leu-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O DWOGMPWRQQWPPF-GUBZILKMSA-N 0.000 description 1
- UJGRZQYSNYTCAX-SRVKXCTJSA-N Asp-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(O)=O UJGRZQYSNYTCAX-SRVKXCTJSA-N 0.000 description 1
- IVPNEDNYYYFAGI-GARJFASQSA-N Asp-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC(=O)O)N IVPNEDNYYYFAGI-GARJFASQSA-N 0.000 description 1
- SAKCBXNPWDRWPE-BQBZGAKWSA-N Asp-Met-Gly Chemical compound CSCC[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CC(=O)O)N SAKCBXNPWDRWPE-BQBZGAKWSA-N 0.000 description 1
- YFGUZQQCSDZRBN-DCAQKATOSA-N Asp-Pro-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(O)=O YFGUZQQCSDZRBN-DCAQKATOSA-N 0.000 description 1
- WMLFFCRUSPNENW-ZLUOBGJFSA-N Asp-Ser-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O WMLFFCRUSPNENW-ZLUOBGJFSA-N 0.000 description 1
- MGSVBZIBCCKGCY-ZLUOBGJFSA-N Asp-Ser-Ser Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O MGSVBZIBCCKGCY-ZLUOBGJFSA-N 0.000 description 1
- JSNWZMFSLIWAHS-HJGDQZAQSA-N Asp-Thr-Leu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)O)NC(=O)[C@H](CC(=O)O)N)O JSNWZMFSLIWAHS-HJGDQZAQSA-N 0.000 description 1
- GCACQYDBDHRVGE-LKXGYXEUSA-N Asp-Thr-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H]([C@H](O)C)NC(=O)[C@@H](N)CC(O)=O GCACQYDBDHRVGE-LKXGYXEUSA-N 0.000 description 1
- HCOQNGIHSXICCB-IHRRRGAJSA-N Asp-Tyr-Arg Chemical compound N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)O HCOQNGIHSXICCB-IHRRRGAJSA-N 0.000 description 1
- KNDCWFXCFKSEBM-AVGNSLFASA-N Asp-Tyr-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O KNDCWFXCFKSEBM-AVGNSLFASA-N 0.000 description 1
- VHUKCUHLFMRHOD-MELADBBJSA-N Asp-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC(=O)O)N)C(=O)O VHUKCUHLFMRHOD-MELADBBJSA-N 0.000 description 1
- BYLPQJAWXJWUCJ-YDHLFZDLSA-N Asp-Tyr-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(O)=O BYLPQJAWXJWUCJ-YDHLFZDLSA-N 0.000 description 1
- 108010017640 Aspartic Acid Proteases Proteins 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 208000020084 Bone disease Diseases 0.000 description 1
- 206010061728 Bone lesion Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 238000010599 BrdU assay Methods 0.000 description 1
- 108010045403 Calcium-Binding Proteins Proteins 0.000 description 1
- 102000005701 Calcium-Binding Proteins Human genes 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- GUTLYIVDDKVIGB-OUBTZVSYSA-N Cobalt-60 Chemical compound [60Co] GUTLYIVDDKVIGB-OUBTZVSYSA-N 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- ACTIUHUUMQJHFO-UHFFFAOYSA-N Coenzym Q10 Natural products COC1=C(OC)C(=O)C(CC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)C)=C(C)C1=O ACTIUHUUMQJHFO-UHFFFAOYSA-N 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 102000005636 Cyclic AMP Response Element-Binding Protein Human genes 0.000 description 1
- 108010045171 Cyclic AMP Response Element-Binding Protein Proteins 0.000 description 1
- 102100023033 Cyclic AMP-dependent transcription factor ATF-2 Human genes 0.000 description 1
- 102000004654 Cyclic GMP-Dependent Protein Kinases Human genes 0.000 description 1
- 108010003591 Cyclic GMP-Dependent Protein Kinases Proteins 0.000 description 1
- CPTUXCUWQIBZIF-ZLUOBGJFSA-N Cys-Asn-Ser Chemical compound SC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O CPTUXCUWQIBZIF-ZLUOBGJFSA-N 0.000 description 1
- XABFFGOGKOORCG-CIUDSAMLSA-N Cys-Asp-Leu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O XABFFGOGKOORCG-CIUDSAMLSA-N 0.000 description 1
- SRIRHERUAMYIOQ-CIUDSAMLSA-N Cys-Leu-Ser Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O SRIRHERUAMYIOQ-CIUDSAMLSA-N 0.000 description 1
- HMWBPUDETPKSSS-DCAQKATOSA-N Cys-Pro-Lys Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CS)N)C(=O)N[C@@H](CCCCN)C(=O)O HMWBPUDETPKSSS-DCAQKATOSA-N 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 108020001019 DNA Primers Proteins 0.000 description 1
- 230000008836 DNA modification Effects 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 238000012270 DNA recombination Methods 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 241000251948 Dolophilodes major Species 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- UPEZCKBFRMILAV-JNEQICEOSA-N Ecdysone Natural products O=C1[C@H]2[C@@](C)([C@@H]3C([C@@]4(O)[C@@](C)([C@H]([C@H]([C@@H](O)CCC(O)(C)C)C)CC4)CC3)=C1)C[C@H](O)[C@H](O)C2 UPEZCKBFRMILAV-JNEQICEOSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108010040476 FITC-annexin A5 Proteins 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 102100035111 Farnesyl pyrophosphate synthase Human genes 0.000 description 1
- 102000002090 Fibronectin type III Human genes 0.000 description 1
- 108050009401 Fibronectin type III Proteins 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- 108091006027 G proteins Proteins 0.000 description 1
- 102000030782 GTP binding Human genes 0.000 description 1
- 108091000058 GTP-Binding Proteins 0.000 description 1
- 101710113436 GTPase KRas Proteins 0.000 description 1
- 102100039554 Galectin-8 Human genes 0.000 description 1
- 208000034826 Genetic Predisposition to Disease Diseases 0.000 description 1
- ATRHMOJQJWPVBQ-DRZSPHRISA-N Glu-Ala-Phe Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O ATRHMOJQJWPVBQ-DRZSPHRISA-N 0.000 description 1
- NCWOMXABNYEPLY-NRPADANISA-N Glu-Ala-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O NCWOMXABNYEPLY-NRPADANISA-N 0.000 description 1
- SRZLHYPAOXBBSB-HJGDQZAQSA-N Glu-Arg-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SRZLHYPAOXBBSB-HJGDQZAQSA-N 0.000 description 1
- TUTIHHSZKFBMHM-WHFBIAKZSA-N Glu-Asn Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(O)=O TUTIHHSZKFBMHM-WHFBIAKZSA-N 0.000 description 1
- JPHYJQHPILOKHC-ACZMJKKPSA-N Glu-Asp-Asp Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O JPHYJQHPILOKHC-ACZMJKKPSA-N 0.000 description 1
- ZZIFPJZQHRJERU-WDSKDSINSA-N Glu-Cys-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CS)C(=O)NCC(O)=O ZZIFPJZQHRJERU-WDSKDSINSA-N 0.000 description 1
- SJPMNHCEWPTRBR-BQBZGAKWSA-N Glu-Glu-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O SJPMNHCEWPTRBR-BQBZGAKWSA-N 0.000 description 1
- LGYZYFFDELZWRS-DCAQKATOSA-N Glu-Glu-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O LGYZYFFDELZWRS-DCAQKATOSA-N 0.000 description 1
- KUTPGXNAAOQSPD-LPEHRKFASA-N Glu-Glu-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)N)C(=O)O KUTPGXNAAOQSPD-LPEHRKFASA-N 0.000 description 1
- CUXJIASLBRJOFV-LAEOZQHASA-N Glu-Gly-Ile Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(O)=O CUXJIASLBRJOFV-LAEOZQHASA-N 0.000 description 1
- NJPQBTJSYCKCNS-HVTMNAMFSA-N Glu-His-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CCC(=O)O)N NJPQBTJSYCKCNS-HVTMNAMFSA-N 0.000 description 1
- HVYWQYLBVXMXSV-GUBZILKMSA-N Glu-Leu-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O HVYWQYLBVXMXSV-GUBZILKMSA-N 0.000 description 1
- VSRCAOIHMGCIJK-SRVKXCTJSA-N Glu-Leu-Arg Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O VSRCAOIHMGCIJK-SRVKXCTJSA-N 0.000 description 1
- LZMQSTPFYJLVJB-GUBZILKMSA-N Glu-Leu-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)O)N LZMQSTPFYJLVJB-GUBZILKMSA-N 0.000 description 1
- NWOUBJNMZDDGDT-AVGNSLFASA-N Glu-Leu-His Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 NWOUBJNMZDDGDT-AVGNSLFASA-N 0.000 description 1
- MWMJCGBSIORNCD-AVGNSLFASA-N Glu-Leu-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O MWMJCGBSIORNCD-AVGNSLFASA-N 0.000 description 1
- WNRZUESNGGDCJX-JYJNAYRXSA-N Glu-Leu-Phe Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O WNRZUESNGGDCJX-JYJNAYRXSA-N 0.000 description 1
- OQXDUSZKISQQSS-GUBZILKMSA-N Glu-Lys-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O OQXDUSZKISQQSS-GUBZILKMSA-N 0.000 description 1
- SJJHXJDSNQJMMW-SRVKXCTJSA-N Glu-Lys-Arg Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O SJJHXJDSNQJMMW-SRVKXCTJSA-N 0.000 description 1
- CUPSDFQZTVVTSK-GUBZILKMSA-N Glu-Lys-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCC(O)=O CUPSDFQZTVVTSK-GUBZILKMSA-N 0.000 description 1
- HRBYTAIBKPNZKQ-AVGNSLFASA-N Glu-Lys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCC(O)=O HRBYTAIBKPNZKQ-AVGNSLFASA-N 0.000 description 1
- UMHRCVCZUPBBQW-GARJFASQSA-N Glu-Met-Pro Chemical compound CSCC[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCC(=O)O)N UMHRCVCZUPBBQW-GARJFASQSA-N 0.000 description 1
- QNJNPKSWAHPYGI-JYJNAYRXSA-N Glu-Phe-Leu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(O)=O)CC1=CC=CC=C1 QNJNPKSWAHPYGI-JYJNAYRXSA-N 0.000 description 1
- FGSGPLRPQCZBSQ-AVGNSLFASA-N Glu-Phe-Ser Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O FGSGPLRPQCZBSQ-AVGNSLFASA-N 0.000 description 1
- BXSZPACYCMNKLS-AVGNSLFASA-N Glu-Ser-Phe Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O BXSZPACYCMNKLS-AVGNSLFASA-N 0.000 description 1
- TWYSSILQABLLME-HJGDQZAQSA-N Glu-Thr-Arg Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O TWYSSILQABLLME-HJGDQZAQSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- SCCPDJAQCXWPTF-VKHMYHEASA-N Gly-Asp Chemical compound NCC(=O)N[C@H](C(O)=O)CC(O)=O SCCPDJAQCXWPTF-VKHMYHEASA-N 0.000 description 1
- FUTAPPOITCCWTH-WHFBIAKZSA-N Gly-Asp-Asp Chemical compound [H]NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O FUTAPPOITCCWTH-WHFBIAKZSA-N 0.000 description 1
- FIQQRCFQXGLOSZ-WDSKDSINSA-N Gly-Glu-Asp Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O FIQQRCFQXGLOSZ-WDSKDSINSA-N 0.000 description 1
- SOEATRRYCIPEHA-BQBZGAKWSA-N Gly-Glu-Glu Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O SOEATRRYCIPEHA-BQBZGAKWSA-N 0.000 description 1
- XMPXVJIDADUOQB-RCOVLWMOSA-N Gly-Gly-Ile Chemical compound CC[C@H](C)[C@@H](C([O-])=O)NC(=O)CNC(=O)C[NH3+] XMPXVJIDADUOQB-RCOVLWMOSA-N 0.000 description 1
- YIWFXZNIBQBFHR-LURJTMIESA-N Gly-His Chemical compound [NH3+]CC(=O)N[C@H](C([O-])=O)CC1=CN=CN1 YIWFXZNIBQBFHR-LURJTMIESA-N 0.000 description 1
- LHYJCVCQPWRMKZ-WEDXCCLWSA-N Gly-Leu-Thr Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LHYJCVCQPWRMKZ-WEDXCCLWSA-N 0.000 description 1
- BBTCXWTXOXUNFX-IUCAKERBSA-N Gly-Met-Arg Chemical compound CSCC[C@H](NC(=O)CN)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O BBTCXWTXOXUNFX-IUCAKERBSA-N 0.000 description 1
- SJLKKOZFHSJJAW-YUMQZZPRSA-N Gly-Met-Glu Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)CN SJLKKOZFHSJJAW-YUMQZZPRSA-N 0.000 description 1
- HHRODZSXDXMUHS-LURJTMIESA-N Gly-Met-Gly Chemical compound CSCC[C@H](NC(=O)C[NH3+])C(=O)NCC([O-])=O HHRODZSXDXMUHS-LURJTMIESA-N 0.000 description 1
- QGDOOCIPHSSADO-STQMWFEESA-N Gly-Met-Phe Chemical compound [H]NCC(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O QGDOOCIPHSSADO-STQMWFEESA-N 0.000 description 1
- JJGBXTYGTKWGAT-YUMQZZPRSA-N Gly-Pro-Glu Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O JJGBXTYGTKWGAT-YUMQZZPRSA-N 0.000 description 1
- OOCFXNOVSLSHAB-IUCAKERBSA-N Gly-Pro-Pro Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 OOCFXNOVSLSHAB-IUCAKERBSA-N 0.000 description 1
- HAOUOFNNJJLVNS-BQBZGAKWSA-N Gly-Pro-Ser Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O HAOUOFNNJJLVNS-BQBZGAKWSA-N 0.000 description 1
- OLIFSFOFKGKIRH-WUJLRWPWSA-N Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CN OLIFSFOFKGKIRH-WUJLRWPWSA-N 0.000 description 1
- ZZWUYQXMIFTIIY-WEDXCCLWSA-N Gly-Thr-Leu Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O ZZWUYQXMIFTIIY-WEDXCCLWSA-N 0.000 description 1
- LLWQVJNHMYBLLK-CDMKHQONSA-N Gly-Thr-Phe Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O LLWQVJNHMYBLLK-CDMKHQONSA-N 0.000 description 1
- CUVBTVWFVIIDOC-YEPSODPASA-N Gly-Thr-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)CN CUVBTVWFVIIDOC-YEPSODPASA-N 0.000 description 1
- AJHCSUXXECOXOY-NSHDSACASA-N Gly-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)CN)C(O)=O)=CNC2=C1 AJHCSUXXECOXOY-NSHDSACASA-N 0.000 description 1
- SYOJVRNQCXYEOV-XVKPBYJWSA-N Gly-Val-Glu Chemical compound [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O SYOJVRNQCXYEOV-XVKPBYJWSA-N 0.000 description 1
- RYAOJUMWLWUGNW-QMMMGPOBSA-N Gly-Val-Gly Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O RYAOJUMWLWUGNW-QMMMGPOBSA-N 0.000 description 1
- BAYQNCWLXIDLHX-ONGXEEELSA-N Gly-Val-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)CN BAYQNCWLXIDLHX-ONGXEEELSA-N 0.000 description 1
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 206010018498 Goitre Diseases 0.000 description 1
- 208000003807 Graves Disease Diseases 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- RVKIPWVMZANZLI-UHFFFAOYSA-N H-Lys-Trp-OH Natural products C1=CC=C2C(CC(NC(=O)C(N)CCCCN)C(O)=O)=CNC2=C1 RVKIPWVMZANZLI-UHFFFAOYSA-N 0.000 description 1
- 101150009006 HIS3 gene Proteins 0.000 description 1
- 102100028976 HLA class I histocompatibility antigen, B alpha chain Human genes 0.000 description 1
- 108010058607 HLA-B Antigens Proteins 0.000 description 1
- WSDOHRLQDGAOGU-BQBZGAKWSA-N His-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CN=CN1 WSDOHRLQDGAOGU-BQBZGAKWSA-N 0.000 description 1
- UOAVQQRILDGZEN-SRVKXCTJSA-N His-Asp-Leu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O UOAVQQRILDGZEN-SRVKXCTJSA-N 0.000 description 1
- RBOOOLVEKJHUNA-CIUDSAMLSA-N His-Cys-Asn Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(O)=O RBOOOLVEKJHUNA-CIUDSAMLSA-N 0.000 description 1
- AKAPKBNIVNPIPO-KKUMJFAQSA-N His-His-Lys Chemical compound C([C@@H](C(=O)N[C@@H](CCCCN)C(O)=O)NC(=O)[C@@H](N)CC=1NC=NC=1)C1=CN=CN1 AKAPKBNIVNPIPO-KKUMJFAQSA-N 0.000 description 1
- VTZYMXGGXOFBMX-DJFWLOJKSA-N His-Ile-Asp Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O VTZYMXGGXOFBMX-DJFWLOJKSA-N 0.000 description 1
- QMUHTRISZMFKAY-MXAVVETBSA-N His-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC1=CN=CN1)N QMUHTRISZMFKAY-MXAVVETBSA-N 0.000 description 1
- BKOVCRUIXDIWFV-IXOXFDKPSA-N His-Lys-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC1=CN=CN1 BKOVCRUIXDIWFV-IXOXFDKPSA-N 0.000 description 1
- SOYCWSKCUVDLMC-AVGNSLFASA-N His-Pro-Arg Chemical compound N[C@@H](Cc1cnc[nH]1)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCNC(=N)N)C(=O)O SOYCWSKCUVDLMC-AVGNSLFASA-N 0.000 description 1
- 101000974934 Homo sapiens Cyclic AMP-dependent transcription factor ATF-2 Proteins 0.000 description 1
- 101001023007 Homo sapiens Farnesyl pyrophosphate synthase Proteins 0.000 description 1
- 101000608769 Homo sapiens Galectin-8 Proteins 0.000 description 1
- 101000997829 Homo sapiens Glial cell line-derived neurotrophic factor Proteins 0.000 description 1
- 101000628547 Homo sapiens Metalloreductase STEAP1 Proteins 0.000 description 1
- 101001110286 Homo sapiens Ras-related C3 botulinum toxin substrate 1 Proteins 0.000 description 1
- 101000951145 Homo sapiens Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Proteins 0.000 description 1
- 101000904868 Homo sapiens Transcriptional regulator ATRX Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 1
- 206010020850 Hyperthyroidism Diseases 0.000 description 1
- 101000829171 Hypocrea virens (strain Gv29-8 / FGSC 10586) Effector TSP1 Proteins 0.000 description 1
- QYZYJFXHXYUZMZ-UGYAYLCHSA-N Ile-Asn-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)N)C(=O)O)N QYZYJFXHXYUZMZ-UGYAYLCHSA-N 0.000 description 1
- XENGULNPUDGALZ-ZPFDUUQYSA-N Ile-Asn-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)O)N XENGULNPUDGALZ-ZPFDUUQYSA-N 0.000 description 1
- LOXMWQOKYBGCHF-JBDRJPRFSA-N Ile-Cys-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(O)=O LOXMWQOKYBGCHF-JBDRJPRFSA-N 0.000 description 1
- LDRALPZEVHVXEK-KBIXCLLPSA-N Ile-Cys-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N LDRALPZEVHVXEK-KBIXCLLPSA-N 0.000 description 1
- JDAWAWXGAUZPNJ-ZPFDUUQYSA-N Ile-Glu-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N JDAWAWXGAUZPNJ-ZPFDUUQYSA-N 0.000 description 1
- CSQNHSGHAPRGPQ-YTFOTSKYSA-N Ile-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)O)N CSQNHSGHAPRGPQ-YTFOTSKYSA-N 0.000 description 1
- PFPUFNLHBXKPHY-HTFCKZLJSA-N Ile-Ile-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)O)N PFPUFNLHBXKPHY-HTFCKZLJSA-N 0.000 description 1
- UWBDLNOCIDGPQE-GUBZILKMSA-N Ile-Lys Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN UWBDLNOCIDGPQE-GUBZILKMSA-N 0.000 description 1
- AKOYRLRUFBZOSP-BJDJZHNGSA-N Ile-Lys-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)O)N AKOYRLRUFBZOSP-BJDJZHNGSA-N 0.000 description 1
- CKRFDMPBSWYOBT-PPCPHDFISA-N Ile-Lys-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N CKRFDMPBSWYOBT-PPCPHDFISA-N 0.000 description 1
- MSASLZGZQAXVFP-PEDHHIEDSA-N Ile-Met-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)N MSASLZGZQAXVFP-PEDHHIEDSA-N 0.000 description 1
- IIWQTXMUALXGOV-PCBIJLKTSA-N Ile-Phe-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(=O)O)C(=O)O)N IIWQTXMUALXGOV-PCBIJLKTSA-N 0.000 description 1
- FQYQMFCIJNWDQZ-CYDGBPFRSA-N Ile-Pro-Pro Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 FQYQMFCIJNWDQZ-CYDGBPFRSA-N 0.000 description 1
- JZNVOBUNTWNZPW-GHCJXIJMSA-N Ile-Ser-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)O)N JZNVOBUNTWNZPW-GHCJXIJMSA-N 0.000 description 1
- PXKACEXYLPBMAD-JBDRJPRFSA-N Ile-Ser-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PXKACEXYLPBMAD-JBDRJPRFSA-N 0.000 description 1
- SAEWJTCJQVZQNZ-IUKAMOBKSA-N Ile-Thr-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N SAEWJTCJQVZQNZ-IUKAMOBKSA-N 0.000 description 1
- RKQAYOWLSFLJEE-SVSWQMSJSA-N Ile-Thr-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)O)N RKQAYOWLSFLJEE-SVSWQMSJSA-N 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- HGCNKOLVKRAVHD-UHFFFAOYSA-N L-Met-L-Phe Natural products CSCCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 HGCNKOLVKRAVHD-UHFFFAOYSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- SENJXOPIZNYLHU-UHFFFAOYSA-N L-leucyl-L-arginine Natural products CC(C)CC(N)C(=O)NC(C(O)=O)CCCN=C(N)N SENJXOPIZNYLHU-UHFFFAOYSA-N 0.000 description 1
- 241000254158 Lampyridae Species 0.000 description 1
- ZRLUISBDKUWAIZ-CIUDSAMLSA-N Leu-Ala-Asp Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC(O)=O ZRLUISBDKUWAIZ-CIUDSAMLSA-N 0.000 description 1
- KWTVLKBOQATPHJ-SRVKXCTJSA-N Leu-Ala-Lys Chemical compound C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(C)C)N KWTVLKBOQATPHJ-SRVKXCTJSA-N 0.000 description 1
- UILIPCLTHRPCRB-XUXIUFHCSA-N Leu-Arg-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(C)C)N UILIPCLTHRPCRB-XUXIUFHCSA-N 0.000 description 1
- DBVWMYGBVFCRBE-CIUDSAMLSA-N Leu-Asn-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O DBVWMYGBVFCRBE-CIUDSAMLSA-N 0.000 description 1
- POJPZSMTTMLSTG-SRVKXCTJSA-N Leu-Asn-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCCCN)C(=O)O)N POJPZSMTTMLSTG-SRVKXCTJSA-N 0.000 description 1
- RRSLQOLASISYTB-CIUDSAMLSA-N Leu-Cys-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(O)=O)C(O)=O RRSLQOLASISYTB-CIUDSAMLSA-N 0.000 description 1
- RVVBWTWPNFDYBE-SRVKXCTJSA-N Leu-Glu-Arg Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O RVVBWTWPNFDYBE-SRVKXCTJSA-N 0.000 description 1
- WIDZHJTYKYBLSR-DCAQKATOSA-N Leu-Glu-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O WIDZHJTYKYBLSR-DCAQKATOSA-N 0.000 description 1
- KEVYYIMVELOXCT-KBPBESRZSA-N Leu-Gly-Phe Chemical compound CC(C)C[C@H]([NH3+])C(=O)NCC(=O)N[C@H](C([O-])=O)CC1=CC=CC=C1 KEVYYIMVELOXCT-KBPBESRZSA-N 0.000 description 1
- POZULHZYLPGXMR-ONGXEEELSA-N Leu-Gly-Val Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O POZULHZYLPGXMR-ONGXEEELSA-N 0.000 description 1
- AVEGDIAXTDVBJS-XUXIUFHCSA-N Leu-Ile-Arg Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O AVEGDIAXTDVBJS-XUXIUFHCSA-N 0.000 description 1
- SEMUSFOBZGKBGW-YTFOTSKYSA-N Leu-Ile-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O SEMUSFOBZGKBGW-YTFOTSKYSA-N 0.000 description 1
- DNDWZFHLZVYOGF-KKUMJFAQSA-N Leu-Leu-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O DNDWZFHLZVYOGF-KKUMJFAQSA-N 0.000 description 1
- KPYAOIVPJKPIOU-KKUMJFAQSA-N Leu-Lys-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O KPYAOIVPJKPIOU-KKUMJFAQSA-N 0.000 description 1
- ZAVCJRJOQKIOJW-KKUMJFAQSA-N Leu-Phe-Asp Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(O)=O)C(O)=O)CC1=CC=CC=C1 ZAVCJRJOQKIOJW-KKUMJFAQSA-N 0.000 description 1
- UCBPDSYUVAAHCD-UWVGGRQHSA-N Leu-Pro-Gly Chemical compound CC(C)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O UCBPDSYUVAAHCD-UWVGGRQHSA-N 0.000 description 1
- XOWMDXHFSBCAKQ-SRVKXCTJSA-N Leu-Ser-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC(C)C XOWMDXHFSBCAKQ-SRVKXCTJSA-N 0.000 description 1
- HWMQRQIFVGEAPH-XIRDDKMYSA-N Leu-Ser-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(C)C)C(O)=O)=CNC2=C1 HWMQRQIFVGEAPH-XIRDDKMYSA-N 0.000 description 1
- LRKCBIUDWAXNEG-CSMHCCOUSA-N Leu-Thr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LRKCBIUDWAXNEG-CSMHCCOUSA-N 0.000 description 1
- QWWPYKKLXWOITQ-VOAKCMCISA-N Leu-Thr-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CC(C)C QWWPYKKLXWOITQ-VOAKCMCISA-N 0.000 description 1
- VUBIPAHVHMZHCM-KKUMJFAQSA-N Leu-Tyr-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CO)C(O)=O)CC1=CC=C(O)C=C1 VUBIPAHVHMZHCM-KKUMJFAQSA-N 0.000 description 1
- AIMGJYMCTAABEN-GVXVVHGQSA-N Leu-Val-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O AIMGJYMCTAABEN-GVXVVHGQSA-N 0.000 description 1
- AAKRWBIIGKPOKQ-ONGXEEELSA-N Leu-Val-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O AAKRWBIIGKPOKQ-ONGXEEELSA-N 0.000 description 1
- 108010006444 Leucine-Rich Repeat Proteins Proteins 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- MPGHETGWWWUHPY-CIUDSAMLSA-N Lys-Ala-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN MPGHETGWWWUHPY-CIUDSAMLSA-N 0.000 description 1
- YNNPKXBBRZVIRX-IHRRRGAJSA-N Lys-Arg-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(O)=O YNNPKXBBRZVIRX-IHRRRGAJSA-N 0.000 description 1
- JPNRPAJITHRXRH-BQBZGAKWSA-N Lys-Asn Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CC(N)=O JPNRPAJITHRXRH-BQBZGAKWSA-N 0.000 description 1
- HQVDJTYKCMIWJP-YUMQZZPRSA-N Lys-Asn-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O HQVDJTYKCMIWJP-YUMQZZPRSA-N 0.000 description 1
- NCTDKZKNBDZDOL-GARJFASQSA-N Lys-Asn-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCCCN)N)C(=O)O NCTDKZKNBDZDOL-GARJFASQSA-N 0.000 description 1
- UGTZHPSKYRIGRJ-YUMQZZPRSA-N Lys-Glu Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CCC(O)=O UGTZHPSKYRIGRJ-YUMQZZPRSA-N 0.000 description 1
- GJJQCBVRWDGLMQ-GUBZILKMSA-N Lys-Glu-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O GJJQCBVRWDGLMQ-GUBZILKMSA-N 0.000 description 1
- ISHNZELVUVPCHY-ZETCQYMHSA-N Lys-Gly-Gly Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)NCC(O)=O ISHNZELVUVPCHY-ZETCQYMHSA-N 0.000 description 1
- QOJDBRUCOXQSSK-AJNGGQMLSA-N Lys-Ile-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(O)=O QOJDBRUCOXQSSK-AJNGGQMLSA-N 0.000 description 1
- PRSBSVAVOQOAMI-BJDJZHNGSA-N Lys-Ile-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCCCN PRSBSVAVOQOAMI-BJDJZHNGSA-N 0.000 description 1
- MUXNCRWTWBMNHX-SRVKXCTJSA-N Lys-Leu-Asp Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O MUXNCRWTWBMNHX-SRVKXCTJSA-N 0.000 description 1
- XIZQPFCRXLUNMK-BZSNNMDCSA-N Lys-Leu-Phe Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](CCCCN)N XIZQPFCRXLUNMK-BZSNNMDCSA-N 0.000 description 1
- URGPVYGVWLIRGT-DCAQKATOSA-N Lys-Met-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(O)=O URGPVYGVWLIRGT-DCAQKATOSA-N 0.000 description 1
- WWEWGPOLIJXGNX-XUXIUFHCSA-N Lys-Met-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)N WWEWGPOLIJXGNX-XUXIUFHCSA-N 0.000 description 1
- WLXGMVVHTIUPHE-ULQDDVLXSA-N Lys-Phe-Val Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(O)=O WLXGMVVHTIUPHE-ULQDDVLXSA-N 0.000 description 1
- SQXZLVXQXWILKW-KKUMJFAQSA-N Lys-Ser-Phe Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O SQXZLVXQXWILKW-KKUMJFAQSA-N 0.000 description 1
- MIFFFXHMAHFACR-KATARQTJSA-N Lys-Ser-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCCN MIFFFXHMAHFACR-KATARQTJSA-N 0.000 description 1
- TVOOGUNBIWAURO-KATARQTJSA-N Lys-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCCCN)N)O TVOOGUNBIWAURO-KATARQTJSA-N 0.000 description 1
- BIWVMACFGZFIEB-VFAJRCTISA-N Lys-Trp-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CCCCN)N)O BIWVMACFGZFIEB-VFAJRCTISA-N 0.000 description 1
- MDDUIRLQCYVRDO-NHCYSSNCSA-N Lys-Val-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN MDDUIRLQCYVRDO-NHCYSSNCSA-N 0.000 description 1
- 101150028955 MBP gene Proteins 0.000 description 1
- 241001446467 Mama Species 0.000 description 1
- 208000035346 Margins of Excision Diseases 0.000 description 1
- 108091027974 Mature messenger RNA Proteins 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- NKDSBBBPGIVWEI-RCWTZXSCSA-N Met-Arg-Thr Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O NKDSBBBPGIVWEI-RCWTZXSCSA-N 0.000 description 1
- BQVJARUIXRXDKN-DCAQKATOSA-N Met-Asn-His Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CC1=CNC=N1 BQVJARUIXRXDKN-DCAQKATOSA-N 0.000 description 1
- GPAHWYRSHCKICP-GUBZILKMSA-N Met-Glu-Glu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O GPAHWYRSHCKICP-GUBZILKMSA-N 0.000 description 1
- QXOHLNCNYLGICT-YFKPBYRVSA-N Met-Gly Chemical compound CSCC[C@H](N)C(=O)NCC(O)=O QXOHLNCNYLGICT-YFKPBYRVSA-N 0.000 description 1
- 108010072489 Met-Ile-Phe-Leu Proteins 0.000 description 1
- NHXXGBXJTLRGJI-GUBZILKMSA-N Met-Pro-Ser Chemical compound [H]N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O NHXXGBXJTLRGJI-GUBZILKMSA-N 0.000 description 1
- LXCSZPUQKMTXNW-BQBZGAKWSA-N Met-Ser-Gly Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O LXCSZPUQKMTXNW-BQBZGAKWSA-N 0.000 description 1
- JHVNNUIQXOGAHI-KJEVXHAQSA-N Met-Tyr-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CCSC)N)O JHVNNUIQXOGAHI-KJEVXHAQSA-N 0.000 description 1
- 102100026712 Metalloreductase STEAP1 Human genes 0.000 description 1
- 206010050513 Metastatic renal cell carcinoma Diseases 0.000 description 1
- ZOKXTWBITQBERF-AKLPVKDBSA-N Molybdenum Mo-99 Chemical compound [99Mo] ZOKXTWBITQBERF-AKLPVKDBSA-N 0.000 description 1
- 208000002231 Muscle Neoplasms Diseases 0.000 description 1
- PKFBJSDMCRJYDC-GEZSXCAASA-N N-acetyl-s-geranylgeranyl-l-cysteine Chemical compound CC(C)=CCC\C(C)=C\CC\C(C)=C\CC\C(C)=C\CSC[C@@H](C(O)=O)NC(C)=O PKFBJSDMCRJYDC-GEZSXCAASA-N 0.000 description 1
- AJHCSUXXECOXOY-UHFFFAOYSA-N N-glycyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)CN)C(O)=O)=CNC2=C1 AJHCSUXXECOXOY-UHFFFAOYSA-N 0.000 description 1
- 108010087066 N2-tryptophyllysine Proteins 0.000 description 1
- 206010029113 Neovascularisation Diseases 0.000 description 1
- 102000007999 Nuclear Proteins Human genes 0.000 description 1
- 108010089610 Nuclear Proteins Proteins 0.000 description 1
- 240000008881 Oenanthe javanica Species 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 101150102573 PCR1 gene Proteins 0.000 description 1
- 102000000470 PDZ domains Human genes 0.000 description 1
- 108050008994 PDZ domains Proteins 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- HXSUFWQYLPKEHF-IHRRRGAJSA-N Phe-Asn-Arg Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N HXSUFWQYLPKEHF-IHRRRGAJSA-N 0.000 description 1
- JWQWPTLEOFNCGX-AVGNSLFASA-N Phe-Glu-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 JWQWPTLEOFNCGX-AVGNSLFASA-N 0.000 description 1
- BIYWZVCPZIFGPY-QWRGUYRKSA-N Phe-Gly-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](CO)C(O)=O BIYWZVCPZIFGPY-QWRGUYRKSA-N 0.000 description 1
- MYQCCQSMKNCNKY-KKUMJFAQSA-N Phe-His-Ser Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)N[C@@H](CO)C(=O)O)N MYQCCQSMKNCNKY-KKUMJFAQSA-N 0.000 description 1
- WEMYTDDMDBLPMI-DKIMLUQUSA-N Phe-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N WEMYTDDMDBLPMI-DKIMLUQUSA-N 0.000 description 1
- RFCVXVPWSPOMFJ-STQMWFEESA-N Phe-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 RFCVXVPWSPOMFJ-STQMWFEESA-N 0.000 description 1
- KDYPMIZMXDECSU-JYJNAYRXSA-N Phe-Leu-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 KDYPMIZMXDECSU-JYJNAYRXSA-N 0.000 description 1
- KNYPNEYICHHLQL-ACRUOGEOSA-N Phe-Leu-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 KNYPNEYICHHLQL-ACRUOGEOSA-N 0.000 description 1
- INHMISZWLJZQGH-ULQDDVLXSA-N Phe-Leu-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 INHMISZWLJZQGH-ULQDDVLXSA-N 0.000 description 1
- DOXQMJCSSYZSNM-BZSNNMDCSA-N Phe-Lys-Leu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O DOXQMJCSSYZSNM-BZSNNMDCSA-N 0.000 description 1
- XZQYIJALMGEUJD-OEAJRASXSA-N Phe-Lys-Thr Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XZQYIJALMGEUJD-OEAJRASXSA-N 0.000 description 1
- GPLWGAYGROGDEN-BZSNNMDCSA-N Phe-Phe-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O GPLWGAYGROGDEN-BZSNNMDCSA-N 0.000 description 1
- NJJBATPLUQHRBM-IHRRRGAJSA-N Phe-Pro-Ser Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CC2=CC=CC=C2)N)C(=O)N[C@@H](CO)C(=O)O NJJBATPLUQHRBM-IHRRRGAJSA-N 0.000 description 1
- XBCOOBCTVMMQSC-BVSLBCMMSA-N Phe-Val-Trp Chemical compound C([C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(O)=O)C1=CC=CC=C1 XBCOOBCTVMMQSC-BVSLBCMMSA-N 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- FKUYMLZIRPABFK-UHFFFAOYSA-N Plastoquinone 9 Natural products CC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCC1=CC(=O)C(C)=C(C)C1=O FKUYMLZIRPABFK-UHFFFAOYSA-N 0.000 description 1
- 102100025067 Potassium voltage-gated channel subfamily H member 4 Human genes 0.000 description 1
- 101710163352 Potassium voltage-gated channel subfamily H member 4 Proteins 0.000 description 1
- 101800001357 Potential peptide Proteins 0.000 description 1
- 102400000745 Potential peptide Human genes 0.000 description 1
- OBVCYFIHIIYIQF-CIUDSAMLSA-N Pro-Asn-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O OBVCYFIHIIYIQF-CIUDSAMLSA-N 0.000 description 1
- AMBLXEMWFARNNQ-DCAQKATOSA-N Pro-Asn-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@@H]1CCCN1 AMBLXEMWFARNNQ-DCAQKATOSA-N 0.000 description 1
- LHALYDBUDCWMDY-CIUDSAMLSA-N Pro-Glu-Ala Chemical compound C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CCCN1)C(O)=O LHALYDBUDCWMDY-CIUDSAMLSA-N 0.000 description 1
- MGDFPGCFVJFITQ-CIUDSAMLSA-N Pro-Glu-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O MGDFPGCFVJFITQ-CIUDSAMLSA-N 0.000 description 1
- DMKWYMWNEKIPFC-IUCAKERBSA-N Pro-Gly-Arg Chemical compound [H]N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O DMKWYMWNEKIPFC-IUCAKERBSA-N 0.000 description 1
- KLSOMAFWRISSNI-OSUNSFLBSA-N Pro-Ile-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H]1CCCN1 KLSOMAFWRISSNI-OSUNSFLBSA-N 0.000 description 1
- XQPHBAKJJJZOBX-SRVKXCTJSA-N Pro-Lys-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O XQPHBAKJJJZOBX-SRVKXCTJSA-N 0.000 description 1
- ABSSTGUCBCDKMU-UWVGGRQHSA-N Pro-Lys-Gly Chemical compound NCCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H]1CCCN1 ABSSTGUCBCDKMU-UWVGGRQHSA-N 0.000 description 1
- VGVCNKSUVSZEIE-IHRRRGAJSA-N Pro-Phe-Asn Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O VGVCNKSUVSZEIE-IHRRRGAJSA-N 0.000 description 1
- LNICFEXCAHIJOR-DCAQKATOSA-N Pro-Ser-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O LNICFEXCAHIJOR-DCAQKATOSA-N 0.000 description 1
- KWMZPPWYBVZIER-XGEHTFHBSA-N Pro-Ser-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KWMZPPWYBVZIER-XGEHTFHBSA-N 0.000 description 1
- GVUVRRPYYDHHGK-VQVTYTSYSA-N Pro-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1 GVUVRRPYYDHHGK-VQVTYTSYSA-N 0.000 description 1
- WVXQQUWOKUZIEG-VEVYYDQMSA-N Pro-Thr-Asn Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(O)=O WVXQQUWOKUZIEG-VEVYYDQMSA-N 0.000 description 1
- SNSYSBUTTJBPDG-OKZBNKHCSA-N Pro-Trp-Pro Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)N4CCC[C@@H]4C(=O)O SNSYSBUTTJBPDG-OKZBNKHCSA-N 0.000 description 1
- DYJTXTCEXMCPBF-UFYCRDLUSA-N Pro-Tyr-Phe Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)N[C@@H](CC3=CC=CC=C3)C(=O)O DYJTXTCEXMCPBF-UFYCRDLUSA-N 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 208000004965 Prostatic Intraepithelial Neoplasia Diseases 0.000 description 1
- 101710132641 Protein B7 Proteins 0.000 description 1
- 102000012515 Protein kinase domains Human genes 0.000 description 1
- 108050002122 Protein kinase domains Proteins 0.000 description 1
- 229940123573 Protein synthesis inhibitor Drugs 0.000 description 1
- 108091034057 RNA (poly(A)) Proteins 0.000 description 1
- 108020004518 RNA Probes Proteins 0.000 description 1
- 239000003391 RNA probe Substances 0.000 description 1
- 102100022122 Ras-related C3 botulinum toxin substrate 1 Human genes 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108050009454 Reduced Folate Carrier Proteins 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 101100394989 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) hisI gene Proteins 0.000 description 1
- 102100040756 Rhodopsin Human genes 0.000 description 1
- 108090000820 Rhodopsin Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 229910052772 Samarium Inorganic materials 0.000 description 1
- SSJMZMUVNKEENT-IMJSIDKUSA-N Ser-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](N)CO SSJMZMUVNKEENT-IMJSIDKUSA-N 0.000 description 1
- OBXVZEAMXFSGPU-FXQIFTODSA-N Ser-Asn-Arg Chemical compound C(C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CO)N)CN=C(N)N OBXVZEAMXFSGPU-FXQIFTODSA-N 0.000 description 1
- QPFJSHSJFIYDJZ-GHCJXIJMSA-N Ser-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CO QPFJSHSJFIYDJZ-GHCJXIJMSA-N 0.000 description 1
- BYIROAKULFFTEK-CIUDSAMLSA-N Ser-Asp-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CO BYIROAKULFFTEK-CIUDSAMLSA-N 0.000 description 1
- SMIDBHKWSYUBRZ-ACZMJKKPSA-N Ser-Glu-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O SMIDBHKWSYUBRZ-ACZMJKKPSA-N 0.000 description 1
- MIJWOJAXARLEHA-WDSKDSINSA-N Ser-Gly-Glu Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCC(O)=O MIJWOJAXARLEHA-WDSKDSINSA-N 0.000 description 1
- GZFAWAQTEYDKII-YUMQZZPRSA-N Ser-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CO GZFAWAQTEYDKII-YUMQZZPRSA-N 0.000 description 1
- YZMPDHTZJJCGEI-BQBZGAKWSA-N Ser-His Chemical compound OC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CNC=N1 YZMPDHTZJJCGEI-BQBZGAKWSA-N 0.000 description 1
- CAOYHZOWXFFAIR-CIUDSAMLSA-N Ser-His-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(O)=O CAOYHZOWXFFAIR-CIUDSAMLSA-N 0.000 description 1
- LQESNKGTTNHZPZ-GHCJXIJMSA-N Ser-Ile-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(O)=O LQESNKGTTNHZPZ-GHCJXIJMSA-N 0.000 description 1
- NLOAIFSWUUFQFR-CIUDSAMLSA-N Ser-Leu-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O NLOAIFSWUUFQFR-CIUDSAMLSA-N 0.000 description 1
- YUJLIIRMIAGMCQ-CIUDSAMLSA-N Ser-Leu-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YUJLIIRMIAGMCQ-CIUDSAMLSA-N 0.000 description 1
- IXZHZUGGKLRHJD-DCAQKATOSA-N Ser-Leu-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O IXZHZUGGKLRHJD-DCAQKATOSA-N 0.000 description 1
- SBMNPABNWKXNBJ-BQBZGAKWSA-N Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CO SBMNPABNWKXNBJ-BQBZGAKWSA-N 0.000 description 1
- GZSZPKSBVAOGIE-CIUDSAMLSA-N Ser-Lys-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O GZSZPKSBVAOGIE-CIUDSAMLSA-N 0.000 description 1
- AMRRYKHCILPAKD-FXQIFTODSA-N Ser-Met-Asn Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CO)N AMRRYKHCILPAKD-FXQIFTODSA-N 0.000 description 1
- FKYWFUYPVKLJLP-DCAQKATOSA-N Ser-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO FKYWFUYPVKLJLP-DCAQKATOSA-N 0.000 description 1
- WLJPJRGQRNCIQS-ZLUOBGJFSA-N Ser-Ser-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O WLJPJRGQRNCIQS-ZLUOBGJFSA-N 0.000 description 1
- ILZAUMFXKSIUEF-SRVKXCTJSA-N Ser-Ser-Phe Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 ILZAUMFXKSIUEF-SRVKXCTJSA-N 0.000 description 1
- BEBVVQPDSHHWQL-NRPADANISA-N Ser-Val-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O BEBVVQPDSHHWQL-NRPADANISA-N 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 102100038014 Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Human genes 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- OUUQCZGPVNCOIJ-UHFFFAOYSA-M Superoxide Chemical compound [O-][O] OUUQCZGPVNCOIJ-UHFFFAOYSA-M 0.000 description 1
- IGROJMCBGRFRGI-YTLHQDLWSA-N Thr-Ala-Ala Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O IGROJMCBGRFRGI-YTLHQDLWSA-N 0.000 description 1
- JNQZPAWOPBZGIX-RCWTZXSCSA-N Thr-Arg-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)[C@@H](C)O)CCCN=C(N)N JNQZPAWOPBZGIX-RCWTZXSCSA-N 0.000 description 1
- OJRNZRROAIAHDL-LKXGYXEUSA-N Thr-Asn-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O OJRNZRROAIAHDL-LKXGYXEUSA-N 0.000 description 1
- LMMDEZPNUTZJAY-GCJQMDKQSA-N Thr-Asp-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O LMMDEZPNUTZJAY-GCJQMDKQSA-N 0.000 description 1
- WXVIGTAUZBUDPZ-DTLFHODZSA-N Thr-His Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 WXVIGTAUZBUDPZ-DTLFHODZSA-N 0.000 description 1
- AYCQVUUPIJHJTA-IXOXFDKPSA-N Thr-His-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(O)=O AYCQVUUPIJHJTA-IXOXFDKPSA-N 0.000 description 1
- XTCNBOBTROGWMW-RWRJDSDZSA-N Thr-Ile-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H]([C@@H](C)O)N XTCNBOBTROGWMW-RWRJDSDZSA-N 0.000 description 1
- KZSYAEWQMJEGRZ-RHYQMDGZSA-N Thr-Leu-Val Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O KZSYAEWQMJEGRZ-RHYQMDGZSA-N 0.000 description 1
- XSEPSRUDSPHMPX-KATARQTJSA-N Thr-Lys-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O XSEPSRUDSPHMPX-KATARQTJSA-N 0.000 description 1
- GYUUYCIXELGTJS-MEYUZBJRSA-N Thr-Phe-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N)O GYUUYCIXELGTJS-MEYUZBJRSA-N 0.000 description 1
- VGYVVSQFSSKZRJ-OEAJRASXSA-N Thr-Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)[C@H](O)C)CC1=CC=CC=C1 VGYVVSQFSSKZRJ-OEAJRASXSA-N 0.000 description 1
- MXNAOGFNFNKUPD-JHYOHUSXSA-N Thr-Phe-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O MXNAOGFNFNKUPD-JHYOHUSXSA-N 0.000 description 1
- AHERARIZBPOMNU-KATARQTJSA-N Thr-Ser-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O AHERARIZBPOMNU-KATARQTJSA-N 0.000 description 1
- UQCNIMDPYICBTR-KYNKHSRBSA-N Thr-Thr-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O UQCNIMDPYICBTR-KYNKHSRBSA-N 0.000 description 1
- GRIUMVXCJDKVPI-IZPVPAKOSA-N Thr-Thr-Tyr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O GRIUMVXCJDKVPI-IZPVPAKOSA-N 0.000 description 1
- JNKAYADBODLPMQ-HSHDSVGOSA-N Thr-Trp-Val Chemical compound C1=CC=C2C(C[C@@H](C(=O)N[C@@H](C(C)C)C(O)=O)NC(=O)[C@@H](N)[C@@H](C)O)=CNC2=C1 JNKAYADBODLPMQ-HSHDSVGOSA-N 0.000 description 1
- WCRFXRIWBFRZBR-GGVZMXCHSA-N Thr-Tyr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 WCRFXRIWBFRZBR-GGVZMXCHSA-N 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 102100023931 Transcriptional regulator ATRX Human genes 0.000 description 1
- PEEAINPHPNDNGE-JQWIXIFHSA-N Trp-Asp Chemical group C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(O)=O)=CNC2=C1 PEEAINPHPNDNGE-JQWIXIFHSA-N 0.000 description 1
- OKAMOYTUQMIFJO-JBACZVJFSA-N Trp-Glu-Phe Chemical compound C([C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)N)C(O)=O)C1=CC=CC=C1 OKAMOYTUQMIFJO-JBACZVJFSA-N 0.000 description 1
- GQHAIUPYZPTADF-FDARSICLSA-N Trp-Ile-Arg Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)=CNC2=C1 GQHAIUPYZPTADF-FDARSICLSA-N 0.000 description 1
- DXYQIGZZWYBXSD-JSGCOSHPSA-N Trp-Pro Chemical compound O=C([C@H](CC=1C2=CC=CC=C2NC=1)N)N1CCC[C@H]1C(O)=O DXYQIGZZWYBXSD-JSGCOSHPSA-N 0.000 description 1
- ZZDFLJFVSNQINX-HWHUXHBOSA-N Trp-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CNC3=CC=CC=C32)N)O ZZDFLJFVSNQINX-HWHUXHBOSA-N 0.000 description 1
- AKXBNSZMYAOGLS-STQMWFEESA-N Tyr-Arg-Gly Chemical compound NC(N)=NCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 AKXBNSZMYAOGLS-STQMWFEESA-N 0.000 description 1
- KDGFPPHLXCEQRN-STECZYCISA-N Tyr-Arg-Ile Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O KDGFPPHLXCEQRN-STECZYCISA-N 0.000 description 1
- LOOCQRRBKZTPKO-AVGNSLFASA-N Tyr-Glu-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 LOOCQRRBKZTPKO-AVGNSLFASA-N 0.000 description 1
- AOLHUMAVONBBEZ-STQMWFEESA-N Tyr-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 AOLHUMAVONBBEZ-STQMWFEESA-N 0.000 description 1
- QKXAEWMHAAVVGS-KKUMJFAQSA-N Tyr-Pro-Glu Chemical compound N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O QKXAEWMHAAVVGS-KKUMJFAQSA-N 0.000 description 1
- ZSXJENBJGRHKIG-UWVGGRQHSA-N Tyr-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 ZSXJENBJGRHKIG-UWVGGRQHSA-N 0.000 description 1
- LVFZXRQQQDTBQH-IRIUXVKKSA-N Tyr-Thr-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O LVFZXRQQQDTBQH-IRIUXVKKSA-N 0.000 description 1
- 101710100170 Unknown protein Proteins 0.000 description 1
- GNWUWQAVVJQREM-NHCYSSNCSA-N Val-Asn-His Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N GNWUWQAVVJQREM-NHCYSSNCSA-N 0.000 description 1
- DBOXBUDEAJVKRE-LSJOCFKGSA-N Val-Asn-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](C(C)C)C(=O)O)N DBOXBUDEAJVKRE-LSJOCFKGSA-N 0.000 description 1
- ZQGPWORGSNRQLN-NHCYSSNCSA-N Val-Asp-His Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N ZQGPWORGSNRQLN-NHCYSSNCSA-N 0.000 description 1
- PFMAFMPJJSHNDW-ZKWXMUAHSA-N Val-Cys-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(=O)N)C(=O)O)N PFMAFMPJJSHNDW-ZKWXMUAHSA-N 0.000 description 1
- LKUDRJSNRWVGMS-QSFUFRPTSA-N Val-Ile-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](C(C)C)N LKUDRJSNRWVGMS-QSFUFRPTSA-N 0.000 description 1
- VHRLUTIMTDOVCG-PEDHHIEDSA-N Val-Ile-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)NC(=O)[C@H](C(C)C)N VHRLUTIMTDOVCG-PEDHHIEDSA-N 0.000 description 1
- APEBUJBRGCMMHP-HJWJTTGWSA-N Val-Ile-Phe Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 APEBUJBRGCMMHP-HJWJTTGWSA-N 0.000 description 1
- BTWMICVCQLKKNR-DCAQKATOSA-N Val-Leu-Ser Chemical compound CC(C)[C@H]([NH3+])C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C([O-])=O BTWMICVCQLKKNR-DCAQKATOSA-N 0.000 description 1
- JKHXYJKMNSSFFL-IUCAKERBSA-N Val-Lys Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN JKHXYJKMNSSFFL-IUCAKERBSA-N 0.000 description 1
- XPKCFQZDQGVJCX-RHYQMDGZSA-N Val-Lys-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C(C)C)N)O XPKCFQZDQGVJCX-RHYQMDGZSA-N 0.000 description 1
- DLRZGNXCXUGIDG-KKHAAJSZSA-N Val-Thr-Asp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](C(C)C)N)O DLRZGNXCXUGIDG-KKHAAJSZSA-N 0.000 description 1
- JAIZPWVHPQRYOU-ZJDVBMNYSA-N Val-Thr-Thr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C(C)C)N)O JAIZPWVHPQRYOU-ZJDVBMNYSA-N 0.000 description 1
- IOUPEELXVYPCPG-UHFFFAOYSA-N Valylglycine Chemical compound CC(C)C(N)C(=O)NCC(O)=O IOUPEELXVYPCPG-UHFFFAOYSA-N 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 238000010317 ablation therapy Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 208000017733 acquired polycythemia vera Diseases 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 210000004404 adrenal cortex Anatomy 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 108010070944 alanylhistidine Proteins 0.000 description 1
- 108010017659 albumin Banks Peninsula Proteins 0.000 description 1
- UPEZCKBFRMILAV-UHFFFAOYSA-N alpha-Ecdysone Natural products C1C(O)C(O)CC2(C)C(CCC3(C(C(C(O)CCC(C)(C)O)C)CCC33O)C)C3=CC(=O)C21 UPEZCKBFRMILAV-UHFFFAOYSA-N 0.000 description 1
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 1
- 108010080146 androgen receptors Proteins 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 239000003816 antisense DNA Substances 0.000 description 1
- 230000036506 anxiety Effects 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 238000013528 artificial neural network Methods 0.000 description 1
- 108010010430 asparagine-proline-alanine Proteins 0.000 description 1
- 108010047857 aspartylglycine Proteins 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 108050002883 beta-defensin Proteins 0.000 description 1
- 102000012265 beta-defensin Human genes 0.000 description 1
- 239000003613 bile acid Substances 0.000 description 1
- 239000003124 biologic agent Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000008236 biological pathway Effects 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 108700021042 biotin binding protein Proteins 0.000 description 1
- 102000043871 biotin binding protein Human genes 0.000 description 1
- 210000003443 bladder cell Anatomy 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 230000005978 brain dysfunction Effects 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- BDOSMKKIYDKNTQ-OIOBTWANSA-N cadmium-109 Chemical compound [109Cd] BDOSMKKIYDKNTQ-OIOBTWANSA-N 0.000 description 1
- DEGAKNSWVGKMLS-UHFFFAOYSA-N calcein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC(CN(CC(O)=O)CC(O)=O)=C(O)C=C1OC1=C2C=C(CN(CC(O)=O)CC(=O)O)C(O)=C1 DEGAKNSWVGKMLS-UHFFFAOYSA-N 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 230000005907 cancer growth Effects 0.000 description 1
- 238000002619 cancer immunotherapy Methods 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- 230000004709 cell invasion Effects 0.000 description 1
- 230000010307 cell transformation Effects 0.000 description 1
- 230000003727 cerebral blood flow Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 210000000038 chest Anatomy 0.000 description 1
- 230000014107 chromosome localization Effects 0.000 description 1
- 238000003200 chromosome mapping Methods 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 238000012761 co-transfection Methods 0.000 description 1
- 235000017471 coenzyme Q10 Nutrition 0.000 description 1
- 230000005757 colony formation Effects 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- RYGMFSIKBFXOCR-AKLPVKDBSA-N copper-67 Chemical compound [67Cu] RYGMFSIKBFXOCR-AKLPVKDBSA-N 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 230000002380 cytological effect Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 230000003436 cytoskeletal effect Effects 0.000 description 1
- 210000004292 cytoskeleton Anatomy 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 238000000354 decomposition reaction Methods 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 238000003935 denaturing gradient gel electrophoresis Methods 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 229960002086 dextran Drugs 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 208000022602 disease susceptibility Diseases 0.000 description 1
- 125000002228 disulfide group Chemical group 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 238000007877 drug screening Methods 0.000 description 1
- UPEZCKBFRMILAV-JMZLNJERSA-N ecdysone Chemical compound C1[C@@H](O)[C@@H](O)C[C@]2(C)[C@@H](CC[C@@]3([C@@H]([C@@H]([C@H](O)CCC(C)(C)O)C)CC[C@]33O)C)C3=CC(=O)[C@@H]21 UPEZCKBFRMILAV-JMZLNJERSA-N 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 1
- 230000010595 endothelial cell migration Effects 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- 230000006846 excision repair Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 210000004996 female reproductive system Anatomy 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000009093 first-line therapy Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 238000004374 forensic analysis Methods 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 238000011331 genomic analysis Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 108010079547 glutamylmethionine Proteins 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 108010089804 glycyl-threonine Proteins 0.000 description 1
- YMAWOPBAYDPSLA-UHFFFAOYSA-N glycylglycine Chemical compound [NH3+]CC(=O)NCC([O-])=O YMAWOPBAYDPSLA-UHFFFAOYSA-N 0.000 description 1
- 108010084389 glycyltryptophan Proteins 0.000 description 1
- 201000003872 goiter Diseases 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 208000035392 hereditary 6 prostate cancer Diseases 0.000 description 1
- 208000032154 hereditary 8 prostate cancer Diseases 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 150000002411 histidines Chemical class 0.000 description 1
- 210000003917 human chromosome Anatomy 0.000 description 1
- 210000002758 humerus Anatomy 0.000 description 1
- 238000002169 hydrotherapy Methods 0.000 description 1
- 230000006607 hypermethylation Effects 0.000 description 1
- 230000014200 hypermethylation of CpG island Effects 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 238000009802 hysterectomy Methods 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 238000012309 immunohistochemistry technique Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 239000003999 initiator Substances 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 230000004068 intracellular signaling Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 208000030776 invasive breast carcinoma Diseases 0.000 description 1
- 229940044173 iodine-125 Drugs 0.000 description 1
- 108010031424 isoleucyl-prolyl-proline Proteins 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 238000002536 laser-induced breakdown spectroscopy Methods 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 210000004901 leucine-rich repeat Anatomy 0.000 description 1
- 108010049589 leucyl-leucyl-leucine Proteins 0.000 description 1
- 108010000761 leucylarginine Proteins 0.000 description 1
- 108010091871 leucylmethionine Proteins 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 238000012886 linear function Methods 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 238000009630 liquid culture Methods 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000007762 localization of cell Effects 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 238000013123 lung function test Methods 0.000 description 1
- 208000037841 lung tumor Diseases 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 108010005942 methionylglycine Proteins 0.000 description 1
- 108010068488 methionylphenylalanine Proteins 0.000 description 1
- XWVNOUSQIVZZJK-ZDUSSCGKSA-N methyl (2s)-6-amino-2-[(4-methylphenyl)sulfonylamino]hexanoate Chemical compound NCCCC[C@@H](C(=O)OC)NS(=O)(=O)C1=CC=C(C)C=C1 XWVNOUSQIVZZJK-ZDUSSCGKSA-N 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 210000003470 mitochondria Anatomy 0.000 description 1
- 229950009740 molybdenum mo-99 Drugs 0.000 description 1
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 102000044158 nucleic acid binding protein Human genes 0.000 description 1
- 108700020942 nucleic acid binding protein Proteins 0.000 description 1
- 238000001921 nucleic acid quantification Methods 0.000 description 1
- 230000006849 nucleocytoplasmic transport Effects 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 230000030648 nucleus localization Effects 0.000 description 1
- QYSGYZVSCZSLHT-UHFFFAOYSA-N octafluoropropane Chemical compound FC(F)(F)C(F)(F)C(F)(F)F QYSGYZVSCZSLHT-UHFFFAOYSA-N 0.000 description 1
- 201000008106 ocular cancer Diseases 0.000 description 1
- 229960002378 oftasceine Drugs 0.000 description 1
- 229940046166 oligodeoxynucleotide Drugs 0.000 description 1
- 230000000177 oncogenetic effect Effects 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000011164 ossification Effects 0.000 description 1
- 230000000010 osteolytic effect Effects 0.000 description 1
- 210000003101 oviduct Anatomy 0.000 description 1
- 125000004430 oxygen atom Chemical group O* 0.000 description 1
- 239000003002 pH adjusting agent Substances 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 239000003973 paint Substances 0.000 description 1
- 210000002990 parathyroid gland Anatomy 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 101150017854 petB gene Proteins 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 108010064486 phenylalanyl-leucyl-valine Proteins 0.000 description 1
- 108010073101 phenylalanylleucine Proteins 0.000 description 1
- XEBWQGVWTUSTLN-UHFFFAOYSA-M phenylmercury acetate Chemical compound CC(=O)O[Hg]C1=CC=CC=C1 XEBWQGVWTUSTLN-UHFFFAOYSA-M 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- FKUYMLZIRPABFK-IQSNHBBHSA-N plastoquinone-9 Chemical compound CC(C)=CCC\C(C)=C\CC\C(C)=C\CC\C(C)=C\CC\C(C)=C\CC\C(C)=C\CC\C(C)=C\CC\C(C)=C\CC\C(C)=C\CC1=CC(=O)C(C)=C(C)C1=O FKUYMLZIRPABFK-IQSNHBBHSA-N 0.000 description 1
- 208000037244 polycythemia vera Diseases 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 108010079317 prolyl-tyrosine Proteins 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 1
- 150000003180 prostaglandins Chemical class 0.000 description 1
- 210000005267 prostate cell Anatomy 0.000 description 1
- 208000021046 prostate intraepithelial neoplasia Diseases 0.000 description 1
- 238000011471 prostatectomy Methods 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 230000006916 protein interaction Effects 0.000 description 1
- 239000000007 protein synthesis inhibitor Substances 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 238000000275 quality assurance Methods 0.000 description 1
- 238000009801 radical cystectomy Methods 0.000 description 1
- 238000011472 radical prostatectomy Methods 0.000 description 1
- 238000002601 radiography Methods 0.000 description 1
- 239000011535 reaction buffer Substances 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000000306 recurrent effect Effects 0.000 description 1
- NPCOQXAVBJJZBQ-UHFFFAOYSA-N reduced coenzyme Q9 Natural products COC1=C(O)C(C)=C(CC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)C)C(O)=C1OC NPCOQXAVBJJZBQ-UHFFFAOYSA-N 0.000 description 1
- 239000013074 reference sample Substances 0.000 description 1
- 230000022986 regulation of DNA recombination Effects 0.000 description 1
- 230000033586 regulation of DNA repair Effects 0.000 description 1
- 230000022983 regulation of cell cycle Effects 0.000 description 1
- 230000016515 regulation of signal transduction Effects 0.000 description 1
- 230000037425 regulation of transcription Effects 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 102000037983 regulatory factors Human genes 0.000 description 1
- 108091008025 regulatory factors Proteins 0.000 description 1
- 208000010639 renal pelvis urothelial carcinoma Diseases 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 230000000284 resting effect Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 230000028706 ribosome biogenesis Effects 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- KZUNJOHGWZRPMI-UHFFFAOYSA-N samarium atom Chemical compound [Sm] KZUNJOHGWZRPMI-UHFFFAOYSA-N 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 210000000582 semen Anatomy 0.000 description 1
- 210000001625 seminal vesicle Anatomy 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 108010069117 seryl-lysyl-aspartic acid Proteins 0.000 description 1
- 108010071207 serylmethionine Proteins 0.000 description 1
- 230000036299 sexual function Effects 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 230000007781 signaling event Effects 0.000 description 1
- 210000003625 skull Anatomy 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- FQENQNTWSFEDLI-UHFFFAOYSA-J sodium diphosphate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])([O-])=O FQENQNTWSFEDLI-UHFFFAOYSA-J 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- 229940048086 sodium pyrophosphate Drugs 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 238000002798 spectrophotometry method Methods 0.000 description 1
- 208000037959 spinal tumor Diseases 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 125000004434 sulfur atom Chemical group 0.000 description 1
- 229910021653 sulphate ion Inorganic materials 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000004654 survival pathway Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 238000009121 systemic therapy Methods 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 235000019818 tetrasodium diphosphate Nutrition 0.000 description 1
- 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 208000021510 thyroid gland disease Diseases 0.000 description 1
- 210000003371 toe Anatomy 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 206010044412 transitional cell carcinoma Diseases 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 102000027257 transmembrane receptors Human genes 0.000 description 1
- 108091008578 transmembrane receptors Proteins 0.000 description 1
- YNJBWRMUSHSURL-UHFFFAOYSA-N trichloroacetic acid Chemical compound OC(=O)C(Cl)(Cl)Cl YNJBWRMUSHSURL-UHFFFAOYSA-N 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- 108010084932 tryptophyl-proline Proteins 0.000 description 1
- 239000000439 tumor marker Substances 0.000 description 1
- 108010051110 tyrosyl-lysine Proteins 0.000 description 1
- 229940035936 ubiquinone Drugs 0.000 description 1
- 238000009808 unilateral salpingo-oophorectomy Methods 0.000 description 1
- 210000000689 upper leg Anatomy 0.000 description 1
- 210000000626 ureter Anatomy 0.000 description 1
- 201000000334 ureter transitional cell carcinoma Diseases 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 201000010653 vesiculitis Diseases 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 239000002699 waste material Substances 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 229910052727 yttrium Inorganic materials 0.000 description 1
- VWQVUPCCIRVNHF-UHFFFAOYSA-N yttrium atom Chemical compound [Y] VWQVUPCCIRVNHF-UHFFFAOYSA-N 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0693—Tumour cells; Cancer cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/075—Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Cell Biology (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Biotechnology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Wood Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Epidemiology (AREA)
- Food Science & Technology (AREA)
- Hospice & Palliative Care (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- General Engineering & Computer Science (AREA)
Description
1
DESCRIÇÃO
"ÁCIDOS NUCLEICOS DESIGNADOS 273P4B7 E A SUA UTILIZAÇÃO NA DETEÇÃO DE CANCRO"
CAMPO DA INVENÇÃO A invenção descrita aqui refere-se a genes, designados 273P4B7 e variantes dos mesmos, expressos em certos cancros, e a métodos diagnósticos e terapêuticos e composições úteis no tratamento de cancros que expressam 273P4B7.
ANTECEDENTE DA INVENÇÃO 0 cancro é a segunda causa principal de morte humana logo a seguir à doença coronária. Em todo o mundo, milhões de pessoas morrem de cancro cada ano. Só nos Estados Unidos, como relatado pela Sociedade Americana de Cancro, o cancro causa a morte de bem mais de meio milhão de pessoas por ano, com mais de 1,2 milhões de novos casos diagnosticados anualmente. Enquanto as mortes por doença coronária têm diminuído significativamente, aquelas resultantes do cancro estão, em geral, a aumentar. No início do próximo século, prevê-se que o cancro se torne na principal causa de morte.
Em todo o mundo, vários cancros salientam-se como os mais mortíferos. Em particular, os carcinomas do pulmão, próstata, mama, cólon, pâncreas, e ovário representam as causas primárias de morte por cancro. Estes, e virtualmente todos os outros, carcinomas partilham uma característica letal comum. Com muito poucas exceções, a doença metastática de um carcinoma é fatal. Além disso, mesmo para aqueles pacientes de cancro que inicialmente sobrevivem aos seus cancros primários, a experiência comum tem mostrado que as suas vidas são dramaticamente alteradas. Muitos pacientes com cancro sofrem de forte ansiedade motivada pela consciência da possibilidade de uma recaída ou 2 insucesso do tratamento. Muitos pacientes com cancro sofrem debilitações físicas após o tratamento. Além disso, muitos pacientes com cancro sofrem uma recaída.
Em todo o mundo, o cancro da próstata é o quarto tipo de cancro mais prevalente no homem. Na América do Norte e Europa do Norte, é sem dúvida o cancro mais comum nos homens, sendo, neste grupo, a segunda causa de morte por cancro. Só nos Estados Unidos, bem mais de 30.000 homens morrem anualmente desta doença - um número só ultrapassado pelo cancro do pulmão. Apesar da magnitude destes números, não existe ainda um tratamento eficaz para o cancro da próstata metastático. A prostatectomia cirúrgica, terapêutica de radiação, terapêutica de ablação hormonal, castração cirúrgica e a quimioterapia continuam a ser as principais modalidades de tratamento. Infelizmente, estes tratamentos são ineficazes para muitos e estão frequentemente associados a consequências indesejáveis.
No que diz respeito ao diagnóstico, a falta de um marcador de tumor da próstata que possa detetar com precisão tumores localizados em fase inicial permanece uma limitação significativa no diagnóstico e tratamento desta doença. Apesar do teste do antígeno prostático específico (PSA) no soro ser uma ferramenta muito útil, porém, a sua especificidade e utilidade geral é amplamente considerada como baixa em vários aspetos importantes. Têm sido feitos avanços na identificação de marcadores específicos adicionais para o cancro da próstata pela geração de xenoenxertos de cancro da próstata que podem recapitular diferentes estádios da doença em ratinhos. Os xenoenxertos LAP (Los Angeles Cancro da Próstata) são xenoenxertos de cancro da próstata que sobreviveram à passagem em ratinhos severamente imunodeficientes combinados (SCID) e que exibiram a capacidade de mimetizar a transição de dependência de androgénio para independência de androgénio (Klein et al., 1997, Nat. Med. 3:402). Mais 3 recentemente, marcadores de cancro da próstata identificados incluem PCTA-1 (Su et al., 1996, Proc. Natl. Acad. Sei. USA 93: 7252), antigeno da membrana especifica da próstata (PSM) (Pinto et al., Clin Câncer Res 1996 2 de Setembro (9):1445-51), STEAP (Hubert, et al., Proc Natl Acad Sei USA. 1999 7 de Dezembro; 96 (25): 14523-8) e antigeno de célula estaminal da próstata (PSCA) (Reiter et al., 1998, Proc. Natl. Acad. Sei. USA 95:1735).
Embora marcadores previamente identificados tais como PSA, PSM, PCTA e PSCA tenham facilitado os esforços para diagnosticar e tratar cancro da próstata, existe a necessidade de identificar marcadores adicionais e alvos terapêuticos para a próstata e cancros relacionados de forma a melhorar ainda mais o diagnóstico e a terapêutica. 0 carcinoma de células renais (RCC) representa aproximadamente 3 por cento das malignidades adultas. Assim que os adenomas atingem um diâmetro de 2 a 3 cm, existe potencial maligno. No adulto, os dois tumores renais malignos principais são o adenocarcinoma das células renais e o carcinoma das células transicionais da pélvis renal ou ureter. A incidêcia do adenocarcinoma das células renais estima-se que represente mais de 29.000 casos nos Estados Unidos, e mais de 11.600 pacientes morreram desta doença em 1998. O carcinoma das células transicionais é menos frequente, com uma incidência de aproximadamente 500 casos por ano nos Estados Unidos. uma A cirurgia foi a terapêutica primária para o adenocarcinoma das células renais durante muitas décadas. Até recentemente, a doença metastática foi refratária a qualquer terapêutica sistémica. Com desenvolvimentos recentes nas terapêuticas sistémicas, particularmente imunoterapêuticas, o carcinoma das células renais metastático pode ser abordado agressivamente em pacientes apropriados com uma possibilidade de respostas duráveis. Não obstante, existe ainda uma necessidade para 4 terapêuticas eficazes para estes pacientes.
De todos os novos casos de cancro nos Estados Unidos, o cancro da bexiga representa aproximadamente 5 por cento em homens (quinto neoplasma mais comum) e 3 por cento em mulheres (oitavo neoplasma mais comum). A incidência está a crescer devagar, coincidente com uma população cada vez mais idosa. Em 1998, existiam 54.500 casos estimados, incluindo 39.500 em homens e 15.000 em mulheres. A incidência ajustada por idade nos Estados Unidos é 32 por 100.000 para os homens e oito por 100.000 em mulheres. A razão homens/mulheres histórica de 3:1 pode estar a diminuir relacionada com os padrões de consumo de tabaco nas mulheres. Ocorreram 11.000 mortes estimadas de cancro da bexiga em 1998 (7.800 em homens e 3.900 em mulheres). A incidência do cancro da bexiga e a mortalidade aumentam fortemente com a idade e constituirão um problema crescente à medida que a população envelhece. A maioria dos cancros de bexiga ocorre de novo na bexiga. O cancro de bexiga é tratado com uma combinação de resseção transuretral da bexiga (TUR) e quimioterapia intravesical ou imunoterapêutica. A natureza multifocal e recorrente do cancro de bexiga destaca as limitações da TUR. A maioria dos cancros invasivos dos músculos não são curados apenas pela TUR. Cistectomia radical e diversão urinária é o meio mais eficaz para eliminar o cancro mas acarreta um impacto inegável na função urinária e sexual. Continua a existir uma necessidade significativa para modalidades de tratamento que sejam benéficas para os pacientes com cancro de bexiga.
130.200 casos estimados de cancro colo-retal ocorreram em 2000 nos Estados Unidos, incluindo 93.800 casos de cancro do cólon e 36.400 de cancro retal. Os cancros colo-retais são os terceiros cancros mais comuns em homens e mulheres. As taxas de incidência diminuíram significativamente durante 1992-1996 (-2,1% por ano). A 5 investigação sugere que estas reduções têm sido devidas ao aumento da monitorização e remoção de pólipos, prevenindo a progressão dos pólipos para cancros invasivos. Estima-se que tenham ocorrido 56.300 mortes (47.700 de cancro do cólon, 8.600 de cancro retal) em 2000, representando cerca de 11% de todas as mortes por cancro nos Estados Unidos.
Atualmente, a cirurgia é a forma terapêutica mais comum para cancro coloretal, e para cancros que não se espalharam, é frequentemente curativa. A quimioterapia, ou quimioterapia mais radiação, é administrada antes ou depois da cirurgia à maioria dos pacientes cujo cancro perfurou profundamente a parede do intestino ou se espalhou para os gânglios linfáticos. Uma colostomia permanente (criação de uma abertura abdominal para a eliminação de desperdícios corporais) é ocasionalmente necessária no cancro do cólon e é pouco frequentemente necessária para o cancro retal. Continua a haver uma necessidade para modalidades de diagnóstico e tratamento eficazes para o cancro coloretal.
Estima-se que houve 164.100 novos casos de cancro do pulmão e brônquico em 2000, representando 14% de todos os diagnósticos de cancro nos Estados Unidos. A taxa de incidência de cancro do pulmão e brônquico está a diminuir significativamente nos homens, de uma taxa elevada de 86,5 por 100.000 em 1984 para 70,0 em 1996. Nos anos 90, a taxa de aumento entre mulheres começou a abrandar. Em 1996, a taxa de incidência em mulheres era de 42,3 por 100.000.
Estima-se que o cancro do pulmão e brônquico tenha causado 156.900 mortes em 2000, representando 28% de todas as mortes por cancro. Durante o período 1992-1996, a mortalidade por cancro do pulmão diminuiu significativamente entre homens (-1,7% por ano) enquanto as taxas para mulheres ainda estavam a aumentar significativamente (0,9% por ano). Desde 1987, cada ano morreram mais mulheres de cancro do pulmão do que de cancro da mama, que, durante mais de 40 anos, foi a causa 6 principal de morte por cancro em mulheres. As taxas decrescentes de incidência e mortalidade por cancro do pulmão foram provavelmente resultado das taxas decrescentes de consumo de tabaco durante os 30 anos anteriores; contudo, os padrões de consumo de tabaco decrescentes entre mulheres apresentam um atraso em relação aos dos homens. Preocupante é o facto de apesar de a redução no consumo de tabaco em adultos ter diminuído, o consumo de tabaco em jovens está de novo a aumentar.
As opções de tratamento para cancro do pulmão e brônquico são determinadas pelo tipo e estádio do cancro e incluem a cirurgia, radioterapia, e quimioterapia. Para muitos cancros localizados, a cirurgia é normalmente o tratamento de eleição: porque a doença já se espalhou normalmente na altura em que foi detetada, a radioterapia e quimioterapia são frequentemente necessárias em combinação com a cirurgia. A quimioterapia isolada ou combinada com radiação é o tratamento de eleição para cancro do pulmão de pequena células; neste regime, uma grande percentagem de pacientes sofre remissão, que, em alguns casos, é duradoura. Existe, contudo, uma necessidade permanente de abordagens de tratamento e diagnóstico eficazes para os cancros do pulmão e bronquial.
Esperava-se que ocorresse uma estimativa de 182.800 novos casos invasivos de cancro da mama entre mulheres nos Estados Unidos durante 2000. Além disso, esperava-se que fossem diagnosticados cerca de 1.400 novos casos de cancro da mama em homens em 2000. Depois de terem aumentado cerca de 4% por ano nos anos 80, as taxas de incidência do cancro da mama em mulheres estabilizaram nos anos 90 para cerca de 110,6 casos por 100.000. Só nos Estados Unidos, estima-se que ocorriam 41.200 mortes (40.800 mulheres, 400 homens) em 2000 devido a cancro da mama. O cancro da mama está em segundo lugar na lista de mortes por cancro em mulheres. De acordo com os 7 dados mais recentes, as taxas de mortalidade diminuíram significativamente durante 1992-1996 com as maiores reduções em mulheres jovens, tanto caucasianas como negras. Estas reduções foram provavelmente o resultado de deteção precoce e tratamento melhorado.
Considerando as circunstâncias médicas e as preferências do paciente, o tratamento do cancro da mama pode envolver lumpectomia (remoção local do tumor) e remoção dos gânglios linfáticos debaixo do braço; a mastectomia (remoção cirúrgica da mama) e remoção dos gânglios linfáticos debaixo do braço; radioterapia; quimioterapia; ou terapêutica hormonal. Com frequência, são utilizados dois ou mais métodos combinados. Estudos numerosos mostraram que, para doença em fase inicial, as taxas de sobrevivência a longo-prazo após a lumpectomia mais radioterapia são semelhantes às taxas de sobrevivência após mastectomia radical modificada. Avanços consideráveis em técnicas de reconstrução providenciam várias opções para a reconstrução do peito após a mastectomia. Recentemente, tal reconstrução tem sido feita ao mesmo tempo que a mastectomia. A excisão local do carcinoma ductal in situ (DCIS) com quantidades adequadas de tecido da mama circundante normal pode prevenir a reincidência local do DCIS. A radiação para a mama e/ou tamoxifeno podem reduzir a probabilidade do DCIS ocorrer no restante tecido da mama. Isto é importante porque o DCIS, se não for tratado, pode degenerar em cancro da mama invasivo. No entanto, existem efeitos secundários sérios ou sequelas a estes tratamentos. Existe, assim, uma necessidade para tratamentos do cancro da mama eficazes.
Estima-se que houve 23.100 novos casos de cancro do ovário nos Estados Unidos em 2000. Representa 4% de todos os cancros entre mulheres e está em segundo lugar na lista dos cancros ginecológicos. Durante o período 1992-1996, as taxas de incidência do cancro do ovário diminuíram significativamente. Como consequência do cancro do ovário, estimam-se 14.000 mortes em 2000. O cancro do ovário causa mais mortes do que qualquer outro cancro do sistema reprodutor feminino. A cirurgia, radioterapia, e quimioterapia são opções de tratamento para o cancro do ovário. A cirurgia normalmente inclui a remoção de um ou ambos os ovários, das trompas de falópio (salpingo-ooforectomia) , e do útero (histerectomia). Em alguns tumores muito iniciais, apenas o ovário envolvido será removido, especialmente em mulheres jovens que desejam ter filhos. Em estado avançado da doença, é feita uma tentativa para remover toda a doença intra-abdominal para potenciar o efeito da quimioterapia. Continua a existir uma necessidade importante para opções de tratamento eficazes para o cancro do ovário.
Estima-se que tenham aparecido 28.300 novos casos de cancro do pâncreas nos Estados Unidos em 2000. Ao longo dos últimos 20 anos, as taxas de cancro do pâncreas diminuíram em homens. As taxas entre mulheres permaneceram aproximadamente constantes mas podem estar a começar a diminuir. Estima-se que o cancro do pâncreas tenha causado 28.200 mortes em 2000 nos Estados Unidos. Ao longo dos últimos 20 anos, houve uma ligeira, mas significativa, redução nas taxas de mortalidade entre homens (cerca de 0,9% por ano) enquanto as taxas aumentaram ligeiramente entre mulheres. A cirurgia, radioterapia, e quimioterapia são opções de tratamento para o cancro do pâncreas. Estas opções de tratamento podem aumentar a sobrevivência e/ou aliviar sintomas em muitos pacientes mas não é provável que produzam uma cura para a maioria. Existe uma necessidade considerável para terapêuticas adicionais e opções de diagnóstico para o cancro do pâncreas.
SUMÁRIO DA INVENÇÃO A presente invenção refere-se a um gene, designado 9 273Ρ4Β7, que agora se sabe ser sobre-expresso no(s) cancro(s) listados no Quadro I. A análise de expressão Northern blot da expressão do gene 273P4B7 em tecidos normais mostra um padrão de expressão restrito em tecidos adultos. As sequências de nucleotideos (Figura 2) e aminoácidos (Figura 2, e Figura 3) de 273P4B7 são providenciadas. 0 perfil de 273P4B7 relacionado com o tecido em tecidos adultos normais, combinados com a sobre-expressão observada nos tecidos listados no Quadro I, mostra que 273P4B7 é aberrantemente sobre-expresso em, pelo menos, alguns cancros, e portanto serve como um alvo útil de diagnóstico, profilático, prognóstico, e/ou terapêutico para cancros do(s) tecido(s) tais como aqueles listados no Quadro I. A invenção providencia polinucleotídeos correspondentes ou complementares à totalidade ou parte dos genes 273P4B7, ARNm, e/ou sequências codificantes, preferencialmente sob a forma isolada, incluindo polinucleotídeos que codificam proteínas relacionadas com 273P4B7, bem como ADN, ARN, híbridos ADN/ARN, e moléculas relacionadas, e polinucleotídeos ou oligonucleotídeos que hibridam com os genes 273P4B7, ARNm, ou com os polinucleotídeos que codificam ο 273P4B7. Também se providenciam meios para isolar ADNc e os genes que codificam 273P4B7. Moléculas de ADN recombinantes contendo polinucleotídeos 273P4B7, e células transformadas ou transduzidas com tais moléculas, também são providenciadas.
Em certas modalidades, existe uma cláusula de que a sequência completa de ácido nucleico da Figura 2 não é codificada e/ou a sequência completa de aminoácidos da Figura 2 não é preparada. Em certas modalidades, a sequência completa de ácido nucleico da Figura 2 é codificada e/ou a sequência completa de aminoácidos da Figura 2 é preparada, qualquer uma das quais estão nas respetivas formas de dose unitária humanas. 10 A invenção providencia ainda métodos para detetar a presença e estatuto de polinucleotídeos e proteínas 273P4B7 em várias amostras biológicas, bem como métodos para identificar células que expressam 273P4B7. Uma modalidade típica desta invenção providencia métodos para monitorizar produtos do gene 273P4B7 num tecido ou amostra hematológica que tem, ou se suspeita que tem, alguma forma de desregulação de crescimento tal como cancro.
Além disso, a invenção compreende sequências de ácido nucleico de 273P4B7. Modalidades de uma sequência de ácido nucleico da invenção compreende uma sequência que codifica uma sequência de aminoácidos como apresentado aqui.
BREVE DESCRIÇÃO DAS FIGURAS
Figura 1. A sequência 273P4B7 SSH de 170 nucleotídeos.
Figura 2.A) A sequência de ADNc e de aminoácidos de 273P4B7 variante 1 (também designada "273P4B7 v.l" ou "273P4B7 variante 1") é mostrada na Figura 2A. A metionina de iniciação está sublinhada. A grelha de leitura aberta estende-se do ácido nucleico 95-3847 incluindo o codão de terminação. B) A sequência de ADNc e de aminoácidos de 273P4B7 variante 2 (também designada "273P4B7 v.2") é mostrada na Figura 2B. O codão de iniciação para a metionina está sublinhado. A grelha de leitura aberta estende-se do ácido nucleico 604-3987 incluindo o codão de terminação. C) 273P4B7 v.3 a v.8, variantes SNP de 273P4B7 v.l. As 273P4B7 v.3 a v.8 são variantes com a diferença de um único nucleotídeo que codificam 273P4B7 v.l. 273P4B7 v.3, v.7, e v.8 para a mesma proteína como as proteínas v.l. 273P4B7 v.4, v. 5, e v.6 diferem de 273P4B7 v.l por um aminoácido. Apesar destas variantes SNP serem mostradas separadamente, também podem ocorrer em quaisquer combinações e em qualquer das variantes transcritas listadas anteriormente nas Figuras 2A e 2B. D) A sequência de ADNc e de aminoácidos de 273P4B7 variante 11 9 (também designada "273P4B7 v.9") é mostrado na Figura 2D. 0 codão de iniciação gue codifica a metionina está sublinhado. A grelha de leitura aberta estende-se do ácido nucleico 4-3324 incluindo o codão de terminação. E) A sequência de ADNc e de aminoácidos de 273P4B7 variante 10 (também designada "273P4B7 v.10") é mostrada na Figura 2E. O codão de iniciação que codifica a metionina está sublinhado. A grelha de leitura aberta estende-se do ácido nucleico 688-1947 incluindo o codão de terminação. F) A sequência de ADNc e de aminoácidos de 273P4B7 variante 11 (também designada "273P4B7 v.ll") é mostrada na Figura 2F. O codão de iniciação que codifica a metionina está sublinhado. A grelha de leitura aberta estende-se do ácido nucleico 114-1373 incluindo o codão de terminação.
Figura 3. A) A sequência de aminoácidos de 273P4B7 v.l é mostrada na Figura 3A; tem 1250 aminoácidos. B) A sequência de aminoácidos de 273P4B7 v.2 é mostrada na Figura 3B; tem 1127 aminoácidos. C) A sequência de aminoácidos de 273P4B7 v.4 é mostrada na Figura 3C; tem 1250 aminoácidos. D) A sequência de aminoácidos de 273P4B7 v.5 é mostrada na Figura 3D; tem 1250 aminoácidos. E) A sequência de aminoácidos de 273P4B7 v.6 é mostrada na Figura 3E; tem 1250 aminoácidos. F) A sequência de aminoácidos de 273P4B7 v.9 é mostrada na Figura 3F; tem 1106 aminoácidos. G) A sequência de aminoácidos de 273P4B7 v.10 0 é mostrada na Figura 3G; tem 419 aminoácidos. Η) A sequência de aminoácidos de 273P4B7 v.ll é mostrada na Figura 3H; tem 419 aminoácidos.
Como usado aqui, uma referência para 273P4B7 inclui todas as variantes da mesma, incluindo aquelas mostradas nas Figuras 2, 3, 10, e 11, a menos que o contexto claramente indique o contrário. 12
Figura 4. Alinhamento de 273P4B7 com homólogos conhecidos. Figura 4(A) Alinhamento de 273P4B7 com proteína humana sem nome (gi|22760345) . Figura 4 (B) Alinhamento de 273P4B7 com antígeno de turmor humano BJ-HCC-15 (giI22002580). Figura 4(C) Alinhamento de 273P4B7 com proteína de ratinho (gi|27706852).
Figura 5. Perfil de hidrofobicidade de aminoácidos de 273P4B7 v.l determinado por análise de sequência de algoritmo em computador utilizando o método de Hopp e Woods (Ηορρ T.P., Woods K.R., 1981. Proc. Natl. Acad. Sei. U.S.A. 78:3824-3828) acedido no site da Protscale localizado na internet em (www.expasy.ch/cgi-bin/protscale.pl) através do sevidor de biologia molecular ExPasy.
Figura 6. Perfil de hidropaticidade de aminoácidos de 273P4B7 v.l determinado por análise de sequência de algoritmo em computador utilizando o método de Kyte e Doolittle (Kyte J., Doolittle R.F., 1982. J. Mol. Biol. 157:105-132) acedido no site da Protscale localizado na internet em (www.expasy.ch/cgi-bin/protscale.pl) através do sevidor de biologia molecular ExPasy.
Figura 7. Perfil de percentagem de resíduos de aminoácidos acessíveis de 273P4B7 v.l determinado por análise de sequência de algoritmo em computador utilizando o método de Janin (Janin J.,1979 Nature 277:491-492) acedido no site da Protscale localizado na internet em (www.expasy,ch/cgi-bin/protscale.pl) através do sevidor de biologia molecular ExPasy.
Figura 8. Perfil de flexibilidade média de aminoácido de 273P4B7 v.l determinado por análise de sequência de algoritmo em computador utilizando o método de Bhaskaran e Ponnuswamy (Bhaskaran R., and Ponnuswamy P.K., 1988. Int. J. Pept. Protein Res. 32:242-255) acedido no site da Protscale localizado na internet em (www.expasy.ch/cgi-bin/ protscale.pl) através do sevidor de biologia molecular ExPasy. 13
Figura 9. Perfil de aminoácidos de volta beta de 273P4B7 variante 1 determinado por análise de sequência de algoritmo em computador utilizando o método de Deleage e Roux (Deleage, G., Roux B. 1987 Protein Engineering 1:289-294) acedido no site da Protscale localizado na internet em (www.expasy.chlcgi-bin/protscale.pl) através do sevidor de biologia molecular ExPasy.
Figura 10. Estruturas de variantes transcritas de 273P4B07. A variante 273P4B07 v.2 foi identificada como uma variante transcrita de 273P4B07 v.l. A variante 273P4B07 v.2 estendia o exão 1 por 22 bp quando comparada com v.l e adicionava um exão entre os exões 1 e 2 da variante v.l. As variantes v.9, v.10 e v.ll eram parte do último exão de v.l ou v.2. Caudas poli A e SNP não são mostradas aqui. Os números em "( )" debaixo das caixas correspondem àqueles de 273P4B07 v.l. Os comprimentos dos intrões e exões não são proporcionais.
Figura 11. Alinhamento esquemático de variantes proteicas de 273P4B07. As variantes proteicas correspondem a variantes de nucleotídeos. Variantes de nucleotideos 273P4B07 v.3, v.7, e v.8 codificava a mesma proteína que v.l. A variante v.2 codificava uma proteína que era 123 aminoácidos mais curta que v.l. A variante de nucleotídeo 273P4B07 v.2 era uma variante transcrita de v.l, como mostrado na Figura 10. As variantes v.9 e v.10 eram mais curtas e tinham alguns aminoácidos diferentes quando comparadas com v.l nas posições correspondentes mostradas na figura. A variante v.ll era a mesma que a parte terminal C de v.l e diferente de v.10 por um aminoácido na posição 158. SNP em v.l também podia aparecer em v.2. Diferenças de um único aminoácido foram indicadas em cima das caixas. As caixas negras representam a mesma sequência que 273P4B07 v.l. Os números debaixo da caixa correspondem a 273P4807 v.l.
Figura 12. Alinhamento esquemático de variantes SNP de 14 273Ρ4Β07. Variantes 273P4B07 v.3 a v.8 eram variantes com diferenças de um único nucleotideo como comparada com a variante v.l (ORF:29-1858) . Apesar destas variantes SNP terem sido mostradas separadamente, também poderiam ocorrer em quaisquer combinações e em quaisquer variantes transcritas que continham os pares de base, tais como v.2 mostrada na Figura 10. Os números correspondem àqueles de 273P4B07 v.l. A caixa negra mostra a mesma sequência que 273P4B07 v.l. As SNP estão indicadas em cima na caixa.
Figura 13. Estrutura secundária e previsão de domínios transmembranares para a proteína 273P4B7 variante 1. Figura 13A: A estrutura secundária da proteína 273P4B7 variante 1 (Figura 13A) (SEQ. ID N.° 134) foi prevista utilizando o método HNN - Rede Neural Hierárquica (NPS@: Análise de Sequência Proteica em Rede TIBS 2000 Março Volume 25, N.° 3 [291]: 147-150 Combet C., Blanchet C., Geourjon C. e Deléage G., http://pbil.ibcp.ibcp-fr/cgi-bin/npsa_auto-mat.pl?page=npsa_nn.html), acedida a partir do servidor de biologia molecular ExPasy localizado na internet em (www.expasy.ch/tools/). Este método prevê a presença e localização de hélices alfa, cadeias estendidas, e espirais aleatórias da sequência porteica primária. A percentagem de proteína numa dada estrutura secundária também é listada. Figura 13B: Representação esquemática da probabilidade de existência de regiões transmembranares de 273P4B7 variante 1 baseada no algoritmo TMpred de Hofmann e Stoffel que utiliza TMBASE (K. Hofmann, W. Stoffel. TMBASE - A database of membrane spanning protein segments Biol. Chem. Hoppe-Seyler 374:166, 1993). Figura 13C: Representação esquemática da probabilidade de existência de regiões transmembranares de 273P4B7 variante 1, baseada no algoritmo TMHMM de Sonnhammer, von Heijne, e Krogh (Erik L.L. Sonnhammer, Gunnar von Heijne, e Anders Krogh: A hidden Markov model for predicting transmembrane helices in protein sequences. Em Proc. of 6a Conferência Internacional 15 em Intelligent Systems for Molecular Biology, páginas 175-182 Editores J. Glasgow, T. Littlejohn, F. Major, R. Lathrop, D. Sankoff, e C. Sensen Menlo Park, CA: AAAI Press, 1998). Os algoritmos TMpred e TMHMM são acedidos a partir do servidor de biologia molecular ExPasy localizado na internet em (www.expasy.ch/tools/).
Figura 14. Expressão de 273P4B7 por RT-PCR. A primeira cadeia de ADNc foi preparada a partir de tecidos normais (bexiga, cerebro, coração, rim, fígado, pulmão, próstata, baço, músculo esguelético, testículo, pâncreas, cólon e estômago), e de grupos de espécimes de pacientes com cancro (grupo de cancro de próstata, grupo de cancro de bexiga, grupo de cancro de rim, grupo de cancro de cólon, grupo de cancro do pulmão, grupo de cancro do ovário, grupo de cancro da mama, grupo de metástases de cancro, grupo de cancro de pâncreas, grupo de xenoenxerto de cancro de próstata, metástases de próstata para nódulo linfático, grupo de cancro de osso e melanoma, grupo de cancro do colo do útero, grupo de cancro linfoma, grupo de cancro de estômago, grupo de cancro do útero, e grupo de multi-xenoenxertos). A normalização foi realizada por PCR utilizando iniciadores para actina. PCR semi-quantitativa, utilizando iniciadores para 273P4B7, foi realizada a 22, 26 e 30 ciclos de amplificação. Na imagem da (Figura 14A) do RT-PCR mostra-se o gel de agarose. Nos produtos PCR (Figura 14B) foram quantificados utilizando o programa Alphalmager. Os resultados mostram uma expressão forte de 273P4B7 no grupo de cancro de próstata, grupo de cancro de bexiga, grupo de cancro de rim, grupo de cancro de cólon, grupo de cancro do pulmão, grupo de cancro do ovário, grupo de cancro da mama, grupo de metástases de cancro, grupo de cancro de pâncreas, grupo de xenoenxerto de cancro de próstata, metástases de próstata para nódulo linfático, grupo de cancro de ossos e melanoma, grupo de cancro do colo do útero, grupo de cancro linfoma, grupo de cancro de 16 estômago, grupo de cancro do útero e grupo de multi-xenoenxertos (cancro de próstata, cancro de rim e grupo de xenoenxerto de cancro de bexiga). Em tecidos normais, 273P4B7 é predominantemente expresso em testículos e não em qualquer outro tecido normal testado.
Figura 15. Expressão de 273P4B7 em tecidos normais. Dois northern blots de tecidos múltiplos (Clontech) ambos com 2 ug de ARNm/via foram sondados com a sequência 273P4B7. São indicados de lado os padrões de tamanho em kilobases (kb). Os resultados mostram expressão de um transcrito de 273P4B7 com aproximadamente 7kb em testículos normais mas não nos outros tecidos normais testados.
Figura 16. Expressão de 273P4B7 em espécimes de pacientes com cancro de pâncreas, ovário, e testículo. 0 ARN foi extraído a partir de pâncreas normal (NPa), ovário normal (NO), testículo normal (NTe), espécime de paciente com cancro de pâncreas (Pl), espécime de paciente com cancro do ovário (P2,P3,P4), e espécime de paciente com cancro de testículo (P5,P6,P7). Northern blot com 10 ug de ARN total/via foi sondado com sequência SSH de 273P4B7. São indicados de lado os padrões de tamanho em kilobases (kb) . O transcrito de 273P4B7 foi detetado em espécimes de paciente, mas não nos tecidos normais.
Figura 17. Expressão de 273P4B7 em espécimes de pacientes com cancro de colo do útero. Figura 17 (A) : O ARN total foi extraído a partir de espécimes de pacientes com cancro de colo do útero (T1-T7), e linha de células HeLa. Northern blot com 10 ug de ARN total/via foi sondado com sequência SSH de 273P4B7. São indicados de lado os padrões de tamanho em kilobases (kb). O transcrito de 273P4B7 foi detetado em todos os espécimes de paciente testados bem como na linha de células Hela. Figura 17(B): A primeira cadeia de ADNc foi preparada a partir de um painel de espécimes de pacientes com cancro de colo do útero, colo do útero normal e linha de células do colo do útero HeLa. A 17 normalização foi realizada por PCR utilizando iniciadores para actina. PCR semi-quantitativa, utilizando iniciadores para 273P4B7, foi realizada a 26 e 30 ciclos de amplificação. As amostras foram corridas em gel de agarose, e os produtos da PCR foram quantificados utilizando o programa Alphalmager. A expressão foi registada como ausente, baixa, média ou elevada. Os resultados mostram a expressão de 273P4B7 na maioria dos tecidos com cancro de colo do útero testados.
Figura 18. Expressão de 273P4B7 em espécimes de pacientes com cancro de bexiga. A primeira cadeia de ADNc foi preparada a partir de um painel de espécimes de pacientes com cancro de bexiga, bexiga normal (N) e linhas de células de cancro de bexiga (UM-UC-3, TCCSUP, J82). A normalização foi realizada por PCR utilizando iniciadores para actina. PCR semi-quantitativa, utilizando iniciadores para 273P4B7, foi realizada a 26 e 30 ciclos de amplificação. As amostras foram corridas em gel de agarose (Figura 18(A)), e os produtos da PCR foram quantificados utilizando o programa Alphalmager (Figura 18(B)). A expressão foi registada como ausente, baixa, média ou elevada. Os resultados mostram a expressão de 273P4B7 na maioria dos tecidos com cancro de bexiga testados, mas não nos tecidos normais da bexiga.
Figura 19. Expressão de 273P4B7 em espécimes de pacientes com cancro de cólon. A primeira cadeia de ADNc foi preparada a partir de um painel de espécimes de pacientes com cancro de cólon, cólon normal, e linhas de células de cancro de cólon (LoVo, CaCo-2, SK-COl, Colo205, and T284). A normalização foi realizada por PCR utilizando iniciadores para actina. PCR semi-quantitativa, utilizando iniciadores para 273P4B7, foi realizada a 26 e 30 ciclos de amplificação. As amostras foram corridas em gel de agarose, e os produtos da PCR foram quantificados utilizando o programa Alphalmager. A expressão foi registada como 18 ausente, baixa, média ou elevada. Os resultados mostram a expressão de 273P4B7 na maioria dos tecidos com cancro de cólon testados, mas não nos tecidos de cólon normais. A expressão também foi detetada nas linhas de células LoVo, CaCo-2, SK-C01, Colo205, mas não na linha de célula T284.
Figura 20. Expressão de 273P4B7 em espécimes de pacientes com cancro do ovário. A primeira cadeia de ADNc foi preparada a partir de um painel em espécimes de pacientes com cancro do ovário, ovário normal e linhas de células de cancro do ovário (OV-1063, PA-1, SW626). A normalização foi realizada por PCR utilizando iniciadores para actina. PCR semi-quantitativa, utilizando iniciadores para 273P4B7, foi realizada a 26 e 30 ciclos de amplificação. As amostras foram corridas em gel de agarose, e os produtos da PCR foram quantificados utilizando o programa Alphalmager. A expressão foi registada como ausente, baixa, média ou elevada. Os resultados mostram a expressão de 273P4B7 na maioria dos tecidos com cancro do ovário testados bem como nas linhas de células, mas não em tecidos do ovário normais. DESCRIÇÃO DETALHADA DA INVENÇÃO Esboço das Secções I. ) Definições II. ) Polinucleotídeos de 273P4B7 II.A.) Utilizações dos Polinucleotídeos de 273P4B7 II.A.1.) Monitorização de anomalias genéticas II.A.2.) Modalidades anti-sense II.A.3.) Iniciadores e pares de iniciadores II.A.4.) Isolamento de moléculas de ácido nucleico que codificam 273P4B7 II. A.5.) Moléculas de ácido nucleico recombinantes e sistemas hospedeiro-vector III. ) Proteínas relacionadas com 273P4B7 III. A.) Expressão de proteínas relacionadas com 273P4B7 IV. ) Métodos para deteção de 273P4B7 19 V. ) Métodos para monitorizar o estatuto de genes relacionados com 273P4B7 e os seus produtos VI. ) Modalidades de diagnósticoe prognóstico de 273P4B7. VII. ) KITS/artigos de fabrico I.) Definições: A menos que definido em contrário, todos os termos de arte, notações e outros termos científicos ou terminologia utilizada aqui pretende-se que tenha os significados geralmente entendidos por aqueles habilitados na arte aos quais a invenção pertence. Em alguns casos, termos com significados geralmente entendidos são definidos aqui para clareza e/ou para referência rápida, e a inclusão de tais definições aqui não deve ser necessariamente interpretada como representando uma diferença substancial em relação ao que é geralmente entendido na arte. Muitas das técnicas e procedimentos descritos ou referenciados aqui são bem entendidos e geralmente empregues utilizando metodologia convencional por aqueles habilitados na arte, tais como, por exemplo, as metodologias amplamente utilizadas de clonagem molecular descritas em Sambrook et al., Molecular Cloning: A Laboratory Manual 2a edição (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, Nova Iorque. Como apropriado, os procedimentos envolvendo a utilização de kits e reagentes disponíveis comercialmente são geralmente realizados de acordo com os protocolos e/ou parâmetros definidos pelo fabricante, a menos que indicado em contrário.
Os termos "cancro de próstata avançado", "cancro de próstata localmente avançado", "doença avançada" e "doença localmente avançada" refere-se aos cancros de próstata que se estenderam através da cápsula da próstata, e pretende-se que incluam doença em fase C de acordo com o sistema da Associação Americana de Urologia (AUA), doença em fase Cl-C2 de acordo com o sistema de Whitmore-Jewett, e doença em fase T3 - T4 e N+ de acordo com o sistema TNM (tumor, 20 nódulo, metástases). Em geral, a cirurgia não é recomendada para pacientes com doença localmente avançada, e estes pacientes têm resultados substancialmente menos favoráveis comparados com os pacientes gue têm cancro de próstata clinicamente localizado (confinado ao órgão) . A doença localmente avançada é clinicamente identificada por evidência palpável de endurecimento para lá da fronteira lateral da próstata, ou assimetria ou endurecimento acima da base da próstata. Cancro de próstata localmente avançado é presentemente diagnosticado patologicamente seguindo prostatectomia radical se o tumor invade ou penetra a cápsula prostática, se estende na margem cirúrgica, ou invade as vesículas seminais. "Alterar o padrão de glicosilação nativo" é pretendido para fins agui gue significam eliminar uma ou mais frações de hidrato de carbono encontradas na sequência nativa de 273P4B7 (ou removendo o local de glicosilação subjacente ou eliminando a glicosilação por meios químicos e/ou enzimáticos) , e/ou adicionando um ou mais locais de glicosilação que não estão presentes na sequência nativa de 273P4B7. Além disso, a frase inclui alterações qualitativas na glicosilação das proteínas nativas, envolvendo uma alteração na natureza e proporções das várias frações de hidrato de carbonos presentes. O termo "análogo" refere-se a uma molécula que é estruturalmente semelhante ou partilha atributos semelhantes ou correspondentes com outra molécula (por exemplo, uma proteína relacionada com 273P4B7). Por exemplo, um análogo de uma proteína 273P4B7 pode estar especificamente ligada por um anticorpo ou célula T que especificamente se liga a 273P4B7. O termo "sequências otimizadas de codão" refere-se a sequências de nucleotideos que foram otimizadas para uma espécie hospedeira particular substituindo quaisquer codões tendo uma frequência de uso de menos de cerca de 20%. As 21 sequências de nucleotídeos que foram otimizadas para expressão numa dada espécie hospedeira por eliminação de sequências espúrias de poliadenilação, eliminação de sinais de splicing exão/intrão, eliminação de repetições tipo transposão e/ou otimização de conteúdo GC além de otimização de codão são referenciadas aqui como "sequências potenciadas de expressão." 0 "produto do gene" é, por vezes, referido aqui como uma proteína ou ARNm. Por exemplo, um "produto do gene da invenção' é, por vezes, referido aqui como uma "sequência de aminoácido de cancro", "proteína do cancro", "proteína de um cancro listado no Quadro I", um "cancro ARNm", "ARNm de um cancro listado no Quadro I", etc. A proteína do cancro pode ser codificada por um ácido nucleico da Figura 2. A proteína do cancro pode ser um fragmento, ou em alternativa, ser a proteína de comprimento inteiro para o fragmento codificado pelos ácidos nucleicos da Figura 2. Uma sequência de aminoácidos de cancro pode ser utilizada para determinar identidade ou semelhança de sequência. As sequências podem ser variantes alélicas que ocorrem naturalmente de uma proteína codificada por um ácido nucleico da Figura 2. As sequências podem ser variantes de sequência como se descreve ainda aqui.
Testes de "classificação de rendimento elevado" para a presença, ausência, quantificação, ou outras propriedades de ácidos nucleicos particulares são bem conhecidas daqueles habilitados na arte. Da mesma forma, testes de ligação e testes de gene repórter são bem conhecidos. Assim, por exemplo, a Patente U.S. N.° 5 559 410 revela métodos de classificação de rendimento elevado para proteínas; a Patente U.S. N.° 5 585 639 revela métodos de classificação de rendimento elevado para ligação de ácido nucleico (isto é, em coleções); enquanto as Patentes U.S. N.°s 5 576 220 e 5 541 061 revelam métodos de rendimento elevado de classificação para ligação ligando/anticorpo. 22
Além disso, os sistemas de classificação de rendimento elevado estão disponíveis comercialmente (ver, por exemplo, Amersham Biosciences, Piscataway, NJ; Zymark Corp., Hopkinton, MA; Air Technical Industries, Mentor, OH; Beckman Instruments, Inc. Full-erton, CA; Precision Systems, Inc., Natick, MA; etc.). Estes sistemas tipicamente automatizam procedimentos completos, incluindo toda a pipetagem de amostras e reagentes, dispensar de líquidos, incubações temporizadas, e leituras finais da microplaca em detetore(s) apropriados para o ensaio. Estes sistemas configuráveis providenciam rendimento elevado e início rápido bem como um elevado grau de flexibilidade e personalização. Os fabricantes de tais sistemas providenciam protocolos detalhados para vários sistemas de rendimento elevado. Assim, por exemplo, a Zymark Corp. Providenci boletins técnicos que descrevem sistemas de classificação para detetar a modulação da transcrição de gene, ligação ao ligando, e afins. 0 termo "homólogo" refere-se a uma molécula que exibe homologia com outra molécula, por ter, por exemplo, sequências de resíduos químicos que são as mesmas ou semelhantes em posições correspondentes. "Antígeno Leucocitário Humano" ou "HLA" é uma proteína do Complexo Maior de Histocompatibilidade (MHC) humano de classe I ou classe II (ver, por exemplo, Stites, et al., IMMUNOLOGY, 8a EDIÇÃO, Lange Publishing, Los Altos, CA (1994).
Os termos "hibridizar", "hibridizando", "hibridiza" e afins, utilizados no contexto de polinucleotídeos, pretende-se que se refiram a condições de hibridação convencionais, preferencialmente tais como hibridação em 50% de formamida/6XSSC/0,1% SDS/ 100 pg/ml ADNss, nas quais as temperaturas para hibridação são acima dos 37 graus °C e as temperaturas para lavagem em 0,1 XSSC/0,1 % SDS são acima dos 55 graus °C. 23
As frases "isolado" ou "biologicamente puro" referem-se a material que é substancialmente ou essencialmente livre de componentes que normalmente acompanham o material como este é encontrado no seu estado nativo. Assim, péptidos isolados de acordo com a invenção preferencialmente não contêm materiais normalmente associados com os péptidos o seu ambiente in situ. Por exemplo, diz-se que um polinucleotideo está "isolado" quando está substancialmente separado de polinucleotídeos contaminantes que correspondem ou são complementares a genes que não os genes 273P4B7 ou que codificam polipeptideos que não o produto do gene 273P4B7 ou fragmentos do mesmo. Um especialista habilitado pode rapidamente empregar procedimentos de isolamento de ácido nucleico para obter um polinucleotideo 273P4B7 isolado. Diz-se que uma proteína está "isolada," por exemplo, quando métodos físicos, mecânicos ou químicos são empregues para remover as proteínas 273P4B7 dos constituintes celulares que estão normalmente associados com a proteína. Um especialista habilitado pode rapidamente empregar métodos de purificação para obter uma proteína 273P4B7 isolada. Em alternativa, uma proteína isolada pode ser preparada por meios químicos. 0 termo "mamífero" refere-se a qualquer organismo classificado como um mamífero, incluindo ratinhos, ratazanas, coelhos, cães, gatos, vacas, cavalos e humanos. Numa modalidade da invenção, o mamífero é um ratinho. Numa outra modalidade da invenção, o mamífero é um humano.
Os termos "cancro metastático da próstata" e "doença metastática" representam cancros da próstata que se espalharam para os nódulos linfáticos regionais ou para locais distantes, e pretende-se que incluam doença em fase D de acordo com o sistema da AUA e fase TxNxM+ de acordo com o sistema TNM. Como é o caso com cancro da próstata localmente avançado, a cirurgia não é geralmente indicada 24 para pacientes com doença metastática, e a terapêutica hormonal (ablação de androgénio) é uma modalidade de tratamento preferida. Os pacientes com cancro metastático da próstata eventualmente desenvolvem um estado refratário de androgénio dentro de 12 a 18 meses após o inicio do tratamento. Aproximadamente metade destes pacientes refratários de androgénio morrem num prazo de 6 meses após o desenvolvimento daquele estado. 0 local mais comum para o cancro metastático da próstata são os ossos. As metástases nos ossos do cancro da próstata são frequentemente osteoblásticas em vez de osteoliticas (isto é, resultando na formação liquida de osso) . As metástases nos ossos são encontradas mais frequentemente na espinha dorsal, seguido pelo fémur, pélvis, gaiola torácica, crânio e úmero. Outros locais comuns para metástases incluem nódulos linfáticos, pulmão, figado e cérebro. 0 cancro metastático da próstata é tipicamente diagnosticado por linfadenectomia aberta ou pélvia laparoscópica, exames radionuclideos do corpo inteiro, radiografia do esqueleto, e/ou biópsia de lesão do osso.
Um "excipiente farmacêutico" compreende um material tal como um adjuvante, um veiculo, agentes tamponantes e de ajuste do pH, agentes de ajuste da tonicidade, tensioactivos humectantes, conservante, e afins. "Aceitável farmaceuticamente" refere-se a um não tóxico, inerte, e/ou composição que é fisiologicamente compatível com humanos ou outros mamíferos. 0 termo "polinucleotídeo" significa uma forma polimérica de nucleotídeos de, pelo menos, 10 bases ou pares de base de comprimento, quer ribonucleotídeos ou desoxinucleotídeos ou uma forma modificada de qualquer um dos tipos de nucleotídeo, e pretende-se que inclua formas de cadeia simples e dupla de ADN e/ou ARN. Na arte, este termo é frequentemente utilizado alternadamente com "oligonucleotideo". Um polinucleotídeo pode compreender uma 25 sequência de nucleotídeo revelada aqui em que a timidina (T), como mostrado, por exemplo, na Figura 2, também pode ser uracilo (U); esta definição pertence às diferenças entre as estruturas químicas do ADN e ARN, em particular a observação de que uma das quatro bases principais no ARN é o uracilo (U) em vez da timidina (T). 0 termo "polipéptido" significa um polímero de, pelo menos, cerca de 4, 5, 6, 7, ou 8 aminoácidos. Ao longo da especificação, são utilizadas designações padrão para aminoácidos de três letras ou uma só letra. Na arte, este termo é frequentemente utilizado alternadamente com "péptido" ou "proteína".
Os "radioisótopos" incluem, mas não se limitam ao seguinte (utilizações exemplares não limitantes são também estabelecidas): Exemplos de Isótopos Médicos:
Isótopo Descrição do uso actínio-225 (AC- Ver Tório-229 (Th-229) 225)
Actínio-227 (AC-227)
Bismuto-212 (Bi-212)
Pai de Rádio-223 (Ra-223) que é um emissor alfa utilizado para tratar metástases no esqueleto resultando de cancro (isto é, cancros da mama e da próstata), e radioimunoterapêutica do cancro
Ver Tório-228 (Th-228)
Bismuto-213 (Bi- Ver Tório-229 (Th-229) 213) Cádmio-109 (Cd- Deteção de cancro 109)
Cobalto-60 (Co- Fonte de radiação para radioterapia de 60) cancro, para irradiação alimentar, e para esterilização de provisões médicas 26 26 cobre-64 (Cu-64) cobre-67 (Cu-67)
Disprósio-166 (Dy-166) érbio-169 (Er-169)
Európio-152 (Eu-152) Európio-154 (Eu-154) Gadolínio-153 (Gd-153) Ouro-198 (Au-198) Hólmio-166 (Ho-16 6)
Um emissor de pósitron utilizado para terapêutica de cancro e técnica de tomografia SPECT
Emissor de Beta/gama utilizado em radioimunoterapêutica de cancro e estudos de diagnóstico (isto é, cancros da mama e cólon, e linfoma) radioimunoterapêutica de cancro
Tratamento da artrite reumatóide, particularmente para as pequenas articulações associadas com dedos das mãos e dos pés
Fonte de radiação para irradiação alimentar, e para esterilização de provisões médicas Fonte de radiação para irradiação alimentar, e para esterilização de provisões médicas
Deteção da osteoporose e dispositivos nucleares de garantia de qualidade médica
Implantes e terapêutica intracavidade de cancros do ovário, próstata, e cérebro tratamento de mieloma múltiplo em terapêutica dirigida ao esqueleto, radioimunoterapêutica de cancro, ablação da medula óssea, e tratamento da artrite reumatóide 27 27 Iodo-125 (1-125)
Deteção da osteoporose, técnica de tomografia de diagnóstico, rastreio de fármacos, tratamento de cancro de cérebro, radiomarcação, técnica de tomografia de tumores, mapeamento de recetores no cérebro, radioterapia intersticial, braquioterapêutica para tratamento de cancro de próstata, determinação de taxa de filtração glomerular (GFR), determinação de volume de plasma, deteção de trombose de veias profundas das pernas
Iodo-131 (1-131)
Irídio-192 (Ir-192)
Avaliação da função da tiroide, deteção da doença da tiroide, tratamento de cancro da tiroide bem como outras doenças da tiroide não malignas (isto é, doença de Graves, bócio, e hipertiroidismo), tratamento de leucemia, linfoma, e outras formas de cancro (por exemplo, cancro da mama) utilizando radioimunoterapêutica Braquiterapêutica, tratamento de tumor de cérebro e espinha dorsal, tratamento de artérias bloqueadas (isto é, arteriosclerose e restenose), e implantes para tumores de mama e próstata
Lutécio-177 (Lu 177) radioimunoterapêutica de cancro e tratamento de artérias bloqueadas (isto é, arteriosclerose e restenose) 28 28 Molibdénio-9 9 (Mo-9 9) ósmio-194 (Os-194) Paládio-103 (Pd-103) Platina-195m (Pt-195m) Fósforo-32 (P-32) Fósforo-33 (P-33) Rádio-223 (Ra-223)
Pai de tecnécio-99m (Tc-99m) que é utilizado para tomografia do cérebro, figado, pulmões, coração, e outros orgãos. Atualmente, Tc-99m é o radioisótpo mais amplamente utilizado para tomografia de diagnóstico de vários cancros e doenças envolvendo o cérebro, coração, figado, pulmões; também utilizado na deteção de trombose de veias profundas das pernas radioimunoterapêutica de cancro tratamento de cancro da próstata
Estudos sobre a biodistribuição e metabolismo da cisplatina, um fármaco quimioterapêutico policitemia rubra vera (doença das células sanguíneas) e tratamento de leucemia, cancro dos ossos diagnóstico/tratamento; tratamento de cancro do cólon, do pâncreas, e do fígado; radiomarcação de ácidos nucleicospara investigação in vitro, diagnóstico de tumores superficiais, tratamento de artérias bloqueadas (isto é, arteriosclerose e restenose), e terapêutica intracavidade tratamento de leucemia, diagnóstico/tratamento de doena dos ossos, radiomarcação, e tratamento de artérias bloqueadas (isto é, arteriosclerose e restenose)
Ver Actínio-227 (Ac-227) 29 29 Rénio-186 (Re-186) Rénio-188 (Re-188) Ródio-105 (Rh-105) Samário-145 (Sm-145) Samário ~153 (Sm-153) Scândio-47 (Sc-47) Selénio-75 (Se-75)
Estrôncio-85 (Sr-85) Estrôncio -89 (Sr-89) Tecnécio-99m Ver (Tc-99m)
Alívio da dor do cancro dos ossos, tratamento da artrite reumatoide, e diagnóstico e tratamento de linfoma e cancros dos ossos, da mama, cólon, e do fígado utilizando radioimunoterapêutica diagnóstico e tratamento de cancro utilizando radioimunoterapêutica, alívio da dor do cancro dos ossos, tratamento da artrite reumatoide, e tratamento d cancro da próstata Radioimunoterapêutica de cancro
Tratamento de cancro ocular
Radioimunoterapêutica de cancro e alívio da dor do cancro dos ossos Radioimunoterapêutica de cancro e alívio da dor do cancro dos ossos Radio-rastreio utilizado em estudos do cérebro, tomografia do córtex adrenal por gama-cintigrafia, localizações laterais de tumores secretores de esteroides, examinação do pâncreas, deteção de glândulas da paratiroide hiperativas, taxa de medida de ácido biliar perdido do grupo endógeno Deteção do cancro dos ossos e exames ao cérebro alívio da dor do cancro dos ossos, tratamento de mieloma múltiplo, e terapêutica osteoblástica Molibdénio-99 (Mo-99) 30 30 Tório-228 (Th-228) Tório-229 (Th-229) Túlio-170 (Tm-170) (Sn-117m) (Sn-117m) Tungsténio-18 8 (W-188) Xénon-127 (Xe-127)
Itérbio-175 (Yb-175) ítrio-9 0 ítrio-91 (Y-91)
Uma molécula molécula de ADN
Pai de Bismuto-212 (Bi-212) que é um amissor alfa utilizado na radioimunoterapêutica de cancro Pai de Actínio-225 (Ac-225) e avô de Bismuto-213 (Bi-213) que são emissores alfa utilizados na radioimunoterapêutica de cancro
Fonte gama para irradiores de sangue, fonte de energia para dispositivos médicos implantados
Imunoterapia do cancro e alivio da dor do cancro dos ossos
Parental de rénio-188 (Re-188) que é utilizado para diagnósticos/tratamento de cancro, alivio da dor do cancro dos ossos, tratamento da artrite reumatóide, e tratamento de artérias bloqueadas (isto é, arteriosclerose e restenose) Neurotomografia de disfunções cerebrais, estudos SPECT de alta resolução, testes de função pulmonar, e estudos de fluxo sanguíneo cerebral Radioimunoterapêutica de cancro
Microsementes obtidas a partir de ítrio-89 (Y-89) irradiador para tratamento do cancro do fígado
Um rótulo emissor gama para ítrio-90 (Y-90) que é utilizado para radioimunoterapêutica de cancro (isto é, linfoma, cancros da mama, cólon, rim, pulmão, ovário, próstata, pâncreas, e fígado inoperáveis) de ADN ou ARN "recombinante" é uma ou ARN que foi sujeita a manipulação 31 molecular in vitro. A "restringência" das reações de hibridação é rapidamente determinável por alguém com habilitação comum na arte, e geralmente é um cálculo empírico dependente do comprimento da sonda, temperatura de lavagem, e concentração de sal. Em geral, sondas mais compridas requerem temperaturas mais elevadas para hibridação adequada, enquanto sondas mais curtas precisam de temperaturas mais baixas. A hibridação geralmente depende da capacidade das sequências de ácido nucleico desnaturado para voltarem a hibridizar quando cadeias complementares estão presentes num ambiente abaixo da sua temperatura de fusão. Quanto mais alto o grau de homologia desejado entre a sonda e a sequência hibridizável, mais alta a temperatura relativa que pode ser utilizado. Como resultado, temperaturas relativas mais elevadas tenderiam a tornar as condições da reação mais restringentes, enquanto temperaturas mais baixas o fariam menos. Para detalhes adicionais e explicação da restringência das reações de hibridação, ver Ausubel et al., Current Protocols in Molecular Biology, Wiley Interscience Publishers, (1995). "Condições restringentes" ou "condições de elevada restringência", como definido aqui, são identificadas por, mas não limitadas, àquelas que: (1) empregam baixa força iónica e temperatura alta para lavagem, por exemplo, 0,015 M de cloreto de sódio/0,0015 M de citrato de sódio/0,1% de dodecilsulfato de sódio a 50°C; (2) empregam durante a hibridação um agente desnaturante, tal como formamida, por exemplo, 50% (v/v) formamida com 0,1 % soro de albumina bovino/0,1 % Ficoll/0,1 % polivinilpirrolidona/ 50 mM de tampão de fosfato de sódio a pH 6,5 com 750 mM de cloreto de sódio, 75 mM de citrato de sódio a 42 °C; ou (3) empregam 50% de formamida, 5 x SSC (0,75 M NaCl, 0,075 M de citrato de sódio), 50 mM de fosfato de sódio (pH 6,8), 0,1% de pirofosfato de sódio, 5 x de solução de Denhardt, ADN de 32 esperma de salmão sonicado (50 pg/ml), 0,1% SDS, e 10% sulfato de dextrano a 42 °C, com lavagens a 42°C em 0,2 x SSC (cloreto de sódio/citrato de sódio) e 50% formamida a 55 °C, seguido por uma lavagem de restringência elevada consistindo em 0,1 x SSC contendo EDTA a 55 °C. "Condições moderadamente restringentes" são descritas por, mas não limitadas a, aquelas em Sambrook et al., Molecular Cloning: A Laboratory Manual, Nova Iorque: Cold Spring Harbor Press, 1989, e incluem a utilização de solução de lavagem e condições de hibridação (por exemplo, temperatura, força iónica e % SDS) menos restringentes do que aquelas descritas em cima. Um exemplo de condições moderadamente restringentes é a incubação durante a noite a 37°C numa solução compreendendo: 20% formamida, 5 x SSC (150 mM NaCl, 15 mM citrato de trisódio) , 50 mM fosfato de sódio (pH 7,6), 5 x solução de Denhardt, 10% sulfato de dextrano, e 20 mg/mL ADN de esperma de salmão tosado desnaturado, seguido de lavagem dos filtros em 1 x SSC a cerca de 37-50°C. O especialista habilitado reconhecerá como ajustar a temperatura, força iónica, etc. como necessário para acomodar fatores tais como comprimento da sonda e afins.
Como usado aqui "tratar" ou "terapêutico" e termos gramaticamente relacionados, referem-se a qualquer melhoria de qualquer consequência da doença, tal como sobrevivência prolongada, menor morbidez, e/ou uma diminuição de efeitos secundários que são os subprodutos de uma modalidade terapêutica alternativa; a erradicação completa da doença não é necessária. O termo "variante" refere-se a uma molécula que exibe uma variação de um tipo ou norma descrita, tal como uma proteína que tem um ou mais resíduos de aminoácidos diferentes na posição(ões) correspondentes de uma proteína especificamente descrita (por exemplo, a proteína 273P4B7 mostrada na Figura 2 ou Figura 3. Um análogo é um exemplo de uma proteína variante. Isoformas de splicing e 33 polimorfismo de nucleotídeo únicos (SNPs) são exemplos adicionais de variantes.
As "proteínas relacionadas com 273P4B7" incluem aquelas especificamente identificadas aqui, bem como variantes alélicas, variantes de substituição conservadoras, análogos e homólogos que podem ser isolados/gerados e caracterizados sem experimentação indevida seguindo os métodos resumidos aqui ou rapidamente disponíveis na arte. As proteínas de fusão que combinam partes de proteínas 273P4B7 diferentes ou fragmentos das mesmas, bem como proteínas de fusão de uma proteína 273P4B7 e um polipéptido heterólogo também estão incluídas. Tais proteínas 273P4B7 são coletivamente referidas como as proteínas relacionadas com 273P4B7, ou 273P4B7. 0 termo "proteína relacionada com 273P4B7" refere-se a um fragmento de polipéptido ou a uma sequência da proteína 273P4B7 de 4, 5, 6 , 7, CJí oo O \—1 CM \—1 1-1 \—1 , 13, . 14, . 15, CD \—1 OO \—1 1—1 , 19, . 20, 21, 22, ; 23, 2 < 4, 2 5, ou mais de 25 aminoácidos; ou, pelo meno s, 30 , 35, 40, 45, 50, 55 , 60 , 65, 70, 80, 85 , 90, , 95, 100, 105, 110, 115, r 120, 125, 130 , 135 ,140, 145, 150, 155, 160, 165, 170, 175, 180,1 .85, 190, 195, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525, 550, 575, ou 576 ou mais aminoácidos. II.) Polinucleotídeos 273P4B7
Um aspeto da invenção relaciona-se com polinucleotídeos correspondentes ou complementares com todo ou parte de um gene 273P4B7, ARNm, e/ou sequência codificante, preferencialmente em forma isolada, incluindo polinucleotídeos que codificam uma proteína relacionada com 273P4B7 e fragmentos dos mesmos, ADN, ARN, híbrido ADN/ARN, e moléculas relacionadas, polinucleotídeos ou oligonucleotídeos complementares a um gene 273P4B7 ou sequência de ARNm ou uma parte da mesma, e polinucleotídeos ou oligonucleotídeos que hibridam com um gene 273P4B7, ARNm, ou com um polinucleotídeo que codifica 273P4B7 34 (coletivamente, "polinucleotídeos 273P4B7"). Em todas as ocasiões quando referidas nesta secção, T também pode ser U na Figura 2.
Os polinucleotídeos 273P4B7 incluem: um polinucleotídeo 273P4B7 que tem a sequência mostrada na Figura 2, the nucleotide sequência of 273P4B7 as shown in Figura 2 em que T é U; pelo menos 10 nucleotídeos contíguos de um polinucleotídeo que tem a sequência como mostrada na Figura 2; ou, pelo menos 10 nucleotídeos contíguos de um polinucleotídeo que tem a sequência como mostrada na Figura 2 onde T é U. A invenção providencia um polinucleotídeo isolado compreendendo a sequência de: (a) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847; (b) SEQ. ID N.°4, dos resíduos de nucleotídeos números 604 a 3987; (c) SEQ. ID N.°8, dos resíduos de nucleotídeos números 688 a 1947; (d) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 571 é T; (e) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 608 é G; (f) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 1185 é G; (g) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 2759 é A; (h) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 3658 é C; ou (i) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 3850 é A. Por exemplo, os nucleotídeos 273P4B7 podem compreender, sem limitação: (I) um polinucleotídeo compreendendo, consistindo essencialmente de, ou consistindo numa sequência como mostrada na Figura 2, em que T também pode ser U; (II) um polinucleotídeo compreendendo, consistindo essencialmente de, ou consistindo numa sequência como mostrada na Figura 2A, desde o resíduo de nucleotídeo 35 número 95 ao resíduo de nucleotídeo número 3847, incluindo o codão de terminação, em que T também pode ser U; (III) um polinucleotídeo compreendendo, consistindo essencialmente de, ou consistindo numa sequência como mostrada na Figura 2B, desde o resíduo de nucleotídeo número 604 ao resíduo de nucleotídeo número 3987, incluindo o codão de terminação, em que T também pode ser U; (IV) um polinucleotídeo que codifica uma proteína relacionada com 273P4B7 que é, pelo menos, 90,91, 92,93, 94.95, 96,97, 98,99 ou 100% homóloga com uma sequência de aminoácidos completa mostrada na Figura 2A-F; (V) um polinucleotídeo que codifica uma proteína relacionada com 273P4B7 que é, pelo menos, 90,91, 92,93, 94.95, 96,97, 98,99 ou 100% idêntica a uma sequência de aminoácidos completa mostrada na Figura 2A-F; (VII) um polinucleotídeo que codifica uma região peptídica de, pelo menos, 5,6, 7,8, 9,10, 11,12, 13,14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de um péptido das Figuras 3A e 3C-3E em qualquer incremento de número inteiro até 1250 que inclui, pelo menos, 1, 2 , 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição(ões) de aminoácido que têm um valor superior a 0,5 no perfil de hidrofobicidade da Figura 5; (VIII) um polinucleotídeo que codifica uma região peptídica de, pelo menos, 5, 6, 7, 8, 9,10, 11, 12,13, 14,15, 16,17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32,
33, 34, 35 aminoácidos de um péptido da Figura 3A e 3C-3E em qualquer incremento de número inteiro até 1250 que inclui 1, 2, 3, 4, 5, 6, 7, 8, 9,10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição(ões) de aminoácido que têm um valor inferior a 0,5 no perfil de hidropaticidade da Figura 6; 36 (IX) um polinucleotídeo que codifica uma região peptídica de, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de um péptido da Figura 3A e 3C-3E em qualquer incremento de número inteiro até 1250 que inclui 1, 2, 3, 4, 5, 6, 7, 8, 9,10,11,12,13,14,15,16,17,18,19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição(ões) de aminoácido que têm um valor superior a 0,5 no perfil de percentagem de resíduos acessíveis da Figura 7; (X) um polinucleotídeo que codifica uma região peptídica de, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de um péptido da Figura 3A e 3C-3E em qualquer incremento de número inteiro até 1250 que inclui 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição (ões) de aminoácido que têm um valor superior a 0,5 no perfil de flexibilidade média da Figura 8; (XI) um polinucleotídeo que codifica uma região peptídica de, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de um péptido da Figura 3A e 3C- 3E em qualquer incremento de número inteiro até 1250 que inclui 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição (ões) de aminoácido que têm um valor superior a 0,5 no perfil de volta beta da Figura 9; (XII) um polinucleotídeo que codifica uma região peptídica de, pelo menos, 5, 6, 7, 8, 9,10,11,12,13,14,15,16,17,18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de um péptido da Figura 3B em qualquer incremento de número inteiro até 1127 que inclui 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 37 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição(ões) de aminoácido que têm um valor superior a 0. 5 no perfil de hidrofilicidade da Figura 5; (XIII) um polinucleotideo que codifica uma região peptidica de, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de um péptido da Figura 3B em qualquer incremento de número inteiro até 1127 que inclui 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição (ões) de aminoácido que têm um valor inferior a 0,5 no perfil de hidropaticidade da Figura 6; (XIV) um polinucleotideo que codifica uma região peptidica de, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de um péptido da Figura 3B em qualquer incremento de número inteiro até 1127 que inclui 1, 2, 3, 4, 5, 6, 7, 8, 9. 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição (ões) de aminoácido que têm um valor superior a 0,5 no perfil de percentagem de residuos acessíveis da Figura 7; (XV) um polinucleotideo que codifica uma região peptidica de, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de um péptido da Figura 3B em qualquer incremento de número inteiro até 1127 que inclui 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição (ões) de aminoácido que têm um valor superior a 0,5 no perfil de flexibilidade média da Figura 8; (XVI) um polinucleotideo que codifica uma região peptidica de, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 38 32, 33, 34, 35 aminoácidos de um péptido da Figura 3B em qualquer incremento de número inteiro até 1127 que inclui 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição (ões) de aminoácido que têm um valor superior a 0,5 no perfil de volta beta da Figura 9; (XVII) um polinucleotideo que é totalmente complementar com um polinucleotideo de qualquer um de (I)-(XVI); e (XVIII) um polinucleotideo que é totalmente complementar com um polinucleotideo de qualquer um de (I)-(XVII).
Uma composição (XX) pode compreender um polinucleotideo de qualquer um de (I)-(XVIII) junto com um excipiente farmacêutico e/ou nuam forma de dose unitária humana.
Um polinucleotideo de qualquer (I)-(XVIII) ou uma composição (XX) podem ser utilizados num método para modular uma célula que expressa 273P4B7.
Um polinucleotideo de qualquer (I)-(XVIII) ou uma composição (XX) podem ser utilizados num método para diagnosticar, fazer profilaxia, prognosticar, ou tratar um indivíduo que é portador de uma célula que expressa 273P4B7.
Um polinucleotideo de qualquer (I)-(XVIII) ou uma composição (XX) podem ser utilizados num método para diagnosticar, fazer profilaxia, prognosticar, ou tratar um indivíduo que é portador de uma célula que expressa 273P4B7, dita célula de um cancro de um tecido listado no Quadro I.
Um polinucleotideo de qualquer (I)-(XXVIII) ou uma composição (XX) podem ser utilizados num método para diagnosticar, fazer profilaxia, prognosticar, ou tratar um cancro.
Um polinucleotideo de qualquer (I)-(XXVIII) ou uma composição (XX) podem ser utilizados num método para diagnosticar, fazer profilaxia, prognosticar, ou tratar um 39 cancro de um tecido listado no Quadro I.
Um polinucleotideo de qualquer (I)-(XXVIII) ou uma composição (XX) podem ser utilizados num método para identificar ou caracterizar um modulador de uma célula que expressa 273P4B7.
Como usado aqui, um intervalo é entendido para revelar especificamente todas as posições de unidade inteira do mesmo. Polinucleotideos 273P4B7 típicos codificam porções específicas de sequências de ARNm 273P4B7 (e aquelas que são complementares a tais sequências) tais como aquelas que codificam as proteínas e/ou fragmentos das mesmas, por exemplo: (a) 4, 5, 6, 7, 8, 9,10,11,12,13,14,15,16,17,18,19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95,100,105,110,115, 120, 125,130,135,140,145,150,155,160,165,170, 175, 180,185, 190,195, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525, 550, 575, 600, 625, 650, 675, 700, 725, 750, 775, 800, 825, 850, 875, 900, 925, 950, 975, 1000, 1025, 1050, 1075, 1100, 1125, 1150, 1175, 1200, 1225, 1235, 1240, 1245, 1250 ou mais aminoácidos contíguos de 273P4B7 variante 1; os comprimentos máximos relevantes para outras variantes são: variante 2, 1127 aminoácidos; variante 4, 1250 aminoácidos, variante 5, 1250 aminoácidos, variante 6, 1250 aminoácidos, variante 9,1106 aminoácidos; variante 10, 419 aminoácidos; e variante 11, 419 aminoácidos.
Por exemplo, polinucleotideos representativos que codificam cerca de 1 aminoácido a cerca de 10 aminoácidos da proteína 273P4B7 mostrada na Figura 2 ou Figura 3, cerca de 10 aminoácidos a cerca de aminoácidos 20 aminoácidos da proteína 273P4B7 mostrada na Figura 2 ou Figura 3, cerca de 20 aminoácidos a cerca de 30 aminoácidos da proteína 273P4B7 mostrada na Figura 2 ou Figura 3, cerca de 30 aminoácidos a cerca de 40 aminoácidos da proteína 273P4B7 40 mostrada na Figura 2 ou Figura 3, cerca de 40 aminoácidos a cerca de 50 aminoácidos da proteína 273P4B7 mostrada na Figura 2 ou Figura 3, cerca de 50 aminoácidos a cerca de 60 aminoácidos da proteína 273P4B7 mostrada na Figura 2 ou Figura 3, cerca de 60 aminoácidos a cerca de 70 aminoácidos da proteína 273P4B7 mostrada na Figura 2 ou Figura 3, cerca de 70 aminoácidos a cerca de 80 aminoácidos da proteína 273P4B7 mostrada na Figura 2 ou Figura 3, cerca de 80 aminoácidos a cerca de 90 aminoácidos da proteína 273P4B7 mostrada na Figura 2 ou Figura 3, cerca de 90 aminoácidos a cerca de 100 aminoácidos da proteína 273P4B7 mostrada na Figura 2 ou Figura 3, em incrementos de cerca de 10 aminoácidos, terminando no terminal carboxilo do aminoácido apresentado na Figura 2 ou Figura 3. Em concordância, polinucleotídeos podem codificar porções da sequência de aminoácidos (de cerca de 10 aminoácidos), de aminoácidos, 100 através do terminal carboxilo do aminoácido da proteína 273P4B7. Onde é entendido que cada posição de aminoácido particular revela aquela posição mais ou menos cinco resíduos de aminoácidos.
Polinucleotídeos podem codificar porções relativamente longas de uma proteína 273P4B7. Por exemplo, polinucleotídeos que codificam desde cerca de 1 aminoácido (ou 20 ou 30 ou 40 etc.) a cerca de 20 aminoácidos, (ou 30, ou 40 ou 50 etc.) da proteína 273P4B7 "ou variante" mostrada na Figura 2 ou Figura 3 podem ser gerados por uma variedade de técnicas bem conhecidas na arte. Estes fragmentos de polinucleotídeo podem incluir qualquer porção da sequência 273P4B7 como mostrado na Figura 2.
Os fragmentos de polinucleotídeo 273P4B7 podem codificar um ou mais dos motivos biológicos contidos dentro de uma proteína 273P4B7 ou sequência "variante". Fragmentos típicos de polinucleotídeo codificam uma ou mais das regiões da proteína 273P4B7 ou variante que exibem homologia com uma molécula conhecida. Fragmentos típicos de 41 polinucleotídeo podem codificar um ou mais dos locais de the N-glicosilação da proteína 273P4B7 ou variante, locais de fosforilação da proteína quinase dependentes de cAMP e cGMP, locais de fosforilação da caseína quinase II ou local de N-miristoilação e locais de amidação. II.A.) Utilizações de polinucleotídeos 273P487 II.A.1.) Monitorização de anormalidades genéticas
Os polinucleotídeos dos parágrafos anteriores têm um número de utilizações específicas diferentes. 0 gene humano 273P487 mapeia para a localização cromossómica apresentada no Exemplo designado "Mapeamento cromossómico de 273P4B7." Por exemplo, porque o gene 273P4B7 mapeia para este cromossoma, os polinucleotídeos que codificam diferentes regiões das proteínas 273P4B7 são utilizados para caracterizar anormalidades citogenéticas destes locais cromossómicos, tais como anormalidades que são identificadas como estando associadas com vários cancros. Em certos genes, foi identificada uma variedade de anormalidades cromossómicas, incluindo rearranjos, como anormalidades citogenéticas frequentes num número de cancros diferentes (ver, por exemplo, Krajinovic et al., Mutat. Res. 382 (3-4): 81-83 (1998); Johansson et al., Blood 86 (10): 3905-3914 (1995) e Finger et al. , P.N.A.S. 85(23): 9158-9162 (1988)). Assim, os polinucleotídeos que codificam regiões específicas das proteínas 273P4B7 providenciam novas ferramentas que podem ser utilizadas para delinear, com maior precisão do que previamente possível, anormalidades citogenéticas na região cromossómica que codifica 273P4B7 que podem contribuir para o fenótipo maligno. Neste contexto, estes polinucleotídeos satisfazem uma necessidade na arte para expandir a sensibilidade da classificação cromossómica de maneira a identificar anormalidades cromossómicas mais subtis e menos comuns (ver, por exemplo, Evans et al., Am. J. Obstet. Gynecol 171 (4) :1055-1057 (1994)) . 42
Além disso, como se demonstrou que 273P4B7 é altamente expresso no cancro da próstata e outros cancros, os polinucleotídeos 273P4B7 são utilizados em métodos que avaliam o estado dos produtos do gene 273P4B7 em tecidos normais versus cancerígenos. Tipicamente, os polinucleotídeos que codificam regiões específicas das proteínas 273P4B7 são utilizados para avaliar a presença de perturbações (tais como deleções, inserções, mutações pontuais, ou alterações que resultam numa perda de um antígeno etc.) em regiões específicas do gene 273P4B7, tais como regiões contendo um ou mais motivos. Testes exemplares incluem ambos testes RT-PCR bem como análise de polimorfismo de conformação de cadeia simples (SSCP) (ver, por exemplo, Marrogi et al., J. Cutan. Pathol. 26(8): 369-378 (1999), ambos os quais utilizam polinucleotídeos que codificam regiões específicas de uma proteína para examinar estas regiões dentro da proteína. II.A.2.) Modalidades anti-sense
Outras modalidades especificamente contempladas relacionadas com ácidos nucleicos da invenção reveladas aqui são ADN genómico, ADNc, ribozimas, e moléculas anti-sense, bem como moléculas de ácido nucleico baseadas numa estrutura alternativa, ou incluindo bases alternativas, seja derivadas de fontes naturais ou sintetizadas, e incluem moléculas capazes de inibir a expressão de ARN ou proteína de 273P4B7. Por exemplo, moléculas anti-sense podem ser ARN ou outras moléculas, incluindo ácidos nucleicos peptídicos (PNA) ou moléculas de ácido não nucleico tais como derivados do fosforotioato que se ligam especificamente ao ADN ou ARN de uma maneira dependente do par de base. Um especialista habilitado pode rapidamente obter estas classes de moléculas de ácido nucleico utilizando polinucleotídeos 273P4B7 e sequências de polinucleotídeo reveladas aqui. A tecnologia anti-sense requer a administração de 43 oligonucleotídeos exógenos que se ligam a um polinucleotídeo alvo localizado dentro das células. 0 termo "anti-sense" refere-se ao facto de que tais oligonucleotídeos são complementares com os seus alvos intracelulares, por exemplo, 273P4B7. Ver, por exemplo, Jack Cohen, Oligodeoxynucleotides, Antisense Inhibitors of Gene Expression, CRC Press, 1989; e Synthesis 1:1-5 (1988). Os oligonucleotídeos 273P4B7 anti-sense da presente invenção incluem derivados tais como S-oligonucleotídeos (derivados do fosforotioato ou S-oligos, ver, Jack Cohen, supra), que exibem ação inibidora do crescimento de células cancerígenas aumentado. Os S-oligos (nucleosídeo fosforotioatos) são análogos isoeletrónicos de um oligonucleotídeo (O-oligo) no qual um átomo de oxigénio que não faz uma ponte do grupo fosfato é substituído por um átomo de enxofre. Os S-oligos da presente invenção podem ser preparados por tratamento dos O-oligos correspondentes com 3H-1,2-benzoditiol-3-ona-l,1-dioxido, que é um reagente de transferência de enxofre. Ver, por exemplo, lyer, R P. et al., J. Org. Chem. 55: 4693-4698 (1990); e lyer, R. P. et al., J. Am. Chem. Soc. 112:1253-1254 (1990). Oligonucleotídeos 273P4B7 anti-sense adicionais da presente invenção incluem oligonucleotídeos morfolino anti-sense conhecidos na arte (ver, por exemplo, Partridge et al., 1996, Antisense & Nucleic Acid Drug Development 6:169-175).
Os oligonucleotídeos 273P4B7 anti-sense da presente invenção podem ser tipicamente ARN ou ADN que é complementar a e hibridiza de forma estável com os primeiros 100 codões 5' ou os últimos 100 codões 3' de uma sequência genómica de 273P4B7 ou o ARNm correspondente. A complementaridade absoluta não é necessária, apesar de altos graus de complementaridade serem preferidos. A utilização de um oligonucleotídeo complementar a esta região permite a hibridação seletiva ao ARNm de 273P4B7 e não ao ARNm especificando outras subunidades reguladoras da 44 proteína quinase. Numa modalidade, os oligonucleotídeos 273P4B7 anti-sense da presente invenção são fragmentos 15 a 30-meros da molécula de ADN anti-sense que tem uma sequência que híbrida com ARNm de 273P4B7. Opcionalmente, o oligonucleotídeo 273P4B7 anti-sense é um oligonucleotídeo 30-mero que é complementar com uam região nos primeiros 10 codões 5' ou últimos 10 codões 3' de 273P4B7. Em alternativa, as moléculas anti-sense são modificadas para empregar ribozimas na inibição da expressão de 273P4B7, ver, por exemplo, L. A. Couture & D. T. Stinchcomb; Trends Genet 12: 510-515 (1996) . II.A.3.) Iniciadores e pares de iniciadores
Modalidades específicas adicionais destes nucleotídeos incluem iniciadores e pares de iniciadores, que permitem a amplificação específica de polinucleotídeos da invenção ou de quaisquer partes específicas dos mesmos, e sondas que seletivamente ou especificamente hibridam com moléculas de ácido nucleico da invenção ou com qualquer parte das mesmas. As sondas podem ser rotuladas com um marcador detetável, tal como, por exemplo, um radioisótopo, composto fluorescente, composto bioluminescente, um composto quimiluminescente, quelante metal ou enzima. Tais sondas e iniciadores são utilizados para detetar a presença de um polinucleotídeo 273P4B7 numa amostra e como uma forma de detetar uma célula que expressa uma proteína 273P4B7.
Exemplos de tais sondas incluem polipeptídeos compreendendo toda ou parte da sequência de ADNc de 273P4B7 humana mostrada na Figura 2. Exemplos de pares de iniciadores capazes de amplificar especificamente ARNms de 273P4B7 também são descritos nos Exemplos. Como será entendido pelo especialista habilitado, muitos iniciadores e sondas diferentes podem ser preparados com base nas sequências providenciadas aqui e utilizadas eficazmente para amplificar e/ou detetar um ARNm de 273P4B7.
Os polinucleotídeos 273P4B7 da invenção são úteis para 45 uma variedade de fins, incluindo, mas não limitado a, o seu uso como sondas e iniciadores para a amplificação e/ou deteção do gene(s) 273P4B7, ARNm(s), ou fragmentos do mesmo; como reagentes para o diagnóstico e/ou prognóstico de cancro da próstata e outros cancros; como sequências codificantes capazes de dirigir a expressão de polipeptideos 273P4B7; como ferramentas para modular ou inibir a expressão dos gene(s) 273P4B7 e/ou tradução dos transcrito(s) de 273P4B7; e como agentes terapêuticos. A presente invenção inclui a utilização de qualquer sonda como descrito aqui para identificar e isolar uma sequência de ácido nucleico de 273P4B7 ou relacionada com 273P4B7 a partir de uma fonte que ocorre naturalmente, tal como humanos ou outros mamíferos, bem como a sequência de ácido nucleico isolada por si, que compreenderia todas ou a maioria das sequências encontradas na sonda utilizada. II. A. 4.) Isolamento de moléculas de ácido nucleico que codificam 273P4B7
As sequências de ADNc de 273P4B7 descritas aqui permitem o isolamento de outros polinucleotídeos que codificam o(s) produto(s) do gene 273P4B7, bem como o isolamento de polinucleotídeos que codificam os homólogos dos produtos do gene 273P4B7, em isoformas de splicing alternativo, variantes alélicas, e formas mutantes de um produto do gene 273P4B7 bem como polinucleotídeos que codificam análogos de proteínas relacionadas com 273P4B7. Vários métodos de clonagem molecular que podem ser empregues para isolar cDNAs de comprimento inteiro que codificam um gene 273P4B7 são bem conhecidos (ver, por exemplo, Sambrook, J. et al., Molecular Cloning: A Laboratory Manual, 2a edição, Cold Spring Harbor Press, New York, 1989; Current Protocols in Molecular Biology. Ausubel et al., Eds., Wiley e Filhos, 1995). Por exemplo, as metodologias de clonagem de fago lambda podem ser convenientemente empregues, utilizando sistemas de clonagem 46 comercialmente disponíveis (por exemplo, Lambda ZAP Express, Stratagene). Os clones de fagos contendo cADNs do gene 273P4B7 podem ser identificados sondando com um ADNc de 273P4B7 marcado ou um fragmento do mesmo. Por exemplo, numa modalidade, um ADNc de 273P4B7 (por exemplo, Figura 2) ou uma porção do mesmo pode ser sintetizado e utilizado como uma sonda para recuperar sobreposição e cDNAs de comprimento inteiro correspondentes a um gene 273P4B7. Um gene 273P4B7 por si só pode ser isolado classificando as bibliotecas de ADN genómico, bibliotecas cromossómicas artificiais de bactérias (BACs), bibliotecas cromossómicas artificiais de leveduras (YACs), e afins, com sondas ou iniciadores de ADN de 273P4B7. II.A.5.) Moléculas de ácido nuclelco recombinantes e sistema hospedeiro-vetor A invenção também providencia moléculas de ADN ou ARN recombinantes contendo um polinucleotídeo 273P4B7, incluindo, mas não limitado a, fagos, plasmídeos, fagomídeos, cosmídeos, YACs, BACs, bem como vários vetores virais e não virais bem conhecidos na arte, e células transformadas ou transfetadas com tais moléculas de ADN ou ARN recombinantes. Os métodos para gerar tais moléculas são bem conhecidos (ver, por exemplo, Sambrook et al., 1989, supra) . A invenção providencia ainda um sistema hospedeiro-vetor compreendendo uma molécula de ADN recombinante contendo um polinucleotídeo 273P4B7, fragmento, análogo ou homólogo do mesmo dentro de uma célula hospedeira procarionte ou eucarionte adequada. Exemplos de células hospedeiras eucariontes adequadas incluem uma célula de levedura, uma célula vegetal, ou uma célula animal, tal como uma célula de mamífero ou uma célula de inseto (por exemplo, uma célula infetável por baculovírus tal como uma célula Sf9 ou HighFive). Exemplos de células de mamífero adequadas incluem várias linhas de células de cancro da 47 próstata tais como DU145 e TsuPrl, outras linhas de células de cancro da próstata transduciveis ou transfetáveis, células primárias (PrEC), bem como um número de células de mamíferos utilizadas de forma rotineira para a expressão de proteínas recombinantes (por exemplo, células COS, CHO, 293, 293T). Mais particularmente, um polinucleotídeo compreendendo a sequência codificante de 273P4B7 ou um fragmento, análogo ou homólogo do mesmo pode ser utilizado para gerar proteínas 273P4B7 ou fragmentos das mesmas utilizando assim qualquer número de sistemas hospedeiro-vetor utilizados de forma rotineira e amplamente conhecidos na arte.
Uma ampla gama de sistemas hospedeiro-vetor adequados para a expressão de proteínas 273P4B7 ou fragmentos dos mesmos estão disponíveis, ver por exemplo, Sambrook et al, 1989, supra; Current Protocols in Molecular Biology, 1995, supra). Os vetores preferidos para a expressão de mamífero incluem, mas não se limitam a, pADNc3.1 myc-His-tag (Invitrogen) e o vetor retroviral pSRatkneo (Muller et al, 1991, MCB 11: 1785). Utilizando estes vetores de expressão, 273P4B7 pode ser expressa em vários cancro da próstata e linhas de células da não próstata, incluindo, por exemplo, 293,293T, rat-1, NIH 3T3 e TsuPrl. Os sistemas hospedeiro-vetor são úteis na produção de uma proteína 273P4B7 ou fragmento da mesma. Tais sistemas hospedeiro-vetor podem ser empregues para estudar as propriedades funcionais de 273P4B7 e mutações ou análogos de 273P4B7.
Proteína 273P4B7 humana recombinante ou um análogo ou homólogo ou fragmento da mesma pode ser produzida por células de mamífero transfetadas com uma construção que codifica um nucleotídeo relacionado com 273P4B7. Por exemplo, as células 293T podem ser transfetadas com um plasmídeo de expressão que codifica 273P4B7 ou fragmento, análogo ou homólogo do mesmo, uma proteína relacionada com 273P4B7 é expressa nas células 293T, e a proteína 273P4B7 48 recombinante é isolada utilizando métodos de purificação padrão (por exemplo, purificação por afinidade utilizando anticorpos anti-273P4B7). Uma sequência que codifica 273P4B7 pode ser subclonada num vetor retroviral pSRaMSVtkneo e utilizada para infetar várias linhas de células de mamíferos, tais como NIN 3T3, TsuPrl, 293 e rat-1 de maneira a estabelecer linhas de células que expressam 273P4B7. Vários outros sistemas de expressão bem conhecidos na arte também podem ser empregues. As construções de expressão que codificam um péptido líder unidos em estrutura a uma sequência que codifica 273P4B7 podem ser utilizadas para a geração de uma forma secretada de proteína 273P4B7 recombinante.
Como discutido aqui, redundância no código genético permite variação em sequências de gene 273P4B7. Em particular, é sabido na arte que a espécie hospedeira específica tem, com frequência, preferências específicas de codão, e, assim, é possível adaptar a sequência revelada como preferido para um hospedeiro desejado. Por exemplo, sequências de codão análogo preferidas tipicamente têm codões raros (isto é, codões que têm uma frequência de uso inferior a cerca de 20% em sequências conhecidas do hospedeiro desejado) substituídos com codões de alta frequência. As preferências de codões para uma espécie específica são calculadas, por exemplo, uilizando tabelas de utilização de codão disponíveis na INTERNET tais como em URL dna.affrc.go.jp/~nakamura/codon.html. São conhecidas modificações adicionais de sequência por aumentar a expressão da proteína num hospedeiro celular. Estas incluem eliminação de sequências que codificam sinais espúrios de poliadenilação, sinais de local de splicing exão/intrão, repetições tipo transpóson, e/ou outras sequências igualmente bem caracterizadas que são deletérias para a expressão génica. O conteúdo GC da sequência é ajustado para níveis médios para um dado 49 hospedeiro celular, como calculado por referência a genes conhecidos expressos na célula hospedeira. Onde possível, a sequência é modificada para evitar estruturas de ARNm secundário hairpin previstas. Outras modificações úteis incluem a adição de uma sequência consenso de iniciação traducional no início da grelha de leitura aberta, como descrito em Kozak, Mol. Cell Biol., 9:5073-5080 (1989). Especialistas habilitados compreendem que a regra geral de que os ribossomas eucariontes iniciam a tradução exclusivamente no codão AUG proximal 5' é anulada apenas em condições raras (ver, por exemplo, Kozak PNAS 92 (7): 2662-2666, (1995) e Kozak NAR 15 (20): 8125-8148 (1987)). III.) Proteínas relacionadas com 273P4B7
Um polinucleotídeo 273P4B7 pode codificar um polipéptido 273P4B7. Proteínas específicas de 273P4B7 compreendem um polipéptido que tem toda ou parte da sequência de aminoácidos de 273P4B7 humano como mostrado na Figura 2 ou Figura 3. Em alternativa, as proteínas 273P487 podem compreender polipeptídeos variantes, homólogos ou análogos que têm alterações na sequência de aminoácidos de 273P4B7 mostrada na Figura 2 ou Figura 3.
Um polipéptido 273P4B7 pode incluir: um polipéptido 273P4B7 que tem uma sequência mostrada na Figura 2, uma sequência peptídica de um 273P4B7 como mostrado na Figura 2 em que T é U; pelo menos 10 nucleotídeos contíguos de um polipéptido que tem asequência como mostrado na Figura 2; ou, pelo menos 10 péptidos contíguos de um polipéptido que tem a sequência como mostrado na Figura 2 onde T é U. Por exemplo, péptidos 273P4B7 podem compreender, sem limitação: (I) uma proteína compreendendo, consistindo essencialmente de, ou consistindo de uma sequência de aminoácidos como mostrado na Figura 2A-F ou Figura 3A-H; (II) uma proteína relacionada com 273P4B7 que é, pelo menos, 90, 91, 92, 93, 94, 95, 96, 97, 8, 99 ou 100% homóloga com uma sequência de aminoácidos completa mostrada 50 na Figura 2A-F ou 3A-H; (III) uma proteína relacionada com 273P4B7 que é, pelo menos, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 ou 100% idêntica a uma sequência de aminoácidos completa mostrada na Figura 2A-F ou 3A-H; (IX) um polipéptido compreendendo, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de uma proteína da Figura 3A, 3C-3E em qualquer incremento de número inteiro até 1250 respetivamente que inclui pelo menos 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,12,13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição(ões) de aminoácido que têm um valor superior a 0,5 no perfil de hidrofobicidade da Figura 5; (X) um polipéptido compreendendo, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de uma proteína da Figura 3A, 3C-3E, em qualquer incremento de número inteiro até 1250 respetivamente que inclui, pelo menos, 1, 2, 3, 4, 5, 6, 7, 8, 9,10, 11, 12, 13, 14, 15,16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição(ões) de aminoácido que têm um valor inferior a 0,5 no perfil de hidropaticidade da Figura 6; (XI) um polipéptido compreendendo, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de uma proteína da Figura 3A, 3C-3E, em qualquer incremento de número inteiro até 1250 respetivamente que inclui, pelo menos, 1, 2, 3, 4, 5, 6, 7, 8, 9,10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição (ões) de aminoácido que têm um valor superior a 0,5 no perfil de percentagem de resíduos acessíveis da Figura 7; (XII) um polipéptido compreendendo, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 51 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de uma proteína da Figura 3A, 3C-3E, em qualquer incremento de número inteiro até 1250 respetivamente que inclui, pelo menos, 1, 2, 3, 4, cn > > co 9, 10, 11, 12, 13, 14, LD i—1 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição(ões ) de aminoácido que têm um valor superior a 0,5 no perfil de flexibilidade média da Figura 8; (XIII) um polipéptido compreendendo, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, aminoácidos de uma proteína da Figura 3A, 3C-3E em qualquer incremento de número inteiro até 1250 respetivamente que inclui, pelo menos, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição(ões) de aminoácido que têm um valor superior a 0,5 no perfil de volta beta da Figura 9; (XIV) um polipéptido compreendendo, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de uma proteína da Figura 3B, em qualquer incremento de número inteiro até 1127 respetivamente que inclui, pelo menos, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição (ões) de aminoácido que têm um valor superior a 0,5 no perfil de hidrofobicidade da Figura 5; (XV) um polipéptido compreendendo, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de uma proteína da Figura 3B, em qualquer incremento de número inteiro até 1127 respetivamente que inclui, pelo menos, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição (ões) de aminoácido que têm um 52 valor inferior a 0,5 no perfil de hidropaticidade da Figura 6; (XVI) um polipéptido compreendendo, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de uma proteína da Figura 3B, em qualquer incremento de número inteiro até 1127 respetivamente que inclui, pelo menos, at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, \—1 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição(ões) de aminoácido que têm um valor superior a 0, 5 no perfil de percentagem de resíduos acessíveis da Figura 7; (XVII) um polipéptido compreendendo, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 aminoácidos de uma proteína da Figura 3B, em qualquer incremento de número inteiro até 1127 respetivamente que inclui, pelo menos, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição(ões) de aminoácido que têm um valor superior a 0.,5 no perfil de flexibilidade média da Figura 8; (XVIII) um polipéptido compreendendo, pelo menos, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, aminoácidos de uma proteína da Figura 3B em qualquer incremento de número inteiro até 1127 respetivamente que inclui, pelo menos, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 posição (ões) de aminoácido que têm um valor superior a 0,5 no perfil de volta beta da Figura 9; (XXVII) um péptido que compreende um, duas, três, quatro, ou cinco das seguintes características, ou um oligonucleotídeo que codifica tal péptido: i) uma região de, pelo menos, 5 aminoácidos de um péptido 53 particular da Figura 3, em qualquer incremento de número inteiro até ao comprimento total daquela proteína na Figura 3, que inclui uma posição de aminoácido que tem um valor superior ou igual a 0,5, 0,6, 0,7, 0,8, 0,9, ou que tem um valor igual a 1,0, no perfil de hidrofobicidade da Figura 5; ii) uma região de, pelo menos, 5 aminoácidos de um péptido particular da Figura 3, em qualquer incremento de número inteiro até ao comprimento total daquela proteína na Figura 3, que inclui uma posição de aminoácido que tem um valor inferior ou igual a 0,5, 0,4, 0,3, 0,2, 0,1, ou que tem um valor igual a 0,0, no perfil de hidropaticidade da Figura 6; iii) uma região de, pelo menos, 5 aminoácidos de um péptido particular da Figura 3, em qualquer incremento de número inteiro até ao comprimento total daquela proteína na Figura 3, que inclui uma posição de aminoácido que tem um valor superior ou igual a 0,5, 0,6, 0,7, 0,8, 0,9, ou que tem um valor igual a 1,0, no perfil de percentagem de resíduos acessíveis da Figura 7; iv) uma região de, pelo menos, 5 aminoácidos de um péptido particular da Figura 3, em qualquer incremento de número inteiro até ao comprimento total daquela proteína na Figura 3, que inclui uma posição de aminoácido que tem um valor superior ou igual a 0,5, 0,6, 0,7, 0,8, 0,9, ou que tem um valor igual a 1,0, no prfil de flexibilidade média da Figura 8; ou, v) uma região de, pelo menos, 5 aminoácidos de um péptido particular da Figura 3, em qualquer incremento de número inteiro até ao comprimento total daquela proteína na Figura 3, que inclui uma posição de aminoácido que tem um valor superior ou igual a 0,5, 0,6, 0,7, 0,8, 0,9, ou que tem um valor igual a 1,0, no perfil de volta beta da Figura 9;;
Em geral, variantes alélicas que ocorrem naturalmente de 273P4B7 humana partilham um grau elevado de identidade 54 estrutural e homologia (por exemplo, 90% ou mais de homologia). Tipicamente, variantes alélicas de uma proteína 273P4B7 contêm substituições de aminoácidos conservadoras dentro das sequências 273P4B7 descritas aqui ou contêm uma substituição de um aminoácido de uma posição correspondente num homólogo de 273P4B7. Uma classe de 273P4B7 variantes alélicas são proteínas que partilham um elevado grau de homologia com, pelo menos, uma região pequena de uma sequência de aminoácidos particular de 273P4B7, mas partilham ainda uma diferença radical da sequência, tal como uma substituição não conservadora, mutilação, inserção ou alteração da estrutura. Em comparações de sequências proteicas, os termos, semelhança, identidade, e homologia cada têm um significado distinto como apreciado no campo da genética. Além disso, ortologia e paralogia podem ser conceitos importantes que descrevem a relação de membros de uma dada família de proteínas num organismo com os membros da mesma família noutros organismos. São providenciadas abreviações de aminoácidos no Quadro II. Substituições de aminoácidos conservadoras podem frequentemente ser feitas numa proteína sem alterar quer a conformação ou a função da proteína. As proteínas da invenção podem compreender 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 substituições conservadoras. Tais alterações incluem substituir qualquer de isoleucina (I), valina (V), e leucina (L) por quaisquer outro destes aminoácidos hidrofóbicos; ácido aspártico (D) por ácido glutâmico (E) e vice versa; glutamina (Q) por asparagina (N) e vice versa; e serina (S) por treonina (T) e vice versa. Outras substituições também podem ser consideradas conservadoras, dependendo do ambiente de um aminoácido particular e do seu papel na estrutura tridimensional da proteína. Por exemplo, glicina (G) e alanina (A) podem ser intercambiáveis frequentemente, tal como o podem alanina (A) e valina (V). Metionina (M), que é relativamente 55 hidrofóbica, pode ser intercambiável com frequência com leucina e isoleucina, e por vezes com valina. Lisina (K) e arginina (R) são frequentemente intercambiáveis em localizações nas quais a caracteristica principal do residuo de aminoácido é a sua carga e as diferenças entre os pK destes dois resíduos de aminoácido não são significativos. Ainda assim, outras alterações podem ser consideradas "conservadoras" em ambientes particulares (ver, por exemplo Quadro III aqui; páginas 13-15 "Biochemistry" 2a EDIÇÃO. Lubert Stryer editor (Universidade de Stanford); Henikoff et al., PNAS 1992 Vol. 89 10915-10919; Lei et al., J Biol Chem 1995 May 19; 270(20): 11882-6).
Uma grande variedade de variantes ou análogos aceites pela arte de proteínas 273P4B7 tais como polipeptídeos tendo inserções, deleções e substituições de aminoácidos. As variantes de 273P4B7 podem ser feitas utilizando métodos conhecidos na arte tais como mutagénese sítio-dirigida, digitalização de alanina, e mutagénese por PCR. A mutagénese sítio-dirigida (Cárter et al., Nucl. Acids Res., 13:4331 (1986); Zoller et al., Nucl. Acids Res., 10:6487 (1987)), cassete de mutagénese (Wells et al., Gene, 34:315 (1985)), mutagénese de seleção de restrição (Wells et al., Philos. Trans. R. Soc. London Série A, 317:415 (1986)) ou outras técnicas conhecidas podem ser realizadas no ADN clonado para produzir ADN de variante de 273P4B7.
Proteínas relacionadas com 273P4B7 são geradas utilizando tecnologia padrão de síntese peptídica ou utilizando métodos de separação químicos bem conhecidos na arte. Em alternativa, métodos recombinantes podem ser utilizados para gerar moléculas de ácido nucleico que codificam uma proteína relacionada com 273P4B7. Moléculas de ácido nucleico podem providenciar um meio para gerar fragmentos definidos de uma proteína 273P4B7 (ou variantes, homólogos ou análogos do mesmo). 56 A invenção compreende sequências de ácido nucleico de 273P4B7. Um fragmento de proteína pode ser: uma subsequência de, pelo menos, 158, ou 262, ou 420 aminoácidos contíguos de uma proteína da 273P4B7 v.l; uma subsequência de aminoácidos de uma proteína da 273P4B7 v. 1 com uma cláusula de que a proteína 273P4B7 v.l é tal que não inclui uma valina (V) ou metionina (M) na posição 145; arginina (R) ou glicina (G) na posição 172; isoleucina (I) ou valina (V) na posição 889; ou, lisina (K) ou arginina (R) na posição 989. Uma sequência de aminoácidos pode ser um fragmento de uma proteína da 273P4B7 v.l com uma cláusula de que não é uma proteína de 273P4B7 v. 9, v.10 ou v. 11 . Um fragmento de aminoácido pode ser 4, 5, 6, 7, 00 O \—1 11, 1 2, 13 , 14, 15, 16, 17, 18, 19, 20, 21, 22 , 23 , 24, 25, 30, 3 5, 40 , 45, 50, 55, 60, 65, 70, 75, 80, 85 , 90 , 95, 100, 105, 110, 115, 120, 125, 130, 135, 140 , 145, 150 , 155, 56, 157, 158, 159, 160, 161, 162, 163, 164, 165, 170, 175, 180, 185, 190, 195, 200, 225, 250, 260, 261, 262, 263, 264, 265, 270, 275, 300, 325, 350, 375, 400, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 422, 434, 435, 450, 475, 500, 525, 550, 575, 600, 650, 675, 700, 705, 710, 715, 716, 717, 718, 719, 720, 725, 750, 775, 800, 825, 850 , 875 , 90 0, 92 Ϊ 5, 950, 9 75,1000, 1025,1 050, 1075, 1100 , 13 .25, 1127, 11 50, 1175, 1201 o, : 1025, ou 1250 aminoácidos contíguos de uma proteína da Figura 2; o fragmento/subsequência pode compreender um motivo funcional ou estrutural, por exemplo, como apresentado aqui, ou compreender um epítopo de sistema imune (anticorpo ou célula T). Uma sequência de ácido nucleico da invenção pode compreender uma sequência que codifica uma sequência de aminoácidos como apresentado aqui. III.A.) Expressão de proteínas relacionadas com 273P4B7
Nos exemplos que se seguem, 2 73P4B7 pode ser convenientemente expressa em células (tais como células 293T) transfetadas com um vetor de expressão comercialmente 57 disponível tal como um vetor de expressão dirigido pelo CMV que codifica 273P4B7 com um terminal C 6XHis e MYC tag (pcDNA3.1/mycHIS, Invitrogen ou Tag5, GenHunter Corporation, Nashville TN) . 0 vetor Tag5 providencia um sinal de secreção IgGK que pode ser utilizado para facilitar a produção de uma proteína 273P4B7 segregada em células transfetadas. A 273P4B7 HIS-rotulada segregada no meio de cultura pode ser purificada, por exemplo, utilizando uma coluna de níquel utilizando técnicas padrão. IV) Métodos para a deteção de 273P4B7
Outro aspeto da presente invenção relaciona-se com métodos para detetar polinucleotídeos 273P4B7, bem como métodos para identificar uma célula que expressa 273P4B7. 0 perfil de expressão de 273P4B7 torna-o um marcador diagnóstico para doença que entrou em metástase. Em concordância, o estado dos produtos do gene 273P4B7 providencia informação útil para predizer uma variedade de fatores incluindo suscetibilidade à doença em fase avançada, taxa de progressão, e/ou agressividade do tumor. Como discutido em detalhe aqui, o estado dos produtos do gene 273P4B7 em amostras de pacientes pode ser analisado por uma variedade de protocolos que são bem conhecidos na arte incluindo análise imunohistoquímica, a variedade de técnicas de Northern blotting incluindo hibridação in situ, análise RT-PCR (por exemplo, em amostras microdissecadas por captura por laser), análise Western blot e análise de coleção de tecido.
Mais particularmente, a invenção providencia testes para a deteção de polinucleotídeos 273P4B7 numa amostra biológica, tal como soro, osso, próstata, e outros tecidos, urina, sémen, preparações celulares, e afins. Polinucleotídeos 273P4B7 detetáveis incluem, por exemplo, um gene 273P4B7 ou fragmento do mesmo, ARNm de 273P4B7, variante de splicing alternativo de ARNms de 273P4B7, e moléculas de ADN ou ARN recombinantes que contêm 58 polinucleotídeo 273P4B7. Um número de métodos para amplificar e/ou detetar a presença de polinucleotídeo 273P4B7 são bem conhecidos na arte e podem ser empregues na prática deste aspeto da invenção.
Numa modalidade, um método para detetar um ARNm de 273P4B7 numa amostra biológica compreende produzir ADNc a parir da amostra por transcrição reversa utilizando, pelo menos, um iniciador, amplificar o ADNc então produzido utilizando polinucleotídeos 273P4B7 como iniciadores senso e anti-sense para amplificar ADNc de 273P4B7 neles; e detar a presença do cDNA de 273P4B7 amplificado. Opcionalmente, a sequência do ADNc de 273P4B7 amplificado pode ser determinada.
Noutra modalidade, um método de detetar um gene 273P4B7 numa amostra biológica compreende primeiro isolar ADN genómico a partir da amostra; amplifiar o ADN genómico isolado utilizando polinucleotídeos 273P4B7 como iniciadores senso e anti-sense; e detetar a presença do gene 273P4B7 amplificado. Qualquer número de combinações de sonda senso e anti-sense apropriadas pode ser desenhado a partir de uma sequência nucleotídica de 273P4B7 (ver, por exemplo, Figura 2) e utilizada para este fim. Métodos para identificar uma célula que expressa 273P4B7 estão também dentro do âmbito da invenção. Numa modalidade, um ensaio para identificar uma célula que expressa um gene 273P4B7 compreende detetar a presença de ARNm de 2 73P48 7 na célula. Métodos para a deteção de ARNm particulares nas células são bem conhecidos e incluem, por exemplo, testes de hibridação utilizando sondas de ADN complementares (tais como hibridação in situ utilizando ribossondas 273P4B7 rotuladas, Northern blot e técnicas relacionadas) e vários testes de amplificação de ácidos nucleicos (tais como RT-PCR utilizando iniciadores complementares específicos para 273P4B7, e outros métodos de deteção tipo de amplificação, tais como, por exemplo, 59 ADN ramificado, SISBA, TMA e afins). A análise da expressão de 273P4B7 também é útil como ferramenta para identificar e avaliar agentes que modulam a expressão génica de 273P4B7. Por exemplo, a expressão de 273P4B7 é significativamente regulada para cima no cancro da próstata, e é expressa em cancros dos tecidos listados no Quadro I. A identificação de uma molécula ou agente biológico que inibe a expressão de 273P4B7 ou sobre-expressão em células cancerígenas é de valor terapêutico. Por exemplo, tal agente pode ser identificado utilizando um ecrã que quantifica a expressão de 273P4B7 por RT-PCR, hibridação de ácido nucleico ou ligação do anticorpo. V) Métodos para monitorizar o estado dos genes relacionados com 273P4B7 e seus produtos A oncogénese é conhecida por ser um processo multi-etapas onde o crescimento celular se torna progressivamente desregulado e o progresso das células de um estado fisiológico normal para pré-canceroso e depois estados cancerosos (ver, por exemplo, Alers et al., Lab Invest. 77 (5): 437-438 (1997) e Isaacs et al., Câncer Surv. 23:19-32 (1995)). Neste contexto, examinar uma amostra biológica para evidência de crescimento celular desregulado (tal como expressão aberrante de 273P4B7 em cancros) permite a deteção precoce de tal fisiologia aberrante, antes de um estado patológico tal como cancro ter progredido para um estado em que as opções terapêuticas são mais limitadas e/ou o prognóstico é pior. Em tais exames, o estado de 273P4B7 numa amostra biológica de interesse pode ser comparado, por exemplo, com o estado de 273P4B7 numa amostra normal correspondente (por exemplo uma amostra daquele indivíduo ou em alternativa outro indivíduo que não é afetado por uma patologia). Uma alteração no estado de 273P4B7 na amostra biológica (como comparado com a amostra normal) providencia evidência de crescimento celular desregulado. Além de utilizar uma amostra biológica que não 60 é afetada por uma patologia como uma amostra normal, também é possível utilizar um valor normativo pré-determinado tal como um nível normal pré-determinado de expressão de ARNm (ver, por exemplo, Grever et al. , J. Comp. Neurol. 9 de Dezembro de 1996; 376(2): 306-14 e Patente U.S. N.° 5 837 501) para comparar o estado de 273P4B7 numa amostra. O termo "estado" neste contexto é utilizado de acordo com o seu significado aceite na arte e refere-se à condição ou estado de um gene e seus produtos. Tipicamente, especialistas habilitados utilizam um número de parâmetros para avaliar a condição ou estado de um gene e seus produtos. Estes incluem, mas não se limitam, à localização de produtos de gene expressos (incluindo a localização de células que expressam 273P4B7) bem como o nível, e atividade biológica de produtos de genes expressos (tais como ARNm de 273P4B7, polinucleotídeos e polipeptídeos). Tipicamente, uma alteração no estado de 273P4B7 compreende uma alteração na localização de 273P4B7 e/ou células que expressam 273P4B7 e/ou um aumento em ARNm de 273P4B7 e/ou expressão proteica. O estado de 273P4B7 numa amostra pode ser analisado por um número de meios bem conhecidos na arte, incluindo sem limitação, análise imunohistoquímica, hibridação in situ, análise RT-PCR em amostras microdissecadas por captura por laser, análise Western blot, e análise de coleção de tecido. Protocolos típicos para avaliar o estado de um gene 273P4B7 e os produtos do gene são encontrados, pr exemplo em Ausubel et al. editores, 1995, Current Protocols in Molecular Biology, Unidades 2 (Northern Blotting), 4 (Southern Blotting), 15 (Imunoblotting) e 18 (Análise PCR) . Assim, o estado de 273P4B7 numa amostra biológica é avaliado por vários métodos utilizados por especialistas habilitados incluindo, mas não limitado a, análise Southern genómica (para examinar, por exemplo, perturbações num gene 273P4B7), analise Northern e/ou 61 análise PCR de ARNm de 273P4B7 (para examinar, por exemplo alterações nas sequências de polinucleotídeo ou níveis de expressão de ARNm de 273P4B7), e, análise Western e/ou imunohistoquímica (para examinar, por exemplo alterações nas sequências de polipeptídeo, alterações na localização do polipeptídeo dentro de uma amostra, alterações nos níveis de expressão de proteínas 273P4B7 e/ou associações de proteínas 273P4B7 com parceiros de ligação de polipeptídeo). Polinucleotídeos 273P4B7 detetáveis incluem, por exemplo, um gene 273P4B7 ou fragmento do mesmo, ARNm de 273P4B7, variantes de splicing alternativo, ARNm de 273P4B7, e moléculas de ADN ou ARN recombinantes contendo um polinucleotídeo 273P4B7. 0 perfil de expressão de 273P4B7 torna-o um marcador diagnóstico para doença local e/ou em metástases, e providencia informação sobre o crescimento ou potencial oncogénico de uma amostra biológica. Em particular, o estado de 273P4B7 providencia informação útil para predizer a suscetibilidae a estádios da doença particulares, progressão, e/ou agressividade do tumor. A invenção providencia métodos e testes para determinar o estado de 273P487 e diagnosticar cancros que expressam 273P4B7, tais como cancros dos tecidos listados no Quadro I. Por exemplo, porque o ARNm de 2 73P4B7 é tão altamente expresso na próstata e outros cancros relativos ao tecido normal da próstata, testes que avaliam os níveis de transcritos de ARNm de 273P4B7 numa amostra biológica podem ser utilizados para diagnosticar uma doença associada com desregulação de 273P4B7, e podem providenciar informação prognóstica útil para definir opções terapêuticas apropriadas. 0 estado de expressão de 273P4B7 providencia informação incluindo a presença, estádio e localizações de células displásticas, pré-cancerosas e cancerosas, prevendo a suscetibilidade a vários estádios da doença, e/ou para calibrar a agressividade do tumor. Além disso, o perfil de 62 expressão torna-o útil como uma reagente de tomografia para doença com metástases. Consequentemente, um aspeto da invenção é dirigido a vários métodos de diagnóstico e prognóstico molecular para examinar o estado de 273P4B7 em amostras biológicas tais como aquelas de indivíduos que padecem de, ou suspeitos de sofrer de uma patologia caracterizada por crescimento celular desregulado, tal como cancro.
Como descrito em cima, o estado de 273P4B7 numa amostra biológica pode ser examinado por um número de procedimentos bem conhecidos na arte. Por exemplo, o estado de 273P4B7 numa amostra biológica retirada de uma localização específica no corpo pode ser examinada avaliando a amostra para a presença ou ausência de células que expressam 273P4B7 (por exemplo aquelas que expressam ARNm de 273P4B7). Esta análise pode providenciar evidência de crescimento celular desregulado, por exemplo, quando as células que expressam 273P4B7 são encontradas numa amostra biológica que não contém normalmente tais células (tais como um nódulo linfático), porque tais alterações no estado de 273P4B7 numa amostra biológica estão frequentemente associadas com crescimento celular desregulado. Especificamente, um indicador de crescimento celular desregulado são as metástases de células cancerígenas de um órgão de origem (tal como a próstata) para uma área diferente do corpo (tal como um nódulo linfático) . Neste contexto, a evidência de crescimento celular desregulado é importante, por exemplo, porque metástases ocultas de nódulo linfático podem ser detetadas numa proporção substancial de pacientes com cancro da próstata, e tais metástases estão associadas com prognosticadores conhecidos de progressão da doença (ver, por exemplo, Murphy et al., Prostate 42(4): 315-317 (2000); Su et al., Semin. Surg. Oncol. 18 (1): 17-28 (2000) e Freeman et al., J Urol 1995 Agosto 154(2 Pt 1):474-8). 63
Num aspeto, a invenção providencia método para monitorizar os produtos do gene 273P4B7 determinando o estado dos produtos do gene 273P4B7 expressos por células de um indivíduo suspeito de ter uma doença associada com crescimento celular desregulado (tal como hiperplasia ou cancro) e depois comparar o estado então determinado com o estado dos produtos de gene 273P4B7 numa amostra normal correspondente. A presença de produtos do gene 273P4B7 aberrantes na amostra teste relativa à amostra normal providencia uma indicação da presença de crescimento celular desregulado dentro das células do indivíduo.
Num outro aspeto, a invenção providencia testes úteis em determinar a presença de cancro num indivíduo, compreendendo detetar um aumento significativo na expressão de ARNm de 273P4B7 numa célula teste ou amostra de tecido em relação aos níveis de expressão na célula ou tecido normal correspondente. A presença de ARNm de 273P4B7 pode, por exemplo, ser avaliada em tecidos incluindo, mas não limitados, àqueles listados no Quadro I. A presença de expressão significativa de 273P4B7 em qualquer destes tecidos é útil para indicar a emergência, presença e/ou severidade de um cancro, uma vez que os tecidos normais correspondentes não expressam ARNm de 273P4B7 ou expressam-no em níveis baixos.
Numa modalidade adicional, é possível avaliar o estado do nucleotídeo 273P4B7 e sequências de aminoácidos numa amostra biológica de modo a identificar perturbações na estrutura destas moléculas. Estas perturbações podem incluir inserções, deleções, substituições e afins. Tais avaliações são úteis porque perturbações no nucleotídeo e sequências de aminoácidos são observadas num grande número de proteínas associadas com um fenótipo de crescimento desregulado (ver, por exemplo, Marrogi et al., 1999, J. Cutan. Pathol. 26(8):369-378). Por exemplo, uma mutação na sequência de 273P4B7 pode ser indicativa da presença ou promoção de um tumor. Tais ensaios, portanto, têm valor diagnóstico e preditivo onde uma mutação em 273P4B7 indica uma perda potencial da função ou aumento no crescimento do tumor.
Uma grande variedade de testes para observar perturbações em sequências de nucleotídeo e de aminoácidos são bem conhecidos na arte. Por exemplo, e tamanho e estrutura das sequências de aminoácidos ou ácidos nucleicos dos produtos do gene 273P4B7 são observadas por protocolos Northern, Southern, Western, PCR e de sequenciação de ADN discutidos aqui. Além disso, outros métodos para observar perturbações em sequências de nucleotídeo e de aminoácidos tais como análise de polimorfismo de conformação de cadeia simples são bem conhecidos na arte (ver, por exemplo, Patentes U.S. N.°s 5 382 510 emitida a 7 de Setembro e 1999, e 5 952 170 emitida a 17 de Janeiro de 1995).
Além disso, é possível examinar o estado de metilação de um gene 273P4B7 numa amostra biológica. Desmetilação e/ou hipermetilação aberrante de ilhas CpG em regiões 5' reguladoras de gene ocorre frequentemente em células imortalizadas e transformadas, e pode resultar na expressão alterada de vários genes. Por exemplo, o promotor de hipermetilação da classe pi glutationa S-transferase (uma proteína expressa na próstata normal mas não expressa em >90% de carcinomas da próstata) parece silenciar permanentemente a transcrição deste gene e é a alteração genómica mais frequentemente detetada em carcinomas da próstata (De Marzo et al., Am. J. Pathol. 155(6): 1985-1992 (1999)). Além disso, esta alteração está presente em, pelo menos, 70% dos casos de neoplasia intraepitelial prostática (PIN) de alto grau (Brooks et al., Câncer Epidemiol. Biomarkers Prev., 1998, 7:531-536). Num outro exemplo, a expressão do gene específico do tumor LAGE-I (que não é expresso na próstata normal mas é expresso em 25-50% de cancros da próstata) é induzida por desoxi-azacitidina em 65 células linfoblastoides, o que sugere que a expressão tumoral é devida à desmetilação (Lethe et al., Int. J. Câncer 76(6): 903-908 (1998)). Uma variedade de testes para examinar o estado de metilação de um gene são bem conhecidos na arte. Por exemplo, é possível utilizar, em abordagens de hibridação Southern, enzimas de restrição sensíveis à metilação que não podem separar sequências que contêm locais CpG metilados para avaliar o estado de metilação das ilhas CpG. Além disso, MSP (PCR específica de metilação) pode perfilar rapidamente o estado de metilação de todos os locais CpG presentes numa ilha CpG de um dado gene. Este procedimento envolve modificação inicial do ADN por bissulfito de sódio (que converterá todas as citosinas não metiladas em uracilo) seguido de amplificação utilizando iniciadores específicos para ADN metilado versus não metilado. Os protocolos envolvendo a interferência de metilação também podem ser encontrados, por exemplo, em Current Protocols In Molecular Biology, Unidade 12, Frederick M. Ausubel et al. eds., 1995. A amplificação génica é um método adicional para avaliar o estado de 273P4B7. A amplificação génica é medida diretamente numa amostra, por exemplo, por Southern blotting ou Northern blotting convencional para quantificar a transcrição de ARNm (Thomas, 1980, Proc. Natl. Acad. Sei. USA, 77:5201-5205), dot blotting (análise de ADN), ou hibridação in situ, utilizando uma sonda rotulada de forma apropriada, com base nas sequências providenciadas aqui. Em alternativa, são empregues anticorpos que reconhecem dúplices específicos, incluindo dúplices de ADN, dúplices de ARN, e dúplices de híbridos ADN-ARN ou dúplices de proteína ADN. Os anticorpos, por sua vez, são rotulados e o ensaio realizado onde o dúplice está ligado a uma superfície, para que na formação do dúplice na superfície, a presença de anticorpo ligado ao dúplice pde ser detetado.
Tecido biopsiado ou sangue periférico pode ser 66 convenientemente testado para a presença de células cancerosas utilizando, por exemplo, análise Northern, dot blot ou RT-PCR para detetar a expressão de 273P4B7. A presença de ARNm de 273P4B7 amplificável por RT-PCR providencia uma indicação da presença de cancro. Testes RT-PCR são bem conhecidos na arte. Os testes de deteção por RT-PCR para células tumorais no sangue periférico estão atualmente a ser avaliados para uso no diagnóstico e gestão de um número de tumores sólidos humanos. No campo do cancro da próstata, estes incluem testes RT-PCR para a deteção de células que expressam PSA e PSM (Verkaik et al., 1997, Urol. Res. 25:373-384; Ghossein et al., 1995, J. Clin. Oncol. 13:1195-2000; Heston et al., 1995, Clin. Chem. 41 : 1687-1688) .
Um aspeto adicional é uma avaliação da suscetibilidade que um indivíduo tem de desenvolver cancro. Um método para predizer suscetibilidade ao cancro pode compreender detetar ARNm de 273P487 numa amostra de tecido, indicando a sua presença suscetibilidade a cancro, em que o grau da expressão de ARNm de 273P4B7 se correlaciona com o grau de suscetibilidade. A presença de 273P4B7 na próstata ou outro tecido pode ser examinada, com a presença de 273P4B7 na amostra providenciando uma indicação da suscetibilidade ao cancro da próstata (ou a emergência ou existência de um tumor na próstata). Da mesma forma, é possível avaliar a integridade de sequências de nucleotídeo e de aminoácidos 273P4B7 numa amostra biológica, de maneira a identificar perturbações na estrutura destas moléculas tais como inserções, deleções, substituições e afins. A presença de uma ou mais perturbações em produtos do gene 2 73P4B7 na amostra é uma indicação de suscetibilidade ao cancro (ou a emergência ou existência de um tumor).
Podem ser utilizados métodos para calibrar a agressividade do tumor. Um método para calibrar a agressividade de um tumor pode compreender determinar o 67 nível de ARNm de 273P4B7 expresso por células do tumor, comparando o nível então determinado com o nível de ARNm de 273P4B7 expresso num tecido normal correspondente retirado de um mesmo indivíduo ou de uma amostra referência de tecido normal, em que o grau de expressão de ARNm de 273P4B7 na amostra do tumor em relação à amostra normal indica o grau de agressividade. A agressividade de um tumor pod ser avaliada determinando a extensão em que 273P4B7 é expresso em células tumorais, com níveis de expressão mais elevados indicando tumores mais agressivos. Outra modalidade é a avaliação da integridade de sequências de nucleotídeo e de aminoácidos 273P4B7 numa amostra biológica, de maneira a identificar perturbações na estrutura destas moléculas tais como inserções, deleções, substituições e afins. A presença de uma ou mais perturbações indica tumores mais agressivos.
Podem ser utilizados métodos para observar a progressão de uma malignidade num indivíduo ao longo do tempo. Métodos para observar a progressão de uma malignidade num indivíduo ao longo do tempo pode compreender determinar o nível de ARNm de 273P4B7 expresso por células numa amostra do tumor, comparando o nível então determinado com o nível de ARNm de 273P4B7 expresso numa amostra de tecido equivalente retirada de um mesmo indivíduo num tempo diferente, em que o grau de expressão de ARNm de 273P4B7 numa amostra de tumor ao longo do tempo providencia informação sobre a progressão do cancro. A progressão de um cancro pode ser avaliada determinando a expressão de 273P4B7 em células tumorais ao longo do tempo, onde a expressão aumentada ao longo do tempo indica uma progressão do cancro. Além disso, é possível avaliar a integridade de sequências de nucleotídeo e de aminoácidos 273P4B7 numa amostra biológica de maneira a identificar perturbações na estrutura destas moléculas tais como inserções, deleções, substituições e afins, onde a presença 68 de uma ou mais perturbações indica uma progressão do cancro.
As abordagens de diagnóstico anteriores podem ser combinadas com qualquer uma de uma grande variedade de protocolos de prognóstico e diagnóstico conhecidos na arte. Por exemplo, podem ser utilizados métodos para observar uma coincidência entre a expressão do gene 273P4B7 e produtos do gene 273P4B7 (ou perturbações no gene 273P4B7 e produtos do gene 273P4B7) e um fator que está associado com malignidade, como uma forma de diagnosticar e prognosticar o estado de uma amostra de tecido. Uma grande variedade de fatores associados com malignidade pode ser utilizada, tis como a expressão de genes associados com malignidade (por exemplo expressão de PSA, PSCA e PSM para cancro da próstata, etc.) bem como observações citológicas brutas (ver, por exemplo, Bocking et al., 1984, Anal. Quant. Cytol. 6(2):74-88; Epstein, 1995, Hum. Pathol. 26 (2):223 — 9; Thorson et al., 1998, Mod. Pathol. 11 (6) :543-51; Baisden et al., 1999, Am. J. Surg. Palhol. 23(8):918-24). Métodos para observar uma coincidência entre a expressão do gene 273P4B7 e produtos do gene 273P4B7 (ou perturbações no gene 273P4B7 e produtos do gene 273P4B7) e outro fator que está associado com malignidade são úteis, por exemplo, porque a presença de um conjunto de fatores específicos que coincidem com doença providencia informação crucial para diagnosticar e prognosticar oe stado de uma amostra de tecido. Métodos para observar uma coincidência entre a expressão do gene 273P4B7 e produtos do gene 273P4B7 (ou perturbações no gene 273P4B7 e produtos do gene 273P4B7) e outro fator associado com malignidade requerem detetar a sobre-expressão de ARNm de 273P487 numa amostra de tecido, detetando a sobre-expressão de PSA ARNm ou proteína numa amostra de tecido (ou expressão de PSCA ou PSM), e observar uma coincidência de sobre-expressão de ARNm de 273P4B7 e 69 PSA ARNm ou proteína (ou expressão de PSCA ou PSM) . A expressão de 273P4B7 e PSA. ARNm em tecido da próstata pode ser examinada, onde a coincidência de 273P4B7 e sobre-expressão de PSA ARNm na amostra indica a existência de cancro da próstata, suscetibilidade ao cancro da próstata ou a emergência ou estado de um tumor na próstata. Métodos para detetar e quantificar a expressão de ARNm de 273P4B7 são descritos aqui, tecnologias padrão de quantificação e deteção de ácido nucleico são bem conhecidas na arte. Métodos padrão para a deteção e quantificação de ARNm de 273P4B7 incluem hibridação in situ utilizando ribossondas 273P4B7 rotuladas, Northern blot e técnicas relacionadas utilizando sondas de polinucleotídeo 273P4B7, análise RT-PCR utilizando iniciadores específicos para 273P4B7, e outros métodos de deteção tipo amplificação, tais como, por exemplo, ADN ramificado, SISBA, TMA e afins. Numa modalidade específica, RT-PCR semi-quantitativa é utilizada para detetar e quantificar a expressão de ARNm de 273P4B7. Qualquer número de iniciadores capazes de amplificar 273P4B7 pode ser utilizado para este fim, incluindo, mas não limitado, aos vários conjuntos de iniciadores especificamente descritos aqui. VI.) Modalidades de diagnóstico e prognóstico de 273P4B7.
Como revelado aqui, polinucleotideos 273P4B7, são utilizados em testes diagnósticos, prognóssticos e terapêuticos bem conhecidos que examinam as condições associadas com crescimento celular desregulado, tais como cancro, em particular os cancros litados no Quadro I (ver, por exemplo, tanto o seu padrão específico de expressão do tecido bem como a sua sobre-expressão em certos cancros como descrito, por exemplo, no Exemplo designado "Análise da expressão de 273P4B7 em tecidos normais, e espécimes de paciente "). 273P4B7 pode ser analogizado a um PSA de antigeno 70 associado à próstata, o marcador arquétipo que tem sido utilizado por profissionais médicos durante anos para identificar e monitorizar a presença de cancro da próstata (ver, por exemplo, Merrill et al., J. Urol. 163 (2): 503-5120 (2000); Polascik et al., J. Urol. Aug; 162(2): 293-306 (1999) e Fortier et al., J. Nat. Câncer lnst. 91 (19): 1635-1640(1999)). Uma variedade de outros marcadores diagnósticos também são utilizados em contextos semelhantes incluindo p53 e K-ras (ver, por exemplo, Tulchinsky et al., Int J Mol Med Julho de 1999 4(1):99-102 e Minimoto et al., Câncer Detect Prev 2000; 24(1): 1-12). Assim, esta revelação de polinucleotideos 273P4B7 (bem como sondas de polinucleotideo 273P4B7 utilizadas para identificar a presença destas moléculas) e as suas propriedades permite aos especialistas habilitados utilizarem estas moléculas em métodos que são análogos àqueles utilizados, por exemplo, numa variedade de testes de diagnóstico dirigidos a examinar as condições associadas com cancro.
Modalidades típicas de métodos de diagnóstico que utilizam os polinucleotideos 273P4B7, sã análogos àqueles métodos de testes de diagnóstico bem estabelecidos, que empregam, por exemplo, polinucleotideos PSA, polipepetídeos, células T reativas e anticorpos. Por exemplo, tal como os polinucleotideos PSA são utilizados como sondas (por exemplo, na análise Northern, ver, por exemplo, Sharief et al., Biochem. Mol. Biol. Int. 33(3):567-74(1994)) e iniciadores (por exemplo, na análise PCR, ver, por exemplo, Okegawa et al., J. Urol. 163(4): 1189-1190 (2000)) para observar a presença e/ou o nivel de PSA ARNm em métodos de monitorizar a sobre-expressão de PSA ou as metástases dos cancros da próstata, os polinucleotideos 273P4B7 descritos aqui podem ser utilizados da mesma maneira para detetar a sobre-expressão de 273P487 ou as metástatses da próstata e outros cancros que expressam este gene. 71
Especificamente, porque as metástases encolvem o movimento de células cancerosas de um orgão de origem (tal como pulmão ou glândula da próstata, etc.) para uma área do corpo diferente (tal como um nódulo linfático), os testes que examinam uma amostra biológica para a presença de células que expressam polinucleotideos 273P4B7 podem ser utilizados para providenciar evidência de metástases. Por exemplo, quando se verifica que uma amostra biológica de tecido que não contém normalmente células que expressam 273P4B7 (nódulo linfático) contém células que expressam 273P4B7, tal como a expressão de 273P4B7 observada em LAPC4 e LAPC9, xenoenxertos isolados do nódulo linfático e metástases do osso, respetivamente, esta observação é indicativa de metástases.
Em alternativa, polinucleotideos 273P4B7 podem ser utilizados para providenciar evidência de cancro, por exemplo, quando células numa amostra biológica que não expressam normalmente 273P4B7 ou expressam 273P4B7 a um nivel diferente se verifica que expressam 273P4B7 ou têm uma expressão aumentada de 273P4B7 (ver, por exemplo, a expressão de 273P4B7 nos cancros listados no Quadro I e em amostras de pacientes, etc. mostradas nas Figuras que acompanham este pedido). Em tais testes, os especialistas podem ainda desejar gerar evidência suplementar de metástases testando a amostra biológica para a presença de um marcador restrito de tecido secundário (além de 273P4B7) tal como PSA, PSCA etc. (ver, por exemplo, Alanen et al., Pathol. Res. Pract. 192(3): 233-237 (1996)).
Tais como os fragmentos do polinucleotideo PSA e variantes do polinucleotideo são empregues por especialistas habilitados para utilização em métodos de monitorizar PSA, fragmentos de polinucleotideo 273P4B7 e variantes de polinucleotideo são utilizados de uma maneira análoga. Em particular, polinucleotideos PSA típicos utilizados em métodos de monitorizar PSA são sondas ou 72 iniciadores que consistem em fragmentos da sequência de ADNc do PSA. A ilustrar isto, os iniciadores utilizados para amplificar por PCR um polinucleot ideo PSA têm de incluir menos de toda a sequência PSA para funcionar na reação em cadeia da polimerase. No contexto de tais reações PCR, os especialistas habilitados geralmente criam uma variedade de fragmentos de polinucleotídeo diferentes que podem ser utilizados como iniciadores de maneira a amplificar diferentes porções de um polinucleotídeo de interesse ou para otimizar as reações de amplificação (ver, por exemplo, Caetano-Anolles, G. Biotechniques 25(3): 472-476, 478-480 (1998); Robertson et al., Methods Mol. Biol. 98:121-154 (1998)). Uma ilustração adicional da utilização de tais fragmentos é providenciada no Exemplo designado "Análise da expressão de 273P4B7 em tecidos normais, e espécimes de paciente," onde um fragmento de polinucleotídeo 273P4B7 é utilizado como sonda para mostrar a expressão de ARN de 273P4B7 em células cancerosas. Além disso, sequências de polinucleotídeo variantes são tipicamente utilizadas como iniciadores e sondas para os ARNm correspondentes em análises PCR e Northern (ver, por exemplo, Sawai et al., Fetal Diagn. Ther. Novembro-Dezembro de 1996 11(6):407-13 e Current Protocols In Molecular Biology, Volume 2, Unidade 2, Frederick M. Ausubel et al. editores, 1995)). Os fragmentos e variantes de polinucleotídeo são úteis neste contexto onde são capazes de se ligar a um sequência de polinucleotídeo alvo (por exemplo, um polinucleotídeo 273P4B7 mostrado na Figura 2 ou variante do mesmo) em condições de restringência elevada.
Como mostrado aqui, os polinucleotídeos 273P4B7 (bem como sondas de polinucleotídeo 273P4B7 utilizadas para identificar a presença destas moléculas) exibem propriedades específicas que as tornam úteis para diagnosticar cancros tais como aqueles litados no Quadro I. Os testes de diagnóstico que medem a presença de produtos 73 do gene 273P4B7, de maneira avaliar a presença ou despoletar de uma condição doença descrita aqui, tal como cancro da próstata, são utilizados para identificar pacientes para medidas preventivas ou ainda monitorizar, como foi feito com tanto sucesso com PSA. Além disso, estes materiais satisfazem a necessidade na arte de moléculas que têm caracteristicas semelhantes ou complementares a PSA em situações onde, por exemplo, um diagnóstico definitivo de metástases de origem prostática não pode ser feito apenas com base num teste de PSA (ver, por exemplo, Alanen et al., Pathol. Res. Pract. 192(3): 233-237 (1996)), e consequentemente, materiais tais como polinucleotideos e polipeptideos 273P4B7 (bem como as sondas de polinucleotideo 273P4B7 e anticorpos anti-273P4B7 utilizados para identificar a presença destas moléculas) precisam de ser empregues para confirmar metástases e origem prostática.
Finalmente, além do seu uso em testes de diagnóstico, os polinucleotideos 273P4B7 revelados aqui têm um número de outras utilidades tais como o seu uso na identificação de anormalidades cromossómicas associada a oncogenética na região cromossómica para a qual o gene 273P4B7 mapeia (ver o Exemplo designado "Mapeamento cromssómico de 273P4B7" em baixo) . Além disso, além da sua utilização em testes de diagnóstico, as proteínas relacionadas com 273P487 e polinucleotídeos revelados aqui têm outras utilidades tais como a sua utilização em análise forense de tecidos de origem desconhecida (ver, por exemplo, Takahama K Forensic Sei Int 28 de Junho de 1996; 80(1-2): 63-9). VII.) Kits/artigos de fabrico
Para utilização em laboratório, das aplicações de prognóstico e diagnóstico descritas aqui, são descritos kits. Tais kits podem compreender um veículo, pacote, ou recipiente que é compartimentalizado para receber um ou mais recipientes tais como frascos para injetáveis, tubos, 74 e afins, cada dos recipiente(s) compreendendo um dos elementos separados para ser utilizado no método, juntamente com um rótulo ou inserção compreendendo instruções para uso, tais como um uso descrito aqui. Por exemplo, o recipiente (s) pode compreender uma sonda que é ou pode ser rotulada detetavelmente. Tal sonda pode ser um polinucleotideo especifico para um gene ou mensagem da invenção. Onde o método utiliza hibridação de ácido nucleico para detetar o ácido nucleico alvo, o kit também pode ter recipientes contendo nucleotideo(s) para amplificação da sequência do ácido nucleico alvo. Os kits podem compreender um recipiente compreendendo um repórter, tal como uma proteína de ligação à biotina, tal como avidina ou estreptavidina, ligada a uma molécula repórter, tal como um rótulo enzimático, fluorescente, ou radioisótopo; tal repórter pode ser utilizado com, por exemplo, um ácido nucleico. 0 kit pode incluir toda ou parte de sequências de aminoácidos na Figura 2 ou Figura 3 ou análogos dos mesmos, ou uma molécula de ácido nucleico que codifica tais sequências de aminoácidos. 0 kit tipicamente compreenderá o recipiente descrito anteriormente e um ou mais outros recipientes associados com isso que compreendem materiais desejáveis desde um ponto de vista comercial e do usuário, incluindo tampões, diluentes, filtros, agulhas, seringas; veículo, pacote, recipiente, frasco para injetáveis e/ou conteúdos de listagem de rótulos de tubo e/ou instruções de utilização, e insertos de pacotes com instruções de utilização.
Um rótulo pode estar presente em ou com o recipiente para indicar que a composição é utilizada para uma aplicação não terapêutica específica, tal como uma aplicação de prognóstico, diagnóstico ou de laboratório, e também pode indicar direções tanto para utilização in vivo como in vitro, tais como aquelas descritas aqui. Direções e/ou outra informação também pode ser incluída num 75 inserto(s) ou rótulo (s) que é incluído com ou no kit. 0 rótulo pode estar no ou associado ao recipiente. Um rótulo a pode estar num recipiente quando letras, números ou outros caracteres que formam o rótulo são moldados ou gravados no próprio recipiente; um rótulo pode estar associado com um recipiente quando está presente dentro de um recetáculo ou veículo que também detém o recipiente, por exemplo, como um inserto de pacote. 0 rótulo pode indicar que a composição é utilizada para diagnosticar, prognosticar uma condição patológica, tal como uma neoplasia de um tecido apresentada no Quadro I.
Os termos "kit' e "artigo de fabrico" podem ser utilizados como sinónimos.
Um artigo(s) de fabrico pode conter composições, tal como sequência(s) de ácido nucleico, por exemplo, materiais úteis para o diagnóstico, ou prognóstico de neoplasias de tecidos tais como aqueles apresentados no Quadro I são providenciados. 0 artigo de fabrico tipicamente compreende pelo menos um recipiente e, pelo menos, um rótulo. Recipientes adequados incluem, por exemplo, garrafas, frascos para injetáveis, seringas, e tubos teste. Os recipientes podem ser formados a partir de uma variedade de materiais tais como vidro, metal ou plástico. 0 recipiente pode deter sequência (s) de ácido nucleico e/ou célula ou população(s) . 0 recipiente pode deter um polinucleotídeo para utilização no exame do perfil de expressão do ARNm de uma célula, juntamente com reagentes utilizados para este fim.
Em alternativa, o recipiente pode deter uma composição que +e eficaz no diagnóstico ou prognóstico de uma condição patológica e pode ter uma porta de acesso estéril (por exemplo, o recipiente pode ser um saco de solução intravenosa ou um frasco para injetáveis com um travão perfurado por uma agulha de injeção hipodérmica. 0 artigo de fabrico pode, ainda, compreender um 76 segundo recipiente compreendendo um tampão farmaceuticamente adequado, tal como solução salina tamponada com fosfato, solução de Ringer e/ou solução de dextrose. Pode ainda incluir outros materiais desejáveis desde um ponto de vista comercial e do usuário, incluindo outros tampões, diluentes, filtros, agitadores, agulhas, seringas, e/ou insertos de pacote com indicações e/ou instruções de utilização. EXEMPLOS: Vários aspetos da invenção são ainda descritos e ilustrados pelos vários exemplos que se seguem, nenhum dos quais se pretende que limite o âmbito da invenção.
Exemplo 1: Isolamento gerado por SSH de fragmento de ADNc do gene 273P4B7
Para isolar genes que são sobre-expressos no cancro do pulmão foi utilizado o procedimento de Hibridação Substrativa de Supressão (SSH) utilizando ADNc derivado de tecidos de cancro do pulmão. A sequência do ADNc de 273P4B7 SSH foi derivada a partir de tumor do pulmão menos ADNc derivado de pulmão normal. 0 ADNc de 273P4B7 foi identificado como altamente expresso em cancro.
Materiais e Métodos Tecidos Humanos: 0 paciente com cancro e tecidos normais foram comprados a partir de fontes diferentes tais como o NDRI (Filadélfia, PA). 0 ARNm para alguns tecidos normais foram comprados da Clontech, Paio Alto, CA.
Isolamento de ARN;
Os tecidos foram homogenizados em reagente Trizol (Life Technologies, Gibco BRL) utilizando 10 ml/g de ARN total de tecido isolado. ARN Poli A foi purificado a partir do ARN total utilizando kits de Qiagen Oligotex ARNm Mini e Midi. ARNm total e ARNm foram quantificados por análise espectrofotométrica (O.D. 260/280 nm) e analisado em gel de electroforese. 77
Oligonucleotídeos:
Foram utilizados os seguintes oligonucleotídeos HPLC purificados. DPNCDN (iniciador de síntese de ADNc): 5TTTTGATCAAGCTT303 ' (SEQ. 1D N, ° 30)
Adaptador 1; 5'CTAATACGACTCACTATAGGGCTCGAGCGGCCGCCCGGGCAG3' (SEQ. ID N. 0 31) 3'GGCCCGTCCTAG5' (SEQ. ID N.° 32)
Adaptador 2: 5'GTAATACGACTCACTATAGGGCAGCGTGGTCGCGGCCGAG3' (SEQ. ID N.° 33) 3'CGGCTCCTAG5' (SEQ. ID N.° 34)
Iniciador 1 de PCR: 5'CTAATACGACTCACTATAGGGC3' (SEQ. ID N.° 35)
Iniciador aninhado (NP)1: 5TCGAGCGGCCGCCCGGGCAGGA3' (SEQ. IDN.° 36)
Iniciador aninhado (NP)2; 5'AGCGTGGTCGCGGCCGAGGA3' (SEQ. ID N.° 37)
Suppression Subtractive Hybridization:
Hibridação Substrativa de Supressão (SSH) foi utilizada para identificar ADNc correspondentes a genes que podem ser expressos diferencialmente no cancro. A reação SSH utilizou ADNc de cancro do pulmão e tecidos normais. A sequência do gene 273P4B7 foi derivada de cancro do pulmão menos pulmão normal e uma mistura de subtração de ADNc de 9 tecidos normais. A sequência de ADN SSH (Figura 1) foi identificada. O ADNc derivado de um pulmão normal misturado com um grupo de 9 tecidos normais foi utilizado como a fonte do ADNc "controlador", enquanto o ADNc do cancro do pulmão foi utilizado como a fonte do ADNc de "teste". ADNc de cadeia dupla correspondentes aos ADNc teste e controlador foram sintetizados a partir de 2 pg de ARN poli(A)+ isolado a partir do tecido relevante, como descrito anteriormente, 78 utilizando o kit da CLONTECH de subtração do ADNc selecionado por PCR e 1 ng de DPNCDN oligonucleotideo como iniciador. As sínteses da primeira e segunda cadeia foram realizadas como descrito no protocolo do manual do usuário do Kit (Protocolo CLONTECH N.° PT1117-1, Catálogo N.° K1804-1). 0 ADNc resultante foi digerido com Dpn II durante 3 horas a 37°C. 0 ADNc dierido foi extraído com fenol/clorofórmio (1:1) e etanol precipitado. 0 ADNc controlador foi gerado combinando numa razão 1:1 ADNc digerido com Dpn II de pulmão normal com uma mistura de ADNc digeridos derivados de nove tecidos normais: estômago, músculo esquelético, pulmão, cérebro, fígado, rim, pâncreas, intestino delgado, e coração. 0 ADNc e teste foi gerado diluindo 1 μΐ de ADNc digerido com Dpn II de uma fonte de tecido relevante (ver em cima) (400 ng) em 5 μΐ de água. O ADNc diluído (2 μΐ, 160 ng) foi depois ligado a μΐ do Adaptador 1 e Adaptador 2 (10 μΜ) , em reações de ligação separadas, num volume total de 10 μΐ a 16°C durante a noite, utilizando 400 u de T4 DNA ligase (CLONTECH). A ligação foi terminada com 1 μΐ de 0,2 M EDTA e aquecimento a 72°C durante 5 minutos. A primeira hibridação foi realizada adicionando 1,5 μΐ (600 ng) de ADNc controlador a cada um de dois tubos contendo 1,5 μΐ (20 ng) de cDNA de teste ligado ao Adaptador 1 e Adaptador 2. Num volume final de 4 μΐ, as amostras foram sobrepostas com óleo mineral, desnaturadas num termociclador MJ Research a 98°C durante 1,5 minutos, e depois foi-lhes permitido hibridizar durante 8 horas a 68°C. As duas hibridizações foram depois misturadas com 1 μΐ adicional de ADNc controlado desnaturado fresco e foi permitido hibridizar durante a noite a 68°C. A segunda hibridação foi depois diluída em 200 μΐ de 20 mM Hepes, pH 8,3, 50 mM NaCl, 0,2 mM EDTA, aquecida a 70°C durante 7 minutos e armazenada a -20°C.
Amplificação por PCR, Clonagem e Seguenciação de fragmentos 79 de Gene gerados a partir de SSH:
Para amplificar fragmentos de gene resultantes de reações SSH, foram realizadas duas amplificações PCR. Na reação PCR primária 1 μΐ da mistura de hibridação diluída final foi adicionada a 1 μΐ de iniciador 1 de PCR (10 μΜ), 0,5 μΐ mistura dNTP (10 μΜ) , 2,5 μΐ 10 x tampão de reação (CLONTECH) e 0,5 μΐ 50 x mistura de polimerase ADNc Advantage (CLONTECH) num volume final de 25 μΐ. A PCR 1 foi conduzida utilizando as seguintes condições: 75°C durante 5 minutos, 94°C durante 25 segundos, depois 27 ciclos de 94°C durante 10 segundos, 66°C durante 30 segundos, 72°C durante 1,5 minutos. Cinco reações PCR primárias separadas foram realizadas para cada experiência. Os produtos foram agrupados e diluídos 1:10 com água. Para a reação PCR secundária, 1 μΐ da reação PCR primária agrupada e diluída foi adicionada à mesma mistura de reação como utilizado para PCR 1, exceto que os iniciadores NP1 e NP2 (10 μΜ) foram utilizados em vez do iniciador 1 de PCR. PCR 2 foi realizada utilizando 10-12 ciclos de 94°C durante 10 segundos, 68°C durante 30 segundos, e 72°C durante 1,5 minutos. Os produtos da PCR foram analisados utilizando 2% de electroforese em gel de agarose.
Os produtos PCR fora inseridos em pCR2.1 utilizando o kit de clonagem do vetor T/A (Invitrogen). E. coli transformadas foram sujeitas a seleção azul/branca e ampicilina. As colónias brancas foram escolhidas e colecionadas em placas com 96 poços e foram crescidas em meio de cultura líquido durante a noite. Para identificar insertos, foi realizada amplificação por PCR em 1 μΐ de cultura bacteriana utilizando as condições de PCRl e NP1 e NP2 como iniciadores. Os produtos de PCR foram analisados utilizando electroforese em gel de agarose a 2%.
Clones bcterianos foram armazenados em 20% glicerol num formato com 96 poços. ADN de plasmídeo foi preparado, sequenciado, e sujeito a pesquisas de homologia de ácido 80
nucleico das bases de dados GenBank, dBest, e NCI-CGAP. Análise da expressão RT-PCR ADNc de primeira cadeia podem ser gerados a partir de 1 pg de ARNm com iniciador oligo (dT)12-18 utilizando o sistema de pré-amplificação sobrescrito Gibco-BRL. O protocolo do fabricante foi utilizado que incluiu incubação durante 50 minutos a 42°C com transcritoase reversa seguido por tratamento com RNAse H a 37°C durante 20 minutos. Após completar a reação, o volume pode ser aumentado para 200 μΐ com água antes da normalização. ADNc de primeira cadeia de 16 tecidos humanos normais diferentes podem ser obtidos da Clontech. A normalização da ADNc de primeira cadeia de tecidos múltiplos foi realizada utilizando os iniciadores 5'atatcgccgcgctcgtcgtcgacaa3' (SEQ. ID N.° 38) e 5'agccacacgcagctcattgtagaagg 3' (SEQ. ID N.° 39) para amplificar β-actina. ADNc de primeira cadeia (5 μΐ) foram amplificados num volume total de 50 μΐ contendo 0,4 μΜ iniciadores, 0,2 μΜ cada dNTPs, IX tampão PCR (Clontech, 10 mM Tris-HCl, 1,5 mM MgCl2, 50 mM KCI, pH 8,3) e IX Klentaq ADN polimerase (Clontech). Cinco μΐ da reação da PCR podem ser removidos a 18, 20, e 22 ciclos e utilizados para electrofrese em gel de agarose. PCR foi realizada utilizando um termociclador MJ Research nas seguintes condições: desnaturação inicial pode ser a 94°C durante 15 segundos, seguido de 18, 20, e 22 ciclos a 94°C durante 15, 65°C durante 2 minutos, 72°C durante 5 segundos. Uma extensão final a 72°C foi realizada durante 2 minutos. Após a electroforese em gel de agarose, as intensidades da banda da bandas de β-actina com 283 b.p. de múltiplos tecidos foram comparadas através de inspeção visual. Fatores de diluição para ADNc de primeira cadeia foram calculados para resultar em iguais intensidades de banda de β-actina em todos os tecidos após 22 ciclos de PCR. Três rondas de normalização podem ser necessárias para atingir iguais 81 intensidades de banda em todos os tecidos após 22 ciclos de PCR.
Para determinar os níveis de expressão do gene 273P4B7, 5 μΐ de ADNc de primeira cadeia normalizada foram analisados por PCR utilizando 26, e 30 ciclos de amplificação. A análise de expressão semi-quantitativa pode ser conseguida comparando os produtos da PCR a números de ciclos que dão intensidades de banda claras. Os iniciadores utilizados para RT-PCR estão listados em baixo: 273P4B7.1 5'- GCTAGTGCTCAGAATACCAGACTATGG - 3' (SEQ. ID N.° 40) 273P4B7.2 5'- CGCTTGACATAAAAAGTGCAGATCC - 3' (SEQ. ID N.° 41)
Uma análise de expressão RT-PCR típica está mostrada na Figura 14(A) e 14(B). ADNc de primeira cadeia foi preparado a partir de grupo vital 1 (fígado, pulmão e rim), grupo vital 2 (pâncreas, cólon e estômago), pâncreas normal, grupo de cancro do ovário, e grupo de cancro de pâncreas. A normalização foi realizada por PCR utilizando iniciadores para actina e GAPDH. PCR semi-quantitativo, utilizando iniciadores para 273P4B7, foi realizada a 26 e 30 ciclos de amplificação. A expressão de 273P4B7 foi detetada no grupo de cancro do ovário, grupo de cancro de pâncreas grupo vital 1, mas não no grupo vital 2 nem no pâncreas normal. Exemplo 2: Clonagem de comprimento inteiro de 273P4B7 A sequência de ADNc de 273P4B7 SSH foi derivada de uma subtração consistindo de cancro do pulmão menos tecidos normais. A sequência de ADNc SSH de 170 bp (Figura 1), foi designada 273P4B7. 273P4B7 v.l de 4194 bp foi clonada de cancro do pulmão, revelando uma ORF de 1250 aminoácidos (Figura 2 e Figura 3). Outras variantes de 273P4B7 também foram identificadas e estas estão listadas na Figura 2 e Figura 3. 273P4B7 v.l, v.3, v.7, e v.8 codificam proteínas 82 idênticas de 1250 aminoácidos de comprimento. 273P4B7 v.4, v.5 e v.6 diferem de 273P4B7 v.l por um aminoácido como mostrado na Figura 2. 273P4B7 v.2 é uma variante de splicing de 273P4B7 v.l e codifica uma proteína de 1127 aminoácidos. 273P4B7 v.l mostra 99% sobre apenas 1106 aminoácidos com a proteína sem nome AK074719 . A sequência de ácido nucleico de 273P4B7 v.l alinha com 99% de identidade com a posição 159-4194 de nucleotídeo, para ADNc FLJ31932 fis, clone NT2RP7006296, fracamente semelhante com a PROTEÍNA DE REPARO DE EXCISÃO ERCC-6. 273P4B7 v.l mostra 72% de identidade com a proteína de ratinho BC004701 demonstrada ser um membro da família da superfamília de helicases tipo DEAD. Os membros desta família incluem as helicases de caixa DEAD e DEAH. As helicases estão envolvidas em ácidos nucleicos desenrolados. As helicases de caixa DEAD estão envolvidas em vários aspetos do metabolismo do ARN, incluindo transcrição nuclear, splicing de pré-ARNm, biogénese de ribossoma, transporte nucleocitoplasmático, tradução, decomposição do ARN e expressão de genes de organelos. Exemplo 3: Mapeamento cromossómico de 273P4B7 A localização cromossómica pode implicar genes na patogénese da doença. Várias abordagens ao mapeamento dos cromossomas estão disponíveis incluindo hibridação in situ fluorescente (FISH), painéis híbridos de radiação (RH) humano/hamster (Walter et al.,1994; Nature Genetics 7:22; Research Genetics, Huntsville Al), painéis híbridos de célula somática humano-roedor tais como estão disponíveis no Instituto Coriell (Camden, Nova Jérsia), e visores genómicos que utilizam as homologias BLAST a clones genómicos sequenciados e mapeados (NCBI, Bethesda, Maryland).
Os mapas 273P4B7 para o cromossoma Xql3.1 utilizando a sequência de 273P4B7 e a ferramenta NCBI BLAST localizada 83 na internet em (www.ncbi.nim.nih.govlgenome/seq/page.cgi!?F=HsBlasthtml&&0 RG=Hs).
Exemplo 4: Análise da expressão de 273P4B7 em tecidos normais e espécimes de pacientes A análise da expressão por RT-PCR demonstrou que 273P4B7 é fortemente expresso em espécimes de pacientes com cancro (Figura 14). ADNc de primeira cadeia foi preparado a partir de tecidos normais (bexiga, cérebro, coração, rim, fígado, pulmão, próstata, baço, músculo esquelético, testículo, pâncreas, cólon e estômago), e a partir de grupos de espécimes de pacientes com cancro (grupo de cancro do pâncreas, grupo de cancro de bexiga, grupo de cancro do rim, grupo de cancro do cólon, grupo de cancro do pulmão, grupo de cancro do ovário, gupo de cancro da mama, grupo de metástases de cancro, grupo de cancro do pâncreas, grupo de xenoenxerto de cancro da próstata, metástases da próstata para nódulo linfático, grupo de cancro dos ossos e melanoma, grupo de cancro do colo do útero, grupo de cancro linfoma, grupo de cancro de estômago, grupo de cancro do útero, e grupo multi-xenoenxertos). A normalização foi realizada por PCR utilizando iniciadores para actina. PCR semi-quantitativa, utilizando iniciadores para 273P4B7, foi realizada a 22, 26 e 30 ciclos de amplificação. Na Figura 14(A) é mostrada uma imagem do gel de agarose da RT-PCR. Na Figura 14(B) os produtos de PCR foram quantificados utilizando o programa Alphalmager. Os resultados mostram a força de expressão de 273P4B7 no grupo de cancro da próstata, grupo de cancro de bexiga, grupo de cancro do rim, grupo de cancro do cólon, grupo de cancro do pulmão, grupo de cancro do ovário, grupo de cancro da mama, grupo de metástases de cancro, grupo de cancro do pâncreas, grupo de xenoenxerto de cancro da próstata, metástases da próstata para nódulo linfático, grupo de cancro dos ossos e melanoma, grupo de cancro do colo do útero, grupo de cancro 84 linfoma, grupo de cancro de estômago, grupo de cancro do útero, e grupo multi-xenoenxertos (cancro da próstata, cancro do rim e grupo de xenoenxerto de cancro de bexiga). Em tecidos normais, 273P4B7 é predominantemente expresso no testículo e não em qualquer outro tecido normal testado. A expressão extensa de 273P4B7 em tecidos normais é mostrada na Figura 15. Dois northern blots de tecidos múltiplos (Clontech) ambos com 2 pg de ARNm/via foram sondados com a sequência 273P4B7. Os tamanhos padrão em quilobases (kb) estão indicados de lado. Os resultados mostram a expressão de um transcrito de 273P4B7 com aproximadamente 7kb em testículo normal mas não noutro tecido normal testado. A expressão de 273P4B7 em espécimes de pacientes com cancro do pâncreas, ovário e testículo é mostrada na Figura 16. 0 ARN foi extraído de pâncreas normal (NPa), ovário normal (NO), testículo normal (NTe) , espécime de paciente com cancro de pâncreas (Pl), espécime de paciente com cancro do ovário (P2,P3,P4), e espécime de paciente com cancro de testículo (P5,P6,P7). Northern blot com 10 pg de ARN total/via foi sondado com sequência SSH de 273P4B7. Os tamanhos padrão em quilobases (kb) estão indicados de lado. O transcrito 273P4B7 foi detetado em espécimes de pacientes, mas não nos tecidos normais. A Figura 17 mostra a expressão de 273P4B7 em espécimes de pacientes com cancro do colo do útero, na Figura 17(A), o ARN total foi extraído de espécimes de pacientes com cancro do colo do útero (T1-T7), e linha de células HeLa. Northern blot com 10 pg de ARN total/via foi sondado com sequência de SSH 273P4B7. Os tamanhos padrão em quilobases (kb) estão indicados de lado. O transcrito 273P4B7 foi detetado em todos espécimes de pacientes testados bem como na linha de células Hela. Na Figura 17 (B), o ADNc de primeira cadeia foi preparado a partir de um painel de espécimes de pacientes com cancro do colo do útero, colo do 85 útero normal e linha de células do colo do útero HeLa. A normalização foi realizada por PCR utilizando iniciadores para actina. PCR semi-quantitativa, utilizando iniciadores para 273P4B7, foi realizada a 26 e 30 ciclos de amplificação. As amostras foram corridas em gel de agarose, e os produtos da PCR foram quantificados utilizando o programa Alphalmager. A expressão foi registada como ausente, baixa, média ou forte. Os resultados mostram a expressão de 273P4B7 na maioria dos tecidos com cancro de colo do útero testados. A expressão da 273P4B7 em espécimes de pacientes com cancro de bexiga é mostrada na Figura 18. ADNc de primeira cadeia foi preparado a partir de um painel de espécimes de pacientes com cancro de bexiga, bexiga normal (N) e linhas de células de cancro de bexiga (UM-UC-3, TCCSUP, J82). A normalização foi realizada por PCR utilizando iniciadores para actina. PCR semi-quantitativa, utilizando iniciadores para 273P4B7, foi realizada a 26 e 30 ciclos de amplificação. As amostras foram corridas num gel de agarose Figura 18(A), e os produtos da PCR foram quantificados utilizando o programa Alphalmager Figura 18(B). A expressão foi registada como ausente, baixa, média ou elevada. Os resultados mostram a expressão de 273P4B7 na maioria dos tecidos com cancro de bexiga testados, mas não nos tecidos de bexiga normais. A expressão da 273P4B7 em espécimes de pacientes com cancro de cólon é mostrada na Figura 19. ADNc de primeira cadeia foi preparado a partir de um painel de espécimes de pacientes com cancro de cólon, cólon normal, e linhas de células de cancro de cólon (LoVo, CaCo-2, SK-COl, Colo205, e T284) . A normalização foi realizada por PCR utilizando iniciadores para actina. PCR semi-quantitativa, utilizando iniciadores para 273P4B7, foi realizada a 26 e 30 ciclos de amplificação. As amostras foram corridas num gel de agarose, e os produtos da PCR foram quantificadas 86 utilizando o programa Alphalmager. A expressão foi registada como ausente, baixa, média ou elevada. Os resultados mostram a expressão de 273P4B7 na maioria dos tecidos com cancro de cólon testados, mas não nos tecidos normais de cólon. A expressão também foi detetada nas linhas de células LoVo, CaCo-2, SK-C01 Colo205, mas não na linha de células T284. A Figura 20 mostra a expressão de 273P4B7 em espécimes de pacientes com cancro do ovário. ADNc de primeira cadeia foi preparado a partir de um painel de espécimes de pacientes com cancro do ovário, ovário normal e linhas de células de cancro do ovário (OV-1063, PA-1, SW626). A normalizaçõ foi realizada por PCR utilizando iniciadores para actina. PCR semi-quantitativa, utilizando iniciadores para 273P4B7, foi realizada a 26 e 30 ciclos de amplificação. As amostras foram corridas num gel de agarose, e os produtos da PCR foram quantificados utilizando o programa Alphalmager. A expressão foi registada como ausente, baixa, média ou elevada. Os resultados mostram expressão de 273P4B7 na maioria dos tecidos com cancro do ovário testados bem como nas linhas de células, mas não em ovário normal. A expressão restrita da 273P4B7 em tecidos normais e a expressão detetada em espécimes de pacientes com cancro sugerem que a 273P4B7 é um alvo terapêutico e um marcador diagnóstico para cancros humanos.
Exemplo 5: Variantes Transcritas da 273P4B7
Como usado aqui, o termo variante compreende variantes transcritas e polimorfismos de nucleotideo único (SNPs). Variantes transcritas são variantes de ARNm maduro do mesmo gene que surgem por transcrição alternativa ou splicing alternativo. Os transcritos alternativos são transcritos do mesmo gene mas começam a transcrição em pontos diferentes. As variantes de splicing são variantes de splicing de ARNm diferencial do mesmo transcrito. Nos eucariontes, quando um 87 gene multi-exão é transcrito do ADN genómico, o ARN inicial é submetido a splicing para produzir ARNm funcional, que tem apenas exões e é utilizado para tradução numa sequência de aminoácido. Em concordância, um dado gene pode ter zero a muitos transcritos alternativos e cada transcrito pode ter zero a muitas variantes de splicing. Cada variante transcrita tem uma composição de exão única, e pode ter diferentes porções codificantes e/ou não codificantes (extremidade 5' ou 3'), do transcrito original. Variantes transcritas podem codificar as mesmas, semelhantes ou diferentes proteínas com a mesma ou função semelhante ou podem codificar proteínas com funções diferentes, e podem ser expressas no mesmo tecido ao mesmo tempo, ou em diferentes tecidos ao mesmo tempo, ou no mesmo tecido em tempos diferentes, ou em diferentes tecidos em tempos diferentes. As proteínas codificadas por variantes transcritas podem ter localizações extracelulares ou subcelulares semelhantes ou diferentes, por exemplo, segregadas versus intracelulares.
Variantes transcritas são identificada por uma variedade de métodos aceites pela arte. Por exemplo, transcritos alternativos e variantes de splicing são identificados por experiências de clonagem de comprimento inteiro, ou por uso de transcrito de comprimento inteiro e sequências EST. Primeiro, todos os ESTs humanos foram agrupados em grupos que mostram identidade direta ou indireta um com o outro. Em segundo lugar, ESTs no mesmo grupo foram ainda agrupados em sub-grupos e reunidos numa sequência consenso. A sequência original do gene é comparada com a sequência(s) consenso ou outras sequências de comprimento inteiro. Cada sequência consenso é uma variante de splicing potencial para aquele gene. Mesmo quando uma variante é identificada que ainda não é um clone de comprimento inteiro, aquela porção da variante é muito útil como ferramenta de investigação, por exemplo, para 88 geração de antígeno e para clonagem adicional da variante de splicing de comprimento inteiro, utilizando técnicas conhecidas daqueles habilitados na arte.
Além disso, estão disponíveis programas informáticos àqueles habilitados na arte que identificam variantes transcritas com base em sequência genómicas. Os programas de identificação de variante transcrita baseada na genómica incluem FgenesH (A. Salamov e V. Solovyev, "Ab initio gene finding in Drosophila genomic DNA," Genome Research. 2000 April;10(4):516-22); Grail (URL compbio.oml.gov/Grail-bin/EmptyGrailForm) e GenScan (URL genes.mit.edu/GENSCAN.htmt). Para uma discussão geral de protocolos de identificação de variante de splicing, ver, por exemplo, Southan, C., A genomic perspective on human proteases, FEBS Lett. 8 de Junho de 2001; 498 (2-3): 214-8; de Souza, S.J., et al., Identification of human chromosome 22 transcribed sequences with 0RF expressed sequência tags, Proc. Natl. Acad. Sei USA. 7 de Novembro de 2000; 97(23): 12690-3.
Para confirmar ainda os parâmetros de uma variante transcrita, estão disponíveis uma variedade de técnicas na arte, tais como clonagem de comprimento inteiro, validação proteómica, validação com base em PCR, e validação 5' RACE, etc. (ver, por exemplo, Proteomic Validation: Brennan, S.O., et al., Albumin banks peninsula: a new termination variant characterized by electrospray mass spectrometry, Biochem Biophys Acta. 17 de Agosto de 1999;1433(1-2):321-6; Ferranti P, et al., Differential splicing of pre-messenger RNA produces multiple forms of mature caprine alpha(sl)-casein, Eur J Biochem. 1 de Outubro de 199 7;249 (1):1-7. Para validação com base em PCR: Wellmann S, et al., Specific reverse transcripfion-PCR quantification of vascular endothelial growth factor (VEGF) variantes de splicing by LightCycter technology, Clin Chem. 2001 Apr;47(4):654-60; Jia, H.P., et al., Discovery of new human 89 beta-defensins using a genomics-based approach, Gene. 24 de Janeiro de 2001; 263(1-2):211-8. Para validação com base em PCR e 5' RACE: Brigle, K.E., et al., Organization of the murine reduced folate carrier gene and Identification of variant splice forms, Biochem Biophys Acta. 7 de Agosto de 1997; 1353(2): 191-8). É sabido na arte que as regiões genómicas são moduladas nos cancros. Quando a região genómica para a qual o gene mapeia é modulada num cancro particular, os transcritos alternativos ou variantes de splicing do gene também são moduladas. Revelado aqui é que 273P4B7 tem um perfil de expressão particular relacionado com o cancro (ver, por exemplo, Quadro 1). Transcritos alternativos e variantes de splicing de 273P4B7 também estão envolvidos em cancros nos mesmos tecidos ou diferentes, servindo assim como antígenos/marcadores associados a tumores.
Utilizando o gene de comprimento inteiro e sequências EST, quatro variantes transcritas adicionais foram identificadas, designadas como 273P4B7 v.2, v.9 e v.10. As fronteiras dos exões no transcrito original, 273P4B7 v.l estão mostradas no Quadro LI. As estruturas das variantes transcritas estão mostradas na Figura 10. Variante 273P4B7 v.2 adicionou 22 bases à extremidade 5' do exão 1 e um exão adicional no primeiro intrão da variante v.l. As variantes v.9 e v.10 eram mais curtas e correspondiam a parte do último exão de v.l, com alguns pares de bases diferentes. Os quadros LII(a)-(d) a LV(a)-(c) são apresentados numa base variante-por-variante. Os quadros LII(a)-(d) mostram a sequência nucleotidica das variantes transcritas. Os quadros LIII(a)-(d) mostram o alinhamento da variante transcrita com sequência de ácido nucleicos da 273P4B7 v.l. O Quadro LIV(a)-(d) apresenta a tradução de aminoácidos da variante transcrita para a orientação da grelha de leitura identificada. O Quadro LV(a)-(d) mostra alinhamentos da sequência de aminoácidos codificada pela variante de 90 splicing com aquela de 273P4B7 v.l.
Exemplo 6: Polimorfismos de nucleotídeo único de 273P4B7
Um polimorfismo de nucleotideo único (SNP) é uma variação de um único par de base numa sequência nucleotidica numa localização especifica. Em qualquer dado ponto do genoma, existem quatro pares de base de nucleotideos possíveis: A/T, C/G, G/C e T/A. O genótipo refere-se à sequência do par de base específica de uma ou mais localizações no genoma de um indivíduo. 0 haplótipo refere-se à sequência de par de base de mais do que uma localização na mesma molécula de ADN (ou o mesmo cromossoma nos organismos superiores), frequentemente no contexto de um gene o no contexto de vários genes estreitamente ligados. SNP que ocorre num ADNc é designado cSNP. Este cSNP pode alterar aminoácidos da proteína codificada pelo gene e assim alterar as funções da proteína. Alguns SNP causam doenças hereditárias; outros contribuem para variações quantitativas em fenótipo e reações a fatores ambientais incluindo dieta e fármacos entre indivíduos. Assim, SNP e/ou combinações de alelos (clamados haplótipos) têm muitas aplicações, incluindo diagnóstico de doenças hereditárias, determinação de reações a fármacos e dosagem, identificação de genes responsáveis por doenças, e análise da relação genética entre indivíduos (P. Nowotny, j. m. Kwon e A. M. Goate, "SNP analysis to dissect human traits, " Curr. Opin. Neurobiol. Outubro de 2001; 11 (5):637-641; M. Pirmohamed e B. K. Park, "Genetic susceptibility to adverse drug reactions," Trends Pharmacol. Sei. Junho de 2001; 22 (6):298-305,- J. H. Riley, C. J. Allan, E. Lai e A. Roses, "The use of single nucleotide polymorphisms in the isolation of common disease genes," Pharmacogenomics. Fevereiro de 2000; 1 (1) :39 — 47; R. Judson, J. C. Stephens e A. Windemuth, "The predictive power of haplotypes in clinicai response," Pharmacogenomics, Fevereiro de 2000; 1(1): 15-26) . 91 SNP são identificados por uma variedade de métodos aceites pela arte (P. Bean, "The promising voyage of SNP target discovery," Am Clin. Lab. Outubro-Novembro de 2001; 20(9):18-20; K. M. Weiss, "In search of human variation," Genome Res. Julho de 1998; 8 ( 7) :691-697; Μ. M. She, "Enabling large-scale pharmacogenetic studies by high-throughput mutation detection and genotyping technologies," Clin. Chem. Fevereiro de 2001; 47(2):164-172). Por exemplo, SNP pode ser identificado sequenciando fragmentos de ADN que mostram polimorfismo por métodos baseados em gel tais como polimorfismo de comprimento de fragmento de restrição (RFLP) e electroforese em gel de gradiente desnaturante (DGGE). Também podem ser descobertos por sequenciação direta de amostras de ADN agrupadas por diferentes indivíduos ou comparando sequências de diferentes amostras de ADN. Com a acumulação rápida de dados de sequência em bases de dados públicas e privadas, é possível descobrir SNP comparando sequências utilizando programas informáticos (Z. Gu, L. Hillier e P. Y. Kwok, "Single nucleotide polymorphism hunting in cyberspace," Hum Mutat 1998; 12 (4) :221-225) . SNP pode ser verificado e o genótipo ou haplótipo de um indivíduo pode ser determinado por uma variedade de métodos incluindo sequenciação direta e microcoleções de rendimento elevado (P. Y. Kwok, "Methods for genotyping single nucleotide polymorphisms," Annul. Rev. Genomics Hum. Genet. 2001; 2:235-258; M. Kokoris, K. Dix, K. Moynihan, J. Mathis, B. Erwin, P. Grass, B. Hines e A. Duesterhoeft, "High-throughput SNP genotyping with the Masscode system," Mol. Diagn. Dezembro de 2000; 5(4):329-340) .
Utilizando os métodos descritos em cima, foram identificados seis SNP no transcrito, 273P4B7 v.l, como mostrado no Quadro LVI. Os transcritos ou proteínas com alelo alternativos e foram designados como variante 273P4B7 v.3 a v.8, como mostrado no Quadro LVI e Figura 12. Estes 92 alelos do SNP, apesar de mostrados separadamente aqui, podem ocorrer em diferentes combinações (haplótipos) e em qualquer uma das variantes transcritas (tais como 273P4B7 v.2, como listado no quadro LVI) qe contém o local do SNP, como apresentado nas Figuras 11 e 12.
Exemplo 7: Produção de 273P4B7 recombinante em sistemas procariontes
Para expressar 273P4B7 recombinante e variantes 273P4B7 em células procariontes, 273P4B7 de comprimento parcial ou inteiro e as sequências de ADNc de 273P4B7 variante são clonados em qualquer um de uma variedade de vetores de expressão conhecidos na arte. Uma ou mais das seguintes regiões de variantes 273P4B7 são expressas: a sequência de comprimento inteiro apresentada nas Figuras 2 e 3, ou qualquer 8, 9, 10 , 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 ou mais aminoácidos contíguos de 273P4B7, variantes, ou análogos dosmesmos. A. Transcrição In vitro e construções de tradução: pCRII: Para gerar sondas de ARN de 273P4B7 senso e anti-senso para investigações de ARN in situ, as construções pCRII (Invitrogen, Carlsbad CA) são geradas que codificam ou todo ou fragmentos do ADNc de 273P4B7. vetor pCRII tem promotores Sp6 e T7 que flanqueiam o inserto para dirigir a transcrição do ARN de 273P4B7 para uso como sondas em experiências de hibridação in situ de ARN. Estas sondas são utilizadas para analisar a expressão da célula e do tecido de 273P4B7 ao nível de ARN. 0 ARN transcrito de 273P4B7 que representa o ADN da região codificante de aminoácido que codifica a região do gene 273P4B7 é utilizada em sistemas de tradução in vitro tais como o sistema reticulolisado acoplado inT™ (Promega, Corp., Madison, WI) para sintetizar a proteína 273P4B7. B. Construções bacterianas:
Construções pGEX: Para gerar proteínas 273P4B7 93 recombinantes em bactérias que estão fundidas com a poteína glutationa S-transferase (GST), toda ou partes da sequência codificante da proteína de ADNc de 273P4B7 são clonadas na família pGEX de vetores de fusão GST (Amersham Pharmacia Biotech, Piscataway, NJ) . Estas construções permitem a expressão controlada de sequências de proteína 273P4B7 recombinante com GST fundido no terminal amino e um epítopo com seis histidinas (6X His) no terminal carboxilo. As etiquetas GST e 6X His permitem a purificação da proteína de fusão recombinante a partir de bactérias induzidas com a matriz de afinidade apropriada e permite reconhecer a proteína de fusão com anticorpos anti-GST e anti-His. A etiqueta 6X His é gerada adicionando 6 codões de histidina ao iniciador de clonagem na extremidade 3', por exemplo, da grelha de leitura aberta (ORF). Um local de separação proteolítico, tal como o local de reconhecimento PreScission™ em pGEX-6P-l, pode ser empregue de tal maneira que permite a separação da etiqueta GST da proteína relacionada com 273P4B7. 0 gene de resistência à ampicilina e a origem de pBR322 permite a seleção e manutenção dos plasmídeos pGEX em E. coli.
Construções pMAL: Para gerar, nas bactérias, proteínas 273P4B7 recombinantes que estão fundidas com proteína de ligação à maltose (MBP), todas ou partes da sequência codificante de proteína do ADNc de 273P4B7 estão fundidas com o gene MBP por clonagem nos vetores pMAL-c2X e pMAL-p2X vectors (New England Biolabs, Beverly, MA). Estas construções permitem a expressão controlada de sequências de proteína 273P4B7 recombinantes com MBP fundido no terminal amino e uma etiqueta do epítopo de 6X His no terminal carboxilo. As etiquetas MBP e 6X His permitem a purificação da proteína recombinante das bactérias induzidas com a matriz de afinidade apropriada e permitem o reconhecimento da proteína de fusão com anticorpos anti-MBP e anti-His. A etiqueta do epítopo 6X His é gerada 94 adicionando 6 codões de histidina ao iniciador de clonagem em 3'. Um local de reconhecimento do fator Xa permite a separação da etiqueta pMAL de 273P4B7. Os vetores pMAL-c2X e pMAL-p2X são otimizados para expressar a proteína recombinante no citoplasma ou periplasma, respetivamente. A expressão do periplasma aumenta a dobragem das proteínas com ligações dissulfureto.
Construções pET: Para expressar 273P4B7 em células bacterianas, toda ou partes da sequência codificante de proteína do ADNc de 273P4B7 são clonados na família de vetores pET (Novagen, Madison, WI). Estes vetores permitem a expressão ligeiramente controlada de proteína 273P4B7 recombinante em bactérias com e sem fusão com as proteínas que aumenta a solubilidade, tais como NusA e tioredoxin (Trx) , e etiquetas de epítopo, tais como 6X His e S-Tag™ que ajudam à purificação e deteção da proteína recombinante. Por exemplo, as construções são feitas utilizando o sistema de fusão pET NusA 43.1 de tal maneira que regiões da proteína 273P4B7 são expressas como fusões de terminal amino com NusA. C. Construções de levedura:
Construções pESC: Para expressar 273P4B7 na espécie de levedura Saccharomyces cerevisiae para geração de proteína recombinante e estudos funcionais, toda ou partes da sequência codificante de proteína do ADNc de 273P4B7 são clonadas na família de vetores pESC cada uma das quais contém 1 de 4 marcadores selecionáveis, HIS3, TRP1, LEU2, e URA3 (Stratagene, La Jolla, CA). Estes vetores permitem a expressão controlada do mesmo plasmídeo de até 2 genes diferentes ou sequências clonadas contendo etiquetas de epítopo Flag™ ou Myc na mesma célula de levedura. Este sistema é útil para confirmar interações proteína- proteína de 273P4B7. Além disso, a expressão em leveduras produz modificações pós-traducionais semelhantes, tais como glicosilações e fosforilações que são encontradas quando 95 expressas em células eucariontes.
Construções pESP: Para expressar 273P4B7 na espécie de levedura Saccharomyces pombe, toda ou partes da sequência codificante de proteína do ADNc de 273P4B7 são clonadas na família de vetores pESP. Estes vetores permitem altos níveis de expressão controlados de uma sequência de proteína 273P4B7 que é fundida ou num terminal amino ou no terminal carboxilo com GST que ajuda à purificação da proteína recombinante. Uma etiqueta de epítopo Flag™ permite a deteção da proteína recombinante com anticorpo anti-Flag™.
Exemplo 8: Produção de 273P4B7 recombinante em sistemas eucariontes superiores A. Construções de mamíferos:
Para expressar 273P4B7 recombinante em células eucariontes, as sequências de ADNc de 273P4B7 de comprimento parcial ou inteiro foram clonadas numa qualquer de uma variedade de vetores de expressão conhecidos na arte. Uma ou mais das regiões seguintes de 273P4B7 foram expressas nestas construções, aminoácidos 1 a 1250 ou qualquer 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 ou mais aminoácidos contíguos de 273P4B7 v.l, v.4, v.5, e v.6; aminoácidos 1 a 1127 de v.2 ou qualquer 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 ou mais aminoácidos contíguos de variantes de 273P4B7, ou análogos do mesmo.
As construções podem transfetar numa qualquer de uma grande variedade de células de mamíferos tais como células 293T. Lisados de célula 293T transfetados podem ser sondados com o soro policlonal anti-273P4B7, descrito aqui.
Construções pcDNA4/HisMax: Para expressar 273P4B7 em células de mamíferos, uma ORF de 273P4B7, ou porções da mesma, de 273P4B7 são clonadas em pcDNA4/HisMax Versão A (Invitrogen, Carlsbad, CA). A expressão proteica é dirigida 96 a partir a partir do promotor do citomegalovirus (CMV) e do potenciador traducional SP16. A proteína recombinante tem Xpress™ e seis epítopos de histidina (6X His) fundidos com o terminal amino. 0 vetor pcDNA4/HisMax também contém o sinal de poliadenilação da hormona de crescimento bovina (BGH) e a sequência de terminação da transcrição para aumentar a estabilidade de ARNm juntamente com a origem de SV40 para replicação epissomal e resgate simples de vetor em linhas de células que expressa o antígeno T grande. 0 gene de resistência à zeocina permite a seleção de células de mamíferos que expressam a proteína e o gene de resistência à ampicilina e origem ColEl permitem a seleção e manutenção do plasmídeo em E. coli.
Construções pcDNA3.1/MycHis: Para expressar 273P4B7 em células de mamíferos, ORF de 273P4B7, ou porções das mesmas, de 273P487 com um local de iniciação de tradução Kozak consenso foi clonado em pcDNA3.1/MycHis Versão A (Invitrogen, Carlsbad, CA). A expressão proteica é dirigida a partir do promotor do citomegalovirus (CMV). As proteínas recombinantes têm o epítopo myc e epítopo 6X His fundido com o terminal carboxilo. 0 vetor pcDNA3.1/MycHis também contém o sinal de poliadenilação da hormona de crescimento bovina (BGH) e a sequência de terminação da transcrição para aumentar a estabilidade de ARNm, juntamente com a origem SV40 para replicação epissomal e resgate simples de vetor em linhas de células que expressam o antígeno T grande. 0 gene de resistência à neomicina pode ser utilizado, uma vez que permite a seleção de células de mamífero que expressam a proteína e o gene de resistência à ampicilina e origem ColEl permite a seleção e manutenção do plasmídeo em E. coli.
Construção pcDNA3.1/CT-GFP-TOPO: Para expressar 273P4B7 em células de mamífero e permitir a deteção das proteínas recombinantes utilizando fluorescência, uma ORF de 273P4B7, ou porções da mesma, com um local de iniciação 97 de tradução Kozak consenso foi clonado em pcDNA3.1/CT-GFP-TOPO (Invitrogen, CA). A expressão proteica é dirigida a partir do promotor de citomegalovirus (CMV). As proteínas recombinantes têm a Proteína Fluorescente Verde (GFP) fundida com o terminal carboxilo facilitando a deteção não invasiva, in vivo e estudos de biologia celular. 0 vetor pcDNA3.1 CT GFP-TOPO também contém sinal de poliadenilação da hormona de crescimento bovina (BGH) e a seguência de terminação da transcrição para aumentar a estabilidade de ARNm juntamente com a origem SV40 para replicação epissomal e resgate simples de vetor em linhas de células gue expressam o antígeno T grande. 0 gene de resistência à neomicina permite a seleção de células de mamífero gue expressam a proteína e o gene de resistência à ampicilina e origem ColEl permite a seleção e manutenção do plasmídeo em E. coli. Construções adicionais com uma fusão GFP terminal amino são feitas em pcDNA3.1/NT-GFP-T0P0 abrangendo o comprimento inteiro de uma proteína 273P4B7. PAPtag: Uma ORF de 273P4B7, ou porções da mesma, é clonada em pAPtag-5 (GenHunter Corp. Nashville, TN) . Esta construção gera uma fusão de fosfatase alcalina no terminal carboxilo de uma proteína 273P4B7 enguanto funde a sequência sinal de IgGK para o terminal amino. Construções também são geradas nas quais a fosfatase alcalina com uma sequência sinal de IgGK em terminal amino é fundida com um terminal amino de uma proteína 273P4B7. As proteínas 273P4B7 recombinantes resultantes são otimizadas para secreção nos meios de células de mamíferos transfetadas e podem ser utilizadas para identificar proteínas, tais como ligandos ou recetores que iteragem com proteínas 273P4B7. A expressão proteica é dirigida a partir a partir do promotor CMV e as proteínas recombinantes também contêm epítopos myc e 6X His fundidos no terminal carboxilo que facilita a deteção e purificação. 0 gene de resistência à zeocina presente no vetor permite a seleção de células de mamífero 98 que expressam a proteína recombinante e o gene de resistência à ampicilina permite a seleção do plasmídeo em E. coli. pTag5: Uma ORF de 273P4B7, ou porções da mesma, é clonada em pTag-5. Este vetor é semelhante a pAPtag mas sem a fusão da fosfatase alcaliana. Esta construção gera a proteína 273P4B7 sem uma sequência sinal de IgGK em terminal amino e etiquetas de epítopos myc e 6X His no terminal carboxilo que facilita a deteção e purificação de afinidade. A proteína 273P4B7 recombinante resultante é otimizada para secreção nos meios de células de mamífero transfetadas, e é utilizada como imunogene ou ligando para identificar proteínas tais como ligandos ou recetores que interagem com as proteínas 273P4B7. A expressão proteica é dirigida a partir do promotor do CMV. 0 gene de resistência à zeocina presente no vetor permite a seleção de células de mamífero que expressam a proteína, e o gene de resistência à ampicilina permite a seleção do plasmídeo em E. coli.
PsecFc: Uma ORF de273P4B7, ou porções da mesma, é também clonda em psecFc. 0 vetor psecFc foi reunido clonando a imunoglobulina humana G1 (IgG) Fc (dobradiça, regiões CH2, CH3) em pSecTag2 (Invitrogen, Califórnia). Esa construção gera uma fusão IgGl Fc no terminal carboxilo das proteínas 273P4B7, enquanto funde a sequência sinal de IgGK ao terminal N. As fusões 273P4B7 utilizando a região murina IgGl Fc também são utilizadas. As proteínas 273P4B7 recombinantes resultantes são otimizadas para secreção nos meios de células de mamífero transfetadas, epodem ser utilizadas como imunogenes ou para identificar proteínas tais como ligandos ou recetores que interagem com a proteína 273P4B7. A expressão proteica é dirigida a partir do promotor de CMV. 0 gene de resistência à higromicina presente no vetor permite a seleção de células de mamífero que expressam a proteína recombinante, e o gene de resistência à ampicilina permit a seleção do plasmídeo em 99 E. coli.
Construções pSRa: Para gerar linhas de células de mamíferos que expressam 273P4B7 constitutivamente, ORF de 273P4B7, ou porções das mesmas, de 273P4B7 foram clonados em construções pSRa. Retrovírus anfotrópicos e ecotrópicos foram gerados por transfeção de construções pSRa na linha de embalagem 293T-10A1 ou co-transfeção de pSRa e um plasmídeo auxiliar (contendo sequências de embalagem eliminadas) nas células 293, respetivamente. 0 retrovírus é utilizado para infetar uma variedade de linhas de células de mamíferos, resultando na integração do gene clonado, 273P4B7, nas linhas de células hospedeiras. A expressão proteica é dirigida a partir de uma repetição longa de terminal (LTR). 0 gene de resistência à neomicina presente no vetor permite a seleção de células de mamífero que expressam a proteína, e o gene de resistência à ampicilina e origem ColEl permitem a seleção e manutenção do plasmídeo em E. coli. Os vetores retrovirais podem, daí em diante ser utilizados para infeção e geração de várias linhas de células utilizando, por exemplo, células PC3, NIH 3T3, TsuPrl, 293 ou rat-1.
Construções pSRa adicionais foram feitas que fundem uma etiqueta de epítopo tal como a etiqueta FLAG™ para o terminal carboxilo das sequências de 273P4B7 para permitir a deteção utilizando anticorpos anti-Flag. Por exemplo, a sequência FLAG™ 5' gat tac aag gat gac gac gat aag 3' (SEQ. ID N.° 42) é adicionada para clonar o iniciador na extremidade 3' da ORF. Construções pSRa adicionais são feitas para produzir ambos GFP em terminal amino e terminal carboxilo e proteínas de fusão myc/6X His das proteínas 273P4B7 de comprimento inteiro.
Vetores virais adicionais: Construções adicionais são feitas para entrega mediada pelo vírus e expressão de 273P4B7. Título elevado de vírus conduzindo a elevado nível de expressão de 273P4B7 é conseguido em sistemas de entrega 100 virais tais como vetores adenovirais e vetores de herpes amplicon. Sequências que codificam 273P4B7, ou fraqmentos das mesmas, são amplificadas por PCR e subclonadas no vetor shuttle AdEasy (Stratagene). A recombinação e embalagem do virus são realizados de acordo com as instruções do fabricante para gerar vetores adenovirais. Em alternativa, as sequências que codificam 273P4B7, ou fragmentos das mesmas, são clonadas no vetor HSV-1 (Imgenex) para gerar vetores de herpes virai. Os vetores virais são dai em diante utilizados para infeção de várias linhas de células tais como células PC3, NIH 3T3, 293 ou rat-1.
Sistemas de Expressão regulada: Para controlar a expressão de 273P4B7 em células de mamífero, sequências codificantes de 273P4B7, ou porções das mesmas, são clonadas em sistemas de expressão de mamífero regulados tais como o sistema T-Rex (Invitrogen) , o sistema GeneSwitch (Invitrogen) e o sistema da ecdisona regulado pelo pirilampo (Sratagene) . Estes sistemas permitem o estudo de dos efeitos temporais e dependentes de concentração de 273P4B7 recombinante. Estes vetores são daí em diante utilizados para controlar a expressão de 273P4B7 em várias linhas de células tais como células PC3, NIH 3T3, 293 ou rat-1. B. Sistemas de Expressão de Baculovírus
Para gerar proteínas 273P4B7 recombinantes num sistema de expressão de baculovírus, a ORF de 273P4B7, ou porções da mesma, são clonados nos vetores de transferência de baculovírus pBlueBac 4.5 (Invitrogen), que providencia uma His-tag no terminal N. Especificamente, pBlueBac-273P4B7 é co-transfetada com o plasmídeo auxiliar pBac-N-Blue (Invitrogen) em células de inseto SF9 (Spodoptera frugiperda) para gerar baculovírus recombinante (ver manual de instruções de Invitrogen para detalhes). Baculovírus é depois colhido do sobrenadante celular e purificado por teste em placa. 101 A proteína 273P4B7 recombinante é depois gerada por infeção de células de inseto lagarta-militar (Invitrogen) com baculovírus purificado. A proteína 273P4B7 recombinante pode ser detetada utilizando anticorpo anti-273P4B7 ou anti-His-tag. A proteína 273P4B7 pode ser purificada e utilizada em vários tentes baseados na célula ou como imunogene para gerar anticorpos policlonais e monoclonais específicos para 273P4B7.
Exemplo 9: Perfis de antigenicidade e estrutura secundária
As Figura 5, Figura 6, Figura 7, Figura 8, e Figura 9 representam graficamente cinco perfis de aminoácidos de 273P4B7 variante 1, cada avaliação disponível acedendo ao site da ProtScale localizado na internet em (www.expasy.ch/cgi—bin/protscale.pl) no servidor de biologia molecular ExPasy.
Estes perfis: Figura 5, Hidrofobicidade, (Ηορρ T.P., Woods K.R., 1981. Proc. Natl. Acad. Sei. U.S.A. 78: 3824- 3828); Figura 6, Hidropaticidade, (Kyte J., Doolittle R.F.,1982. J. Mol. Biol. 157:105-132); Figura 7, Percentagem de Resíduos Acessíveis (Janin J., 1979 Nature 277:491-492); Figura 8, Flexibilidade média, (Bhaskaran R., e Ponnuswamy P.K., 1988. Int. J. Pept. Protein Res. 32:242-255); Figura 9, Volta beta (Deleage, G., Roux B. 1987 Protein Engineering 1:289-294); e opcionalmente outros disponíveis na arte, tais como no site da ProtScale, foram utilizados para identificar regiões antigénicas de cada uma das proteínas variantes de 273P4B7. Cada um dos perfis de aminoácidos anteriores das variantes de 273P4B7 foram gerados utilizando os seguintes parâmetros da ProtScale para a análise: 1) um tamanho de janela de 9; 2) 100% de peso dos limites da janela comparado com o centro da janela; e, 3) valores de perfis de aminoácidos normalizados para estarem entre 0 e 1.
Os perfis de Hidrofobicidade (Figura 5) ,
Hidropaticidade (Figura 6) e Percentagem de Resíduos 102
Acessíveis (Figura 7) foram utilizados para determinar trechos de aminoácidos hidrofílicos (isto é, valores superiores a 0,5 no perfil de Hidrofobicidade e de Percentagem de Resíduos Acessíveis, e valores inferiores a 0,5 no perfil de Hidropaticidade). É provável que tais regiões fiquem expostas ao ambiente aquoso, estejam presentes na superfície da proteína, e assim disponíveis para reconhecimento imune, tal como por anticorpos.
Os perfis de flexibilidade média (Figura 8) e Volta beta (Figura 9) determinam troços de aminoácidos (isto é, valores superiores a 0,5 no perfil de Volta beta e no perfil de flexibilidade média) que não estão constritos em estruturas secundárias tais como folhas beta e hélices alfa. Também é provável que tais regiões estejam expostas na proteína e, portanto, acessíveis para reconhecimento imune, tal como por anticorpos.
Sequências antigénicas das variantes da proteínas 273P4B7 indicaram, por exemplo, pelos perfis apresentados na Figura 5, Figura 6, Figura 7, Figura 8, e/ou Figura 9 são utilizados para preparar imunogenes, sejam péptidos ou ácidos nucleicos que os codificam, para gerar anticorpos anti-273P4B7 terapêuticos e de diagnóstico. O imunogene pode ser qualquer 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,16,17,18,19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50 ou mais de 50 aminoácidos contíguos, ou os ácidos nucleicos correspondentes que os codificam, das variantes da proteína 273P4B7 listadas nas Figuras 2 e 3. Em particular, os imunogenes peptídicos da invenção podem compreender, uma região peptídica de, pelo menos, 5 aminoácidos das Figuras 2 e 3 em qualquer incremento de número inteiro que inclui uma posição de aminoácido que tem um valor superior a 0,5 nos perfis de Hidrofobicidade da Figura 5; uma região peptídica de, pelo menos, 5 aminoácidos das Figuras 2 e 3 em qualquer incremento de número inteiro que inclui uma posição de aminoácido que tem um valor inferior a 0,5 no 103 perfil de Hidropaticidade das Figuras 6; uma região peptidica de, pelo menos, 5 aminoácidos das Figuras 2 e 3 em gualquer incremento de número inteiro que inclui uma posição de aminoácido que tem um valor superior a 0,5 nos perfis de percentagem de resíduos acessíveis da Figura 7; uma região peptidica de, pelo menos, 5 aminoácidos das Figuras 2 e 3 em qualquer incremento de número inteiro que inclui uma posição de aminoácido que tem um valor superior a 0,5 nos perfis de flexibilidade média da Figura 8; e, uma região peptidica de, pelo menos, 5 aminoácidos das Figuras 2 e 3 em qualquer incremento de número inteiro que inclui uma posição de aminoácido que tem um valor superior a 0,5 no perfil de Volta beta das Figuras 9. Os imunogenes peptídicos da invenção também podem compreender ácidos nucleicos que codificam qualquer dos anteriores.
Todos os imunogenes da invenção, peptídicos ou de ácido nucleico, podem ser tornados em modalidades de forma de dose unitária humana, ou compreendidos por uma composição que inclui um excipiente farmacêutico compatível com a fisiologia humana. A estrutura secundária da proteína 273P4B7 variante 1, nomedamanete a presença prevista e a localização das hélices alfa, cadeias estendidas, e espirais aleatórias, é previsto a partir da sequência de aminoácidos primária utilizando método de Rede Neural Hierárquico-HNN (NPS0: Análise de Sequência Proteica em Rede TIBS Março de 2000 Volume 25, N.° 3 [291]: 147-150 Combet C, Blanchet C, Geourjon C. e Deléage G., http://pbil.ibcp.fr/cgi-bin/npsa_automat.pl?page=npsa_ nn.html), acedido a partir do servidor de biologia molecular ExPasy localizado na internet em (www.expasy.ch/tools/). A análise indica que 273P4B7 variante 1 é composto por 41,60% de hélice alfa, 11,12% de cadeia estendida, e 47,28% de espiral aleatória (Figura 13A). A análise para a presença potencial de domínios 104 transmembranares na proteína 273P4B7 variante 1 foi realizada utilizando uma variedade de algoritmos de previsão transmembranares acedidos a partir do servidor de biologia molecular ExPasy localizado na internet em (www.expasy.ch/tools/). Mostrados graficamente na Figura 13B e Figura 13C estão os resultados da análise da variante 1 utilizando o programa TMpred (Figura 13B) e programa TMHMM (Figura 13C). 0 programa TMpred prevê a presença de 2 domínios transmembranares, ao passo que o programa TMHMM não prevê domínios transmembranares. Tomados em conjunto com a análise utilizando outros programas sumarizados no Quadro VI e Quadro L, os dados sugerem que 273P4B7 é muito provavelmente uma proteína solúvel.
Exemplo 10: Identificação de epítopos candidatos de supermotivo HLA e CTL transportador de motivo
Este exemplo ilustra a identificação e confirmação de epítopos transportadores de motivo e supermotivo. 0 cálculo da cobertura da população é realizado utilizando a estratégia descrita a seguir.
Pesquisas por computador e algoritmos para identificação de epítopos transportadores de supermotivo e/ou motivo
As pesquisas por computador por epítopos que transportam supermotivos ou motivos HLA de Classe I ou Classe II são realizadas como se segue. Todas as sequências da proteína 273P4B7 traduzidas são analisadas utilizando um programa informático de pesquisa de uma série de texto para identificar sequências de péptidos potenciais contendo motivos de ligação ao HLA apropriados; tais programas são rapidamente produzidos de acordo com informação na arte considerando revelações conhecidas de motivo/supermotivo. Além disso, tais cálculos podem ser feitos mentalmente.
As sequências de supermotivo A2-, A3-, e DR- identifiçadas são classificadas utilizando algoritmos polinomiais para prever a sua capacidade para se ligarem a moléculas específicas de HLA-Classe I ou Classe II. Estes 105 algoritmos polinomiais contribuem para o impacto de diferentes aminoácidos em posições diferentes, e são essencialmente baseados na premissa de que a afinidade global (ou AG) das interações péptido-molécula HLA pode ser aproximada a uma função linear polinomial do tipo: "AG" = aiixaaxa3í......xa* onde a é um coeficiente que representa o efeito da presença de um dado aminoácido (j) numa dada posição (i) ao longo da sequência de um péptido de n aminoácidos. A suposição crucial deste método é que os efeitos em cada posição são essencialmente independentes um do outro (isto é, a ligação independente das cadeias laterais do indivíduo) . Quando o residuo j ocorre na posição i no péptido, assume-se que contribui com uma quantidade constante ji para a energia livre de ligação do péptido sem consideração pela sequência do resto do péptido. 0 método de derivação de coeficientes de algoritmo específicos foi descrito em Gulukota et al., J. Mol. Biol. 267:1258-126, 1997; (ver também Sidney et al., Human Immunol. 45:79-93,1996; e Southwood et al., J. Immunol. 160: 3363-3373, 1998). Resumidamente, para todas as posições i, tipo âncora e não âncora, a média geométrica da ligação relativa média (ARB) de todos os péptidos que transportam j é calculada em relação ao restante do grupo, e utilizado como a estimativa de j±. Para péptidos de classe II, se alinhamentos múltiplos são possíveis, apenas o alinhamento com maior classificação é utilizado, seguindo um procedimento iterativo. Para calcular uma classificação do algoritmo de um dado péptido num conjunto teste, e os valores ARB correspondentes à sequência do péptido são multiplicados. Se este produto excede um limite escolhido, prevê-se que o péptido se ligue. Limites apropriados são escolhidos como uma função do grau de restringência da predição desejada.
Seleção péptidos com reação cruzada de supertipo HLA-A2 106
As sequências proteicas de 273P4B7 são digitalizadas utilizando programas de identificação de motivos, para identificar sequências 8-, 9- 10- e 11-meros contendo a especificidade de âncora principal supermotivo HLA-A2. Tipicamente, estas sequências são depois classificadas utilizando o protocolo descrito em cima e os péptidos correspondentes com as sequências que se classificaram positivamente são sintetizadas e testadas pela sua capacidade de ligar moléculas HLA-A*0201 purificadas in vitro (HLA-A*0201 é considerado um protótipo da molécula de supertipo A2).
Estes péptidos são depois testados pela sua capacidade de ligar a moléculas de supertipo A2 adicionais (A*0202, A*0203, A*0206, e A*6802) . Péptidos que se ligam a, pelo menos, três dos cinco alelos de supertipo A2 testados são tipicamente considerados ligantes de reação cruzada e supertipo A2. Péptidos preferidos ligam a uma afinidade igual a ou inferior a 500 nM a três ou mais moléculas de supertipo HLA-A2.
Seleção de epítopos transportadores de supermotivo HLA-A3 A sequência(s) da proteína 273P4B7 digitalizadas anteriormente é também examinada para a presença de péptidos com as âncoras primárias do supermotivo HLA-A3. Péptidos correspondentes a sequências transportadoras de supermotivo HLA A3 são depois sintetizados e testados para a ligação a moléculas de HLA-A*0301 e HLA-A*1101, as moléculas codificadas pelos dois alelos de supertipo A mais prevalentes. Os péptidos que se ligam, pelo menos, a um dos dois alelos com afinidades de ligação de <500 nM, frequentemente < 200 nM, são depois testados para reatividade cruzada de ligação com os outros alelos de supertipo A3 comuns (por exemplo, A*3101, A*3301, e A*6801) para identificar aqueles que podem ligar-se a, pelo menos, três das cinco moléculas de supertipo HLA-A3 testadas. Seleção de epítopos transportadores de supermotivo HLA-B7 107 A prteína(s) 273P4B7 digitalizada anteriormente também é analisada pela presença de péptidos 8-, 9- 10-, ou 11- meros com o supermotivo HLA-B7. Péptidos correspondentes são sintetizados e testados para a ligação a HLA-B*0702, a molécula codificada pelo alelo de supertipo B7 mais comum (isto é, o alelo de supertipo protótipo B7) . Péptidos que se ligam a B*0702 com IC50 de <500 nM são identificados utilizando métodos padrão. Estes péptidos são depois testados par ligação a outras moléculas de supertipo B7 comuns (por exemplo, B*3501, B*5101, B*5301, e B*5401). Péptidos capazes de se ligarem a três ou mais dos cinco alelos de supertipo B7 testados são, por isso, identificados.
Seleção de epítopos transportadores de motivos Al e A24
Para aumentar ainda mais a cobertura da população, epitopos HLA-A1 e -A24 também podem ser incorporados em composições de vacina. Uma análise da proteína 273P4B7 também pode ser realizada para identificar sequências contendo motivo HLA-A1 e A24.
Epítopos de elevada afinidade e/ou de reação de ligação cruzada que transportam outros motivos e/ou supermotivos são identificados utilizando metodologia análoga.
Exemplo 11: Polinucleotídeos complementares
Sequências complementares às sequências que codificam 273P4B7, ou quaisquer partes das mesmas, são utilizadas para detetar, diminuir, ou inibir a expressão de 273P487 que ocorre naturalmente. Apesar de estar descrito um uso de oligonucleotídeos compreendido desde cerca de 15 a 30 pares de base, é utilizado essencialmente o mesmo procedimento com fragmentos de sequência mais pequenos ou maiores. Oligonucleotídeos apropriados são desenhados utilizando, por exemplo, o programa OLIGO 4.06 (National Biosciences) e a sequência codificante de 273P4B7. Para inibir a transcrição, um oligonucleotídeo complementar é definido 108 desde a sequência 5' mais única e utilizada para prevenir a ligação do promotor à sequência codificante. Para inibir a tradução, um oligonucleotideo complementar é desenhado para prevenir a ligação ribossomal a um transcrito que codifica 273P4B7.
Exemplo 12: Comparação da Homologia de 273P4B7 com sequências conhecidas: A proteína 273P4B7 da Figura 3 tem 1250 aminoácidos com peso molecular calculado de 141,1 kDa, e pl de 5,19. Prevê-se que 273P4B7 seja uma proteína nuclear (65% por PSORT) co uma possibilidade de ser uma proteína citoplasmática (50% PSORT). Apesar de alguns programas preditivos indicarem que 273P4B7 pode ter um domínio transmembranar, é igualmente provável que a proteína 273P4B7 seja uma proteína intracelular solúvel.
Utilizando o site da PubMed do N.C.B.I. disponível na internet em (www.ncbi.nlm.nih.gov/entrez), verificou-se que o nível da proteína a que 273P4B7 mostra melhor homologia com uma proteína sem nome (gi|22760345) de função desconhecida, com 99% de identidade e 99% de homologia sobre o comprimento inteiro da proteína (Figura 4A) . A proteína 273P4B7 demonstra semelhança com um antígeno de tumor humano hipotético designado BJ-HCC-15 da proteína (gi|22002580) com 99% de identidade e 100% de homologia sobre os últimos 419 aa da proteína 273P4B7 (Figura 4B). 0 ortólogo de ratinho de 273P4B7 foi identificado mostrando 72% de identidade e 81 % de homologia com 273P4B7 (Figura 4C). Análise bioinformática revelou a presença de um motivo SNF2 no aa 99-417 e um motivo helicase no aa 490-574 da proteína 273P4B7. Estes motivos também são encontrados na proteína da família SNF2/RAD54 de ratinho (gi|27414501) que transporta 72% de identidade com 273P4B7. O domínio SNF2 é frequentemente encontrado em proteínas envolvidas na regulação da transcrição, reparo de ADN, recombinação de ADN, e desenrolar da cromatina 109 (Alexeev A, Mazin A, Kowalczykowski SC. Nat Struct Biol. 2003, 10:182; Solinger JA, Kiianitsa K, Heyer WD. Mol Cell. 2002, 10:1175; Martens JA, Winston F.: Genes Dev. 2002,16:2231). Ao remodelar complexos de ADN, SNF2 torna o ADN nucleossomal acessível a fatores reguladores, regulando assim a expressão génica (Fan HY et al, Mol Cell. 2003,11:1311). Evidência em Saccharomyces cerevisiae indica que SNF2 regula a transcrição nestes organismos. Foi mostrado que complexos SNF com SWI e o SWI/SNF é recrutado para o promotor de genes específicos que induzem a sua ativação transcricional (Kingston, R.E. e Narlikar, G.J. Genes e Dev.1999, 13: 2339-2352). Um complexo remodelador de cromatina semelhante foi identificado em células de mamífero, conhecido como Brm/ Brgl. Verificou-se que este complexo regula a expressão génica bem como o ciclo celular (Muchardt C e Yaniv M, Oncogene 2001, 20: 3067).
Finalmente, um "gene tipo SNF2 associado à proliferação" que contém motivos SNF2 foi associado com AML (Lee D et al, Câncer Res. 2000, 60:3612).
As nossas descobertas de que 273P4B7 é altamente expresso em vários cancros enquanto mostra um padrão de expressão restrito em tecidos normais sugere que o gene 273P4B7 pode desempenhar um papel importante em vários cancros, incluindo os cancros apresentados no Quadro I. É providenciado pela presente invenção que 273P4B7 controla o crescimento e progressão tumoral regulando a proliferação, ciclo celular, expressão génica bem como a sobrevivência celular. Em concordância, quando 273P4B7 funciona como um regulador da proliferação, ciclo celular, expressão génica e sobrevivência celular, 273P4B7 é utilizado para fins terapêuticos, diagnósticos, prognósticos ou preventivos. Exemplo 13: Identificação e Confirmação de vias de transdugão do sinal
Muitas proteínas de mamíferos foram reportadas como interagindo com moléculas sinalizadoras e como participando 110 em vias de sinalização reguladoras. (J Neurochem. 2001; 76:217-223). Em particular, mostrou-se que os fatores de transcrição regula em vias de sobrevivência e mitogénicas (Neeley K, Biochim Biophys Acta. 2002, 1603:19). Utilizando imunoprecipitação e técnicas de Western blotting, as proteínas são identificadas que associam com 273P4B7 e medeiam eventos sinalizadores. Várias vias conhecidas por desempenhar um papel na biologia do cancro podem ser reguladas por 273P4B7, incluindo vias fosfolipídicas tais como P13K, AKT, etc, vias de adesão e de migração, incluindo FAK, Rho, Rac-1, etc, be como cascadas de sobrevivência/mitogénicas tais como ERK, p38, etc (Cell Growth Differ. 2000, 11:279; J Biol Chem. 1999, 274:801; Oncogene. 2000, 19: 3003, J. Cell Biol. 1997, 138:913.). Análise bioinformática revelou que 273P4B7 pode tornar-se fosforilada por serina/treonina bem como tirosina quinases. Assim, a fosforilação de 273P4B7 é providenciada pela presente invenção para conduzir à ativação das vias listadas anteriormente.
Utilizando, por exemplo, técnicas de Western blotting a capacidade de 273P4B7 de regular estas vias é confirmada. As células que expressam ou carecem de 273P4B7 são deixadas não tratadas ou estimuladas com citocinas, hormonas e anticorpos anti-integrina. Lisados celulares são analisados utilizando anticorpos anti-fosfo-específicos (Sinalização celular, Santa Cruz-Biotechnology) de maneira a detetar a fosforilação e regulação de ERK, p38, AKT, P13K, PLC e outras moléculas sinalizadoras.
Para confirmar que 273P4B7 ativa, direta ou indiretamente, vias de transdução do sinal conhecidas em células, testes repórter transcricional baseados na luciferase (luc) são realizados em genes de indivíduo que expressam células. Estes repórteres transcricionais contêm locais de ligação de consenso para fatores de transcrição conhecidos que estão a jusante de vias de transdução do 111 sinal bem caracterizadas. Os repórteres e exemplos destes fatores de transcrição associados, vias de transdução do sinal, e estimulos de ativação estão listados a seguir. 1. NFkB-luc, NFkB/Rel; lk-quinase/SAPK; crescimento/apoptose/stress 2. SRE-luc, SRF/TCF/ELK1; MAPK/SAPK; crescimento/diferenciação 3. AP-l-luc, FOS/JUN; MAPK/SAPK/PKC; crescimento/apoptose/stress 4. ARE-luc, recetor androgénio; esteroides/MAPK; crescimento/diferenciação/apoptose 5. p53-luc, p53; SAPK; crescimento/diferenciação/apoptose 6. CRE-luc, CREB/ATF2; PKA/p38; crescimento/apoptose/stress
Os efeitos mediados pelos genes podem ser testados em células que exibem expressão de ARNm. Plasmideos repórter luciferase podem ser introduzidos por transfeção mediada por lipidos (TFX-50, Promega). A atividade da luciferase, um indicador deatividade transcricional relativa, é medida por incubação de extratos celulares com substrato de luciferina e a luminescência da reação é monitorizada num luminómetro.
Vias de sinalização ativadas por 273P4B7 são mapeadas e utilizadas para a identificação e validação de alvos terapêuticos. Quando 273P4B7 desempenha um papel na regulação de vias de sinalização, vias mitogénicas e de sobrevivência, vias fosfolípidicas e vias de adesão e migração quer individualmente ou coletivamente, é utilizada como um alvo para fins diagnósticos, prognósticos, preventativos e terapêuticos. Além disso, quando 273P4B7 está envolvido na sinalização celular, é utilizado como alvo para fins diagnósticos, prognósticos, preventivos e terapêuticos.
Exemplo 14: Envolvimento na progressão do tumor 0 gene 273P4B7 pode contribuir pra o crescimento das células cancerosas. 0 papel de 273P4B7 no crescimento do 112 tumor é confirmado numa variedade de linhas de células transfetadas e primárias incluindo linhas de células do pâncreas, colo do útero, bexiga, pulmão, próstata, rim, cólon, ovário, mama, osso, pele, nódulo linfático, estômago, e útero bem como células NIH 3T3 fabricadas por engenharia genética para expressarem de forma estável 273P4B7. As células parentais que carecem de 273P4B7 e as células que expressam 273P4B7 são avaliadas pelo crescimento celular utilizando um teste de proliferação bem documentado (Fraser SP, Grimes JA, Djamgoz MB. Prostate. 2000;44:61, Johnson DE, Ochieng J, Evans SL. Anticancer Drugs. 1996, 7:288).
Para confirmar o papel de 273P4B7 no processo de transformação, o seu efeito em testes de formação de colónias é investigado. Células NIH3T3 parentais que carecem de 273P4B7 são comparadas com células NHI-3T3 que expressam 273P4B7, utilizando um teste de agar macio em condições restringentes e mais permissivas (Song Z. et al. Câncer Res. 2000, 60:6730).
Para confirmar ao papel de 273P4B7 na invasão e metástase de células cancerosas, um teste berne stabelecido é utilizado, por exemplo, um teste de sistema de Inserto de Transwell (Becton Dickinson) (Câncer Res. 1999, 59:6010). Células controlo, including, mas não limitado a, linhas de células de próstata, cólon, bexiga e rim que carecem de 273P4B7 são comparadas com células que expressam 273P4B7. As células são carregadas com a tinta fluorescente, calceina, e colocadas em placas no poço de cima do inserto Transwell revestido com um análogo de membrana de subsolo. A invasão é determinada pela fluorescência das células na câmara inferior em relação à fluorescência da população inteira de células. 273P4B7 também pode desempenhar um papel no ciclo celular e apoptose. As células parentais e células que expressam 273P4B7 são comparadas em relação às diferenças 113 na regulação do ciclo celular utilizando um teste de BrdU bem estabelecido (Abdel-Malek ZA. J Célula Physiol. 1988, 136:247). Resumindo, as células são crescidas em condições ótimas (soro inteiro) e limitantes (baixo soro) são rotuladas com BrdU e coradas com anticorpo anti-BrdU e iodeto de propídeo. As células são analisadas pela entrada nas fases Gl, S, e G2M do ciclo celular. Em alternativa, o efeito do stress na apoptose é avaliado em células controlo parentais e células que expressam 273P4B7. Células fabricadas por engenharia genética e parentais são tratadas com vários agentes quimioterapêuticos, tais como paclitaxel, gemcitabina, etc, e inibidores da sintese proteica, tais como cicloheximida. As células são coradas com anexina V-FITC e a morte celular é medida por análise FACS. A modulação da morte celular por 273P4B7 pode desempenhar um papel critico na regulação da progressão do tumor e carga do tumor.
Quando 273P4B7 desempenha um papel no crescimento celular, transformação, invasão e metástase, e ciclo celular e apoptose, é utilizado como um alvo para fins diagnósticos, prognósticos, preventativos e terapêuticos. Exemplo 15: Envolvimento na angiogénese A angiogénese ou formação de vasos sanguíneos capilares é necessária para o crescimento tumoral (Hanahan D, Folkman J. Cell. 1996, 86:353; Folkman J. Endocrinology. 1998 139:441). Foram desenvolvidos vários testes para medir a angiogénese in vitro e in vivo, tais como testes de cultura de tecido, formação de tubos celulares de células endoteliais, e proliferação de células endoteliais. Utilizando estes testes bem como neovascularização in vitro, o efeito de 273P4B7 na angiogénese é confirmado.
Por exemplo, as células endoteliais fabricadas por engenharia genética para expressarem 273P4B7 são avaliadas utilizando testes de formação de tubo e de proliferação. 0 efeito de 273P4B7 também é confirmado em modelos animais in 114 vivo. Por exemplo, as células ou exprimindo ou carecendo de 273P4B7 são implantadas subcutaneamente em ratinhos imunocomprometidos. A migração das células endoteliais e angiogénesse são avaliadas 5-15 dias depois utilizando técnicas de imunohistoquimica.
Quando 273P4B7 afeta a angiogénese, é utilizado como um alvo para fins diagnósticos, prognósticos, preventivos e terapêuticos.
Exemplo 16: Regulação da transcrição A localização de 273P4B7 no núcleo e a sua semelhança com SNF2 contendo proteínas conhecidas por regular a expressão génica e estrutura da cromatina, suportam a presente invenção no uso de 273P4B7 com base no seu papel na regulação transcricional de genes eucariontes. A regulação da expressão génica é confirmada, por exemplo, estudando a expressão génica em células que expressam ou que carecem de 273P4B7. Para este fim, são realizados dois tipos de experiências.
No primeiro conjunto de experiências, o ARN de células parentais e que expressam 273P4B7 é extraído e hibridizado com coleções de genes comercialmente disponíveis (Clontech) (Smid-Koopman E et al. Br J Câncer. 2000. 83:246) . As células em descanso bem como as células tratadas com FBS ou androgénio são comparadas. Genes expressos diferencialmente são identificados de acordo com procedimentos conhecidos na arte. Os genes expressos diferencialmente são depois mapeados para vias biológicas (Chen K et al., Thyroid. 2001.11:41. ) .
No segundo conjunto de experiências, a ativação da via transcricional especifica é avaliada utilizando construções de luciferase repórter comercialmente disponíveis (Stratagene) incluindo: NFkB-luc, SRE-luc, ELKl-luc, ARE-luc, p53-luc, e CRE-luc. Estes repórteres transcricionais contêm locais de ligação de consenso para fatores de transcrição conhecidos que permanecem a jusante de vias de 115 transdução do sinal bem caracterizadas, e representam uma boa ferramenta para verificar a ativação da via e classificar os moduladores como positivos e negativos da ativação da via.
Assim, quando 273P4B7 desempenha um papel na regulação de genes, é utilizado como um alvo para fins diagnósticos, prognósticos, preventivos e terapêuticos.
Ao longo deste pedido, vários conteúdo de dados em sites de internet, publicações, pedidos de patente e patentes foram referenciados. (os sites de internet são referenciados pelo seu próprio Localizador de Recursos Uniforme, ou URL, endereços na WWW) . Várias modificações aos modelos e métodos da invenção, além daquelas descritas aqui, tornar-se-ão aparentes àqueles habilitados na arte a partir da descrição anterior e ensinamentos, QUADROS: QUADRO I: Tecidos que expressam a 273P4B7:
Tecidos Malignos a. Próstata b. Bexiga c. Rim d. Cólon e. Pulmão f. Ovário g. Mama h. Pâncreas i. Ossos j . Pele k. Colo do útero l. Nódulo linfático m. Estômago n. Útero UMA ÚNICA LETRA TRÊS LETRAS NOME COMPLETO F Phe Fenilalanina QUADRO II: Abreviações dos Aminoácidos_ 116 UMA UNICA LETRA TRES LETRAS NOME COMPLETO L Leu Leucina S Ser Serina Y Tyr tirosina C Cys cisteína W Trp Trptofano P Pro prolina H His Histidina Q Gin Glutamina R Arq Arginina I Ile Isoleucina M Met metionina T Thr Treonina N Asn Asparagina K Lys lisina V Vai Valina A Ala alanina D Asp Ácido aspártico E Glu Ácido glutâmico G Gly glicina 117 QUADRO III: Matriz de substituição de aminoácidos
Adaptado de GCG Software 9.0 BLOSUM62 matriz de substituição de aminoácidos {matriz de substituição de bloco). Quanto mais alto o valor, maior a probabilidade de uma substituição ser encontrada em proteínas naturais
relacionadas. (Ver URL www.ikp.unibe.ch/manual/blosum62.html) ACDEPGHIKLMHPQRSTVWY,
4 0-2-1-2 0 -2 -1 -1 -1 -1 -2 -1-1-1 1 0 0 -3 -2 A
9 -3 -4 -2 -3 -3 -1 -3 -1 -1 -3 -3 -3 -3 -1 -1 -1 -2 -2 C
6 2-3-1 -1 -3 -1 -4 -3 1-1 0-2 0 -1 -3 -4 -3 D
5-3-2 0-3 1-3-2 0-1 2 0 0-1 -2 -3 -2 E
6-3-1 0-3 0 0-3 -4 -3 -3 -2-2-1 1 3 P
6 -2 -4 -2 -4 -3 0 -2 -2 -2 0 -2 -3 -2 -3 G
8 -3 -1 -3-2 1-2 0 0 -1 -2 -3-2 2 H 4-3 2 1-3-3 -3 -3 -2 -1 3-3-11
5-2-1 0-1 1 2 0-1-2 -3 -2 K 4 2-3-3 -2 -2 -2 -1 1-2-11.
S -2 -2 0 -1 -1 -1 1 -1 -1 M
6 -2 0 0 1 0 -3 -4 -2 N
7 -1 -2 -1 -1 -2 -4 -3 P
5 1 0 -1 -2 -2 -1 Q
5 -1 -1 -3 -3 -2 R 4 1 -2 -3 -2 S 5 0 -2 -2 T 4 -3 -1 V 11 2 W
7 Y 118 QUADRO IV:
Motivos/Supermotivos HLA de Classe I/II
QUADRO IV (A): Supermotivos/Motivos HLA de Classe I
SUPERMOTIVO POSIÇÃO POSIÇÃO POSIÇÃO 2 (Âncora primária) 3 (Âncora primária) Terminal C (Âncora primária) AI T ILVM S FWY A2 LIVMATQ IVMATL A3 VSMATLI RK A2 4 YFWIVLMT FIYWLM 87 P VILFMWYA B27 RHK FYLWMIVA B44 ΕΌ FWYLIMVA B58 ATS FWYLJVMA B62 QLIVMP FViYMIVLA MOTIVOS AI TSM Y MOTIFS AI DEAS Y A2.1 LMVQIAT VLIMAT A3 LMVISATF CGD KYRHFA AI 1 VTMLISAGNCDF KRYH A2 4 YFWM FLIW A*3101 MVTALJS RK A*33 01 MVALF IST RK A*6801 AVTMSLI RK B* 0 7 0 2 P LMFWYAJV B*3501 P LMFWYJVA B51 P LIVF WYAM B* 53 01 P IMFWYALV B* 5 4 01 P AYIVLMFWY 119
Os resíduos a negrito são preferidos, os resíduos em itálico são menos preferidos: considera-se que um péptido carrega um motivo se tiver âncoras primárias em cada posição de âncora primária para um motivo ou supermotivo como especificado no quadro em cima.
1 6 9 W, F, Y, V, I, L A, V, I, L, P, C, S, T A, V, I, L, C, S, T, Μ, Y QUADRO IV (B): Supermotivo HLA de Classe II _
QUADRO IV (C): Motivos HLA de Classe II MOTIVOS 1° âncora 1 2 3 4 5 1° âncora 6 7 8 9 DR4 preferido FMYLIIW M T W I VSTCPALIM MH R MH deletério WDE DR1 preferido MFLIVWY C C PAMQ FD CWD VMATSPLIC M D AVM deletério H GDE DR7 preferido MFLIW M W A G IVMSACTPL M N IV G deletério C GRD DR3 MOTIVOS 1 ° 2 3 1° 5 1 ° Mot ivo a âncora âncora âncora 6 preferido LIVMFY 4 KRH Mot ivo b LIVMFAY D preferido DNQEST DR MFLIVWY VMSTACPLI Supermotivo
Resíduos em itálico indicam resíduos menos preferidos ou "tolerados" 120
QUADRO IV (D): Supermotivos HLA de Classe I
SUPER-MOTIVOS POSIÇÃO: 1 2 3 4 5 6 1 8 Terminal C AI 1° Âncora TILVMS 1° Âncora FWY A2 1° Âncora LIVMATQ 1° Âncora LIVMAT A3 preferido deletério DE (3/5); P(5/5) 1° Âncora VSMATLI YFW (4/5) DE (4/5) YFW (3/5) YFW (4/5) P (4/5) 1° Âncora RK A24 1° Âncora YFWIVLMT 1° Âncora FIYWLM B7 preferido FWY (5/5) 1' Âncora P FWY DE G (4/5) QH (4/5) FWY 1° Âncora
deletério LIVM (3/5) (4/5) (3/5) (3/5) VILfMYA
DE (3/5); DE P(5/5); (4/5) G(4/5); 44(3/5);
B27 1° Âncora RHK 1° Âncora FYLMIVA B44 Γ Âncora ED Γ Âncora FWYLIMVA B58 1° Âncora ATS 1° Âncora FWYLIVMA 862 1° Âncora 1° Âncora QLIVMP FWYMIVLA
Resíduos em itálico indicam resíduos menos preferidos ou "tolerados" 121
QUADRO IV (E): Motivos HLA de Classe I POSIÇÃO 12 3 45678 9 Terminal
C
Ou terminal
C
AI 9- preferido GFYW Ia Âncora STM DEA YFW P DEQN YFW Ia Âncora mer deletério DE RHKLIVMP A G A Y AI 9- preferido GRHK ASTCLIVM Ia Âncora GSTC ASTC LIVM DE Ia Âncora mer deletério A RHKDEPYFW DEAS DE PQN RHK PG GP Y AI Preferido YFW Ia Âncora STM DEAQN A YFWQN PASTO GDE P Ia Âncora 10- Y mer Deletério GP RHKGLIVM RHK QNA RHKYFW A DE RHK AI Preferido YFW STCLIVM Ia Âncora A YFW PG G YFW Ia Âncora 10- DEAS Y mer Deletério RHK RHKDEPYFW P G PRHK QN A2.1 Preferido YFW Ia Âncora LM/ YFW STC YFW A P Ia Âncora 9-mer Deletério DEP VQAT DERKH RKH DERKH VUMAT POSIÇÃO: 1 2 3 4 5 6 7 8 9 Terminal C A2.1 Preferido AYFW Ia Âncora LM/ LVIM G G FYWL VIM Ia Âncora 10- VQAT VL/MAT mer Deletério DEP DE RKHA P RKH DERKHRKH A3 Preferido RHK Ia Âncora YFW PRHKYF W A YFW P 1° Âncora LMVISATFCGD KYRHFA Deletério DEP DE 122 (continuação)
POSIÇÃO 1 2 3 4 5 6 1 8 9 Terminal C All Preferido A Ia Âncora YFW YFW A YFW YFW P Ia Âncora VTLMISAGNCD F KRYH Deletério DEP AG A24 Preferido YFWRHK Ia Âncora STC YFW YFW Ia Âncora 9-mer YFWM FLIW Deletério DEG DE G QNP DERHKG AQN A24 Preferido Ia Âncora P YFW P Ia 10- YFWM Âncora mer FLIW Deletério GDE QN RHK DE A QN DEA A3101 Preferido RHK Ia Âncora YFW P YFW YFW AP Ia Âncora MVT/ ALIS RK Deletério DEP DE ADE DE DE DE A3301 Preferido Ia Âncora YFW AYFW Ia Âncora MVALF/ST RK Deletério GP DE A6801 Preferido YFWSTC Ia Âncora YFWLIV M YFW P Ia Âncora AVTMSU RK Deletério GP DEG RHK A B0702 Preferido RHKFWY Ia Âncora P RHK RHK RHK RHK PA Ia Âncora LMFWYAI V Deletério DEQNP DEP DE DE GDE QN DE B3501 preferido FWYLIVM Ia Âncora P FWY FWY Ia Âncora LMFWYIV A ou terminal C AI 9- preferido GFYW Ia Âncora STM DEA YFW P DEQN YFW Ia Âncora mer Y 123 (continuação)
POSIÇÃO 1 2 3 4 5 6 1 8 9 terminal C Deletério DE RHKLIVMP A G A AI 9- Preferido mer GRHK ASTCLIVM Ia Âncora GSTC DEAS ASTC LIVM DE Ia Âncora Y Deletério RHKDEPYFW DE PQN RHK PG GP Deletério AGP G G B51 Preferido LIVMFWY Ia Âncora AGPDER HKSTC P FWY STC FWY G FWY Ia Âncora LIVMA M Deletério DE G DEQN GDE B5301 Preferido LIVMFWY Ia Âncora P FWY STC FWY LIVMFWY FWY 1° Âncora IMFWYAL V deletério AGPQN G RHKQN DE B5401 preferido FWY Ia Âncora P FWYLIVM LIVM ALIVM FWYA P Ia Âncora ATIVLMF M Deletério GPQNDE GDESTC RHKDE DE QNDGE DE 124 QUADRO IV (F):
Sumário de HLA-supertipos Frequências fenotípicas globais de HLA-supertipos em populações étnicas diferentes Especificidade de Frequência fenotipica Supertip o Posição 2 Termina 1 C Caucasian o N, A, Negr o Japonê s Chinês Hispânic o Médi a B7 P AILMVFW Y 43,2 55, 1 57, 1 43, 0 49, 3 49,5 A3 AILMVST RK 37,5 42, 1 45, 8 52, 7 43, 1 44,2 A2 AILMVT AILMVT 45, 8 39,0 42, 4 45, 9 43, 0 2,2 A2 4 YF (WIVLMT ) (YWLM) 23,9 38,9 58,6 40, 1 38, 3 40,0 B44 E (D) FWYLIMV A 43,0 21,2 42,9 39, 1 39, 0 37, 0 41 TI (LVMS) FWY 47, 1 16, 1 21,8 14, 7 26, 3 25,2 B27 RHK FYL (WMI) 28,4 26,1 13,3 13, 9 35, 3 23,4 B62 QL (IVMP) FWY (ΜΙ V) 12,6 4,8 36,5 25, 4 11, 1 18, 1 B58 ATS FWY (LIV) 10,0 25, 1 1,6 9, 0 5,9 10,3 125 QUADRO IV (G) :__ Cobertura da população calculada suportada por combinações de HLA-supertipo diferentes
Frequência fenotípicas de HLA-supertipos A2, A3 e B7 A2, A3, B7, A24, B44 e AI A2, A3, B7, A24, B44, Al, B27, B62, e B 58 Caucasiano N.A Negros Japonês Chinês Hispânico Média 83,0 86,1 87,5 88,4 86,3 86,2 99,5 98,1 100, 0 99,5 99, 4 99,3 99,9 99,6 100, 0 99,8 99, 9 99, 8
Motivos indicam os resíduos que definem as especificidades do supertipo. Os motivos incorporam resíduos determinados com base em dados publicados para serem reconhecidos por alelos múltiplos dentro do supertipo. Os resíduos dentro de parênteses retos são resíduos adicionais que se prevê que também sejam tolerados por alelos múltiplos dentro do supertipo. 126
Quadro V: Motivos que ocorrem frequentemente
Nome % média de identida de Descrição Função Potencial zf-C2H2 34% Dedo de zinco, tipo C2H2 Proteína ligante de ácido nucleico funciona como fator de transcrição, localização nuclear provável citocromo_b _N 68% citocromo b(terminal N)/b6/petB Oxidase ligada a membrana, gera superóxido Lg 19% Domínio da imunoglobulina domínios têm 100 aminoácidos de comprimento e incluem uma ligação dissulfureto intradomínio conservada. WD4 0 18% Domínio WD, repetição G-beta Repetições em tandem de cerca de 40 resíduos, cada contendo um motivo Trp-Asp. Função natransdução do sinal e interação proteica 127
Nome % média de identida de Descrição Função Potencial PDZ 23% Domínio PDZ Pode funcionar em dirigir moléculas sinalizadoras para locais submembranosos LRR 28% Repetição rica em Leucina Motivos de sequência curta envolvidos em interações proteína-proteína Pquinase 23% Domínio da quinase proteica Núcleo catalítico conservado comum a ambas serina/treonina e quinases da proteína tirosina contendo um local de ligação ao ATP e um local catalítico 128
Nome % média de identida de Descrição Função Potencial PH 16% Domínio PH Homologia da plaquestrina envolvida na sinalização intracelular ou como constituintes do citoesqueleto EGF 34% Domínio tipo EGF 30-40 aminoácidos de comprimento encontrado no domínio extracelular das proteínas ligadas à membrana ou em proteínas segregadas Rvt 49% transcritase reversa (polimerase de ADN dependente de ARN) Ank 25% Repetição Ank Proteína citoplasmática, associa proteínas da membrana integral ao citoesqueleto 129
Nome % média de identida de Descrição Função Potencial Oxidored_ql 32% NADH- Ubiquinona/plastoquin ona (complexo I), várias cadeias Associado à membrana. Envolvido na translocação de protão através da membrana Efhand 24% Mão EF Domínio de ligação ao cálcio, consiste num loop de 12 resíduos franqueado em ambos os lados por um domínio alfa-hélice com 12 resíduos Rvp 79% protease aspartilo Retroviral proteases de aspartilo ou ácido, centradas num resíduo de aspartilo catalítico 130
Nome % média de identida de Descrição Função Potencial Colagénio 42% Repetição de colagénio de tripla hélice (20 cópias) Proteínas estruturais extracelulares envolvidas na formação de tecido conetivo. A sequência consiste no G-X-Y e as cadeias polipeptídicas forma uma hélice tripla. Fn3 20% Domínio de fibronectina tipo III Localicado na região de ligação ao ligando extracelular dos recetores e tem cerca de 200 resíduos de aminoácidos de comprimento com dois pares de cisteínas envolvidas em ligações dissulfureto 131
Nome % média de identida de Descrição Função Potencial 7tm_l 19% recetor transmembranar 7 (família da rodopsina) sete regiões transmembranare s hidrofóbicas, com o terminal N localizado extracelularmen te enquanto o terminal Cé citoplásmico. Sinal através de proteínas G
Quadro VI: Modificações pós-traducionais da 273P4B7
Local de N-glicosilação 795 - 798 NVTT (SEQ. ID N. 0 43) 827 - 830 NSSL (SEQ. ID N. 0 44) 903- 906 NESQ (SEQ. ID N. 0 45) 911- 914 NVSI (SEQ. ID N. ° 46) 966 - 969 NFSS (SEQ. ID N. ° 47) 1047- 1050 NTSL (SEQ. ID N. ° 48) 1084 - -1087 ' NKSM (SEQ. IE i N. ° 49; 1155 -1158 NKSS ! (SEQ ID NO. 50)
Local de sulfaçao da tirosina 1119-1133 EAKGPEDYPEEGVEE (SEQ. ID N.° 51) 1134 -1148 SSGEASKYTEEDPSG (SEQ. ID N.° 52) 1193 -1207 AAEATNDYETLVKRG (SEQ. ID N.° 53)
Local de fosforilação da quinase proteica dependente de cAMP e cGMP 335 - 338 KKKS (SEQ. ID N.° 54) 336 - 339 KKSS (SEQ. ID N.° 55) 132
Local de fosforilaçao da proteína quinase C
4-6 SRR 214 - 216 SFR 237 - 239 STK 250 - 252 SNR 282 - 284 TLK 285 - 287 TFK 362 - 364 SRK 418-420 SAR
459 - 461 SGK 503 - 505 TLR 683 - 685 SVK 739 - 741 STK 740 - 742 TKK 769 - 771 SSK 791 - 793 SIK 872 - 874 STK 1004 - 1006 SEK 1036 - 1038 SFK 1055 - 1057 SVK 1063 - 1065 TPK 1089 - 1091 SRR 1095 - 1097 SRR 1162 - 1164 TSK
Local de fosforilaçao da caseína quinase II 180 - 183 SKDE (SEQ. ID N. O 56) 269 - 272 SLFD (SEQ. ID N. O 57) 303 - 306 TPGE (SEQ. ID N. O 58) 329 - 332 TKED (SEQ. ID N. 0 59) 339 -342 SNPE (SEQ. H U o 60) 431 - 434 SAQD (SEQ. ID N. 0 61) 454 - 457 TLME (SEQ. ID N. 0 62) 589 - 592 TVEE (SEQ. ID N. 0 63) 608 - 611 TTGE (SEQ. ID N. 0 64) 620 - 623 SKQE (SEQ. ID N. 0 65) 133 629 - 632 TIED (SEQ. ID N.0 66) 672 - 675 SDHD (SEQ. ID N.0 67) 683 -686 SVKE (SEQ. ID N.0 68) 724 - 727 TRNE (SEQ. ID N.0 69) 763 - 766 TQEE (SEQ. ID N.0 70) 798 - 801 TLQD (SEQ. ID N.0 71) 820 - 823 SVEE (SEQ. ID N.0 72) 838 -841 TKNE (SEQ. ID N.0 73) 847 - 850 TLQE (SEQ. ID N.0 74) 873 - 876 TKAD (SEQ. ID N.0 75) 913 - 916 SIIE (SEQ. ID N.0 76) 1004 - 1007 SEKD (SEQ . ID N.0 77 1028 - 1031 SDGE (SEQ . ID N.0 78 1036 - 1039 SFKD (SEQ . ID N.0 79 1134 -1137 SSGE (SEQ. ID N.0 80) 1142 -1145 TEED (SEQ. ID N.0 81) 1188 -1191 SPQD (SEQ. ID N.0 82)
Local de fosforilaçao da tirosina quinase 655 - 662 KLDEHIAY (SEQ. ID N.° 83) Local de N-miristoilação
117 - 122 GGILAD (SEQ. ID N. 0 84) 125 - 130 GLGKTV (SEQ. ID N. 0 85) 138 - 143 GMFDAS (SEQ. ID N. 0 86) 196 - 201 GVIITT (SEQ. ID N. 0 87) 277 - 282 GSLLGT (SEQ. ID N. 0 88) 281 -286 i GTLKTF (SEQ. H U o 89) 428 - 433 GTFSAQ (SEQ. ID N. 0 90) 540 - 545 GVGLTL (SEQ. ID N. 0 91) 542 - 547 GLTLTA (SEQ. ID N. 0 92) 574 - 579 GQKENV (SEQ. ID N. 0 93) 804 - 809 GTGSAD (SEQ. ID N. 0 94) 806 - 811 GSADSI (SEQ. ID N. 0 95) 831 - 836 GMEKSF (SEQ. ID N. 0 9 6) 983 - 988 GSAPNS (SEQ. ID N. 0 97) 1130 - 113 5 GVEESS (SEQ . ID N. O CO 134
Amidaçao 113 - 116 DGRK (SEQ. ID N.° 99)
Quadro VII: Péptidos de procura 273P4B7 variante 1 para 9-meros, 10-meros e 15-meros (SEQ.ID N.° 100) MEASRRFPEA EALSPEQAAH YIiRYVKEAKE ATKNGDLEEA FKLFNIAKDI FPNEKVLSRI 60 QKXQEALEEL· AEQGDDEFTD VCNSGIiIiIiYR ELHNQLFEHQ KEGIAFLYSL· YRDGRKGGILi 120
ADDMOLGKTV QIIAFLSGMF DASIiVMHVH» IMPTHLIHTW VKEFIKWTPG MRVKTFHGPS ISO KDERTRNLNR IQQRNGVIIT TYQMLINNWQ QLS3FRGQEF VWDYVILDEA HKXKTSSTKS 240 AXCARAXPAS NRLLLTGTPI QNNLQELWSL FDFACQGSLL GTLKTFKMBY EtJPITRAREK 300 DATPGEKftLG KKISENIiMAI IKPYFIiRRTK EDVQKKKSSH PEASIiNEKHP DVDAICEMPS 360 LSRKHDLIIW IRIiVPLQEEI YRKFVSLDHI KELLMETRSP LASLGVLKKIi CPHPRLLgAR 420 ACCLLNLGTF SAQDGNEGED SPDVDHIDQV TDDTLMEES3 KMIFLMDLLK RLBDGGHQTL 460 VFSQSRQILN IIERILKNRH FKTLRIDGTV THLLEREKRI NLFQQNKDYS VFLLTTQVGG S40 VGLTKCAATR WIFDPSWNP ATDAQAVDRV YRIGQKENW VYELITCGTV EEK2YRRQVF 600 KDSXiIRQTTG BKKNPFRYFS KQELjREXjFTX EDIiQNSVTQIi QLQSIiHAAQR KSDXKLDEHX 660 AYLQSLGIAG ISDHDLMYTC DLSVKEELDV VEESHYIQQR VQKAQFLVEF ESQNKEFLME 720 QQRTHHEGAW LREPVFPSST KKKCPKENKP QPQPSPLLST HHTQEEDISS KMASWIDDL 730 PKEGEKQDLS SIKVNVTTLQ DGKGTGSADS IATLPKGFGS VEELCTHSSL GMEKSFATKN .840 EAVQKETLQE GPXQBALQED PLESFMYVLS KSTKAD3GPH IjDQLKDDBIL· RHCHPWPIIS 900 XTHESQNAES NVSIIEIADD LSA5HSALQD AQASEAKLEE EPSASSPQYA CDFHI1FX1EDS 960 ADHRQHFÊSQ SLEHVBKENS LCGEAPHSRA GFVHSKTCLS WEFSEKDDEP EEVWKAKXR 1020 SKARRTVSDG EDEDDSFKDT SSINPFWTSL FQFSSVKQFD ASTPKNDISP PGRFFSSQIP 1080 SSVNKSKKSR RSIíASRRSLI HMVtiDHVEDM EERLDDSSEA KGPEDYPEEG VEESSGEASK 1140 YTÈEDPSGET LSSENKSSWL MTSKPSALAQ BTSLGAPEPÍi sgeqlvgspq DKAAEAINDY 1200 ETLVKRGKBL KECGKXQEAL NCLVKALDIK SAEiPEVMLLT LSLYKQXjNNS 1250 273P4B7 v.4 9- mers, aa 164-180 FIKWTPGMGVKTFHGPS (SEQ ID NO: 101) 10- mers, aa 163-181 EFIKWTPGMGVKTFHGPSK (SEQ ID NO: 102) 15-mers, aa 158-186 NTWVKEFIKWTPGMGVKTFHGP SKDERTR (SEQ ID NO: 103) 273P4B7V.5 9- mers, aa 356-372 ΟΒΜΡάΙιΞΚΒΝΒΙιΙΙΗΙΕ (SEQ ID NO: 104) 10- raers, aa 355-373 ICBMPSIiSRRNDIiIIWIRIi (SEQ ID NO: 105) , 15-mers, aa 350-378 PDVDAICEMPSLSRENDLIIWIRLVPLQE (SEQ ID NO: 106) 273P4B7 V.6 9- mers, aa 881-897 DDQLKDDEVLRHCNPWP (SEQ ID N0: 107) 10- mers, aa 880-898 NLDQLKDDEVIiRHCNPWPI (SEQ ID NO: 106) 15-mers, aa 875-903 ADIGPNIiDQLKDDEVDRHCNPWPIISITN (SEQ ID NO: 109) 135
Quadro L: Características proteicas da 273P4B7
Programa Bioinformáti co URL Resultado ORF Comprimento da proteína Buscador de ORF 95-3847 1250 aa Região Transmembran ar TM Pred http://www.ch.embnet.org/ 2TM, aal32 -157, aa532-554 HMMTop http://www.enzim.hu/ hmmtop/ 2TM, aal32-151, aa 538-558 Sosui http://www.genome.ad.tp/ SOSui/ Proteína solúvel TMHMM http://www.cbs.dtu.dk/ Services/TMHMM sem TM Péptido sinal Sinal P http://www.cbs.dtu.dk/ Services/SignalP/ não pi pl/MW tool http://www.expasy.ch/tool s / 5.1 pl Peso Molecular pl/MW tool http://www.expasy.ch/tool s / 141.1 kDa Localização PSORT PSORT II http://psort.nibb.ac.jp/ 50%cytoplasmic,30% http://psort.nibb.ac.jp/ 65%nuclear,2l%cytoplasmic mitocondria 1 Motivos Pf am http://www.sanger.ac.uk/ Pf am/ Domínio SNF2- terminal N, terminal Helicase-C- Impressões http: //www.biochem.ucl.ac.uk/ Nenhum encontrado 136
Blocos http://www.blocks.fhcrc.o Domínio rg/ relacionado com SNF2
Quadro LI:
Limites de exão da 273P4B7 v.l transcrita Número exao Início Fim Comprimento 1 1 162 162 2 163 4194 4032 137
Quadro Lll(a). Sequência de nucleotídeos da variante transcrita 273P4B7 v.2 (SEQ. ID N.a 110) atgcgcgggg cgggagtgag cgaaattcaa gctccaaact ctaagctcca agctccaagc 60 tccaagctcc aagctccaaa ctcccgccgg ggtaactgga acccaatccg agggtcatgg 120 aggcatcccg aaggtttccg gaagccgagg ccttgagccc agagcaggct gctcatfcacc 160 taagggtctt gctgtgtcgc ccagactgga attcagtggc ctgatcatag ttcactgcag 240 cctcgaactc ctgggctcaa gcagtcctcc tgccccagcc tccctagtag cbgggactta 300 agatatgtga aagaggccaa agaagcaact aagaatggag acctggaaga agcatttaaa 360 cttttcaatt tggcaaagga catttttccc aatgaaaaag tgctgagcag aatccaaaaa 420 atacaggaag ccttggagga gttggcagaa cagggagatg atgaatttac agatgtgtgc 480 aactctggct tgctacttta tcgagaactg cacaaccaac tctttgagca ccagaaggaa 540 ggcatagctt tcctctatag cctgtatagg gatggaagaa aaggtggtat attggctgat 600 gatatgggat tagggaagac tgttcaaatc attgctttcc tttccggtat gtttgatgca 660 tcacttgtga atcatgtgct gctgatcatg ccaaccaatc ttattaacac atgggtaaaa 720 gaattcatca agtggactcc aggaatgaga gtcaaaacct ttcatggtcc tagcaaggat 780 gaacggacca gaaacctcaa tcggattcag caaaggaatg gtgttattat cactacatac 840 caaatgttaa tcaataactg gcagcaactt ccaagcttta ggggccaaga gtttgtgtgg 900 gactatgtca tcctcgatga agcacataaa ataaaaacct catctactaa gtcagcaata 960 tgtgctcgtg ctattcctgc aagtaatcgc ctcctcctca caggaaeccc aatceagaat 1020 aatttacaag aactatggtc cctatttgat tttgcttgtc aagggtccct gctgggaaca 1080 ttaaaaactt ttaagatgga gtatgaaaat cctattacta gagcaagaga gaaggatgct 1140 accccaggag aaaaagcctt gggatttaaa atatctgaaa acttaatggc aatcataaaa 1200 ccctattttc tcaggaggac taaagaagac gtacagaaga aaaagtcaag caacccagag 1260 gccagactta atgaaaagaa tccagatgtt gatgccattt gtgaaatgcc ttccctttcc 1320 aggaaaaatg atttaattat ttggatacga cttgtgcctt tacaagaaga aatatacagg 1380 aaatttgtgt ctttagatca tatcaaggag ttgctaatgg agacgcgctc acctttggct 1440 gagctaggtg tcttaaagaa gctgtgtgat catcctaggc tgctgtctgc acgggcttgt 1500 tgtttgctaa atcttgggac attctctgct caagatggaa atgaggggga agattcccca 1560 gatgkggacc atattgatca agtaactgat gacacattga tggaagaatc tggaaaaatg 1620 atafcfccctaa tggacctact taagaggctg cgagatgagg gacatcaasc tctggtgttt 1680 tctcaatcga ggcaaattct aaacatcatt gaacgcctct taaagaatag gcactttaag 1740 acattgcgaa tcgatgggac agttactcat cttttggaac gagaaaaaag aattaactta 1800 ttccagcaaa ataaagatta ctctgttttt ctgcttacea ctcaagtagg tggtgtcggt 1860 ttaacatfcaa ctgcagcaac tagagtggtc atttttgacc ctagctggaa tcctgcaact 1920 gatgctcaag ctgtggatag agtttaccga attggacaaa aagagaatgt tgtggtttat 1980 aggctaatca cttgtgggac bgtagaggaa aaaatataca gaagacaggt tttcaaggac 2040 tcattaataa gacaaactac tggtgaaaaa aagaaccctt tccgatattt tagtaaacaa 2100 gaattaagag agctctttac aatcgaggat cttcagaact ctgtaaccca gctgcagctt 2160 cagtcfcttgc atgctgctca gaggaaatct gatataaaac tagatgaaca tattgcctac 2220 ctgcagtctt tggggatagc tggaatctca gaccatgatt tgatgtacac atgtgatctg 2280 tctgttaaag aagagcttga tgtggtagaa gaatcbcact atattcaaca aagggttcag 2340 aaagctcaat tcctcgttga attcgagtct caaaataaag agttcctgat ggaacaacaa 2400 agaactagaa atgagggggc ctggctaaga gaacctgtat ttccttcttc aacaaagaag 2460 aaatgcccta aattgaataa accacagcct cagccttcac ctcttctaag tactcatcat 2520 actcaggaag aagatatcag ttccaaaatg gcaagtgtag tcattgatga tctgcccaaa 2580 gagggtgaga aacaagatct ctccagtata aaggtgaatg ttaccacctt gcaagatggt 2640 aaaggtacag gtagtgctga ctctatagct actttaccaa aggggtttgg aagtgtagaa 2700 gaactttgta ctaactcttc attgggaatg gaaaaaagct ttgcaactaa aaatgaagct 2760 gtacaaaaag agacattaca agaggggcct aagcaagagg cactgcaaga ggatcctctg 2820 gaaagtttta attatgtact tagcaaatca accaaagctg atattgggcc aaatttagat 2880 caactaaagg atgatgagat tttacgtcat tgcaatcctt ggcccattat ttccataaca 2940 aatgaaagtc aaaatgcaga atcaaatgta tccattattg aaatagctga tgacctttca 3000 gcatcccata gtgcactgca ggatgctcaa gcaagtgagg ccaagttgga agaggaaccb 3060 tcagcatctt caccacagfca tgcatgtgat ttcaatcttfc tcttggaaga ctcagcagac 3120 aacagacaaa atttttccag tcagtcttta gagcatgttg agaaagaaaa tagcttgtgt 3180 ggctctgcac ctaattccag agcagggttt gtgcatagca aaacatgtct cagttgggag 3240 138 ttttctgaga aagacgatga accagaagaa gtagtagtta aagcaaaaat .cagaagtaaa 3300 gctagaagga ttgtttcaga tggcgaagat gaagatgatt cttttaaaga tacctcaagc 3360 ataaatccat toaacacatc tctctttcaa ttctcatctg tgaaacaatt tgatgcttca 3420 actcccaaaa atgacatcag tccaccagga aggttctttt catctcaaat acccagtagt 3480 gtaaataagt ctatgaactc tagaagatct ctggcttcta ggaggtctct tattaatatg 3540 gttttagacc acgtggagga catggaggaa agacttgacg acagcagtga agcaaagggt 3600 cctgaagatt atccagaaga aggggtggag gaaagcagtg gcgaagcctc caagtataca 3660 gaagaggatc cttccggaga aacactgtct tcagaaaaca agtccagctg gttaatgacg 3720 tctaagccta gtgctctagc tcaagagacc tctcttggtg cccctgagcc tttgtctggt 3780 gaacagttgg ttggttctcc ccaggataag gcggcagagg ctacaaatga ctatgagact 3840 cttgtaaagc gtggaaaaga actaaaagag tgtggaaaaa tccaggaggc cctaaactgc 3900 ttagttaaag cgcttgacat aaaaagtgca gatcctgaag ttatgctctt gactttaagt 3960 ttgtataagc aacttaataa caattgagaa tgtaacctgt ttattgtatt ttaaagtgaa 4020 actgaatatg agggaatttt tgttcccata attggattct ttgggaacat gaagcattca 4080 ggcttaaggc aagaaagatc tcaaaaagca acttctgccc tgcaacgccc cccactccat 4140 agtctggtat tctgagcact agcttaatat ttcttcactt gaatattctt atattttagg 4200 catattctat aaatttaact gtgttgtttc ttggaaagtt ttgtaaaatt attctggtca 4260 ttcttaattt tactctgaaa gtgatcatct ttgtatataa cagttcagat aagaaaatta 4320 aagttacttt tctc 4334 139
Quadro LIII(a). Alinhamento da sequência de nucleotideos da 273P4B7 v.2 (SEQ. ID N.s 111) e 273P4B7 v.l (SEQ. ID N.s 112) v.2 23 v.l 1 v.2 73 v.l 51 v.2 123 v.l 101 v.2 173 v.l 151 V.2 223 V.l 159 v.2 273 v.l 159 v.2 323 1 v.l 183 v.2 373 v.l 233 v.2 423 v.l 283 v.2 473 v.l 333 v.2 523 72 50 122 100 172 150 222 156 272 158 322 182 372 232 422 282 472 332 522 382 aaattcaagctccaaactctaagctccaagctccaagctccaagetccaa llllll IIIMIIIM MIMI llimiMllllllillllllllllll aaattcaagctccaaactctaagctccaagctccaagctccaagctccaa gctccaaactcccgccggggtaactggaacocaatccgagggtcatggag ! 11111 í 11 j 111111 í 1111111! 11 Μ Π I j [ [ 1111111111! 1111 gctccaaactcccgccggggtaactggaacccaatocgagggtcatggag gcatcccgaaggtttccggaagccgaggccttgagcccagagcaggctgc
IIMIM! IIIIII [ ΜΙ I Ml 1IIIIII! i! IIIMM 11II MIIIM gcatcccgaaggtttccggaagccgaggccttgagcccagagcaggctgc tcattacctaagggtcttgctgtgtcgcccagactggaattcagtggcct 111E! 111 tcattacc------------------------------------------ c c c c age c t c c c t ag t age tggga c 11 a aga t atg tgaíaagaggccaaag r 11111 i ] 11 in i m 1111111 ---------------------------taagatatgtgaaagaggccaaag aagcaactaagaatggagacctggaagaagcatttaaacttttcaatttg
III.......... í! 11II111II.....................11IM aagcaactaagaatggagacctggaagaagcatttaaacttttcaatttg gcaaaggacatttttcccaatgaaaaagtgctgagcagaatccaaaaaat 111111m11111! 111111 i 11m 1!I! ii1111Hl1111111111 gcaaaggacat t tt t cccaatgaaaaagtgc tgagcagaatccaaaaaat acaggaagccttggaggagttggcagaacagggagatgatgaatttacag IIIIIEIIIIIIIil.lllllllllllllllilllllllllllllllllll acaggaagccttggaggagttggcagaacagggagatgatgaatttacag atgtgtgcaactctggcttgctactttatcgagaaetgcacaaccaactc llllllllllllllllllllllllllllllllllllllllllllilllll atgtgtgcaactetggcttgctactttatcgagaactgcacaaccaactc tttgagcaccagaaggaaggcatagctttcctctatagcctgtataggga llllllllllllllllllllilllllllllinilllllEllillillll 572 140 140 V.l 383 v.2 573 V.l 433 v.2 623 V.l 483 v.2 673 V.l 533 v.2 723 v.l 583 V.2 773 V.l 633 V.2 823 V.l 683 v.2 873 v.l 733 V.2 923 V.l 783 V.2 973 V.l 833 v.2 1023 V.l 8Θ3 v.2 1073 v.l 933 v.2 1123 v.l 983 v.2 1173 v.l 1033 v.2 1223 V. 1 1083 v.2 1273 v.l 1133 v.2 1323 gaaaagaatccagatgttgatgccatfctgtgaaatgccttccctttccag gaaaaatgatttaattatttggatacgacttgtgcctttacaagaagaaa tttgagcaccagaaggaaggcatagctttcctctatagcctgtataggga tggaagaaaaggtggtatattggctgatgatatgggattagggaagactg
I n 11111111! I! 11111! 111M111 M 11111111111111 i 111M tggaagaaaaggtggtatattggctgatgatatgggattagggaagactg ttcaaatcattgctttcctttccggtatgtttgatgcatcacttgtgaat U 11 n I M111111111! 1111 M 11111IM! 11111111II111! 11 II c aaatcattg ct t tc c 11 tcc ggtatgtt tgatgcatcacttgtgaat catgtgctgctgatcatgccaaccaatcttattaacacatgggtaaaaga m!11111111111 m 11! U 111111! 1111111M11111) 11! 11 catgtgctgctgatcatgccaaccaatcttattaacacatgggtaaaaga attcatcaagtggactccaggaatgagagtcaaaacctttcatggtccta i i 1111 [ m m 111111 mi 111 [ 111 í 111111111111 m 11 m i attcatcaagtggactccaggaatgagaqtcaaaacctttcatggtccta g c aaggatgaacgga cc agaa ac c tcaa tcgga t tcagcaaaggaa tggt 111í iIM11mIί111IIIi11i111 M 1111111111111111II11 gcaaggatgaacggaccagaaacctcaatcggattoagcaaaggaatggt gttattatcactacataccaaatgttaatcaataactggcagcaactttc
IIIIIIIIIIIIIMIIIIIIIMIIIIIMIIIIIIIIIIIIIIIIIII gttattatcactacataccaaatgttaatcaataactggcagcaactttc aagctttaggggccaagagtttgtgtgggactatgtcatcctcgatgaag llllllllllllllllllllllllllllllllllllllllllllllllll aagctttaggggccaagagtttgtgtgggactatgtcatcctcgatgaag cacataaaataaaaacctcatctactaagtcagcaatatgtgctcgtgct III ni 11111111111 π í 11 m m 111111 m 1111111111111 cacataaaataaaaacctcatctactaagtcagcaatatgtgctcgtgct attcctgcaagtaatcgcctcctcctcacaggaaccccaatccagaataa
Illlllllllllllll llllll I lllllllllllllimilllllllll attcctgcaagtaatcgcctcctcctcacaggaaccccaatccagaataa 111 a caaga a c ta tgg t c cc ta 11 tgat 11 tgc ttg tcaagggtccctgc IIMIIIIIIMIIM llllll I imillllllllllllllllllllll tttacaagaactatggtccctatttgattttgcttgtcaagggtccctgc tgggaacatt aaaaact tt t aaga tggag t atgaaaatcctat tactaga
IM 111! 111111Π Μ II1! 11 Μ Μ 11 M IM 11111111 Ht IIIII tgggaacaC taaaaa cttttaagatggagcatgaaaatcctattac taga gcaagagagaaggatgctaccccaggagaaaaagccttgggatttaaaat II ] I EM 1111IIIM m III M1 M i 1111II11II111 M1111111 gc aagag agaagga tgctaccccaggagaaaaagc cttgggat 11 aaaat atctgaaaacttaatggcaatcataaaaccctattttctcaggaggacta llllllllllltlllllllllllllllllllllllllllimillllll atctgaaaacttaatggcaatcataaaaccctattttctcaggaggacta aagaagacgt acag aagaaaaagtcaagcaac ccagaggcc agacttaat lllllllllllllllimillllllllllllllllllilllllllllll aagaagacgtacagaagaaaaag t c a age aaccc agaggcc agacttaat gaaaagaatccagatgttgatgccatttgtgaaatgccttccctttccag
IM1111111111111M III11II11111II11111II111111111 M 432 622 482 672 532 722 .582 772 632 822 682 872 732 922 782 972 832 1022 882 1072 932 1122 982 1172 1032 1222 1082 1272 1132 1322 1182 1372 141 141 ν.χ 1183 V.2 v.l V.2 1423 v.l 1283 v.2 v.l v.2 v.l V.2 V.l v.2 v.l v. 2 v.l v.2 V.l v.2 V.l V.2 v.l v.2 v.l v.2 V.l 17 83 tgctcaagctgtggatagagtttaccgaattggacaaaaagagaatgttg v.2 v.l V.2 V.l V.2 v.l 111; 111 m! 111 m 11111 m 11 m 1111111 m i n i m 111 gaaaaatgatttaattatttggatacgacttgtgcetttacaagaagaaa 1373 tatacaggaaatttgtgtctttagatcacatcaaggagttgctaatggag
ί 111 M I m l M IJ11111 M t! M Hl l M I ί I m 11111M IM II 1233 tatacaggaaatttgtgtctttagatcatatcaaggagttgctaatggag acgcgc tcac c 11 tgg ctgagc t agg tgtc t taa agaagctgtgtgatca 11111 i 1111111111111111111111! 111111111111111111111 acgcgctcacctttggctgagctaggtgtettaaagaagetgtgtgatca 1473 tectaggctgctgtctgcacgggettgttgtttgctaaatcttgggacat 1111111 m 111 μ i l 1111111111 m 11111111111111111 m 1333 tcctaggctgctgtctgcacgggcttgttgtttgctaaatcttgggacat 1523 tctctgctcaagatggaaatgagggggaagattccccagatgtggaccat 111 m ί π i m 1111 m ί n 111 n 11111111 ti 11 m i m 111 1383 tc t c tgc tc aaga t ggaaa bgagggggaagattc c ce agatg tggacca t 1573 attgatcaagtaactgatgacacattgatggaagaatctggaaaaatgat 11111111111II111111II) I ί 1111111111 M 11II1111 UI 11 ί 1433 at tg at c aag taac tg a tgacacat tgatggaagaat c tggaaaaatgat 1623 attcctaatggacctacttaagaggctgcgagatgagggacatcaaactc limilll! lllllll llllllllllllllllllll llllllllllll! 1483 attcctaatggacetacttaagaggctgcgagatgagggacatcaaactc 1673 tggtgttttctcaatcgaggcaaattctaaacatcattgaa-cgcctctta 11 M 11 M I f 11111111M III111111IIIII111111111111 UI 1 1533 tggtgttttct ca a tcgaggcaaat tc taaa catc at tgaacgc ctc t ta 1723 aagaataggcactttaagacattgcgaatcgatgggacagttactcatct II1í11111M i IIIIII1111111111111 M 111111II111II1111 1583 aagaataggcactttaagacattgcgaatcgatgggacagttactcatct 1773 tttggaacgagaaaaaagaattaacttattccagcaaaataaagattact llllllllllllllllllllllllllllllllllllllllllllllllll 1633 tttggaacgagaaaaaagaattaacttattccagcaaaataaagattact 1823 ctgtttttctgcttaccactcaagtaggtggtgtcggtttaacattaact itiiiiiiiiiiiiiiiiiiiiiiiiiiiniiiiiiiiiimiiiiii 1683 ctgtttttctgcttaccactcaagtaggtggtgtcggtttaacattaact 1873 gcagcaactagagtggtcatttttgaccetagctggaatcctgcaactga lllllllimilllllltlllllllllllllllllllllllllllllll 1733 gcagcaactagagtggtcatttttgaccctagetggaatcctgcaactga 1923 tgctcaagctgtggatagagtttaccgaattggacaaaaagagaatgttg 111 m m u 111 m 11111 n 1111111 ii μ M111111 u u m i 1973 tggtttataggctaatcacttgtgggactgtagaggaaaaaatatacaga 1111 u 1111111 ii 11 m i m i m i m 111 m n i u 11111 n 1833 tggtttataggctaateacttgtgggactgtagaggaaaaaatatacaga 2023 agacaggttttcaaggactcattaataagacaaactactggtgaaaaaaa 1111 ii 111 η u 1111! m m ii i u 11 m m ί u 11 m i m i 1883 agacaggttttcaaggactcattaataagacaaactactggtgaaaaaaa 2073 gaaccctttecgatattttagtaaacaagaattaagagagctctttacaa 11 Mi 11M MIU111 Ml 1 MIII111II) 1IIM 1111111111111 1933 gaaccctttccgatattttagtaaacaagaattaagagagctctttacaa 1232 1422 1282 1472 1332 1522 1382 1572 1432 1622 1482 1672 1532 1722 1582 1772 1632 1822 1682 1872 1732 1922 1782 1972 1832 2022 1882 2072 1932 2122 1982 142 142 v.2 2123 v. 1 1983 V.2 2173 V.l 2033 V.2 2223 v.l 2083 v.2 2273 v.l 2133 v.2 2323 V.l 2183 v.2 2373 v.l 2233 V.2 2423 v.l 2283 v.2 2473 V.l 2333 V.2 2523 V.l 2383 v.2 2573 v.l 2433 v.2 2623 V.l 2483 V.2 2673 V.l 2533 v.2 2723 v.l 2583 v.2 2773 v.l 2633 v.2 2823 v.l 2683 v.2 2873 v.l 2733 accaccttgcaagatggtaaaggtacaggtagtgctgactctatagctac tcgaggatcttcagaactctgtaacccagctgcagcttcagtctttgcat 1111111111111 m 1111 m m 111; i [ m 111111111 í m 11 ti tcgaggatcttcagaactctgtaacccagcCgcagcttcagtctttgcat gctgct cagaggaaatctgatataaaactagatgaacatattgcctacct
IIIIIllllÍllllllimilllllllllllililllimillMIII gctgctcagaggaaatctgatataaaactagatgaacatattgcetacct gcagtctttggggacagctggaatctcagaccatgatttgatgtacacat I í 11 ί11 M m 11M 11 i111111 ίMl 111111111111111111111
gcagtctttggggatagctggaatctcagaccatgatttgatgtacacaC gtgatctgtctgttaaagaagagcttgatgtggtagaagaatctcactat iiiiiiiiiiiimniiiimiiiiiiiiiiiiiiiiiiiiiiiiii gtgatctgtctgttaaagaagagcttgatgtggtagaagaatctcactat a ttc aac aa agggt tc agaaagct caat tcct cgttgaat t cgagtctca II Μ IΜ 11 Μ Μ I Ml 11II1111 m 11 Μ 111Μ Μ111 Μ ΜΙ 11 ί att c aac aaagggttcagaaagctcaattcctcgttgaattcgagtctca aaataaagagttcctgatggaacaacaaagaac tagaaatgagggggcc t
Ml I! 1111111111111111111 Hl I M 111U111111111111111 aaataaagagt tcctgatggaacaacaaagaactagaaatgagggggcct ggctaagagaacctgtatttccttcttcaacaaagaagaaatgccctaaa
111111111111 ί ί Μ ! 1111111 Μ 1111 ί Μ 1 Μ Μ I ί 1111111 Μ I ggctaagagaacctgtatttccttcttcaacaaagaagaaatgccctaaa ttgaataaaccacagcctcagccttcacctcttctaagtactcatcatac
Ii M11M 1111111111111m 111111III M111 M 11111111 n ttgaataaaccacagcctcagccttcacctettctaagtactcateatac tcaggaagaagatatcagttccaaaatggcaagtgtagtcattgatgatc lllllllllllllilllllllll llllllllllllllimillllllll tcaggaagaagatatcagttccaaaatggcaagtgtagtcattgatgatc tgcccaaagagggtgagaaacaagatctctccagtataaaggtgaatgtt llllllllllllllllllllllllllllllllllllllllllllllllll tgcc c aa agagggtgag aaacaagatctctccagtataaaggtgaatgtt accaccttgcaagatggtaaaggtacaggtagtgctgactctatagctac 111 n 11111111111 μ π 11 u i μ 1111M i m 11111 m 11111 tttaccaaaggggtttggaagtgtagaagaactttgtactaactcttcat 11II111111111111111111 M1 n 111Π1111111 M111 Hl 111 tttaccaaaggggtt tggaagtg tagaagaactttgtactaactcttcat tgggaatggaaaaaagctttgcaactaaaaatgaagctgtacaaaaageg
IIIIIIIIIIIIIIIIIIIIIIIIIIIMIIIIIIIIIMIIIIIIIIII tgggaatggaaaaaagctttgcaactaaaaatgaagctgtacaaaaagag acattacaagaggggcctaagcaagaggcactgcaagaggatcctctgga llllllllllllllllimilMIIIIIIMIIllllllllllllllll acattacaagaggggcctaagcaagaggcactgcaagaggatcctctgga aagttttaattatgtacttagcaaatcaaccaaagctgatattgggccaa
IΜ Μ Μ 1111111 m 11 Μ Μ 11 i IΜ I Μ 11 Μ Μ1111111Μ Μ I aagttttaattatgtacttagcaaatcaaCcaaagctgatattgggccaa atttagatcaactaaaggatgatgagattttacgtcattgcaatccttgg lllllllllltlllllllllllilllliillltlllllllllllllllll atttagatcaactaaaggatgatgagattttacgtcattgcaatccttgg 2172 2032 2222 2082 2272 2132 2322 2182 2372 2232 2422 22 82' 2472 2332 2522 2382 2572 2432 2522 2482 2672 2532 2722 2582 2772 2632 2822 26Θ2 2872 2732 2922 2782 143 143 ν.2 v.l ν.2 v.l V.2 V.l V.2 v.l v.2 V.l V.2 v.l V.2 V.l V.2 V.l v.2 v.l v.2 v.l v.2 v.l v.2 v.l v.2 v.l V.2 v.l v.2 v.l 2923 cccattatttccataacaaatgaaagtcaaaatgcagaatcaaatgtatc 111 ui 11 um iin 11 m 11111 m 11111111111 μ n 111111 2783 cccattatttccataacaaatgaaagtcaaaatgcagaatcaaatgtatc 2973 cattattgaaatagctgatgacctttcagcateceatagtgcactgcagg H 1111111111111111 k 111111111111M 1111 M 1111 ί 111111 2833 cattatfcgaaatagctgatgacctttcagcatcccatagtgcactgcagg 3023 atgctcaagcaagtgaggccaagttggaagaggaaecttcagcatcttca 111111111111111111111 i11111111111 k 111M11Π IIM! 11 2883 atgctcaagcaagtgaggccaagttggaagaggaaccttcagcatcttca 3073 ccacagtatgcatgtgatttcaatcttttcttggaagactcagcagacaa 111111111111111111111111111k 1111111111111111111111 2933 ccacagtatgcatgtgatttcaatcttttettggaagactcagcagacaa 3123 cagacaaaatttttceagteagtctttagagcatgttgagaaagaaaata lllllllllllllllllllllllllllllllllllllllllllimill 2983 cagacaaaatttttccagtcagtctttagagcatgttgagaaagaaaata 3173 gcttgtgtggctctgcacctaatteeagagcagggtttgtgcatagcaaa 11 η 111111111111111 m 111111111111 m 11! 1111111111 3 033 gcttgt gtggctctgcacetaattccagagcagggttfcgtgcatagcaaa 3223 acatgtctcagttgggagttttctgagaaagacgatgaaccagaagaagt k 1111 i 11 k 11111111111111111111111! 1111! I M 111111111 3083 acatgtctcagttgggagttttctgagaaagacgatgaaccagaagaagt 3273 agtagttaaagcaaaaatcagaagtaaagctagaaggattgtttcagatg 111111111!111i11111 m 111111111111111111111111II11 3133 agtagttaaagcaaaaatcagaagtaaagctagaaggattgtttcagatg 3323 gcgaagaCgaagatgattcttttaaagatacctcaagcataaatccattc lllllIlinillIlllllllllllllllMIIIIIlHlllllllIlll 3183 gcgaagatgaagatgattcttttaaagatacctcaagcataaatccattc 3373 aacacatctctctttcaattctcatctgtgaaacaatttgatgcttcaac
t k ί11II111111111111 M 111 k! k 11 M IΠ ! 1111 ί I M11111M 3233 aacacatctctctttcaattctcatctgtgaaacaattCgatgcttcaac 3423 tcccaaaaatgacatcagtccaccaggaaggttcttttcatctcaaatac i m e 1111111111 m 1111 n 11111 ] l 111111111111111 m i 3283 tcccaaaaatgacatcagtccaccaggaaggttcttttcatctcaaatac 3473 ccagtagtgtaaataagtctatgaactctagaagatctctggcttctagg 11 m M 11! 111! IU 11111 k 1111111.......I! 111 í ....... 3333 e cagtagtgtaaataagtctatgaactctagaagatctctggcttctagg 3523 aggtctcttattaatatggt11tagaccacgtggaggacatggaggaaag llllillIlllIllIllltlIlllllllMMIIIIIElimillllll 3383 aggtctcttattaatatggttttagaccacgtggaggacatggaggaaag 3573 acttgacgacagcagtgaagcaaagggtcctgaagattatccagaagaag 1111lllM 11111111111 m n1111111111111111111111E11 3433 acttgacgacagcagtgaagcaaagggtcctgaagattatccagaagaag 3623 gggtggaggaaag cagt ggcgaagcc tccaagtatacagaagaggatcct
imilMllillllllllimil I IIIIlIlINilll MIII1IUI 3483 gggtggaggaaag cagtg gcgaagcctccaagtatacagaagaggatcct 3673 tccggagaaacactgtcttcagaaaacaagtccagctggttaatgacgtc 1111111 m 111111111111 μ 111111111 im ii i μ ii 11 ii 11 2972 2832 3022 2Θ82 3072 2932 3122 2982 3172 3032 3222 3082 3272 3132 3322 3182 3372 3232 3422 3282 3472 3332 3522 3382 3572 3432 3622 3482 3672 3S32 V.2 3722 144 3533 tccggagaaacactgtcttcagaaaacaagtccagctggttaatgacgtc 3723 taagcctagtgctctagctcaagagacctctcttggtgcccctgagcctt
] 1111111111111111111111111III11111II11111 M 111 MII 3583 taagcctagtgctctagctcaagagacctctcttggtgcecctgagcctt 3773 tgtctggtgaacagttggttggttctccccaggataaggcggcagaggct 1111 Μ Μ ί11111M i1111!ill 1111!11111111111111111 M ! 3633 tgtctggtgaacagttggttggttctceecaggataaggcggcagaggct 3823 acaaatgactatgagactct tg t a aag cg tggaaaagaac t aaaagagtg llllllllllllilllllillllllimilllltlilllllllllllll 3683 acaaatgactatgagac tcttgtaaagcgtggaaaagaactaaaagagtg 3873 tggaaaaatccaggaggc cctaaactgct tagttaaagcgc ttgacataa 1111!11III1111111111mIi11111!1111111111! 1111! 111 3733 tggaaaaatccaggaggccctaaactgcttagttaaagcgcttgacataa 3923 aaagtgcagatcctgaagttatgctcttgactttaagtttgtataagcaa llllllllllllilllllllllllllllllllllllllllllllllllll 3783 aaagtgcagatcctgaagttatgctcttgactttaagtttgtataagcaa 3973 cttaataacaattgagaatgtaacctgtttattgtattttaaagtgaaac lllllllllllllllllllllllllllllillllllllllllllllllll 3833 cttaataacaattgagaatgtaacctgtttattgtattttaaagtgaaac 4023 tgaatatgagggaatttttgttcccataattggattctttgggaacatga I ί 111 ί l M 11! I!M11111111111111111 It 111111111111 i Í1 3883 tgaatatgagggaatttttgttcccataattggattctttgggaacatga 4073 agcattcaggcttaaggcaagaaagatctcaaaaagcaacttctgccctg I llllli IIIII lllill 1111II llllll I lllíilll llll l.lllill 3933 agcattcaggcttaaggcaagaaagatctcaaaaagcaacttctgccctg 4123 caacgccccccactccatagtctggtattctgagcactagcttaatattt lllllllllllllllllimilllllllllllllllllllllMIllll 3983 caacgccccccactccatagtctggtattctgagcactagcttaatattt 4173 cttcacttgaatattcttatattttaggcatattctataaatttaactgt miiiiiiiiMiiiiiiiiiiiiiiiiimimiiiiiiiiiim 4033 cttcacttgaatattcttatattttaggcatattctataaatttaactgt 4223 gttgtttcttggaaagttttgtaaaattattctggtcattcttaatttta IH 11111111111111111II m 111II11II1111111 M 11 m 11 4083 gttgtttcttggaaagttttgtaaaattattctggtcattcttaatttta 4273 ctctgaaagtgatcatctttgtatataacagttcagataagaaaattaaa m 111111 μ 111111 m i m i j 111 m m 1111111 m 11111 4133 ctctgaaagtgatcatctttgtatataacagttcagataagaaaattaaa 4323 gttacttttctc 4334 llllllllllll 4183 gttacttttctc 4194 145
Quadro LIV(a). Sequências peptidicas da proteína codificada por 273P4B7 v.2 (SEQ. ID N.a 113) 60 120 160 240 300 360 420 480
MGLGKTVQII AFLSGMFDAS LVNHVLLIMP TNLIHTWVKE FIKWTPGMRV KTFHGPSKDE RTRHLNRIQQ RNGVIITTYQ MLINNWQQLS SFRGQEFVWD YVIXjDEAHKI KTSSTKSAIC ARAIPASNRL LLTGTPIQNN LQELWSLFDF ACQGSLLGTIj KTFKMEYEHP ITRAREKDAT PGEKALGFKI SENLMAIIKP YFLRRTKEDV QKKKSSMPEA RLNEKNPDVD AICEMPSLSR KNDLXIWIRL VPLQEEIYRK FVSLDHIKEL LMETRSPLAE IiGVLKKLCDH PRLLSARACC LLNLGTFSAQ DGNEGEDSPD VDHIDQVTDD TLMEESGKMI FXiMDLLKRLR DEGHQTLVFS QSRQILNIIE RLLKNRHFKT IiRIDGTVTHL LEREKRINLF QQNKDYSVFL LTTQVGGVGL TLTAATRWI FDPSWHPATD AQAVDRVYRI GQKENVWYR LITCGTVEEK IYRRQVFKDS LIRQTTGEKK NPFRYFSKQE LRELFTIEDL QHSVTQLQLQ SLHAAQRKSD IKLDEHIAYL 540 QSLGlAGlSD HDLMYTCDLS VKEELDWEE SHYIQQRVQK AQFLVEFESQ NKEFLMEQGR 600 TRNEGAWLRE PVFPSSTKKK CPKLNKPQPQ PSPLLSTHHT QEEDISSKMA SWIDDliPKE 660 GEKQDJjSSIK VHVTTJjQDGK GTGSADSIAT LPKGFGSVEE tCTHSSLGME KSFATKHEAV 720 QKETLQEGPK QEALQEDPLE SFBYVLSKST KADIGPNLDQ LKDDEILRHC HPWPIISITW 780 ESQNAESNVS IXEIADDLSA SHSAXjQDAQA SEAKLEBEPS ASSPQYACDF NLFLEDSADN 840 RQNFSSQSLB HVEKENSLCG SAPNSRAGFV HSKTCLSWEF SEKDDEPEEV WKAKIRSKA 900 RRIVSDGEDB DDSFKDTSSI NPFNTSLFQF SSVKQFDAST PKNDI8PPGR FFSSQIPSSV 960 NKSMNSRRSL ASRRSLINMV LDHVEDMEER LDDSSEAKGP EDYPBEGVEE SSGEASKYTE 1020 EDPSGETLSS ENKSSWIiMTS KPSALAQETS LrGAPEPLSGE QLVGSPQDKA AEATNDYETL 1080 VKRGKELKEC GKIQEALNCL VKALDIKBAD PEVMLLTLSL YKQIjNNN 1127 146
Quadro LV(a). Alinhamento da sequência de aminoácidos de v. 2 (SEQ. ID N.2 114) e 273P4B7 v.l (SEQ. 273P4B7 ID N.s 50 173 100 223 150 273 200 323 250 373 300 423 350 473 400 523 450 573 500 €23 550 673 600 723 115) V. 2 1 v.l 124 v.2 51 v.l 174 v.2 101 v.l 224 v.2 151 v.l 274 v.2 201 v.l 324 v.2 251 V.l 374 v.2 301 v.l 424 v.2 351 v.l 474 v.2 401 v.l 524 V.2 451 v.l 574 v.2 501 v.l 624 v.2 551 v.l 674 v.2 601
MGLGKTVQIIAFLSGMFDASLVNHVLLIMPTNLINTWVKEFIKWTPGMRV
MGLGKTVQIIAFLS GMFDASLVHHVLLIMPTNLINTWVKEFIKWTPGMRV
KTFHGPS KDERTRNLNRIQQRNGVIITTYQMLINNWQQLS S FRGQB FVWD i 1111! 111 m 111! 11111 m 1111 i i 111 m 11111! m m m
KTFHG PS KDERTRNLKRIQQRNGVIITTYQMLINNWQQLS S FRGQEFVWD
YVILDEAHKIKTSSTKSAICARAIPASNRLLLTGTPIQNNLQELWSLFDF
YVILDEAHKIKTSSTKSAICARAIPASNRLLLTGTPIQNNLQELWSLFDF ΑΟΟΟδΙιΙίσΤΙιΚΤΡΚΜΕΥΕΜΡΙΤΗΑΗΕΙΦΑΤΡΟΕΚΑΙιΟΓΚΙ SENLMAIΪΚΡ
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMIIIIIIIIIIIII acqgsllgtlktfkmeyenpitrarekdatpgbkalgfkisenlmaiikp
YFLRRTKEDVQKKKSSNPEARLNEKNPDVDAICEMPSLSRKNDLI IWIRL
m t ί 11 Μ ] 11111 ί 11 Μ Μ 1 M i! 11 Μ Μ M ÍM Μ I Μ I Μ I Μ I YFLRRTKEDVQKKKS SNPEARLNEKNPDVDAI CEMPSLSRKNDLI IWIRL vplqeeiyrkfvsldhikellmetrsplaelgvlkklcdhprllsaracc t Μ 111 ί 11 < 1 Μ 11 Μ 1 i 111 ί Μ Π Μ 1 Μ ! Μ I}! ί Μ ! Μ Μ I i 11 vplqeeiyrkfvsldhikellmetrsplaelgvlkklcdhprllsaracc llnlgtfsaqdgnegedspdvdhidqvtddtlmeesgkmiflmdllkrlr 1111111111 i I lli 11111Π 111 i 11MIIM111111 i 111M1111 llnlgtfsaqdgnegedspdvdhidqvtddtlmeesgkmi flmdllkrlr
ΟΕάΗΟΤΪ,νΡδΟεϊϊΟΙΜίΙ IERLLKNRHFKTLRIDGTVTHLLEREKRINLF
IIIIIIIIIIIEIIIIIIIIIIIIIIIIIIIIIIIIIIIUIIIIIIIII
DEGHQTLVFSQSRQILNIIERLLKNRHFKTLRIDGTVTHLLEREKRINLF
QQNKDY S VFLLTTQVGGVGLTLTAATRWIFDPSWNPATDAQAVDRVYRI M Ml 1 IM IIIII lli M IM 11M111! M11 Ml 1111111111111 QQNKDY S VFLLTTQVGGVGLTLTAATRWI FDPS WNPATDAQAVDRVYRI gqkenvwyrlitcgtveekiyrrqvfkdslirqttgekknpfryfs kqe
llllimillIlIMlIllllllllllllllllllllllllIlllllM
GQKENVWYRLITCGTVEEKIYRRQVFKDS LIRQTTGEKKN PFRYFS KQE
LRELFTIEDLQNSVTQLQLQSLHAAQRKSDIKLDEHIAYLQSLGIAGISD
LRELFTIEDLQNSVTQLQLQSLHAAQRKSDIKLDEHIAYLQSIíGIAGISD hdlmytcdlsvkeeldweeshyiqqrvqkaqflvefesqnkeflmeqqr
I ΜIΜ ΠΙ11Μ 111) IΜ Μ 11 j i IΜ ......Μ11Μ 1111111 M hdlmytcdlsvkeeldweeshyiqqrvqkaqflvefesqnkeflheqqr
TRNEGAWLREPVFPS STKKKCPKLNKPQPQPSPLLSTHHTQEBDIS S KMA
Itll II llll llll IIIIIIII lllllll MINI mm III lllli I 650 147
724 TRMEGAWLREP VFPSSTKKKCPKLNKPQPQPSPLLSTHHTQEEDISSKMA 651 swiddlpkegekqdlss ikvnvttlqdgkgtgsadsiatlpkgfgsvee II i i 111111 ti 111111111 i i n e 1111 m 111111 ii im 11111
774 SWIDDIiPKEGEKQDLSS1 KVNVTTbQDGKGTGSADSIATLPKGFGS VEE 701 LCTNSSLGMEKSFATKWEAVQKETLQEGPKQEALQEDPLESFWYVLSKST
III í III! 111111111! I! 11111111!111111111111111 í 11III
824 LCTNSSLGMEKSFATKHEAVQKETLQEGPKQEALQEDPLESFNYVLSKST 751 KADIGPNLDQLKDDEILRHCNPWPIISITNESQNAESNVSIIE IADDLS A llllllIMIIlllimilllItlIlllllllllllMIIMIIIIIIl
874 KADIGPNLDQLKDDEILRHCNPWPϊISITHESQNAESNVSIΙΕIADDLSA 801 SHSALQDAQAS EAKLEEE PS AS S PQYACDFNL FLEDSADNRQNFS SQSLE 1111 ί 1111IIIII1111111111111111.......11 ί I Ml 111111
924 SHSALQDAQASEAKLEEEPSASS PQYACDFNLFLEDSADNRQNFSSQSLE 851 hvekenslcgsapnsragfvhsktclswbfsekddepeewvkakirska llllllllltlIllllllllllllllEllllliimillllillllltl
974 HVBKENSLCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVWKAKIRSKA 901 RRIVSDGEDEDDSFKDTSSINPFNTS LFQFS S VKQFDASTPKND1S PPGR llllllllllllllllllllllllllllllllimilllllllllllll
1024 RRIVSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPPGR 951 FFSSQIPSSVNKSMNSRRSLASRRSLINMVLDHVEDMEERIíDDSSEAKGP lllllllllllilillllllllllllllllllllilllllllllllllll
1074 FFSSQXPSSVNKSMNSRRSLASKRSLINMVLDHVEDMEBRLDDSSEAKGP 1001 EDYPEEGVEESSGEASKYTEEDPSGETLSSENKSSWLMTSKPSALAQETS
M!lillMIIII]l Μ II1111IIIIIIIIIMIIIIIII1I1IIIIII
1124 EDYPEEGVEES SG EAS KYTEED PSGETLS SENKS SWLMTS KPSALAQETS 1051 IiGAPE PLSGEQLVG5 PQDKAAEATND YETLVKRGKELKECGKIQEALNCL iiiiiiiiiiiiiiiimiiimiiiiiiiuiiiiiiiiiiiiiiii 1174 LGAPEPLSGEQLVGSPQDKAAEATND YETLVKRGKELKECGKIQEALNCL 1101 VKALDIKSADPEVMLLTL S LYKQLNNN 1127 llllllllllllllllllllllllill
1224 VKAIiDIKSADPEVMLLTLSLYKQLNNN 1250 148
Quadro Lll(b). Sequência de nucleotídeos da variante transcrita 273P4B7 v.9 (SEQ. ID N.a 116) aaaatgaatc atgtgctgct gatcatgcca accaatctta ttaacacttg ggtaaaagaa 60 ttcatcaagt ggactccagg aatgggagtc aaaacctttc atggtcctag caaggatgaa 120 cggaccagaa acctcaatcg gattcagcaa aggaatggtg ttattatcac tacataccaa 180 atgttaatca ataactggca gcaactttca agctttaggg gccaagagtt tgtgtgggac 240 tatgtcatcc tcgatgaagc acataaaata aaaacctcat ctactaagtc agcaatatgt 300 gctcgtgcta ttcçtgcaag taatcgcctc ctcctcacag gaaccccaat ccagaataat 360 ttacaagaac tatggtccct atttgatttt gcttgtcaag ggtccctgct gggaacatta 420 aaaactttta agatggagta tgaaaatcct attactagag caagagagaa ggatgctacc 480 ccaggagaaa aagccttggg atttaaaata tctgaaaact taatggcaat cataaaaccc 540 tattttctca ggaggactaa agaagacgta cagaagaaaa agtcaagcaa cccagaggcc 600 agacttaatg aaaagaatcc agatgttgat gccatttgtg aaatgccttc cctttccagg 660 aaaaatgatt taattatttg gatacgactt gtgcctttac aagaagaaat atacaggaaa 720 ttcgtgtctt tagatcatat caaggagttg ctaatggaga cgcgctoacc tttggctgag 780 ctaggtgtct taaagaagct gtgtgatcat cctaggctgc tgtctgcacg ggcttgttgt 840 ttgctaaatc ttgggacatt ctctgctcaa gatggaaabg agggggaaga ttccccagat 900 gtggaccata ttgatcaagt aactgatgac acattgatgg aagaatctgg aaaaatgata 960 ttcctaatgg acctacttaa gaggctgcga gatgagggac atcaaactct ggtgttttct 1020 caatcgaggcaaattctaaa catcattgaa cgcctcttaa agaataggca ctttaagaca 1080 ttgcgaatcg atgggacagt tacteatett ttggaacgag aaaaaagaat taacttattc 1140 149 cagcaaaaba aagattactc tgbbtbbcbg cbtaccactc aagtaggtgg tgtcggttta 1200 acattaactg cagcaactag agtggtcatt tttgacccta gctggaatcc tgcaactgat 1260 gctcaagctg tggatagagt ttaccgaatt ggacaaaaag agaatgbtgt ggttbabagg 1320 ctaatcactt gtgggactgt agaggaaaaa atatacagaa gacaggbbbb caaggactca 1380 ttaataagac aaactactgg tgaaaaaaag aaccctttcc gatatbttag taaacaagaa 1440 ttaagagagc tctttacaat cgaggatcbt cagaactctg taacccagct gcagcttcag 1500 tctbtgcabg ctgctcagag gaaatctgat ataaaactag atgaacatat tgcctacctg 1560 cagtcbbtgg ggatagctgg aatctcagac catgafctfcga tgtacacatg tgatctgtct 1620 gttaaagaag agcttgatgt ggtagaagaa tctcactata ttcaacaaag ggttcagaaa 1680 gctcaabtcc tcgttgaatb cgagtctcaa aataaagagt bcctgatgga acaacaaaga 1740 actagaaatg agggggcctg gctaagagaa cctgtatttc cttcttcaac aaagaagaaa 1800 tgcccbaaat tgaataaacc acagcctcag ccttcacctc ttctaagtac bcatcatact 1860 caggaagaag atatcagttc caaaatggca agtgtagtca ttgatgatct gcccaaagag 1920 ggtgagaaac aagatctctc cagtataaag gtgaatgtta ccaccttgca agatggtaaa 1980 ggtacaggta gtgctgactc tatagctact ttaccaaagg ggtttggaag tgtagaagaa 2040 ctttgtacta actcttcatt gggaabggaa aaaagctbtg caactaaaaa tgaagctgta 2100 caaaaagaga cattacaaga ggggccbaag caagaggcac fcgcaagagga tcctctggaa 2160 agttbbaabt atgbacttag caaateaacc aaagctgata ttgggccaaa tttagatcaa 2220 cfcaaaggatg atgaggtttt acgbcattgc aatccttggc ccattatttc cataacaaab 2280 gaaagtcaaa atgcagaatc aaabgbatcc atbabbgaaa fcagcbgatga cctttcagca 2340 tcccatagtg cacbgcagga bgctcaagca agbgaggcca agtbggaaga ggaaccttca 2400 gcatcttcac cacagtatgc atgtgatttc aatcbbbbcb bggaagacbc ageagacaac 2460 agacaaaatt tbbccagtca gtctttagag catgttgaga aagaaaatag cttgtgtggc 2520 tctgcaccta attccagagc agggbbbgtg catagcaaaa catgtcbcag ttgggagbtt 2580 tctgagaaag acgabgaacc agaagaagta gtagttaaag caaaaabcag aagbaaagcb 2640 agaaggabbg btbcagatgg cgaagabgaa gabgabbcbb ttaaagatac ctcaagcata 2700 aatccatbca acacatcbct ctttcaattc tcatcbgbga aacaabbtga tgcbbcaact 2760 cccaaaaabg acabcagtcc accaggaagg tbcttttcat ctcaaatacc cagtagtgta 2820 aataagtcta tgaactctag aagatctctg gcttcbagga ggtctcttab taatatggtt 2880 btagaccacg tggaggacab ggaggaaaga ctbgacgaca gcagtgaagc aaagggtccb 2940 gaagattatc cagaagaagg ggtggaggaa agcagbggcg aagecbccaa gbatacagaa 3000 gaggatcctt ccggagaaac actgtcttca gaaaacaagb ccagcbggtt aabgacgbct 3060 aagcctagtg cbcbagctca agagaccbct cbbggbgccc ctgagcctbt gtctggtgaa 3120 cagbtggfctg gbbcccccca ggabaaggcg gcagaggcba caaatgacta tgagactctt 3160 gtaaagcgbg gaaaagaact aaaagagbgb ggaaaaabcc aggaggcccb aaactgctta 3240 gbbaaagcgc ttgacataaa aagtgcagab ccfcgaagtba tgcbcbtgac ttbaagtbtg 3300 fcataagcaac tbaataacaa bbgagaatgb aacctgttba bbgtatttba aagbgaaact 3360 gaatatgagg gaabtbttgt bcccabaatt ggabtctbtg ggaacatgaa gcabtcaggc 3420 bfcaaggcaag aaagabctca aaaagcaact tctgcccbgc aacgcccccc acbccabagb 3480 cbggtattct gagcactagc ttaatatttc ttcacttgaa battcbtata bbtbaggcab 3S40 attcbataaa bttaacbgtg bbgtttcttg gaaagbtttg taaaatbatb cbggbcabtc 3600 ktaattttac kcbgaaagtg atcatctttg tatataacag bbcagataag aaaabtaaag 3660 ttactbbbcb c 3671 150 150 273P4B7 v 118) v.l 501 v. 9 1 v.l 551 v. 9 28 v.l 601 v. 9 78 v.l 651 v. 9 128 v.l 701
Quadro Ull(b). Alinhamento da sequência de nucleotideos de (SEQ. ID N.2 117) e 273P4B7 v.l (SEQ. ID N.s SSO 27 600 77 650 127 700 177 750
I < 11 .........11111111 j I aaaa- -tgaatcatgtgctgctgatcatg ccaaccaatcttattaacacatgggtaaaagaattcatcaagtggactcc lllllllllllllllllllMllilllllllllllllllllllllllll ccaaccaatcttattaacacttgggtaaaagaattcatcaagtggactcc aggaatgagagtcaaaacctttcatggtcctagcaaggatgaacggacca
IIIIIIMIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII aggaatgggagtcaaaacctttcatggtcctagcaaggatgaaeggacca gaaacctcaatcggattcagcaaaggaatggtgttattatcactacatac llllllllllllllllllllllllllllllllllllllllllllllllll gaaacctcaatcggattcagcaaaggaatggtgttattatcactacatac caaatgttaatcaataactggcagcaactttcaagctttaggggccaaga 151 1111111! 11! 111 m 11 η 1111111 η ι! m! 1111 μ 111 mi ι 178 caaatgttaateaataactggcagcaactttcaagctttaggggccaaga 751 gtttgtgtgggactatgtcat:cctcgatgaagcacataaaataaaaacct 111 m 111 u 111111111111111 μ ι m m 11 m 11 m ι μ μ 228 gtttgfcgtgggactatgtcatcctcgatgaagcacataaaataaaaacct 801 catctactaagtcagcaatatgtgctegtgctattcctgcaagtaatogc 111!M11ΠII11111111111 ί 11 m III li 11111111111 ] I M) 278 catctactaagtcagcaatatgtgctcgtgctattcctgcaagtaatcgc 851 ctectectcacaggaaccccaatccagaataatttacaagaactatggtc 11111111 π 11111111 μ 11111111111 ......11111 m μ ι 328 ctcctcctc&caggaaccccaatccagaataatttacaagaactaCggtc 901 cctatttgattttgcttgtcaagggtccctgctgggaacattaaaaactt ui iniii ui ι iiiiiii μ iiimiiiiiiiiiiiiiiii mm 378 cctat ttgat tttgcttgtcaagggtccctgctgggaacattaaaaactt 951 11 aagatggagt atg aaaatectattac tagagcaagagagaaggatgct ui mm μ ι iiMiiii μ μ ι Miiiiiiiiiiiiiiimiiiii 42 8 ttaagatggagtatgaaaatcctattactagagcaagagagaaggatgct 1001 accccaggagaaaaagccttgggatttaaaatatcfcgaaaacfctaatggc
11111111111111111111111111111111H 1111111111111III 478 ac c c c agg agaaaaagcc ttgggatttaaaatatctgaaaacttaatggc 1051 aatcataaaaccctattttct caggaggac t aaagaagacgtacagaaga
lllllllll lilhll! IIIIIIΙΙΙΙΙΙΜΙΙΙΜΙΙΙΙΙΙΙΙΙΙΙΙΙI 528 aatcataaaaccctattttct caggaggac t aaagaagacgtacagaaga 1101 aaangtv<iaguaawvagaggwagauttaatgaaaagaatccagatgtt 578 aaaagtcaagcaacccagaggccagacttaatgaaaagaatccagatgtt 1151 gatgccatttgtgaaatgccttccctttcc aggaa aaatgat ttaattat
1111111111111II11 i11111 M i 1111 ί 1111.......111111 M 628 gatgccatttgtgaaatgccttccctttccaggaaaaatgatttaattat 1201 ttggatacgacttgtgcctttacaagaagaaatat acaggaaatttgtgt 678 ttggatacgacttgtgcctttacaagaagaaatatacaggaaatttgtgt 1251 ctttagatcatatcaaggagttgctaatggagacgcgctcacctttggct 728 ctttagateatatcaaggagttgctaatggagacgegctcacctttggct 1301 gagctaggtgtcttaaagaagctgtgtgatcatcctaggctgctgtctge lllllllll lllllllll IE l E i 11111111111! L1111 UI 11 i 1111 778 gagctaggtgtcttaaagaagctgtgtgatcatcctaggctgctgtctgc 1351 acgggct tgttgtttgctaaatc ttgggacattctctgctcaagatggaa 11111M 1111111 M1111111IIIIIIII í 111111111111111111 828 acgggcttgttgtttgctaaatcttgggacattctctgctcaagatggaa 14 01 atgagggggaagattccccagatgtggaccatattgatcaagtaactgat μ 1111111111111111111111 m 11111 r 11111111111111111 878 atgagggggaagattccccagatgtggaccatattgatcaagtaactgat 1451 gacacattgatggaagaatctggaaaaatgatattcctaatggacctact 92 b gacacattgatggaagaatctggaaaaatgatattcctaatggacctact 152 152 V. 1 1501 v.9 978 v.l 1551 V.9 1028 v.l 1601 V.9 1078 V.l 1651 V.9 1128 v.l 1701 v.9 1178 V.l 1751 v.9 1228 v.l 1B01 v.9 1278 v.l 1851 V.9 1328 v.l 1901 v.9 1378 v.l 1951 V.9 1428 v.l 2001 v. 9 1478 v.l 2051 v.9 1528 V.l 2101 V.9 1578 v.l 2151 v.9 1628 v.l 2201 v.9 1678 v.l 2251 v.9 1728 taagaggctgcgagatgagggacatcaaactctggtgttttctcaatcga IIIIIMIIIIIIlllllllllllMlllllllllllllllllillllll taagaggctgcgagatgagggacatcaaactctggtgttttctcaatcga ggcaaattctaaacatcattgaacgcctcttaaagaataggcactttaag imimmiiii ιιικιιιιιιιι iiiiiiiiimiimmi i ggcaaattctaaacatcattgaacgcctcttaaagaataggcactttaag acattgcgaatcgatgggacagttactcatcttttggaacgagaaaaaag 1111111111 i 111Π111111111111! m 111111 m 111111111 acattgcgaatcgatgggacagttactcatcttttggaacgagaaaaaag aattâacttattccagcaaaataaagattactctgtttttctgcttacca IIIIIEIIIIIIIIIIIIIIIIIIIIIIIII llllll milllllllll aattaacttattccagcaaaataaagattactctgtttttctgcttacca ctcaagtaggtggtgtcggtttaacattaactgcagcaactagagtggec iiiiiiimiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiim cteaagtaggtggtgtcggtttaacattaactgeagcaactagagtggte atttttgaccctagctggaatcctgcaactgatgctcaagctgcggatag IIIIIIIIIIIIlililtlIlllllllillllIlIlMMIIIllllll! atttttgaccctagctggaatcctgcaactgatgctcaagctgtggatag agtetaccgaattggacaaaaagagaatgttgtggtttataggotaatca agtttaccgaattgga caaaaagaga atgttgtggt ttataggetaatca cttgtgggactgt agaggaaaaa atatacagaagacaggt tt tcaaggac ettgtgggactgt agaggaaaaaat atacagaagac aggttttoaaggac tcattaataagacaaactactggtgaaaaaaagaaccctttccgatattt lllllltlllllllllllllllllllllílllllllllllllllilllll tcattaataagacaaactactggtgaaaaaaagaaccctttccgatattt tagtaaacaagaattaagagagctctttacaatcgaggatcttcagaact 111 {llt 11111111111111 Ml 11111111111111M1111111111 tagtaaaceagaattaagagagctctttacaatcgaggatcttcagaact ctgtaacccagctgcagcttcagtctttgcatgctgctcagaggaaatct
M 11 i 1111111111111 M 1111J11 i 11IIII1 Μ ΠΙ M 111EI M I ctgtaacccagctgcagcttcagtctttgcatgctgctcagaggaaatct ga t a taaaac tagatga acata t tgcctacctgcag t c 11tggggatage í II M r 111111111J11111M ......II111 il I M I M 11111111 gatataaaactagatgaacatattgcctacctgcagtctttggggatagc tgga a t ctcagaccatgatttgatgtacacatgtgatctgtctgttaaag lllllllllllllllllllllljlllllllllllilllllllllllllll tggaatctcagaccatgatttgatgtacacatgtgatctgtctgttaaag aagagcttgatgtggtagaagaatctcactatat tcaacaaagggttcag 111111111111111IIIM IIM1111 MIΠΙ11M 11M M I (1111 aagagcttgatgtggtagaagaatctcactatattcaacaaagggttcag a&agctcaattcctcgttgaattcgagtctcaaaataaagagttcetgat ΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΜΙΙΙΙΜΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙ aaagctcaattcctcgttgaattcgagtctcaaaataaagagttcctgat ggaacaacaaagaactagaaatgagggggcctggctaagagaacctgtat 111111111M 111LIK1111111 m M 1111111111M MIM 111 ggaacaacaaagaactagaaatgagggggcctggctaagagaacctgtat 1550 1027 1600 1077 1650 '1127 1700 1177 1750 1227 1800 1277 1850 1327 1900 1377 1950 1427 2000 1477 2050 1527 2100 1577 2150 1627 2200 1677 2250 1727 2300 1777 153 2301 ttccttcttcaacaaagaagaaatgccctaaattgaateaaccacagcct iiiimiiiiiiiiimmiiimiiiiiiimiimtimii 1778 ttccttcttcaacaaagaagaaatgccctaaategaataaaceacagcct 2351 cagccttcacctcttctaagtactcatcataeteaggaagaagatatcag 11ΙΙ1ΙΙΙΙΙΙΙΙΙΙ1ΙΙΜΙ1Π1ΜΙΙΙΙΙΙΙ! lilllll llllllll 1828 cagccttcacctcttctaagtactcatcótactcaggaagaagatatcag 2401 ttccaaaatggcaagtgtagtcattgatgatctgccc&aagagggtg&ga 111111 !i 1111111111111111111M111111111111111! 11 í 11 1878 ttccaaaatggcaagtgtagtcattgatgatctgcocaaagagggtgaga 2451 aacaagatctctccagtataaaggtgaatgttaccaccttgcaagatggt 152 8 aacaagatctctccagtataaaggtgaatgttaceacettgcaagatggt 2501 aaaggtacaggtagtgctgactctatagctactttaccaaaggggtttgg 11111111iI!111111111i11111111111111111i111!! I i 1111 197 8 aaaggtacaggtagtgctgactctatagctactttaccaaaggggtttgg 2551 aagtgtagaagaactttgtactaactcttcattgggaatggaaaaaagct 111111111111111! 1111111111111! I í i 11111! 111 m UI 11 2028 aagtgtagaagaactttgtactaactcttcattgggaatggaaaaaagct 2601 ttgcaactaaaaatgaagctgtacaaaaagagacattacaagaggggcct 207 8 ttgcaactaaaaatgaagctgtacaaaaagagacattacaagaggggcct 2651 aagcaagaggcactgcaagaggatcctctggaaagttttaattatgtact 2128 aagcaagaggcactgcaagaggatcctctggaaagtttCaattatgtact 2701 tagoaaatcaaccaaagctgatattgggccaaatttagatcaactaaagg
11ί111111m11!1111!111111111111111111II11111 N I! I 217 B tagcaaatcaaccaaagctgatattgggccaaatttagatcaactaaagg 2751 atgatgagattttacgtcattgcaatccttggcccattatttccataaca MMIIIMIIIIMIIIIII llllllllll INI llll IIIII lllll 2228 atgatgaggttttacgtcattgcaatccttggcccattatttccataaca 2801 aatgaaagtcaaaatgcagaatcaaatgtatccattattgaaatagctga iinmi iiiimini ui mmini iiiimiiii iiiiiii 2278 aatgaaagtcaaaatgcagaatcaaatgtatccattattgaãatagctga 2851 tgacctttcagcatccca tagtgcactgcaggatgctcaagcaagtgagg
lllll llllll lilllll lilllll ΙΙΙΙΜΙI llllllllll Mllll I 2328 tgaccttbcagcatcccatagtgcactgcaggatgctcaagcaagtgagg 2901 ccaagttggaagaggaaccttcagcatcttcaccacagtatgcatgtgat llll IIIIIlllll!lllllll111llllIII f!i 11E11 llllll llll 2378 ccaagttggaagaggaaccttcagcatcttcaccacagtatgeatgtgat 2951 ttcaatcttttctcggaagactcagcagacaacagacaaaatttttccag lilllll! IMIIIMIIIIII llllllllll Mlllill llllll llll 24Z8 ttcaatcttttcttggaagactcagcagacaacagacaaaatttttccag 3001 tcagtctttagagcatgttgagaaagaaaatagcttgtgtggctctgcac lllllllllllllllllllllllllllllllElllllllllillllllll 2478 tcagtctttagagcatgttgagaaagaaaatagcttgtgtggcfcctgcac 3051 ctaattccagagcagggtttgtgcatagcaaaacatgtctcagttgggag 1111111j 1111!11111111111II1111111111111111111m11 154 2528 ctaaetecagagcagggtttgtgcatagcaaaacatgtctcagttgggag 3101 ttttctgagaaagacgatgaaccagaagaagtagtagttaaagcaaaaat 1111H I! 111 Ui f 11111 llt 111 n 11EIIH11 i I! 11II111 m 2578 111 tc tgag a aag aegatgaac c agaagaagtagt agt t aaagc aaaaa t 3151 cagaagtaaagctagaaggatfcgtfctcagatggcgaagatgaagatgatt n i n m 11 m! 1111111! 11111 m 1111111 ΐ! 11111 e 11111 2628 cagaagtaaagctagaaggattgtttcagatggcgaagatgaagatga11 3201 ettttaaagatacctcaagcataaatccattcaacaeatctctctttcaa 11! 111111111m1!Iί11! I! 1111111Π111111111111!M11 2678 cttttaaagatacctcaagcataaatccattcaacacatctctctttcaa 3251 ttctcatctgtgaaacaatttgatgcttcaactcccaaaaatgacatcag llllllllllllllllimilllllllllllllllllllllllllllll 2728 ttctcatctgtgaaacaatttgatgct tcaactcccaaaaatgacatcag 3301 tccaccaggaaggttcttttcatctcaaatacccagtagtgtaaataagt llllllllllllllllllllllllllllllllllllllllllllllllll 2778 tccaccaggaaggfctcttttcatctcaaatacccagtagtgtaaataagt 3351 ctatgaactctagaagatctctggcttctaggaggtctcttattaatatg illlllllllllllllllllllllllllllllllll.lllllllllltlll 2828 ctatgaactctagaagatctctggcttctaggaggtctcttattaatatg 3401 gtttfcagaccacgtggaggacatggaggaaagacttgacgacagcagtga
lilllllll IIIIIllllllllllllllllllllllllllllllllll II 2870 gttttagaccacgtggaggacatggaggaaagacttgacgacagcagtga 3451 agcaaagggtcctgaagatcatccagaagaaggggtggaggaaagcagtg i m ί 1111 n 11 í 11 η i ii 11111111111111 m 111111111111 2928 agcaaaggg t c ctgaaga tC atccagaagaaggggtggaggaaagcagtg 3501 gcgaagcctccaagtatacagaagaggatccttccggagaaacactgtct lllllllllllllllll llimillll llllllllllll II lllllill 2978 gcgaagcctccaagtatacagaagaggatccttccggagaaacacegtct 3551 tcagaaaacaagtccagctggttaatgacgtctaagectagtgctctagc 11M 1111111111 m 11 M 111! 11111111 M III11111 ί 111111 3028 tcagaaaacaagtecagctggttaatgacgtctaagcctagtgetctage 3601 t c aagagacc tctc ttggtgcccctgagcctttgtCtggtgaacagttgg 1111111M1111M!1111 m 111111II M 1111111 M 11111111 3070 tcaagagacctctcttggtgcccctgagcctttgtctggtgaacagttgg 3651 ttggttctccccaggataaggcggcagaggctacaaatgactatgagact u i m i · 111 i 1111 π e 111 m 111 n 1111 m 11111 u 11 m i 3128 ttggttccccccaggataaggcggcagaggetacaaatgactatgagact 3701 cttgtaaagcgtggaaaagaactaaaagagtgtggaaaaatccaggaggc 11111!111111 m 1111111111111111 i 11 i 11 m E111111111 3170 c ttgt aaagcgtggaaaagaactaaaagagtgtggaaaaatccaggaggc 3751 cctaaactgcttagttaaagcgcttgacataaaaagtgcagatcctgaag m itil11111!UIII11111E111f 11MtMIlt!!Im111111 3228 cctaaactgcttagttaaagcgcctgacataaaaagtgcagatcctgaag 3801 ctatgctcttgactttaagcttgtataagcaacttaataacaattgagaa 111 ................11 Π I Μ 11111! ......llllllllllll 3278 ttatgctcttgactttaagtttgtataagcaacttaataacaattgagaa 3851 tgtaaectgtttattgtattttaaagtgaaactgaatatgagggaatttt 155 ν. 9 V.l v.9 v.l V.9 v.l v.9 v.l v.9 v.l v.9 v.l V.9 II ii 111111111 i m 11111111111 μ m 1111 ii 11 ii im i u 3328 tgtaacctgtttattgtattttaaagtgaaactgaatatgagggaatttt 3901 tgttcccataattggattctttgggaacatgaagcattcaggcttaaggcIIIllllimiIlIflIlllilIMIIIIIIIIIlllIlllllllilll 3378 tgttcccataattggattctttgggaacatgaagcattcaggcttaaggc 3951 aagaaagatctcaaaaagcaacttctgccctgcaacgccccccactccat! ΜIIII!11!!1111111111111111111111111!II1111111111 3428 aagaaagabctcaaaaagcaacttctgccctgcaacgccccccactccat 4001 agtctggtattctgagcactagcttaatatttcttcacttgaatattcttlllllllllllllllllIIIIIIIIlilllll III lllllllllll llll 3478 agtctggtattctgagcactagcttaatatttcttcacbtgaatattctt 4051 atattttaggcatattctataaatttaactgtgtfcgtttcttggaaagtt1111111111111 i 11111111111 i i 1111! 111 M1111111111111 3528 atattttaggcatattctataaatttaactgtgttgtttcttggaaagtt 4101 ttgtaaaattattcfcggtcattcttaattttactctgaaagfcgatcatctIII ί 11111111III11II11 i 111111! I Μ ί 111 UI 11Ϊ11 U 1111 3578 ttgtaaaattattctggtcattct taattttactctgaaagtgatcatct 4151 ttgtatataacagttcagataagaaaattaaagttacttttctc 4194MiimmmiimiimimiiiiiiiiiMim 3628 ttgtatataacagttcagataagaaaattaaagttacttttctc 3671 3377 3950 3427 4000 3477 4050 3527 4100 3577 4150 3627
Quadro LIV(b)
Sequências peptidicas da proteína codificada por 273P4B7 v.9 (SEQ. ID N.s 119) MNHVLLIMPT NLINTWVKEF IKWTPGMGVK TFHGPSKDER TRNLNRIQQR NGVIITTYQM 60 LINNWQQLSS FRGQEFVWDY VIIiDEAHKIK TSSTKSAICA RAIPASNRLL LTGTPIQNNIj 120 QELWSLFDFA CQGSLLGTLK TFKMEYENPI TRAREKDATP GEKALGPKIS ENLMAIIKPY 180 PLRRTKBDVQ KKKSSNPEAR LNEKNPDVDA ICEMPSLSRK NDLIIWIRLV PLQEEIYRKF 240 VSLDHIKBLb METRSPIAEL GVLKKLCDHP RLLSARACCL LNLGTFSAQD GNEGEDSPDV 300 DHIDQVTDDT LMEESGKMIF LMDLltKRIíRD EGHQTLVPSQ SRQILNIIER KLKHRHFKTL 360 RIDGTVTHLL EREKRINLFQ QNKDYSVFLL TTQVGGVGLT LTAATRWIF DPSWWPATDA 420 QAVDRVYRIG QKENVWYRL ITCGTVEEKI YRRQVFKDSL IRQTTGEKKN PFRYFSKQEIi 480 RELFTIEDLQ NSVTQLQLQS LHAAQRKSDI KLDEHIAYLQ SLGIAG1SDH DLMYTCDLSV 540 KEELDWEES HYIQQRVQKA QFLVEFESQN KEFLMEQQRT RNEGAWXjREP VFPSSTKKKC 600 PKLNKPQPQP SPLLSTHHTQ EEDISSKMAE WXDDLPKEG EKQDLSSIKV NVTTLQDGKG 660 TGSADSIATL PKGFGSVEEI» CTNSSLGMEK SFATKNEAVQ KETLiQEGPKQ EALQEDPLES 720 FNYVXiSKSTK ADIGPNLDQL KDDEVLRHCN PWPIISITNE SQNAESNVSI IEIADDLSAS 780 HSALQDAQAS EAKLEEEPSA SSPQYACDFN LFLEDSADNR QNFSSQSLEH VEKENSLCGS 840 APNSRAGFVH SKTCLSWEFS EKDDEPEEW VKAKXRSKAR RXVSDGEDED DSFKDTSSIN 900 PFNTSLFQFS SVKQFDASTP KNDISPPGRF FSSQIPSSVM KSMHSRRSLA SRRSLINMVL 960 DHVEDMEERL DDSSEAKGPE DYPEEGVEES SGEASKYTEE DPSGBTLSSE NKSSWLMTSK 1020 PSALAQETSL GAPEPLSGEQ LVGSPQDKAA EATNDYETLV KRGKELKECG KIQEALNCLV 1080 KALDIKSADP EVMLLTLSLY KQLNNN 1106 156Quadro LV(b). Alinhamento da sequência de aminoácidos de 273P4B7 v. 9 (SEQ. ID N.a 120) e 273P4B7 v.l (SEQ. ID N.a 121) v.l v.9 v.l V.9 v.l V.9
101 kegiaflyslyrdgrrggiladdmglgktvqiiaflsgmfdaslvnhvll:(1111 1 MNHVLL 151 imptnlintwvkefikwtpgmrvktfhgpskdertrnlnriqqrngviitI Ml11111111Μ 11............ ......... Μ1111111Μ I 7 IMPTNLINTWVKEFIKWTPGMGVKTPHGPSKDERTRMLNRIQQRNGVIIT 201 TYQMLINNWQQLS S FRGQEFVWDYVILDEAHKIKTSSTKS AI CARAIPASiiiiiiiiiiiiiiiiiiiiiiiimmiiiMimiiiiiiiiiii 57 TYQMLINNWQQLSSFRGQEFVWDYVILDEAHKIKTSSTKSAICARAIPAS 150 6 200 56 250 106 300 157 300 157 V. 1 251 v.9 107 V.l 301 V.9 157 V.l 351 v.9 207 v.l 401 v.9 257 v.l 451 v.9 307 v.l 501 V.9 357 V.l 551 V.9 407 V.l 601 v.9 457 V.l 651 v. 9 507 v.l 701 V. 9 557 v.l 751 v. 9 607 v.l 801 v.9 657 v.l 851 v.9 707 v.l 901 v.9 757 v.l 951 V.9 807 v.l 1001 v.9 857
tn&LLTGTPIGNmiQELWSLFDFACQGSLIiaTLKTFKMBYSNPITRAREK ! 111 M 11II11111111111! I m!! 111111111111111] Im Μ
lTOLLLTGTTIQl^QELWSLFDFAa^SI»LGTI.KTFKMEYENPrrRAREK
DATPGEKALGFKISERLMAIIKPYFLRRTKEDVQKKKSSNPEARLNEKNP 111Η111111II111111111111111 llt! 1111111111Π111111
DATPGEKALGFKISEKLMAXIKPYFLRRTKEDVQKKKSSNPEARLNEKNP
DVDAICEMPSLSRKHDLI IWIRLVPLQEEIYItKFVSLDHXKELIiMIirrRSP II ί 11 i 111 Π ί η I! Μ...... 111III ί Μ η I m 1! 111111111
DVDAICEMPS LSRXHDLI IΗI RLVPLQEEΙ YRKFVSLDHIKEIiIiMETRS Ρ LAEUnrt.KKLOTHPRIASAEACC^IjtniGTFBAQDSNEGBDSFlJVDHIDGV I! 111111 ί 111111111! 11 Π1! 111 Π I ί Π.....I i 11! 1111 > 1
LAEL·GVLKXL·CDHPRL·L·SARACCLL·WL·GTFSAQDGHEGEDSPDVI}HIDQV
TDDTI^ESGKMIFLHDLLKRLRDEGHQTLVFSQSRQILNIIERIiLKMRH III m 111111111111111 m! 1! 111 ΐ! 1111111111 Μ111111
OWri.MEESGKMIFLMDLLKRLRDEGIIQTLVFSQSRQILlJIXERI.I<KiniH FKTLRIDGTVTHIiLEEEKRINLFOQNKDYSVFLLTTQVGGVGLTLTAATR
IMIlllllllllllllMIIMIIIIIIIIlllllllllllltlIlMI
FKTLRXDGTVTHL·L·EREKRINL·FQQΪIKDYSVFLL·TTQVGGVGL·TLTAftTR
WXFDP8WNPRTDAQAVDRVYRIGQKENWVYRLITCGTVEEKIYHRQVF llllllllllllllllllllllllllllllllllllllllllllllllll
WIFDPSWNPATDAQAVDRVYRIGQKENVWyRLITCGTVEEKIYRRQVF KDS LIRQTTGBKKHPFRYFSKQELRELFTIEDLQNSVTQLQLQSLHAAQR iiiiiiiiiiiiiiiiiiiiiiiiiiiiimiiiiiiiiiiniiiiii
KDSLIRQTTGEKKNPFKYFSKQEbKEliFTIEDLQNSVTQljQIiQSIiHAAQR Κ8ΟΙΚΖιΟΕΗΙΆΪίΐ2ΕΧ3ΧΑβΙάΟΗΟ1ΜΥΤαο&5νΚΕΕΙ>ρννΕΕεΗΪΧ0ΟΚ II i11111111111111E11111111)11111111 j lil 1 i 11111! 111
KSDIKLDEHIAYLQS LG LAGXSDHDLMYTCDLSVKEELDWBBSHYIQQR VQKAQFLVE FES QHKE FLMEQQRTRNEGAWLRE PVF PS STKKKCPKLNKP 111111M1111111111111111111111111111111M ! 11111111
VQKAQFLVEFESQMKEFIiMEQQRTRHEG AWLRF.PVF PS S TKKKCPKLNKP QPQPSPLLSTHHTQEEDISS raíASWIDDLPKEGEKQDLS SI KVHVTTLQ III m 111 i 1111 m 111111111! t i i m i i 111 m 11! 111111
QPQPSPLLSTHHTQEEDI SS KMASWIDDLPKEGEKQDLS S IKVHVTTIiQ DGKGTGSADSIATLPKGFGSVEELCTtJSSLGMEKSFATKNEAVQKETLOE IIIIIIIMIIMIMIIIllIllllllllllllllll llllllllllll
DGKGTGSADSIATLPKGFGSVEELCTHSSLGMEKSFATKHEAVQKETIiQE GP KQEAJjQEDPLESFNYVLSKSTKADIGPNLDQLKDDEILRHCNPWPIIS μ ! 1111 m 1111 n 111 m i m! 1111! i i 11 u o 1111 η i! 11
GPKQEAIiQEDPLES FH YVLSKSTKADIGPNLDCIiKDDEVLRHCNPWPI IS ITNESQNAESHVSIIEIADDLSAeHSALÇDAQASEAKLEEEPSASSPQYA 11! 11111 ΜIΜ11 ί 1111II1111Μ! Μ ΜΙ Μ 111111! IΜ 11 ί 1
ITNESQNAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYA CD FNLFIiEDSADHRQNFS SQSLEHVEKENSLCGSAPNS RAGFVHSKTCLS
Ml I M I i 111111....... 11 ί11) 11111111111 m111111111
CDFHLFLEDSADNRQHFSSQSLEHVEKEHSLCGSAPNSRAGFVHSKTCLS
WBFSEKDDEPEEVWKAKIRSKAEPIVSDGEDEDDSFKDTSSINPFHTSL lllllllllllllllllllllllllllllllllltlillllllimill
WEFSEKDDEPEEVWKAKIRSKARRIVSDGEDEDDSFKDTSSIHPFHTSL 156 350 206 400 256 450 306 500 356 550 406 600 456 650 506 700 556 750 606 600 656 850 706 900 756 950 806 1000 856 1050 906 158 V.l 1051 fqfssvkqfdastpkndisppgrffssqipssvnksmnsrrslasrrsli 1 t 11 I i I i I i I 1 1 I I i I [ 11 1 t Μ 1 Μ 1 1 1 1 t 1 1 1 1 1 1 1 1 1 1 1 M ] 1 1 1 1 1100 v,9 907 11lII1 1 11 Μ II II l 1 1 11 1 1 1 l I 1 Μ 1 1 1 I 1 1 II II 1 1 1 1 1 1 1 1 1 1 1 1 FQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSI.I 956 v.l 1101 HMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTEBDPSGET 1 1 1 II 1 1 II 1 1 t 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 M 1 1 1 1 1 1 1 M II 1 II 1 1 1 1 II 1150 v. 9 957 111111111111111111 i 1111111111! M 111111111111111111 NMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDPSGET 1005 v.l 1151 LS SENKS S WLMTS KPSALAQETS LGAPEPLSGEQLVGS PQDKAAEATHDY i n i i i i i 11 i i η! i e m i m i i i i í i m i i i ! i i m i 1111111 L S SENKS S WLMTS KPSALAQETS LGAPEPLSGEQLVGS PQDKAAEATNDY 1200 v. 9 1007 1056 v.l 1201 ETLVKRGKELKE CG Kl QEALNCLVKALDI KS AD PEVHLLTLSLYKQLNNN 1111 1 1 1 1 1 I 1 1 i 1 1 1 1 1 1 1 II t 1 11 1 1 1 1 II 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 II 1 1250 V. 9 1057 1 1 1 l 1 II 1 1 1 1 1 i 1 1 1 l i11111111I111111111 1 1 1 1 1 1 1 1 i 1 1 11 1 ETLVKRGKELKECGKI QEALNCLVKALDIKS AD PEVMLLTLS LYKQLNNN 1106 159
Quadro Lll(c). Sequência de nucleotídeos da variante transcrita 273P4B7 v.10 (SEQ. ID N.a 122) tcattaataa gacaaactac tggtgaaaaa aagaaccctt tccgatattt tagtaaacaa 60 gaattaagag agctctttac aatcgaggat cttcagaact ctgtaaccca gctgcagctt 120 cagtctttgc atgctgctca gaggaaatct gatataaaac tagatgaaca tattgcctac 180 ctgcagtctt tggggatagc tggaatctca gaccatgatt tgatgtacac atgtgatctg 240 tctgttaaag aagagcttga tgtggtagaa gaatctcact atattcaaca aagggttcag 300 aaagctcaat tcctegttga attcgagtct caaaataaag agttcctgat ggaacaacaa 360 agaactagaa atgagggggc ctggctaaga gaacctgtat ttccttcttc aacaaagaag 420 aaatgcccta aattgaataa accacagcct cagccttcac ctcttctaag tactcatcat 480 actcaggaag aagatatcag ttccaaaatg gcaagtgtag tcattgatga tctgcccaaa 540 gagggtgaga aacaagatct ctccagtata aaggtgaatg ttaccacctt gcaagatggg 600 taaggtacag gtagtgctga ctctataact actttaccaa aggggtttgg aagtgtagaa 660 gaactttgta ctaactcttc attgggaatg gaaaaaagct ttgcaactaa aaatgaagct 720 gtacaaaaag agacattaca agaggggcct aagcaggagg cactgcaaga ggatcctctg 780 gaaagtttta attatgtact tagcaaatca accaaagctg atattgggcc aaatttagat 840 caactaaagg atgatgagat tttacgtcat tgcaatcctt ggcccattat ttccataaca 900 aatgaaagtc aaaatgcaga atcaaatgta tccattattg aaatagctga tgacctttca 960 gcateccata gtgcactgca ggatgctcaa gcaagtgagg ccaagttgga agaggaacct 1020 tcagcatctt caccacagta tgcatgtgat ttcaatcttt tcttggaaga ctcagcagac 1080 aacagacaaa atttttccag tcagtcttta gagcatgttg agaaagaaaa tagcttgtgt 1140 ggctctgcac ctaattccaa agcagggttt gtgcatagca aaacatgtct cagttgggag 1200 ttttctgaga aagacgatga accagaagaa gtagtagtta aagcaaaaat cagaagtaaa 1260 gctagaagga ttgtttcaga tggcgaagat gaagatgatt cttttaaaga tacctcaagc 1320 ataaatccat tcaacacatc tctctttcaa ttctcatctg tgaaacaatt tgatgcttca 1380 actcccaaaa atgacatcag tccaccagga aggttctttt catctcaaat acccagtagt 1440 gtaaataagt ctatgaactc tagaagatct ctggcttcta ggaggtctct tattaatatg 1500 gttttagacc acgtggagga catggaggaa agacttgacg acagcagtga agcaaagggt 1560 cctgaagatt atccagaaga aggggtggag gaaagcagtg gcgaagcctc caagtataca 1620 gaagaggatc cttccggaga aacactgtct tcagaaaaca agtccagctg gttaatgacg 1680 tctaagccta gtgctctagc tcaagagacc tctcttggtg cccctgagcc tttgtctggt 1740 gaacagttgg ttggttctcc ccaggataag gcggcagagg ctacaaatga ctatgagact 1800 cttgtaaagc gtggaaaaga actaaaagag tgtggaaaaa tccaggaggc cctaaactgc 1860 ttagttaaag cgcttgacat aaaaagtgca gatcctgaag ttatgctctt gactttaagt 1920 ttgtataagc aacttaataa caattgagaa tgtaacctgt ttattgtatt ttaaagtgaa 1980 actgaatatg agggaatttt tgttcccata attggattct ttgggaacat gaagcattca 2040 ggcttaaggc aagaaagatc tcaaaaagca acttctgccc tgeaacgccc ccçactccat 2100 agtctggtat tctgagcact agcttaatat ttcttcactt gaatattctt atattttagg 2160 catattctat aaatttaact gtgttgtttc ttggaaagtt ttgtaaaatt attctggtca 2220 ttcttaattt tactctgaaa gtgatcatct ttgtatataa cagttcagat aagaaaatta 2280 aagttacttt tctc 2294
Quadro Llll(c). Alinhamento da sequência de nucleotídeos de 273P4B7 v. 10 (SEQ. ID N.2 123) e 273P4B7 v.l (SEQ. ID N.a 124) v.l 1901 tcattaataagacaaactactggtgaaaaaaagaaccctttccgatattt 1950 11 m 11111 m i) m 11111 ii 11 m 1111! i) 111 j 11 m i i 11 160 160 V.10 1 v.l 1951 v.10 51 v.l 2001 v. 10 101 V.l 2051 V.10 151 V.l 2101 v.10 201 V.l 2151 V.10 251 v.l' 2201 v.10 301 v.l 2251 v.10 351 V.l 2301 v.10 401 V.l 2351 V.10 451 V.l 2401 V.10 501 V.l 2451 V.10 551 V.l 2501 V.10 601 v.l 2551 V.10 651 V.l 2601 V.IO 701 V.l 2651 v.10 751 v.l 2701 tcattaataagacaaactactggtgaaaaaaagaaccctttccgatattt tagtaaacaagaattaagagagctctttacaatcgaggatcttcagaact iiimiiiimiiiiiiiiiiiiiiimiiiimiiiiiiiiiiii tagtaaacaagaattaagagagctctttãcaâtcgaggatcttcaga&ct ctgtaacccagctgcagcttcagtctttgcatgctgctcagaggaaatct 11111M111ίIL1111111M1111111!11111111lll111111111 ctgtaacccagctgcagcttcagtctttgcatgctgctcagaggaaatct gatataaaactagatgaaoatattgcctacctgcagtctttggggatagc 111111! 1111111111 η 11111111 η 111 m 11 m 111111 i 111 gatataaaactagatgaacatattgcctacctgcagtotttggggatagc tggaatctcagaecatgatttgatgtacacatgtgafcctgtctgttaaag Μ11111111111 f11111!111111mIΜ I llllilllllllimi tggaatctcagaccatgatttgatgtacacatgtgatctgtctgttaaag aagagcttgatgtggtagaagaatctcactatattcaacaaagggttcag
llllllillllllllItllllllllllllllllllllMIIIIIIIIIII aagagcttgatgtggtagaagaatctcactatattcaacaaagggttcag aaagctcaattcctcgttgaattcgagtctcaaaataaagagttcctgat ! 1111 ί 111 ί 11 Μ 111 i 111111111! 111! Μ ! 11111111 ί I Μ i 11 aaagctcaattcctcgttgaattcgagtctcaaaataaagagttcctgat ggaacaacaaagaactagaaatgagggggcctggctaagagaacctgtat ! 111! 1!til 111!111111111111i1111!11111m i! 1111111 i ggaacaacaaagaactagaaatgagggggcctggctaagagaacctgtat ttccttcttcaacaaagaagaaatgccctaaattgaataaaccacagcct 11 mί L11 MiI<111111i 11Ml11! 111111111 llt111111111 ttccttcttcaacaaagaagaaatgccctaaattgaataaaccacagcct cagccttcacctcttctaagtactcatcatactcaggaagaagatatcag 1 i 111111111111Π1 m 1111L111111111111111 n 11111111 cagccttcacctcttctaagtactcatcatactcaggaagaagatatcag tt ccaaaatggcaagtgtagtcattgatgatctgcccaaagagggtgaga 11111111M111111111111111111111mIM 1111111111111 11 ccaaaatggc aagtg t agt cat tga tgat e tgc ccaa agagggtgaga aacaagatctctccagtataaaggtgaatgttaccaccttgcaagatggt millll IIIIMIIIIIIIIlllllIllMIllilllllllllim· aacaagatctctccagtataaaggtgaatgttaccaccttgcaagatggg aaaggtacaggtagtgctgactctatagctactttaccaaaggggtttgg M 1111 m111M Im11111Ml I-N Ni11111111! Π111111 taaggtacaggtagtgctgactctataactactttaccaaaggggtttgg aagtgtagaagaactttgtactaactcttcattgggaatggaaaaaagct i ί 1111111111111111111 μ m 11 m m m i m 1111 m i m aagtgtagaagaactttgtactaactcttcattgggaatggaaaaaagct t tgcaac taaaaatgaagc tgtacaaaaagagaeattacaagaggggcct 111 m m 1111111 η n 1111 μ 111111 i 11 m 1111111 m 11 ttgcaactaaaaatgaagctgtacaaaaagagacattacaagaggggcct aagcaag aggc actgca agaggatc etctggaaagtt 11 aa 11 atgtac t iiiiMíiiiimmiiiMiiiiiiiiiimiiiiMimiiii aagcaggaggcactgcaagaggatcctctggaaagttt taattatgtact t agcaaa tc aaccaaag ct ga t at tgggcc aaatt tagatcaactaaagg 50 2000 100 2050 ISO 2100 200 2150 250 2200 300 2250 350 2300 400 2350 450 2400 500 2450 550 2500 500 2550 650 2600 700 2650 750 2700 SOO 2750 850 161 850 161 v.10 801 v.l 2751 v. 10 851 v.l 2801 v. 10 901 v.l 2B51 V.10 951 v.l 2901 V.10 1001 V.l 2951 v.10 1051 v.l 3001 v.10 1101 v.l 3051 v.10 1151 v.l 3101 v, 10 1201 v.l 3151 V.10 1251 v.l 3201 v.10 1301 v.l 3251 V.10 1351 v.l 3301 v.10 1401 v. 1 3351 v.10 1451 V. 1 3401 V.10 1501 V.l 3451 V. 10 1551 iiiiimmmiimiiiiiiiiiiiimiiimiiimiiii tagcaaatcaaccaaagctgatattgggccaaatttagatcaactaaagg atgatgagattttacgteattgcaatccttggcccattatttccataaca
i 11111111111! 111111111III111111111 m 1111 M1111 tM atgatgagattttacgtcattgcaatccttggcccattatttccataaca a a tg aaag t c aaaatgc agaat c aaatg tat ccatt at tgaaatage tga 11 M111! 1111Π llt n 1111! 111111 i 11 M 11Π Hl 1111 i 111 aatgaaagtcaaaatgcagaatcaaatgtatccattattgaaatagctga tgacctttcegcatcccatagtgcactgcaggatgctcaagcaagtgagg llllll j 111!! i111111111111111k111ltl11ill1! 11111111 tgacctttcagcatcccatagtgcactgcaggatgctcaagcaagtgagg ccaagttggaagaggaaccttcagcatcttcaccacagtatgcatgtgat 1111111111 Hl I i 11111111111111111 i 11! 11111 ltl 111111 ccaagttggaagaggaaccttcagcatcttcaccacagtatgcatgtgat ttcaatcttttct tggaagactcagcagacaacagacaaaatttttccag lllllll I llllimil I1IMII IIIIIlillllllllMIMIIill ttcaatcttttcttggaagactcagcagacaacagacaaaatttttccag tcagtctttagagca tgt tgaga a agaaaatagettgtgtggctetgcae 11111111111 ti i m 11111 m e 1111111 m i i 11111111 m i tcagtctttagagcatgttgagaaagaaaatagcttgtgtggctctgcac ctaattccagagcagggtttgtgcatagcaaaacatgtctcagttgggag m i M 11 M 11 i 1111111111 m 11111111111111111111111 ctaaítccaaagcagggtttgtgcatagcaaaacatgtctcagttgggag ttttctgagaaagacgatgaaccagaagaagtagtagttaaagcaaaaat lllllll I IIIIMimiimil lllllllllllllllllllllllll ttttctgagaaagacgatgaaccagaagaagtagtagttaaagcaaaaat cagaagtaaagct agaagga t tgt 11cagatggcgaagatgaagatgatt lllllll IIIIII llll imillllllllllllllllllllllllllll cagaagtaaagctagaaggattgtttcagatggcgaagatgaagatgatt cttttaaagatacctcaagcabaaatccattcaacacatctctctttcaa llllllllll III llll lllllllllllllllllllllllllllllllll cttttaaagatacctcaagcataaatccattcaacacatctctctttcaa ttctcatctgtgaaacaatttgatgcttcaactcccaaaaatgacatcag 11111111111111.......11111111111111111111111111111 ttctcacctgtgaaacaatttgatgcttcaactcccaaaaatgacatcag tccaccaggaaggttcttttcatctcaaatacccagtagtgtaaataagt llllllllll IIIIIIIMIIIIIIIIIIIIIIIIIIIIimillllll tccaccaggaaggttcttttCàtctcaaatacccagtagtgtâaataagt ctatgaactctagaagatctctggcttctaggaggtctctfcattaatatg
llllllllll llllll MllimillllllllllllllllllllllMI ctatgaactctagaagatctctggcttctaggaggtctcttattaatatg g tt t tagacca cgtgg aggacatggaggaaagacttgacgacagcagtga
llllllllll MIIIIIIIIIIIIIIIIIIIIIIIIIIIIMIIIIIMI gttttagaccacgtggaggacatggaggaaagacttgacgacagcagtga agcaaagggtcctgaagattatccagaagaaggggtggaggaaagcagtg IIMIIIIII llllllllimilllllllimilllllllllllllll agcaaagggtcctgsagattatccagaagaaggggtggaggaaagcagtg 2800 900 2850 950 2900 1000 2950 1050 3000 1100 3050 1150 3100 1200 3150 1250 3200 1300 3250 1350 3300 1400 3350 1450 3400 1500 3450 1550 3500 1600 162 3501 gcgaagcctccaagtatacagaagaggatccttccggagaaacactgtct 11111ΜII11 Μ ΜIII! 11111111111 Μ I j 1II11111111 i í! 11 1601 gcgaagcctccaagtatacagaagaggatccttccggagaaacactgtct 3551 tcagaaaacaagtccagctggttaatgacgtctaagcctagtgctctagc
IIIIII11111IIII Μ Μ II1111IIIII ΙΜΙΙΙΙΙϋ 11 Ml llf II 1651 tcagaaaacaagtccagctggttaatgacgtctaagcctagtgctctagc 3601 tcaagagacctctcttggtgcccctgagcctttgtctggtgaacagttgg
111111111111! 11M 1 i I! I f IJ i IIII11 i 11111111 ΠII11 [ i I 1701 tcaagagacctctcttggtgecectgagcctttgtctggtgaacagttgg 3651 ttggttctccccaggataaggcggcagaggctacaaatgactafcgagact
lllllllllll IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMI 1751 fctggt tc tccccaggat aaggcggcagaggctacaaatgactatgagac t 3701 cttgtaaagcgtggaaaagaactaaaagagtgtggaaaaatccaggaggc II i ..........I.......II11 lll I M III11......11111111 1801 cttgt aaagcgtggaaaagaac taaaagagtgtggaaaaat ccaggaggc 3751 cctaaactgct tagt t aaagcgc t tgacataaaaagtgcagatcctgaag .....1111111111111 M I i 11111 j 111 i 11111111 .......... 1851 cctaaactgcttagttaaagcgct tgacataaaaagtgcagatcctgaag 3801 ttatgctcttgactttaagtttgtataagcaacttaataacaattgagaa llllllllimilllllllllllllllilllllllllllllllllllll 1901 ttatgctct tgactttaagtttgtataagcaacttaataacaattgagaa 3851 tgtaacctgtttattgtattttaaagtgaaactgaatatgagggaatttt ii1111111m[ 11111111111 r 111111 ii m11111 ii 1111111 1951 tgtaacctgtttattgtattttaaagtgaaactgaatatgagggaatttt 3901 tgttcccataattggattctttgggaacatgaagcattcaggcttaaggc iiiiiiiiiiiiiimiiiiiiiiiiiiiiiiiimiiiiiiiiiiii 2001 tgttcccataattggattctttgggaacâtgaagcattcaggcttaaggc 3951 aagaaagatctcaaaaagcaacttctgccctgcaacgccccccactccat
111i111i 111111111111111111111111E11111 i lll lillll iI 2051 aagaaagatctcaaaaagcaacttctgcectgcaacgccccccactccat 4001 agtctggtattctgagcactagcttaatatttcttcacttgaatattctt iiiiiiiiiiiiiiiiiiiiiiiiiiiimiiiiiiiimiiiiiiii 2101 agtctggtattctgagcactagcttaatatttcttcacttgaatattctt 4051 atattttaggcatattctataaatttaactgtgttgtttcttggaaagtt 11ίIII1111111! 111111111!111 i ί111111111Π M11111111 2151 atattttaggcatattctataaatttaactgtgttgtttcttggaaagtt 4101 ttgtaaaattattctggtcattcttaattttactctgaaagtgatcatct llllllimilllllllllllllllllllllllllllllllllllillt 2201 ttgtaaaatt attc tggtcattcttaat tttactctgaaagtgat cat c t 4151 ttgtatataacagttcagataagaaaattaaagttacttttctc 1111 Μ 11111II111II11 Μ I Μ ! 111111111 Μ III < 111 2251 ttgtatataacagttcagataagaaaattaaagttacttttctc 163
Quadro LIV(c). Sequências peptídicas da proteína codificada por 273P4B7 v.10 (SEQ. ID N.a 125) MEKSFATKNE AVQKETLQEG PKQEALQEDP LESFNYVLSK STKADIGPNL DQLKDDEILR 60 HCNPWPIISI TNESQHAESN VSIIEXADDL· SASHSAIiQDA QASEAKLEEE PSASSPQYAC 120 DFNLFLEDSA DNRQHFSSQS LEHVEKENSI» CGSAPHSKAG FVHSKTCLSW EPSEKDDEPE 180 EWVKAKIRS KARRIVSDGE DEDDSPKDTS SINPFHTSLF QFSSVKQFDA STPKHDISPP 240 GRFFSSQIPS SVNKSHHSRR SLASRRSLIN MVLDHVEDME ERLDDSSEAK GPEDYPEEGV 300 EESSGEASKY TEEDPSGETL SSENKSSWLM TSKPSALAQE TSLGAPEPLS GEQLVGSPQD 360 KAAEATNDYE TLVKRGKELK ECGKIQEALN CLVKAIDIKS ADPEVMLLTL SLYKQLNNN 419
Quadro LV(c). Alinhamento da sequência de aminoácidos de 273P4B7 v. 10 (SEQ. ID N.a 126) e 273P4B7 v.l (SEQ. ID N.a 127) v.l 801 v. 10 1 v.l 851 v. 10 20 v.l 901 v. 10 70 v.l 951 v. 10 120 v.l 1001 v.10 170 v.l 1051 v. 10 220 v.l 1101 V.10 270 V.l 1151 v.10 320 v.l 1201 v.10 370 850 19 900 69 950 119 1000 169 1050 219 1100 269 1150 319 1200 369 1250
DGKGTGS ADSIATLPKG FGS VE ELCTNS S LGMEKS FATKNEAVQKETLQE 11 i μ i m ti i m 1111
MEKE PATKSEAVOKETLQE GPKQEALQEDPLE S FNYVL $ KS TKAD1 GPNLDQItKDDEILRHCNP WP 11S
11 lllllllllllli! IIII11111IIIMIΙΙΙ1Π111111III M I
GPKQEALQEDPLESFNYVLSKSTKADIGPNIíDQLKDDEILRHCNPWPIIS ITNES QWAE SNVS11EIADDLS ASHSALQDAQASEAKLEEEPS ASS PQYA 11111111111111 ] 1111111111ί11[111111111111111E11111
X THE SQHAESNVS11EIADDLS ASHS ALQDAQAS EAKLEEEPS ASS PQYA CDFNL FLED SADNRQNFS S QS LEHVEKENSLCGSAPNS RAGFVHS KTCLS ΙΜΙΜΙΙΙΙΙΙΜΙΙΙΙΙΜΙΙΙΙΙΙΙΙΙΙΙΙΙΙΙΜΙΙΙΙΙΙΠΙΙ
CD FHLFLEDSAD WRQN F S S QS LEHVEKENS LCGSAPKSKAGFVHS KTCLS WEFSEKDDEPEEVWKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSL lllilllllimilllllllllllllllllllllllllllllllimi
WEFSEKDDEPEEWVKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSL
FQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLI llllllllllllllllllllllllllllllllllllllllllllllllli
FQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLI
HMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDPSGET
Mlllllllllllillllllilllllllllllllllllllllllilllll
NMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDPSGET L S S ENKS SWLMTSKPS ALAQETS LGAPEPLS GEQLVGS PQDKAAEATND Y II11111111ΙΠ1111111III m 111111111111111111111 Ml LS S ENKS 5 WLMTS KPS ALAQETS LGAPEPLS GEQLVGS PQDKAAEATNDY ΕΤΕνΚΗβΚΕΙιΚΕαβΚΙ0ΕΑ1ιΚαΧ4νΚΑΙιϋΙΚ3ΑϋΡΕνΜ1Ιι'Ιΐι8ΕΥΚ0υϊΝΝ 11111111.......111 .......111 M1111111111111III111
ETLVKRGKELKECGKIQEALNCLVKALDIKSADPEVMLLTLSLYKQLNNN 419 164
Quadro Lll(d). Sequência de nucleotídeos da variante transcrita 273P4B7 v.ll (SEQ. ID N.a 128) ggcacgaggc caccttgcaa gatggtaaag gtacaggtag tgctgactct atagctactt 60 taccaaaggg gtttggaagt gtagaagaac tttgtactaa ctcttcattg ggaatggaas 120 aaagctttgc aactaaaaat gaagctgtac aaaaagagac attacaagag gggcctaagc 180 aagaggcacfc gcaagaggat cctctggaaa gttttaatta tgtacttagc aaatcaacca 240 aagctgatat tgggccaaat tfcagafccaac taaaggatga tgagatttta cgtcattgca 300 atccttggcc cattatttcc ataacaaatg aaagtcaaaa tgcagaatca aatgtatcca 360 ttattgaaat agctgatgac ctttcagcat cccatagtgc actgcaggat- gctcaagcaa 420 gtgaggccaa gttggaagag gaaccttcag catcttcacc acagtatgca tgtgatttca 480 atcttttctt ggaagactca gcagacaaca gacaaaattt ttccagtcag tctttagagc 540 atgttgagaa agaaaatagc ttgtgtggct ctgcacctaa ttccagagca gggtttgtgc 600 atagcaaaac atgtctcagt tgggagtttt ctgagaaaga cgatgaacca gaagaagtag 660 tagttaaagc aaaaatcaga agtaaagcta gaaggattgt ttoagatggc gaagatgaag 720 atgattcttt taaagatacc tcaagcataa atccattcaa cacatctctc tttcaattct 780 catctgtgaa acaatttgat gcttcaactc ccaaaaatga catcagtcca ccaggaaggt 840 tcttttcatc tcaaataccc agtagtgtaa ataagtctat gaactctaga agatctctgg 900 cttctaggag gtctcttatt aatatggttt tagaccacgt ggaggacatg gaggaaagac 960 ttgacgacag cagtgaagca aagggtcctg aagattatcc agaagaaggg gtggaggaaa 1020 gcagtggcga agcctccaag tatacagaag aggatccttc cggagaaaca ctgtcttcag 1080 aaaacaagtc cagctggtta atgacgtcta agectagtgc tctagctcaa gagacctctc 1140 ttggtgcccc tgagcctttg tctggtgaac agttggttgg ttctccccag gataaggcgg 1200 cagaggctac aaatgactat gagactcttg taaagcgtgg aaaagaacta aaagagtgtg 1260 gaaaaatcca ggaggcccta aactgcttag ttaaagcgct tgacataaaa agtgcagatc 1320 ctgaagttat gctcttgact ttaagtttgt ataagcaact taataacaat tgagaatgta 1380 acctgtttat tgtattttaa agtgaaactg aatatgaggg aatttttgtt cccataattg 1440 gattctbtgg gaacatgaag cattcaggcb taaggcaaga aagatctcaa aaagcaactt 1500 ctgccctgca acgcccccca ctccatagtc tggtattctg agcactagct taatafcttct 1560 tcacttgaat attcttatat tttaggcata ttctataaat ttaactgtgt tgtttcttgg 1620 aaagttttgt aaaattattc tggtcattcfc taattttact ctgaaagtga tcatotttgt 1680 atataacagt tcagataaga aaattaaagt tacttttctc 1720 165
Quadro Llll(d). Alinhamento da sequência de nucleotideos de 273P4B7 v. 11 (SEQ. ID N.a 129) e 273P4B7 v.l (SEQ. ID N.s 130) v.l 2451 V.ll 10 v.l 2501 v.ll 27 v.l 2551 v.ll 77 v.l 2601 v.ll 127 v.l 2651 V.ll 177 v.l 2701 v.ll 227 v.l 2751 v.ll 277 v.l 2801 v.ll 327 v.l 2851 v.ll 377 v.l 2901 v.ll 427 v.l 2951 v.ll 477 v.l 3001 v.ll 527 v.l 3051 v.ll 577 2500 26 2550 76 2600 126 2650 176 2700 226 2750 276 2800 326 2850 376 2900 426 2950 476 3000 526 3050 576 3100 lllllllllllllllll ccaccttgcaagatggt aaaggtacaggtagtgctgactctatagctactttaccaaaggggtttgg lllll lllllllMIIMimilMIllIlllllllllItlilllllll aaaggtacaggtagtgctgactctatagctactttaccaaaggggtttgg aagtgtagaagaactttgtactaactcttcattgggaatggaaaaaaget i m i m i 11111!! 1111 m 11111 m 111 m 11111 i 11111! i aagtgtagaagaactttgtactaactcttcattgggaatggaaaaaagct ttgcaactaaaaatgaagctgtacaaaaagagacattacaagaggggcct
llltlll Mlllll!ll>!111lllllII llllll 1111 Μ lllllll II ttgcaactaaaaatgaagctgtacaaaaagagacattacaagaggggect
INI IMIIIII11IIIII MIM aagcaagaggcactgcaagaggatcctctggaaagttttaattatgtact
11U111 f IΜ111 Ml I aagcaagaggc actgc aag aggat c c tc tggaaagt t tt aa 11 a tgtac t tagcaaatcaaccaaagctgatattgggccaaatttagatcaactaaagg 11111 m i m 11111111 m m 111 m ] 1111111 u 11111 m tagcaaatcaaccaaagctgãtattgggccaaatttagatcaactaaagg atgatgagattttacgtcattgcaatccttggcccattatttccataaca IUI111111111 i111111111111111111i 11111111111111111 atgatgagattttacgtcattgcaatccttggcccattatttccataaca aatgaaagtcaaaatgcagaatcaaatgtatccat:tattgaaatagctga
11Μ [ 1111Μ111111111111111 ΜΙ 11111 i II! 111111111! ί I aatgaaagtcaaaatgcagaatcaaatgtatccattattgaaatagctga tgacct t tcagcatcccatag tgcac tgcaggatgc t caagcaagtgagg
llllllillimillllllllllllMllllllllilllllllMIIII tgacctttcagcatcccatagtgcactgcaggatgctcaagcaagtgagg ccaagttggaagaggaaccttcagcatcttcaccacagtatgcatgtgat
IIIMIIIIMIIIIMIIIIMIIIIIMIMIMIIIIMMIMMI ccaagttggaagaggaaccttcagcatcttcaccacagtatgcatgtgat ttcaatcttttcttggaagactcagcagacaacagacaaaatttttccag
IIIIIIIIIIIIIIIIIIIIIIIIMIIIIIIIIIIIIIMIMIMMI ttcaatcttttcttggaagactcagcagacaacagacaaaatttttccag tcagtctttagagcatgttgagaaagaaaatagcttgtgtggctctgcac
MIMIIIIMIIIIMIIM MIMIIIMIMIMMIMIMMIM tcagtctttagagcatgttgagaaagaaaatagcttgtgtggctctgcac ctaattccagagcagggtttgtgcatagcaaaacatgtctcagttgggag
I .......11111111111111 ....... i M 111II1.........III ctaattccagagcagggtttgtgcatagcaaaacatgtctcagttgggag 626 166 3101 tt ttctgagaaagacgatgaaccagaagaagtagtagttaaagcaaaaat E1111111111 i 11 i 11111111111111111111i11! 11111111111 627 ttttctgagaaagacgatgaaccagaagaagtagtagttaaagcaaaaat 3151 cagaagtaaagctagaaggattgtttcagatggcgaagatgaagatgatt 11111111111111II111111 m1111! I i 11 m t!Π 11111111i 677 cagaagtaaagctagaaggattgtttcagatggcgaagatgaagatgatt 3201 cttttaaagatacctcaagcataaatecattcaacacatctctctttcaa
111111111 m Μ1111111Μ11 m 1111111ΜIN m m 111E 727 cttttaaagatacctcaagcataaatccattcaacacatctctctttcaa 3251 ttctcatctgtgaaacaatttgatgcttcaactcccaaaaatgacatcag Iί 1.......1111111111M111111111111111111111!111111 777 ttctcatctgtgaaacaatttgatgcttcaactcccaaaaatgacatcag 3301 tccaecaggaaggttcttttcatctcaaatacccagtagtgtaaataagt 1111E1111111111111 fl! M 111!!!111!111111111111111! 1 827 tccaccaggaaggttcttttcatctcaaatacccagtagtgtaaataagt 3351 ctatgaactctagaagatctctggcfctctaggaggtctcttattaatatg
lllll llil INI I1EII1111 tlimiimitllllllll I m EM 877 ctatgaactctagaagatctctggcttctaggaggtctcttattaatatg 3401 gttttagaccacgtggaggacatggaggaaagacttgacgacagcagtga 11 M111111111111 m 11111111111111111111111111 i mi i 927 g1111agaccacgtggaggacatggaggaaagacttgacgacagcagtga 3451 agcaaagggtcctgaagattatccagaagaaggggtggaggaaagcagtg IIIIIlllllllÍlIlllimiillllllllllllllllllllllllll 97 7 agcaaagggtcctgaagattatccagaagaaggggtggaggaaageagtg 3501 gcgaagcctccaagtatacagaagaggatccttccggagaaacactgtct IIIMIllllllllllllllllllllMIlllllllllllMllllllll 1027 gcgaagcctccaagtatacagaagaggatectcccggagaaacactgtct 3551 teagaaaaeaagtceagctggttaatgaegtCtaagcctagtgctctagc IIMimilllllilllllllllllllIllllMIliilllllllllll 1077 tcagaaaacaagtccagctggttaatgacgtcfcaagcctagtgctctagc 3601 tcaagagacctctcttggtgcccctgagcctttgtctggtgaacagttgg IIMIllll llll llllllllll III11111111 llllllllllllllll 1127 tcaagagacctctcttggtgcccctgagcctt tgtctggtgaacagttgg 3651 ttggttctccccaggataaggcggcagaggctacaaatgactatgagact miiiiiiiiiiiiiiiiitiMiiiimiÍiiiimiiiiiimi 1177 t tggttctccccaggataaggcggcagaggctacaaatgactatgagact 3701 cttgtaaagcgtggaaaagaactaaaagagtgtggaaaaatceaggaggc lllllllllllllllllillllllllllillillllllllllllllim 1227 cttgtaaagcgtggaaaagaactaaaagagtgtggaaaaatccaggaggc 3751 cctaaactgcttagttaaagcgc ttgacataaaaagtgcagatcctgaag 1111111 m 11M i 11111111111 i 1111M 11M m! M EI i 1111 1277 cctaaactgcttagttaaagcgcttgacataaaaagtgcagatcctgaag 3801 t tatgctcttgactttaagtttgtataagcaacttaataacaattgagaa llllilllllilllllillllllllllllllllllllllllllimill 1327 ttatgctcttgactttaagtttgtataagcaacttaataacaattgagaa 3851 tgtaacctgtttattgtattttaaagtgaaactgaatatgagggaatttt 111Μ Μ1111111Μ111111111111ΜIII1111iΜ! 111111111 1426 167 1426 167 v.ll 1377 v.l 3901 v.ll 1427 v.l 3951 V.ll 1477 v.l 4001 v.ll 1527 v.l 4051 v.ll 1577 v.l 4101 v.ll 1627 v.l 4151 v.ll 1677 3950 1476 4000 1526 4050 1576 4100 1626 4150 1676 v.ll 1377 tgtaacctgtttattgtattttaaagtgaaactgaatatgagggaatttt tgt tccca t aattggattctttgggaacatgaagcattcaggcttaaggc
11111111) 11111111II MUI 11) 111111II11111111 i 1111II i 111 m 111 m 11 m m 111 m 111111 m 111
II tgttcccataattggattctttgggaacatgaagcattcaggcttaaggc aagaaagatctcaaaaagcaacttctgccctgcaacgccccccactccat aagaaagatctcaaaaagcaacttctgccctgcaacgccccccactccat agtc tggt at tctgagcactagctt aatatt tcttcac ttgaatattctt
111 Ml 11II111111............ 11111 m II1111 m 1 m I agtctggtattctgagcactagcttaatatttcttcacttgaatattctt atattttaggcatattctataaatttaactgtgttgtttcttggaaagtt llllllllllllllllllllllllllllllllllllllllllllllllll atattttaggcatattctataaatttaactgtgttgtttcttggaaagtt ttgtaaaattattctggtcattcttaattttactctgaaagtgatcatct lllllllllimillllllllllllllllllillillllllllllllll ttgtaaaattattctggtcattcttaattttactctgaaagtgatcatct ttgtatataacagttcagataagaaaattaaagttacttttctc 4194 lllllllllllllllllllllllllllllllllllillllllll ttgtatataacagttcagataagaaaattaaagttacttttctc 1720
Quadro LIV(d). Sequências peptidicas da proteína codificada por 273P4B7 v.ll (SEQ. ID N.s 131) DQLKDDEILR 60 PSASSPQYAC 120 EFSEKDDEPE 180 STPKMDISPP 240 GPEDYPEEGV 300 GEQLVGSPQD 360 SLYKQLNNN 419
MBKSFATKNE AVQKETLQEG PKQBALQEDP LESFNYVLSK STKADIGPNL HCNPWPIISI TNESQNAESH VSIIEIADDL SASHSALQDA QASEAKLEEE DFKLFLEDSA DNRQNFSSQS LEHVEKEWSXj CGSAPKSRAG FVHSKTCLSW EVWKAKIRS KARRIVSDGE DEDDSFKDTS SINPFNTSLF QFSSVKQFDA GRFFSSQXPS SVNKSMHSRR SLASRRSLXN MVLDHVEDME ERLDDSSEAK BESSGBASKY TEEDPSGETL SSENKSSWLM TSKPSALAQE TSLGAPEPLS KAAEATNDYE TLVKRGKELK ECGKIQEALN CLVKALDIKS ADPEVMLLTL 168 Quadro LV(d). Alinhamento da sequência de aminoácidos de 273P4B7 v 133) v.l 801 v. 11 1 v. 1 851 v.ll 20 v.l 901 v.ll 70 v.l 951 v.ll 120 V.l 1001 v.ll 170 v.l 1051 v.ll 220 v.l 1101 V.ll 270 v.l 1151 v.ll 320 v.l 1201 v.ll 370
lliltllllllllllilll MEKSFATKNEAVQKETLQE GPKQEALQEDPLES FNYVL S KSTKADIGPNLDQLKDDETLRHCNPWP11Si 1111111111111! 1111!111! i I!! Μ 11! 11[111111!ΠΙ11Π GPKQEALQED PLES FNYVLSKSTKADIGPNLDQLKDDBILRHCNPWPI IS ITNE S QNAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASS PQYA1111111111111 i 11111111111111! 1111111111111 i I! 11111 ITNESQNAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYA Θ50 19 900 69 950 119 CD FNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPNSRAGFVHSICTCLS 1000
111111111II m!111M111111!1111111M11i111111111 CDFNLFIiEDSADNRQHFSSQSLEHVEKENSLCGSAPNSRAGFVHSKTCLS 169 WEFSEKDDEPEEWVKAKIRSKAKRIVSDGEDEDDSFKDTSSINPFNTSL 1050 ΜΐιιιιιιιιιιιιιιιιιιιιιιιιιιιιιιιιιιΐΜΐιιιιιιιιι WEFSEKDDEPEEVWKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSIj 219 FQFSSVKQFDASTPKNDISPPGRFPSSQIPSSVNKSMNSRRSLASRRSLI 1100 llliniMMMIIilllllllllllllllllllllllllillllllll FQFSSVKQFEASTPKNDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLI 269 NMVLDHVEDMEERLDDS SE AKG PEDYPEEGVEESSGEASKYTE EDPSGET 1150 11111111IEI11111m I! ItlIi11111111111! 111II111111 i NMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDPSGET 319 LSSEMKSSWLMTSKPSAIAQETSLGAPEPLSGEQLVGSPQDKAAEATNDY 12 00 iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiimmiiiii LS SENKS SWLMTS KP S ALAQETS LGAPEPLSGEQLVGSPQDKAAEATNDY 369 ΕΤί^νΚΕσΚΕΕΚΕ CGKIQEALNCLVKALDIKSADPEVMLLTLS LYKQLNNN 1250 llllllllilllllllllllllltllllllllllllllllllllllllll ETLV KRGKEIjKECGKI QEALNCLVKALDIKSADPEVMLLTLS IíYKQLNNN 419 169
Quadro LVI: SNP e alterações de codão em 273P4B7 v.l e v.2. *AA: aminoácido; **-: deleção da base correspondente. SNP SNP em v.1 SNP em v.2 SN P N. 0 Alelo s varian te SNP Posiça o Alteraç ão AA* Posiça O AA Posiça o Alteraç ão AA Posiça O AA 1 a/1 v. 3 571 159 711 36 2 a/g v. 4 608 R/G 172 748 R/G 49 3 a/g v. 5 1185 K/R 364 1325 K/R 241 4 a/g v. 6 2759 I/V 889 2899 I/V 766 5 t/c v. 7 3658 1188 3798 1065 6 a/g v. 8 3850 3990 170 LISTA DE SEQUÊNCIAS <110> Agensys, Inc.
<120> ÁCIDOS NUCLEICOS E PROTEÍNAS CORRESPONDENTES DESIGNADAS 273P4B7 ÚTEIS NO TRATAMENTO E DETEÇÃO DE CANCRO
<130> N.93904 SER <140> EP 03788558.9 <141> 2003-08-15 <150> PCT/US2003/025665 <151> 2003-08-15
<150> US 60/404,306 <151> 2002-08-16 <150> US 60/423,290 <151> 2002-11-01 <160> 134 <1 7 0> FastSEQ para Windows <210> 1 <211> 170 <212> ADN <213> Homo sapiens <220> <221> misc_feature <222> 151, 161 <223> n = A, T, C ou G 171 <4 Ο 0> 1 gatcctgaag ttatgctctt gactttaagt ttgtataagc aacttaataa caattgagaa 60 tgtaacctgt ttactgtatt ttaaagtgaa actgaatatg agggaatttt tgttcccata 120 attggattct ttgggaacat gaagcattta ngcttaaggc nagaaagatc 170 <210> 2 <211> 4194
<212> ADN <213> Homo sapiens <400> 2 aaattcaagc tccaaactct aagctccaag ctccaagctc caagctccaa gctccaaact 60 cccgccgggg taactggaac ccaatccgag ggtcatggag gcatcccgaa ggtttccgga 120 agccgaggcc ttgagcccag agcaggctgc tcattaccta agatatgtga aagaggccaa 180 agaagcaact aagaatggag acctggaaga agcatttaaa cttttcaatt tggcaaagga 240 catttttccc aatgaaaaag tgctgagcag aatccaaaaa atacaggaag ccttggagga 300 gttggcagaa cagggagatg atgaatttac agatgtgtgc aactctggct tgctacttta 360 tcgagaactg cacaaccaac tctttgagca ccagaaggaa ggcatagctt tcctctatag 420 cctgtatagg gatggaagaa aaggtggtat attggctgat gatatgggat tagggaagac 480 tgttcaaatc attgctttcc tttccggtat gtttgatgca tcacttgtga atcatgtgct 540 gctgatcatg ccaaccaatc ttattaacac atgggtaaaa gaattcatca agtggactcc 600 aggaatgaga gtcaaaacct ttcatggtcc tagcaaggat gaacggacca gaaacctcaa 660 tcggattcag caaaggaatg gtgttattat cactacatac caaatgttaa tcaataactg 720 gcagcaactt tcaagcttta ggggccaaga gtttgtgtgg gactatgtca tcctcgatga 780 agcacataaa ataaaaacct catctactaa gtcagcaata tgtgctcgtg ctattcctgc 840 172 aagtaatcgc ctcctcctca caggaacccc cctatttgat tttgcttgtc aagggtccct gtatgaaaat cctattacta gagcaagaga gggatttaaa atatctgaaa acttaatggc taaagaagac gtacagaaga aaaagtcaag tccagatgtt gatgccattt gtgaaatgcc ttggatacga cttgtgcctt tacaagaaga tatcaaggag ttgctaatgg agacgcgctc gctgtgtgat catcctaggc tgctgtctgc attctctgct caagatggaa atgaggggga agtaactgat gacacattga tggaagaatc taagaggctg cgagatgagg gacatcaaac aaacatcatt gaacgectct taaagaatag agttactcat cttttggaac gagaaaaaag ctctgttttt ctgcttacca ctcaagtagg tagagtggtc atttttgacc ctagctggaa agtttaccga attggacaaa aagagaatgt tgtagaggaa aaaatataca gaagacaggt tggtgaaaaa aagaaccctt tcegatattt aatcgaggat cttcagaact ctgtaaccca gaggaaatct gatataaaac tagatgaaca tggaatctca gaccatgatt tgatgtacac tgtggtagaa gaatctcact atattcaaca attcgagtct caaaataaag agttcctgat ctggctaaga gaacctgtat ttccttcttc accacagcct cagccttcac ctcttctaag ttccaaaatg gcaagtgtag tcattgatga ctccagtata aaggtgaatg ttaccacctt ctctatagct actttaccaa aggggtttgg attgggaatg gaaaaaagct ttgcaactaa agaggggcct aagcaagagg cactgcaaga tagcaaatca accaaagctg atattgggcc tttacgtcat tgcaatcctt ggcccattat atcaaatgta tccattattg aaatagctga ggatgctcaa gcaagtgagg ccaagttgga tgcatgtgat ttcaatcttt tcttggaaga tcagtcttta gagcatgttg agaaagaaaa agcagggttt gtgcatagca aaacatgtct accagaagaa gtagtagtta aagcaaaaat tggcgaagat gaagatgatt cttttaaaga tctctttcaa ttctcatctg tgaaacaatt tccaccagga aggttctttt catctcaaat tagaagatct ctggcttcta ggaggtctct catggaggaa agacttgacg acagcagtga aggggtggag gaaagcagtg gcgaagcctc aacactgtct tcagaaaaca agtccagctg tcaagagacc tctcttggtg cccctgagcc ccaggataag gcggcagagg ctacaaatga actaaaagag tgtggaaaaa tccaggaggc aaaaagtgca gatcctgaag ttatgctctt caattgagaa tgtaacctgt ttattgtatt tgttcccata attggattct ttgggaacat tcaaaaagca acttctgccc tgcaacgccc agcttaatat ttcttcactt gaatattctt gtgttgtttc ttggaaagtt ttgtaaaatt gtgatcatct ttgtatataa cagttcagat <210> 3 <211> 1250 aatccagaat aatttacaag aactatggtc 900 gctgggaaca ttaaaaactt ttaagatgga 960 gaaggatgct accccaggag aaaaagcctt 1020 aatcataaaa ccctattttc tcaggaggac 1080 caacccagag gccagactta atgaaaagaa 1140 ttccctttcc aggaaaaatg atttaattat 1200 aatatacagg aaatttgtgt ctttagatca 1260 acctttggct gagctaggtg tcttaaagaa 1320 acgggcttgt tgtttgctaa atcttgggac 1380 agattcccca gatgtggacc atattgatca 1440 tggaaaaatg atattcctaa tggacctact 1500 tctggtgttt tctcaatcga ggcaaattct 1560 gcactttaag acattgcgaa tcgatgggac 1620 aattaactta ttccagcaaa ataaagatta 1680 tggtgtcggt ttaacattaa ctgcagcaac 1740 tcctgcaact gatgctcaag ctgtggatag 1800 tgtggtttat aggctaatca cttgtgggac 1860 tttcaaggac tcattaataa gacaaactac 1920 tagtaaacaa gaattaagag agctctttae 1980 gctgcagctt cagtctttgc atgctgctca 2040 tattgcctac ctgcagtctt tggggatagc 2100 atgtgatctg tctgttaaag aagagcttga 2160 aagggttcag aaagctcaat tcctcgttga 2220 ggaacaacaa agaactagaa atgagggggc 2280 aacaaagaag aaatgcccta aattgaataa 2340 tactcatcat actcaggaag aagatatcag 2400 tctgcccaaa gagggtgaga aacaagatct 2460 gcaagatggt aaaggtacag gtagtgctga 2520 aagtgtagaa gaactttgta ctaactcttc 2580 aaatgaagct gtacaaaaag agacattaca 2640 ggatcctctg gaaagtttta attatgtact 2700 aaatttagat caactaaagg atgatgagat 2760 ttccataaca aatgaaagtc aaaatgcaga 2820 tgacctttca gcatcccata gtgcactgca 2880 agaggaacct tcagcatctt caccacagta 2940 ctcagcagac aacagacaaa atttttccag 3000 tagcttgtgt ggctctgcac ctaattccag 3060 cagttgggag ttttctgaga aagacgatga 3120 cagaagtaaa gctagaagga ttgtttcaga 3180 tacctcaagc ataaatccat tcaacacatc 3240 tgatgcttca actcccaaaa atgacatcag 3300 acccagtagt gtaaataagt ctatgaactc 3360 tattaatatg gttttagacc acgtggagga 3420 agcaaagggt cctgaagatt atccagaaga 3480 caagtataca gaagaggatc cttccggaga 3540 gttaatgacg tctaagccta gtgctctagc 3600 tttgtctggt gaacagttgg ttggttctcc 3660 ctatgagact cttgtaaagc gtggaaaaga 3720 cctaaactgc ttagttaaag cgcttgacat 3780 gactttaagt ttgtataagc aacttaataa 3840 ttaaagtgaa actgaatatg agggaatttt 3900 gaagcattca ggcttaaggc aagaaagatc 3960 cccactccat agtctggtat tctgagcact 4020 atattttagg catattctat aaatttaact 4080 attctggtca ttcttaattt tactctgaaa 4140 aagaaaatta aagttacttt tctc 4194 173
<212> PRT <213> Homo sapiens <400> 3 174
Met Glu Ala Ser Arg Arg Phe Pro Glu Ala Glu Ala Leu Ser Pro Glu 1 5 10 15 Gin Ala Ala His Tyr Leu Arg Tyr Vai Lys Glu Ala Lys Glu Ala Thr 20 25 30 Lys Asn Gly Asp Leu Glu Glu Ala Phe Lys Leu Phe Asn Leu Ala Lys 35 40 45 Asp Ile Phe Pro Asn Glu Lys Vai Leu Ser Arg Ile Gin Lys Ile Gin 50 55 60 Glu Ala Leu Glu Glu Leu Ala Glu Gin Gly Asp Asp Glu Phe Thr Asp 65 70 75 80 Vai Cys Asn Ser Gly Leu Leu Leu Tyr Arg Glu Leu His Asn Gin Leu 85 90 95 Phe Glu His Gin Lys Glu Gly Ile Ala Phe Leu Tyr Ser Leu Tyr Arg 100 105 110 Asp Gly Arg Lys Gly Gly Ile Leu Ala Asp Asp Met Gly Leu Gly Lys 115 120 125 Thr Vai Gin Ile Ile Ala Phe Leu Ser Gly Met Phe Asp Ala Ser Leu 130 135 140 Vai Asn His Vai Leu Leu Ile Met Pro Thr Asn Leu Ile Asn Thr Trp 145 150 155 160 Vai Lys Glu Phe Ile Lys Trp Thr Pro Gly Met Arg Vai Lys Thr Phe 165 170 175 His Gly Pro Ser Lys Asp Glu Arg Thr Arg Asn Leu Asn Arg Ile Gin 180 185 190 Gin Arg Asn Gly Vai Ile Ile Thr Thr Tyr Gin Met Leu Ile Asn Asn 195 200 205 Trp Gin Gin Leu Ser Ser Phe Arg Gly Gin Glu Phe Vai Trp Asp Tyr 210 215 220 Vai Ile Leu Asp Glu Ala His Lys Ile Lys Thr Ser Ser Thr Lys Ser 225 230 235 240 Ala Ile Cys Ala Arg Ala Ile Pro Ala Ser Asn Arg Leu Leu Leu Thr 245 250 255 Gly thr Pro Ile Gin Asn Asn Leu Gin Glu Leu Trp Ser Leu Phe Asp 260 265 270 Phe Ala Cys Gin Gly Ser Leu Leu Gly Thr Leu Lys Thr Phe Lys Met 275 280 285 Glu Tyr Glu Asn Pro Ile Thr Arg Ala Arg Glu Lys Asp Ala Thr Pro 290 295 300 Gly Glu Lys Ala Leu Gly Phe Lys Ile Ser Glu Asn Leu Met Ala Ile 305 310 315 320 Ile Lys Pro Tyr Phe Leu Arg Arg Thr Lys Glu Asp Vai Gin Lys Lys 325 330 335 Lys Ser Ser Asn Pro Glu Ala Arg Leu Asn Glu Lys Asn Pro Asp Vai 340 345 350 Asp Ala ile Cys Glu Met Pro Ser Leu Ser Arg Lys Asn Asp Leu Ile 355 360 365 Ile Trp Ile Arg Leu Vai Pro Leu Gin Glu Glu Ile Tyr Arg Lys Phe 370 375 380 Vai Ser Leu Asp His Ile Lys Glu Leu Leu Met Glu Thr Arg Ser Pro 385 390 395 400 Leu Ala Glu Leu Gly Vai Leu Lys Lys Leu Cys Asp His Pro Arg Leu 405 410 415 Leu Ser Ala Arg Ala Cys Cys Leu Leu Asn Leu Gly Thr Phe Ser Ala 420 425 430 Gin Asp Gly Asn Glu Gly Glu Asp Ser Pro Asp Vai Asp His Ile Asp 435 440 445 Gin Vai Thr Asp Asp Thr Leu Met Glu Glu Ser Gly Lys Met Ile Phe 450 455 460 Leu Met Asp Leu Leu Lys Arg Leu Arg ASp Glu Gly His Gin Thr Leu 175 465 470 475 480 Vai Phe Ser Gin Ser Arg Gin Ile Leu Asn Ile Ile Glu Arg Leu Leu 485 490 495 Lys Asn Arg His Phe Lys Thr Leu Arg Ile Asp Gly Thr Val Thr His 500 505 510 Leu Leu Glu Arg Glu Lys Arg Ile Asn Leu Phe Gin Gin Asn Lys Asp 515 520 525 Tyr Ser Val Phe Leu Leu Thr Thr Gin Val Gly Gly Val Gly Leu Thr 530 535 540 Leu Thr Ala Ala Thr Arg Val Val Ile Phe Asp Pro Ser Trp Asn Pro 545 550 555 560 Ala Thr Asp Ala Gin Ala Val Asp Arg Val Tyr Arg Ile Gly Gin Lys 565 570 575 Glu Asn Val Val Val Tyr Arg Leu Ile Thr Cys Gly Thr Val Glu Glu 580 585 590 Lys Ile Tyr Arg Arg Gin Val Phe Lys Asp Ser Leu Ile Arg Gin Thr 595 600 605 Thr Gly Glu Lys Lys Asn Pro Phe Arg Tyr Phe Ser Lys Gin Glu Leu 610 615 620 Arg Glu Leu Phe Thr Ile Glu Asp Leu Gin Asn Ser Val Thr Gin Leu 625 630 635 640 Gin Leu Gin Ser Leu His Ala Ala Gin Arg Lys Ser Asp Ile Lys Leu 645 650 655 Asp Glu His Ile Ala Tyr Leu Gin Ser Leu Gly Ile Ala Gly Ile Ser 660 665 670 Asp His Asp Leu Met Tyr Thr Cys Asp Leu Ser Val Lys Glu Glu Leu 675 680 685 Asp val Val Glu Glu Ser His Tyr Ile Gin Gin Arg Val Gin Lys Ala 690 695 700 Gin nL« c jic Leu Val Glu Phe Glu Ser Gin Asn Lys Glu Phe Leu Met ΓΊ .. yiu 705 710 715 720 Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu Arg Glu Pro Val Phe 725 730 735 Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu Asn Lys Pro Gin Pro 740 745 750 Gin Pro Ser Pro Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile 755 760 765 Ser Ser Lys Met Ala Ser Val Val Ile Asp Asp Leu Pro Lys Glu Gly 770 775 780 Glu Lys Gin Asp Leu Ser Ser Ile Lys Val Asn Val Thr Thr Leu Gin 785 790 795 800 Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys 805 810 815 Gly Phe Gly Ser Val Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 820 825 830 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Val Gin Lys Glu Thr Leu 835 840 845 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 850 855 860 Phe Asn Tyr Val Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn 865 870 875 880 Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro Trp 885 890 895 Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Val 900 905 910 Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 915 920 925 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 930 935 940 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 176 945 950 955 960 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai Glu 965 970 975 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 980 985 990 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 995 1000 1005 Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys ile Arg Ser Lys Ala Arg 1010 1015 1020 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 1025 1030 1035 1040 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Vai 1045 1050 1055 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 1060 1065 1070 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met Asn 1075 1080 1085 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai Leu 1090 1095 1100 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 1105 1110 1115 1120 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser Gly 1125 1130 1135 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 1140 1145 1150 Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1155 1160 1165 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1170 1175 1180 Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1185 1190 1195 1200 Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1205 1210 1215 Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser Ala 1220 1225 1230 Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1235 1240 1245
Asn Asn 1250
<210> 4 <211> 4334 <212> ADN <213> Homo sapiens <400> 4 177 atgcgcgggg cgggagtgag cgaaattcaa tccaagctcc aagctccaaa ctcccgccgg aggcatcccg aaggtttccg gaagccgagg taagggtctt gctgtgtcgc ccagactgga cctcgaactc ctgggctcaa gcagtcctcc agatatgtga aagaggccaa agaagcaact cttttcaatt tggcaaagga catttttccc atacaggaag ccttggagga gttggcagaa aactctggct tgctacttta tcgagaactg ggcatagctt tcctctatag cctgtatagg gatatgggat tagggaagac tgttcaaatc tcacttgtga atcatgtgct gctgatcatg gaattcatca agtggactcc aggaatgaga gctccaaact ctaagctcca agctccaagc 60 ggtaactgga acccaatccg agggtcatgg 120 ccttgagccc agagcaggct gctcattacc 180 attcagtggc ctgatcatag ttcactgcag 240 tgccccagcc tccctagtag ctgggactta 300 aagaatggag acctggaaga agcatttaaa 360 aatgaaaaag tgctgagcag aatccaaaaa 420 cagggagatg atgaatttac agatgtgtgc 480 cacaaccaac tctttgagca ccagaaggaa 540 gatggaagaa aaggtggtat attggctgat 600 attgctttcc tttccggtat gtttgatgca 660 ccaaccaatc ttattaacac atgggtaaaa 720 gtcaaaacct ttcatggtcc tagcaaggat 780 178 gaacggacca caaatgttaa gactatgtca tgtgctcgtg aatttacaag ttaaaaactt accccaggag ccctattttc gccagactta aggaaaaatg aaatttgtgt gagctaggtg tgtttgctaa gatgtggacc atattcctaa tctcaatcga acattgcgaa ttccagcaaa ttaacattaa gatgctcaag aggctaatca tcattaataa gaattaagag cagtctttgc ctgcagtctt tctgttaaag aaagctcaat agaactagaa aaatgcccta actcaggaag gagggtgaga aaaggtacag gaactttgta gtacaaaaag gaaagtttta caactaaagg aatgaaagtc gcatcccata tcagcatctt aacagacaaa ggctctgcac ttttctgaga gctagaagga ataaatccat actcccaaaa gtaaataagt gttttagacc cctgaagatt gaagaggatc tctaagccta gaacagttgg cttgtaaagc ttagttaaag ttgtataagc actgaatatg ggcttaaggc agtctggtat catattctat ttcttaattt aagttacttt gaaacctcaa tcaataactg tcctcgatga ctattcctgc aactatggtc ttaagatgga aaaaagcctt tcaggaggac atgaaaagaa atttaattat ctttagatca tcttaaagaa atcttgggac atattgatca tggacctact ggcaaattct tcgatgggac ataaagatta ctgcagcaac ctgtggatag cttgtgggac gacaaactac agctctttac atgctgctca tggggatagc aagagcttga tcctcgttga atgagggggc aattgaataa aagatatcag aacaagatct gtagtgctga ctaactcttc agacattaca attatgtact atgatgagat aaaatgcaga gtgcactgca caccacagta atttttccag ctaattccag aagacgatga ttgtttcaga tcaacacatc atgacatcag ctatgaactc acgtggagga atccagaaga cttccggaga gtgctctagc ttggttctcc gtggaaaaga cgcttgacat aacttaataa agggaatttt aagaaagatc tctgagcact aaatttaact tactctgaaa tctc tcggattcag gcagcaactt agcacataaa aagtaatcgc cctatttgat gtatgaaaat gggatttaaa taaagaagac tccagatgtt ttggatacga tatcaaggag gctgtgtgat attctctgct agtaactgat taagaggctg aaacatcatt agttactcat ctctgttttt tagagtggtc agtttaccga tgtagaggaa tggtgaaaaa aatcgaggat gaggaaatct tggaatctca tgtggtagaa attcgagtct ctggctaaga accacagcct ttccaaaatg ctccagtata ctctatagct attgggaatg agaggggcct tagcaaatca tttacgtcat atcaaatgta ggatgctcaa tgcatgtgat tcagtcttta agcagggttt accagaagaa tggcgaagat tctctttcaa tccaccagga tagaagatct catggaggaa aggggtggag aacactgtct tcaagagacc ccaggataag actaaaagag aaaaagtgca caattgagaa tgttcccata tcaaaaagca agcttaatat gtgttgtttc gtgatcatct caaaggaatg tcaagcttta ataaaaacct ctcctcctca tttgcttgtc cctattacta atatctgaaa gtacagaaga gatgccattt cttgtgcctt ttgctaatgg catcctaggc caagatggaa gacacattga cgagatgagg gaacgcctct cttttggaac ctgcttacca atttttgacc attggacaaa aaaatataca aagaaccctt cttcagaact gatataaaac gaccatgatt gaatctcact caaaataaag gaacctgtat cagccttcac gcaagtgtaa aaggtgaatg actttaccaa gaaaaaagct aagcaagagg accaaagctg tgcaatcctt tccattattg gcaagtgagg ttcaatcttt gagcatgttg gtgcatagca gtagtagtta gaagatgatt ttctcatctg aggttctttt ctggcttcta agacttgacg gaaagcagtg tcagaaaaca tctcttggtg gcggcagagg tgtggaaaaa gatcctgaag tgtaacctgt attggattct aettctgcce ttcttcactt ttggaaagtt ttgtatataa gtgttattat ggggccaaga catctactaa caggaacccc aagggtccct gagcaagaga acttaatggc aaaagtcaag gtgaaatgcc tacaagaaga agacgcgctc tgctgtctgc atgaggggga tggaagaatc gacatcaaac taaagaatag gagaaaaaag ctcaagtagg ctagctggaa aagagaatgt gaagacaggt tccgatattt ctgtaaccca tagatgaaca tgatgtacac atattcaaca agttcctgat ttccttcttc ctcttctaag tcattaataa ttaccacctt aggggtttgg ttgcaactaa cactgcaaga atattgggcc ggcccattat aaatagctga ccaagttgga tcttggaaga agaaagaaaa aaacatgtct aagcaaaaat cttttaaaga tgaaacaatt catctcaaat ggaggtctct acagcagtga gcgaagcctc agtccagctg cccctgagcc ctacaaatga tccaggaggc ttatgctctt ttattgtatt ttgggaacat tgcaacgccc gaatattctt ttgtaaaatt cagttcagat cactacatac 840 gtttgtgtgg 900 gtcagcaata 960 aatccagaat 1020 gctgggaaca 1080 gaaggatgct 1140 aatcataaaa 1200 caacccagag 1260 ttccctttcc 1320 aatatacagg 1380 acctttggct 1440 acgggcttgt 1500 agattcccca 1560 tggaaaaatg 1620 tctggtgttt 1680 gcactttaag 1740 aattaactta 1800 tggtgtcggt 1860 tcctgcaact 1920 tgtggtttat 1980 tttcaaggac 2040 tagtaaacaa 2100 gctgcagctt 2160 tattgcctac 2220 atgtgatctg 2280 aagggttcag 2340 ggaacaacaa 2400 aacaaagaag 2460 tactcatcat 2520 tctgcccaaa 2580 gcaagatggt 2640 aagtgtagaa 2700 aaatgaagct 2760 ggatcctctg 2820 aaatttagat 2880 ttccataaca 2940 tgacctttca 3000 agaggaacct 3060 ctcagcagac 3120 tagcttgtgt 3180 cagttgggag 3240 cagaagtaaa 3300 tacctcaagc 3360 tgatgcttca 3420 acccagtagt 3480 tattaatatg 3540 agcaaagggt 3600 caagtataca 3660 gttaatgacg 3720 tttgtctggt 3780 ctatgagact 3840 cctaaactgc 3900 gactttaagt 3960 ttaaagtgaa 4020 gaagcattca 4080 cccactccat 4140 atattttagg 4200 attctggtca 4260 aagaaaatta 4320 4334 179
<210> 5 <211> 1127 <212> PRT <213> Homo sapiens <400> 5 Met Gly Leu Gly Lys Thr Val Gin Ile Ile Ala Phe Leu Ser Gly Met 1 5 10 15 Phe Asp Ala Ser Leu Val Asn His Val Leu Leu Ile Met Pro Thr Asn 20 25 30 Leu ile Asn Thr Trp Val Lys Glu Phe Ile Lys Trp Thr Pro Gly Met 35 40 45 Arg Val Lys Thr Phe His Gly Pro Ser Lys Asp Glu Arg Thr Arg Asn 50 55 60 Leu Asn Arg Ile Gin Gin Arg Asn Gly Val Ile Ile Thr Thr Tyr Gin 65 70 75 80 Met Leu Ile Asn Asn Trp Gin Gin Leu Ser Ser Phe Arg Gly Gin Glu 85 90 95 Phe Val Trp Asp Tyr Val Ile Leu Asp Glu Ala His Lys lie Lys Thr 100 105 110 Ser Ser Thr Lys Ser Ala Ile Cys Ala Arg Ala Ile Pro Ala Ser Asn 115 120 125 ftrg Leu Leu Leu Thr Gly Thr Pro Ile Gin Asn Asn Leu Gin Glu Leu 130 135 140 Trp Ser Leu Phe Asp Phe Ala Cys Gin Gly Ser Leu Leu Gly Thr Leu 145 150 155 160 Lys Thr Phe Lys Met Glu Tyr Glu Asn Pro Ile Thr Arg Ala Arg Glu 165 170 175 Lys Asp Ala Thr Pro Gly Glu Lys Ala Leu Gly Phe Lys Ile Ser Glu 180 185 190 ftsn Leu Met Ala Ile Ile Lys Pro Tyr Phe Leu Arg Arg Thr Lys Glu 195 200 205 ftsp Val Gin Lys Lys Lys Ser Ser Asn Pro Glu Ala Arg Leu Asn Glu 210 215 220 Lys Asn Pro Asp Val Asp Ala Ile Cys Glu Met Pro Ser Leu Ser Arg 225 230 235 240 Lys Asn Asp Leu Ile Ile Trp Ile Arg Leu Val Pro Leu Gin Glu Glu 245 250 255 Ile Tyr Arg Lys Phe val Ser Leu Asp His Ile Lys Glu Leu Leu Met 260 265 270 Glu Thr Arg Ser Pro Leu Ala Glu Leu Gly Val Leu Lys Lys Leu Cys 275 280 285 Asp His Pro Arg Leu Leu Ser Ala Arg Ala Cys Cys Leu Leu Asn Leu 290 295 300 Gly Thr Phe Ser Ala Gin Asp Gly Asn Glu Gly Glu Asp Ser Pro Asp 305 310 315 320 Vai Asp His Ile Asp Gin Val Thr Asp Asp Thr Leu Met Glu Glu Ser 325 330 335 >1 r«H Lys Met Ile Phe Leu Met Asp Leu Leu Lys Arg Leu Arg Asp Glu 340 345 350 Gly His Gin Thr Leu Val Phe Ser Gin Ser Arg Gin Ile Leu Asn Ile 355 360 365 Ile Glu Arg Leu Leu Lys Asn Arg His Phe Lys Thr Leu Arg Ile Asp 370 375 380 Gly Thr Val Thr His Leu Leu Glu Arg Glu Lys Arg Ile Asn Leu Phe 385 390 395 400 Gin Gin Asn Lys Asp Tyr Ser Val Phe Leu Leu Thr Thr Gin Val Gly 405 410 415 Gly Val Gly Leu Thr Leu Thr Ala Ala Thr Arg Val Val Ile Phe Asp 420 425 430 Pro Ser Trp Asn Pro Ala Thr Asp Ala Gin Ala Val Asp Arg Val Tyr 180 4 35 440 445 Arg Ile Gly Gin Lys Glu Asn Vai Vai Vai Tyr Arg Leu Ile Thr Cys 450 455 4 60 Gly Thr Vai Glu Glu Lys Ile Tyr Arg Arg Gin Vai Phe Lys Asp Ser 465 470 475 480 Leu Ile Arg Gin Thr Thr Gly Glu Lys Lys Asn Pro Phe Arg Tyr Phe 485 490 495 Ser Lys Gin Glu Leu Arg Glu Leu Phe Thr Ile Glu Asp Leu Gin Asn 500 505 510 Ser Vai Thr Gin Leu Gin Leu Gin Ser Leu His Ala Ala Gin Arg Lys 515 520 525 Ser Asp Ile Lys Leu Asp Glu His Ile Ala Tyr Leu Gin Ser Leu Gly 530 535 540 Ile Ala Gly Ile Ser Asp His Asp Leu Met Tyr Thr Cys Asp Leu Ser 545 550 555 560 Vai Lys Glu Glu Leu Asp Vai vai Glu Glu Ser His Tyr Ile Gin Gin 565 570 575 Arg Vai Gin Lys Ala Gin Phe Leu Vai Glu Phe Glu Ser Gin Asn Lys 580 585 590 Glu Phe Leu Met Glu Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu 595 600 605 Arg Glu Pro Vai Phe Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu 610 615 620 Asn Lys Pro Gin Pro Gin Pro Ser Pro Leu Leu Ser Thr His His Thr 625 630 635 640 Gin Glu Glu ASp Ile Ser Ser Lys Met Ala Ser Vai Vai Ile Asp Asp 645 650 655 Leu Pro Lys Glu Gly Glu Lys Gin Asp Leu Ser Ser Ile Lys Vai Asn 660 665 670 Vai Thr Thr Leu Gin Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile 675 680 685 Ala Thr Leu Pro Lys Gly Phe Gly Ser Vai Glu Glu Leu Cys Thr Asn 690 695 700 Ser Ser Leu Gly Met Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai 705 710 715 720 Gin Lys Glu Thr Leu Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu 725 730 735 Asp Pro Leu Glu Ser Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala 740 745 750 Asp Ile Gly Pro Asn Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg 755 760 765 His Cys Asn Pro Trp Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn 770 775 780 Ala Glu ser Asn Vai Ser Ile Ile Glu Ile Ala ASp Asp Leu Ser Ala 785 790 795 800 Ser His Ser Ala Leu Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu 805 810 815 Glu Glu Pro Ser Ala Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu 820 825 830 Phe Leu Glu Asp Ser Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser 835 840 845 Leu Glu HiS Vai Glu Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn 850 855 860 Ser Arg Ala Gly Phe Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe 865 870 875 880 Ser Glu Lys Asp Asp Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile 885 890 895 Arg Ser Lys Ala Arg Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp 900 905 910 Ser Phe Lys Asp Thr Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe 915 920 925 181
Gin Phe Ser Ser Vai Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp 930 935 940 Ile Ser Pro Pro Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser val 945 950 955 960 As η Lys Ser Met Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu 965 970 975 Ile Asn Met Vai Leu Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp 980 985 990 Asp Ser Ser Glu Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Val 995 1000 1005 Glu Glu Ser Ser Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser 1010 1015 1020 Glv Glu Thr Leu Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser 1025 1030 1035 1040 Lys Pro Ser Ala Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro 1045 1050 1055 Leu Ser Gly Glu Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu 1060 1065 1070 Ala Thr Asn ASp Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys 1075 1080 1085 Glu Cys Gly Lys Ile Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu 1090 1095 1100 Asp Ile Lys Ser Ala Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu 1105 1110 1115 1120 Tyr Lys Gin Leu Asn Asn Asn 1125 <210> 6
<211> 3671 <212> ADN <213> Homo sapiens <400> 6 182 aaaatgaatc atgtgctgct gatcatgcca accaatctta ttaacacttg ggtaaaagaa 60 ttcatcaagt ggactccagg aatgggagtc aaaacctttc atggtcctag caaggatgaa 120 cggaccagaa acctcaatcg gattcagcaa aggaatggtg ttattatcac tacataccaa 180 atgttaatca ataactggca gcaactttca agctttaggg gccaagagtt tgtgtgggac 240 tatgtcatcc tcgatgaagc acataaaata aaaacctcat ctactaagtc agcaatatgt 300 gctcgtgcta ttcctgcaag taatcgcctc ctcctcacag gaaccccaat ccagaataat 360 ttacaagaac tatggtccct atttgatttt gcttgtcaag ggtccctgct gggaacatta 420 aaaactttta agatggagta tgaaaatcct attactagag caagagagaa ggatgctacc 480 ccaggagaaa aagccttggg atttaaaata tctgaaaact taatggcaat cataaaaccc 540 tattttctca ggaggactaa agaagacgta cagaagaaaa agtcaagcaa cccagaggcc 600 agacttaatg aaaagaatcc agatgctgat gccatttgtg aaatgccttc cctttccagg 660 aaaaatgatt taattatttg gatacgactt gtgcctttac aagaagaaat atacaggaaa 720 tttgtçtctt tagatcatat caaggagttg ctaatggaga cgcgctcacc tttggctgag 780 ctaggtgtct taaagaagct gtgtgatcat cctaggctgc tgtctgcacg ggcttgttgt 840 ttgctaaatc ttgggacatt ctctgctcaa gatggaaatg agggggaaga ttccccagat 900 gtggaccata ttgatcaagt aactgatgac acattgatgg aagaatctgg aaaaatgata 960 ttcctaatgg acctacttaa gaggctgcga gatgagggac atcaaactct ggtgttttct 1020 caatcgaggc aaattctaaa catcattgaa cgcctcttaa agaataggca ctttaagaca 1080 ttgcgaatcg atgggacagt tactcatctt ttggaacgag aaaaaagaat taacttattc 1140 cagcaaaata aagattactc tgtttttctg cttaccactc aagtaggtgg tgtcggttta 1200 acattaactg cagcaactag agtggtcatt tttgacccta gctggaatcc tgcaactgat 1260 gctcaagctg tggatagagt ttaccgaatt ggacaaaaag agaatgttgt ggtttatagg 1320 ctaatcactt gtgggactgt agaggaaaaa atatacagaa gacaggtttt caaggactca 1380 ttaataagac aaactactgg tgaaaaaaag aaccctttcc gatattttag taaacaagaa 1440 ttaagagagc tctttacaat cgaggatctt cagaactctg taacccagct gcagcttcag 1500 tctttgcatg ctgctcagag gaaatctgat ataaaactag atgaacatat tgcctacctg 1560 cagtctttgg ggatagctgg aatctcagac catgatttga tgtacacatg tgatctgtct 1620 183 gttaaagaag agcttgatgt ggtagaagaa tctcactata ttcaacaaag ggttcagaaa 1680 gctcaattcc tcgttgaatt cgagtctcaa aataaagagt tcctgatgga acaacaaaga 1740 actagaaatg agggggcctg gctaagagaa cctgtatttc cttcttcaac aaagaagaaa 1800 tgccctaaat tgaataaacc acagcctcag ccttcacctc ttctaagtac tcatcatact 1860 caggaagaag atatcagttc caaaatggca agtgtagtca ttgatgatct gcccaaagag 1920 ggtgagaaac aagatctctc cagtataaag gtgaatgtta ccaccttgca agatggtaaa 1980 ggtacaggta gtgctgactc tatagctact ttaccaaagg ggtttggaag tgtagaagaa 2040 ctttgtacta actcttcatt gggaatggaa aaaagctttg caactaaaaa tgaagctgta 2100 caaaaagaga cattaeaaga ggggcctaag caagaggcac tgcaagagga tcctctggaa 2160 agttttaatt atgtacttag caaatcaacc aaagctgata ttgggccaaa tttagatcaa 2220 ctaaaggatg atgaggtttt acgtcattgc aatccttggc ccattatttc cataacaaat 2280 gaaagtcaaa atgcagaatc aaatgtatcc attattgaaa tagctgatga cctttcagca 2340 tcccatagtg cactgcagga tgctcaagca agtgaggcca agttggaaga ggaaccttca 2400 gcatcttcac cacagtatgc atgtgatttc aatcttttct tggaagactc agcagacaac 2460 agacaaaatt tttccagtca gtctttagag catgttgaga aagaaaatag cttgtgtggc 2520 tctgcaccta attccagagc agggtttgtg catagcaaaa catgtctcag ttgggagttt 2580 tctgagaaag acgatgaacc agaagaagta gtagttaaag caaaaatcag aagtaaagct 2640 agaaggattg tttcagatgg cgaagatgaa gatgattctt ttaaagatac ctcaagcata 2700 aatccattca acacatctct ctttcaattc tcatctgtga aacaatttga tgcttcaact 2760 cccaaaaatg acatcagtcc accaggaagg ttcttttcat ctcaaatacc cagtagtgta 2820 aataagtcta tgaactctag aagatctctg gcttctagga ggtctcttat taatatggtt 2880 ttagaccacg tggaggacat ggaggaaaga cttgacgaca gcagtgaagc aaagggtcct 2940 gaagattatc cagaagaagg ggtggaggaa agcagtggcg aagcctccaa gtatacagaa 3000 gaggatcctt ccggagaaac actgtcttca gaaaacaagt ccagctggtt aatgacgtct 3060 aagcctagtg ctctagctca agagacctct cttggtgccc ctgagccttt gtctggtgaa 3120 cagttggttg gttcccccca ggataaggcg gcagaggcta caaatgacta tgagactctt 3180 gtaaagcgtg gaaaagaact aaaagagtgt ggaaaaatcc aggaggccct aaactgctta 3240 gttaaagcgc ttgacataaa aagtgcagat cctgaagtta tgctcttgac tttaagtttg 3300 tataagcaac ttaataacaa ttgagaatgt aacctgttta ttgtatttta aagtgaaact 3360 gaatatgagg gaatttttgt tcccataatt ggattctttg ggaacatgaa gcattcaggc 3420 ttaaggcaag aaagatctca aaaagcaact tctgccctgc aacgcccccc actccatagt 3480 ctggtattct gagcactagc ttaatatttc ttcacttgaa tattcttata ttttaggcat 3540 attctataaa tttaactgtg ttgtttcttg gaaagttttg taaaattatt ctggtcattc 3600 ttaattttac tctgaaagtg atcatctttg tatataacag ttcagataag aaaattaaag 3660 ttacttttct c 3671 <210> 7 <211> 1106
<212> PRT <213> Homo sapiens <400> 7 184
Met Asn His Vai Leu Leu Ile Met 1 5 Vai Lys Glu Phe Ile Lys Trp Thr 20 His Gly Pro Ser Lys Asp Glu Arg 35 40 Gin Arg Asn Gly Vai Ile Ile Thr 50 55 Trp Gin Gin Leu Ser Ser Phe Arg 65 70 Vai Ile Leu Asp Glu Ala His Lys 85 Ala Ile Cys Ala Arg Ala Ile Pro 100 Gly Thr Pro Ile Gin Asn Asn Leu 115 120 Phe Ala Cys Gin Gly Ser Leu Leu 130 135 Glu Tyr Glu Asn Pro Ile Thr Arg
Pro Thr 10 Asn Leu Ile Asn Thr 15 Trp Pro 25 Gly Met Gly Vai Lys 30 Thr Phe Thr Arg Asn Leu Asn 45 Arg Ile Gin Thr Tyr Gin Met 60 Leu Ile Asn Asn Gly Gin Glu 75 Phe Vai Trp Asp Tyr 80 Ile Lys 90 Thr Ser Ser Thr Lys 95 Ser Ala 105 Ser Asn Arg Leu Leu 110 Leu Thr Gin Glu Leu Trp Ser 125 Leu Phe Asp Gly Thr Leu Lys 140 Thr Phe Lys Met Ala Arg Glu Lys Asp Ala Thr Pro 185 145 150 155 160 Gly Glu Lys Ala Leu Gly Phe Lys Ile Ser Glu Asn Leu Met Ala Ile 165 170 175 Ile Lys Pro Tyr Phe Leu Arg Arg Thr Lys Glu Asp vai Gin Lys Lys 180 185 190 Lys Ser Ser Asn Pro Glu Ala Arg Leu Asn Glu Lys Asn Pro Asp Vai 195 200 205 Asp Ala Ile Cys Glu Met Pro Ser Leu Ser Arg Lys Asn Asp Leu Ile 210 215 220 Ile Trp Ile Arg Leu Vai Pro Leu Gin Glu Glu Ile Tyr Arg Lys Phe 225 230 235 240 Vai Ser Leu Asp His Ile Lys Glu Leu Leu Met Glu Thr Arg Ser Pro 245 250 255 Leu Ala Glu Leu Gly Vai Leu Lys Lys Leu Cys Asp His Pro Arg Leu 260 265 270 Leu Ser Ala Arg Ala Cys Cys Leu Leu Asn Leu Gly Thr Phe Ser Ala 275 280 285 Gin Asp Gly Asn Glu Gly Glu Asp Ser Pro Asp Vai Asp His Ile Asp 290 295 300 Gin Vai Thr Asp Asp Thr Leu Met Glu Glu Ser Gly Lys Met Ile Phe 305 310 315 320 Leu Met Asp Leu Leu Lys Arg Leu Arg Asp Glu Gly His Gin Thr Leu 325 330 335 Vai Phe Ser Gin Ser Arg Gin Ile Leu Asn Ile Ile Glu Arg Leu Leu 340 345 350 Lys Asn Arg His Phe Lys Thr Leu Arg Ile Asp Gly Thr Vai Thr His 355 360 365 Leu Leu Glu Arg Glu Lys Arg Ile Asn Leu Phe Gin Gin Asn Lys Asp 370 375 380 Tyr Ser Vai Phe Leu Leu Thr Thr Gin Vai Gly Gly Vai Gly Leu Thr 385 390 395 400 Leu Thr Ala Ala Thr Arg Vai Vai Ile Phe Asp Pro Ser Trp Asn Pro 405 410 415 Ala Thr Asp Ala Gin Ala Vai Asp Arg Vai Tyr Arg Ile Gly Gin Lys 420 425 430 Glu Asn Vai Vai Vai Tyr Arg Leu Ile Thr Cys Gly Thr Vai Glu Glu 435 440 445 Lys Ile Tyr Arg Arg Gin Vai Phe Lys Asp Ser Leu Ile Arg Gin Thr 450 455 460 Thr Gly Glu Lys Lys Asn Pro Phe Arg Tyr Phe Ser Lys Gin Glu Leu 465 470 475 480 Arg Glu Leu Phe Thr Ile Glu Asp Leu Gin Asn Ser Vai Thr Gin Leu 485 490 495 Gin Leu Gin Ser Leu His Ala Ala Gin Arg Lys Ser Asp Ile Lys Leu 500 505 510 Asp Glu His Ile Ala Tyr Leu Gin Ser Leu Gly Ile Ala Gly Ile Ser 515 520 525 Asp His Asp Leu Met Tyr Thr Cys Asp Leu Ser Vai Lys Glu Glu Leu 530 535 540 Asp Vai Vai Glu Glu Ser His Tyr Ile Gin Gin Arg Vai Gin Lys Ala 545 550 555 560 Gin Phe Leu Vai Glu Phe Glu Ser Gin Asn Lys Glu Phe Leu Met Glu 565 570 575 Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu Arg Glu Pro Vai Phe 580 585 590 Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu Asn Lys Pro Gin Pro 595 600 605 Gin Pro Ser Pro Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile 610 615 620 Ser Ser Lys Met Ala Ser Vai Vai Ile Asp Asp Leu Pro Lys Glu Gly 625 630 635 640 186
Glu Lys Gin Asp Leu Ser Ser ile Lys Vai Asn Val Thr Thr Leu Gin 645 650 655 Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys 660 665 670 Gly Phe Gly Ser Vai Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 675 680 685 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala val Gin Lys Glu Thr Leu 690 695 700 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 705 710 715 720 Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn 725 730 735 Leu Asp Gin Leu Lys Asp Asp Glu Vai Leu Arg His Cys Asn Pro Trp 740 745 750 Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Val 755 760 765 Ser Ile Ile Glu ile Ala Asp Asp Leu ser Ala Ser His Ser Ala Leu 770 775 780 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 785 790 795 800 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 805 810 815 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Val Glu 820 825 830 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 835 840 845 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 850 855 860 Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala Arg 865 870 875 880 Arg Ile Vai Ser Asd Gly Glu Asp Glu ASO Asp Ser Phe Lys Asp Thr 885 890 895 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Val 900 905 910 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 915 920 925 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Val Asn Lys Ser Met Asn 930 935 940 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Val Leu 945 950 955 960 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 965 970 975 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Val Glu Glu Ser Ser Gly 980 985 990 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 995 1000 1005 Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1010 1015 1020 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1025 1030 1035 1040 Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1045 1050 1055 Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1060 1065 1070 Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu ASp Ile Lys Ser Ala 1075 1080 1085 Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1090 1095 1100
Asn Asn 1105 187 <210> 8 <211> 2312 <212> ADN <213> Homo sapiens <400> 8 tcattaataa gacaaactac tggtgaaaaa aagaaccctt tccgatattt tagtaaacaa 60 gaattaagag agctctttac aatcgaggat cttcagaact ctgtaaccca gctgcagctt 120 cagtctttgc atgctgctca gaggaaatct gatataaaac tagatgaaca tattgcctac 180 ctgcagtctt tggggatagc tggaatctca gaccatgatt tgatgtacac atgtgatctg 240 tctgttaaag aagagcttga tgtggtagaa gaatctcact atattcaaca aagggttcag 300 aaagctcaat tcctcgttga attcgagtct caaaataaag agttcctgat ggaacaacaa 360 agaactagaa atgagggggc ctggctaaga gaacctgtat ttccttcttc aacaaagaag 420 aaatgcccta aattgaataa accacagcct cagccttcac ctcttctaag tactcatcat 480 actcaggaag aagatatcag ttccaaaatg gcaagtgtag tcattgatga tctgcccaaa 540 gagggtgaga aacaagatct ctccagtata aaggtgaatg ttaccacctt gcaagatggg 600 taaggtacag gtagtgctga ctctataact actttaccaa aggggtttgg aagtgtagaa 660 gaactttgta ctaactcttc attgggaatg gaaaaaagct ttgcaactaa aaatgaagct 720 gtacaaaaag agacattaca agaggggcct aagcaggagg cactgcaaga ggatcctctg 780 gaaagtttta attatgtact tagcaaatca accaaagctg atattgggcc aaatttagat 840 caactaaagg atgatgagat tttacgtcat tgcaatcctt ggcccattat ttccataaca 900 aatgaaagtc aaaatgcaga atcaaatgta tccattattg aaatagctga tgacctttca 960 gcatcccata gtgcactgca ggatgctcaa gcaagtgagg ccaagttgga agaggaacct 1020 tcagcatctt caccacagta tgcatgtgat ttcaatcttt tcttggaaga ctcagcagac 1080 aacagacaaa atttttccag tcagtcttta gagcatgttg agaaagaaaa tagcttgtgt 1140 ggctctgcac ctaattccaa agcagggttt gtgcatagca aaacatgtct cagttgggag 1200 ttttctgaga aagacgatga accagaagaa gtagtagtta aagcaaaaat cagaagtaaa 1260 gctagaagga ttgtttcaga tggcgaagat gaagatgatt cttttaaaga tacctcaagc 1320 ataaatccat tcaacacatc tctctttcaa ttctcatctg tgaaacaatt tgatgcttca 1380 actcccaaaa atgacatcag tccaccagga aggttctttt catctcaaat acccagtagt 1440 gtaaataagt ctatgaactc tagaagatct ctggcttcta ggaggtctct tattaatatg 1500 gttttagacc acgtggagga catggaggaa agacttgacg acagcagtga agcaaagggt 1560 cctgaagatt atccagaaga aggggtggag gaaagcagtg gcgaagcctc caagtataca 1620 gaagaggatc cttccggaga aacactgtct tcagaaaaca agtccagctg gttaatgacg 1680 tctaagccta gtgctctagc tcaagagacc tctcttggtg cccctgagcc tttgtctggt 1740 gaacagttgg ttggttctcc ccaggataag gcggcagagg ctacaaatga ctatgagact 1800 cttgtaaagc gtggaaaaga actaaaagag tgtggaaaaa tccaggaggc cctaaactgc 1860 ttagttaaag cgcttgacat aaaaagtgca gatcctgaag ttatgctctt gactttaagt 1920 ttgtataagc aacttaataa caattgagaa tgtaacctgt ttattgtatt ttaaagtgaa 1980 actgaatatg agggaatttt tgttcccata attggattct ttgggaacat gaagcattca 2040 ggcttaaggc aagaaagatc tcaaaaagca acttctgccc tgcaacgccc cccactccat 2100 agtctggtat tctgagcact agcttaatat ttcttcactt gaatattctt atattttagg 2160 catattctat aaatttaact gtgttgtttc ttggaaagtt ttgtaaaatt attctggtca 2220 ttcttaattt tactctgaaa gtgatcatct ttgtatataa cagttcagat aagaaaatta 2280 aagttacttt tctcaaaaaa aaaaaaaaaa aa 2312
<210> 9 <211> 419 <212> PRT <213> Homo sapiens 188 <400> 9
Met Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr 15 10 15
Leu Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu 20 25 30
Ser Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro 35 40 45 Asn Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro 50 55 60 Trp Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn 65 70 75 80 Vai Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala 85 90 95 Leu Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser 100 105 110 Ala Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp 115 120 125 Ser Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser. Leu Glu His Vai 130 135 140 Glu Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Lys Ala Gly 145 150 155 160 Phe Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp 165 170 175 Asp Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala 180 185 190 Arg Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp 195 200 205 Thr Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser 210 215 220 Vai Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro 225 230 235 240 Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met 245 250 255 Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai 260 265 270 Leu Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu 275 280 285 Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser 290 295 300 Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu 305 310 315 320 Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala 325 330 335 Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu 340 345 350 Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp 355 360 365 Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys 370 375 380 Ile Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser 385 390 395 400 Ala Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu 405 410 415 Asn Asn Asn <210> 10 <211> 1720 189
<212> ADN <213> Homo sapiens <400> 10 atagctactt 60 ggaatggaaa 120 gggcctaagc ISO aaatcaacca 240 cgtcattgca 300 ggcacgaggc caccttgcaa gatggtaaag gtacaggtag tgctgactct taccaaaggg gtttggaagt gtagaagaac tttgtactaa ctcttcattg aaagctttgc aactaaaaat gaagctgtac aaaaagagac attacaagag aagaggcact gcaagaggat cctctggaaa gttttaatta tgtacttagc aagctgatat tgggccaaat ttagatcaac taaaggatga tgagatttta tgcagaatca aatgtatcca 360 actgcaggat gctcaagcaa 420 acagtatgca tgtgatttca 480 ttccagtcag tctttagagc 540 ttccagagca gggtttgtgc 600 cgatgaacca gaagaagtag 660 ttcagatggc gaagatgaag 720 cacatctctc tttcaattct 780 catcagtcca ccaggaaggt 840 gaactctaga agatctctgg 900 ggaggacatg gaggaaagac 960 agaagaaggg gtggaggaaa 1020 cggagaaaca ctgtcttcag 1080 tctagctcaa gagacctctc 1140 ttctccccag gataaggcgg 1200 aaaagaacta aaagagtgtg 1260 tgacataaaa agtgcagatc 1320 taataacaat tgagaatgta 1380 aatttttgtt cccataattg 1440 aagatctcaa aaagcaactt 1500 agcactagct taatatttct 1560 ttaactgtgt tgtttcttgg 1620 ctgaaagtga tcatctttgt 1680 1720 aaagtcaaaa cccatagtgc catcttcacc gacaaaattt ctgcacctaa ctgagaaaga gaaggattgt atccattcaa ccaaaaatga ataagtctat tagaccacgt aagattatcc aggatccttc agcctagtgc agttggttgg taaagcgtgg ttaaagcgct ataagcaact aatatgaggg taaggcaaga tggtattctg ttctataaat taattttact tacttttctc atccttggcc cattatttcc ataacaaatg ttattgaaat agctgatgac ctttcagcat gtgaggccaa gttggaagag gaaccttcag atcttttctt ggaagactca gcagacaaca atgttgagaa agaaaatagc ttgtgtggct atagcaaaac atgtctcagt tgggagtttt tagttaaagc aaaaatcaga agtaaagcta atgattcttt taaagatacc tcaagcataa catctgtgaa acaatttgat gcttcaactc tcttttcatc tcaaataccc agtagtgtaa cttctaggag gtctcttatt aatatggttt ttgacgacag cagtgaagca aagggtcctg gcagtggcga agcctccaag tatacagaag aaaacaagtc cagctggtta atgacgtcta ttggtgcccc tgagcctttg tctggtgaac cagaggctac aaatgactat gagactcttg gaaaaatcca ggaggcccta aactgcttag ctgaagttat gctcttgact ttaagtttgt acctgtttat tgtattttaa agtgaaactg gattctttgg gaacatgaag cattcaggct ctgccctgca acgcccccca ctccatagtc tcacttgaat attcttatat tttaggcata aaagttttgt aaaattattc tggtcattct atataacagt tcagataaga aaattaaagt
<210> 11 <211> 419 <212> PRT <213> Homo sapiens <400> 11 190
Met Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr 1 5 10 15 Leu Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu 20 25 30 Ser Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro 35 40 45 Asn Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro 50 55 60 Trp Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn 65 70 75 80 Vai Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala 85 90 95 Leu Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser 100 105 110 Ala Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp 115 120 125 Ser Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai 130 135 140 Glu Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly 145 150 155 160 Phe vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp 165 170 175 Asp Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala 180 185 190 Arg Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp 195 200 205 Thr Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser 210 215 220 Vai Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro 225 230 235 240 Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met 245 250 255 Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai 260 265 270 Leu Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu 275 280 285 Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser 290 295 300 Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu 305 310 315 320 Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala 325 330 335 Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu 340 345 350 Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp 355 360 365 Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys 370 375 380 lie Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser 385 390 395 400 Ala Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu 405 410 415 Asn Asn Asn <210> 12
<211> 1250 <212> PRT 191 <213> Homo sapiens <400> 12
Met Glu Ala Ser 1 Gin Ala Ala His Lys Asn Gly 20 Asp ASp Ile 35 Phe Pro Glu 50 Ala Leu Glu 65 Vai Cys Asn Ser Phe Glu His Gin Asp Gly Arg 100 Lys Thr Vai 115 Gin Ile Vai 130 Asn His Vai 145 Vai Lys Glu Phe His Gly Pro Ser Gin Arg Asn 180 Gly Trp Gin 195 Gin Leu Vai 210 Ile Leu Asp
Arg 5 Arg Phe Pro Tyr Leu Arg Tyr Leu Glu Glu Ala 40 Asn Glu Lys 55 Vai Glu Leu 70 Ala Glu Gly 85 Leu Leu Leu Lys Glu Gly Ile Gly Gly Ile Leu 120 Ile Ala Phe 135 Leu Leu Leu 150 Ile Met Ile 165 Lys Trp Thr Lys Asp Glu Arg Vai Ile Ile Thr 200 Ser Ser Phe 215 Arg Glu Ala His Lys
Glu Ala 10 Glu Ala Vai 25 Lys Glu Ala Phe Lys Leu Phe Leu Ser Arg Ile 60 Gin Gly Asp 75 Asp Tyr Arg 90 Glu Leu Ala 105 Phe Leu Tyr Ala Asp Asp Met Ser Gly Met Phe 140 Pro Thr Asn 155 Leu Pro Gly 170 Met Arg Thr 185 Arg Asn Leu Thr Tyr Gin Met Gly Gin Glu Phe 220 Ile Lys Thr Ser
Leu Ser Pro 15 Glu >1 Glu 30 Ala Thr Asn 45 Leu Ala Lys Gin Lys Ile Gin Glu Phe Thr Asp 80 His Asn Gin 95 Leu Ser Leu 110 Tyr Arg Gly 125 Leu Gly Lys Asp Ala Ser Leu Ile Asn Thr Trp 160 Vai Lys Thr 175 Phe Asn Arg 190 Ile Gin Leu 205 Ile Asn Asn Vai Trp Asp Tyr Ser Thr Lys Ser 192 225 230 235 240 Ala Ile Cys Ala Arg Ala Ile Pro Ala Ser Asn Arg Leu Leu leu Thr 245 250 255 Gly Thr Pro Ile Gin Asn Asn Leu Gin Glu Leu Trp Ser Leu Phe Asp 260 265 270 Phe Ala Cys Gin Gly Ser Leu Leu Gly Thr Leu Lys Thr Phe Lys Met 275 280 285 Glu Tyr Glu Asn Pro Ile Thr Arg Ala Arg Glu Lys Asp Ala Thr Pro 290 295 300 Gly Glu Lys Ala Leu Gly Phe Lys Ile Ser Glu Asn Leu Met Ala Ile 305 310 315 320 Ile Lys Pro Tyr Phe Leu Arg Arg Thr Lys Glu Asp Val Gin Lys Lys 325 330 335 Lys Ser Ser Asn Pro Glu Ala Arg Leu Asn Glu Lys Asn Pro Asp Val 340 345 350 Asp Ala Ile Cys Glu Met Pro Ser Leu Ser Arg Lys Asn Asp Leu Ile 355 360 365 Ile Trp Ile Arg Leu Val Pro Leu Gin Glu Glu Ile Tyr Arg Lys Phe 370 375 380 Vai Ser Leu Asp His Ile Lys Glu Leu Leu Met Glu Thr Arg Ser Pro 385 390 395 400 Leu Ala Glu Leu Gly Val Leu Lys Lys Leu Cys Asp His Pro Arg Leu 405 410 415 Leu Ser Ala Arg Ala Cys Cys Leu Leu Asn Leu Gly Thr Phe Ser Ala 420 425 430 Gin Asp Gly Asn Glu Gly Glu Asp Ser Pro Asp Val Asp His Ile Asp 435 440 445 Gin Vai Thr Asp Asp Thr Leu Met Glu Glu Ser Gly Lys Met Ile Phe 4 50 455 460 Leu Met Asp Leu Leu Lys Arg Leu Arg Asp Glu Gly His Gin Thr Leu 465 470 475 480 Vai Phe Ser Gin Ser Arg Gin Ile Leu Asn Ile Ile Glu Arg Leu Leu 485 490 495 Lys Asn Arg His Phe Lys Thr Leu Arg Ile Asp Gly Thr Val Thr His 500 505 510 Leu Leu Glu Arg Glu Lys Arg Ile Asn Leu Phe Gin Gin Asn Lys Asp 515 520 525 Tyr Ser Val Phe Leu Leu Thr Thr Gin Val Gly Gly Val Gly Leu Thr 530 535 540 Leu Thr Ala Ala Thr Arg Val Val Ile Phe Asp Pro Ser Trp Asn Pro 545 550 555 560 Ala Thr Asp Ala Gin Ala Val Asp Arg Val Tyr Arg Ile Gly Gin Lys 565 570 575 Glu Asn Val Val Val Tyr Arg Leu Ile Thr Cys Gly Thr Val Glu Glu 580 585 590 Lys Ile Tyr Arg Arg Gin Val Phe Lys Asp Ser Leu Ile Arg Gin Thr 595 600 605 Thr Gly Glu Lys Lys Asn Pro Phe Arg Tyr Phe Ser Lys Gin Glu Leu 610 615 620 Arg Glu Leu Phe Thr Ile Glu Asp Leu Gin Asn Ser Val Thr Gin Leu 625 630 635 640 Gin Leu Gin Ser Leu His Ala Ala Gin Arg Lys Ser Asp Ile Lys Leu 645 650 655 Asp Glu His Ile Ala Tyr Leu Gin Ser Leu Gly Ile Ala Gly Ile Ser 660 665 670 Asp His Asp Leu Met Tyr Thr Cys Asp Leu Ser Val Lys Glu Glu Leu 675 680 685 Asp Val Val Glu Glu Ser His Tyr Ile Gin Gin Arg Val Gin Lys Ala 690 695 700 Gin Phe Leu Val Glu Phe Glu Ser Gin Asn Lys Glu Phe Leu Met Glu 705 710 715 720 193
Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu Arg Glu Pro Vai Phe 725 730 735 Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu Asn Lys Pro Gin Pro 740 745 750 Gin Pro Ser Pro Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile 755 760 765 Ser Ser Lys Met Ala Ser Vai Vai Ile Asp Asp Leu Pro Lys Glu Gly 770 775 780 Glu Lys Gin Asp Leu Ser Ser Ile Lys Vai Asn Vai Thr Thr Leu Gin 785 790 795 800 Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys 805 810 815 Gly Phe Gly Ser Vai Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 820 825 830 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr Leu 835 840 845 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 850 855 860 Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn 865 870 875 880 Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro Trp 885 890 895 Pro lie Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Vai 900 905 910 Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 915 920 925 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 930 935 940 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 945 950 955 960 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai Glu 965 970 975 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 980 985 990 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 995 1000 1005 Glu Pro Glu Glu Vai Vai vai Lys Ala Lys Ile Arg Ser Lys Ala Arg 1010 1015 1020 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 1025 1030 1035 1040 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Vai 1045 1050 1055 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 1060 1065 1070 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met Asn 1075 1080 1085 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai Leu 1090 1095 1100 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 1105 1110 1115 1120 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser Gly 1125 1130 1135 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 1140 1145 1150 Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1155 1160 1165 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1170 1175 1180 Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1185 1190 1195 1200 Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 194 194 1215 Ile Lys Ser Ala 1230 Lys Gin Leu Asn 1245 1205 1210
Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp 1220 1225
Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr 1235 1240
Asn Asn 1250
<210> 13 <211> 1127 <212> PRT <213> Homo sapiens <400> 13 195
Met Gly Leu Gly Lys Thr Vai Gin 1 5 Phe Asp Ala Ser Leu Vai Asn His 20 Leu Ilâ Asn Thr Trp Vai Lys Glu 35 40 Arg Vai Lys Thr Phe His Gly Pro 50 55 Leu Asn Arg Ile Gin Gin Arg Asn 65 70 Met Leu Ile Asn Asn Trp Gin Gin 85 Phe Vai Trp Asp Tyr Vai Ile Leu 100 Ser Ser Thr Lys Ser Ala Ile Cys 115 120 Arg Leu Leu Leu Thr Gly Thr Pro 130 135 Trp Ser Leu Phe Asp Phe Ala Cys 145 150 Lys Thr Phe Lys Met Glu Tyr Glu 165 Lys Asp Ala Thr Pro Gly Glu Lys 180 Asn Leu Met Ala Ile Ile Lys Pro 195 200 Asp Vai Gin Lys Lys Lys Ser Ser 210 215 Lys Asn Fro Asp Vai Asp Ala Ile 225 230 Lys Asn Asp Leu Ile Ile Trp Ile 245 Ile Tyr Arg Lys Phe Vai Ser Leu 260 Glu Thr Arg Ser Pro Leu Ala Glu 275 280 Asp His Pro Arg Leu Leu Ser Ala 290 295 Gly Thr Phe Ser Ala Gin Asp Gly 305 310 Vai Asp His Ile Asp Gin Vai Thr 325 Gly Lys Met Ile Phe Leu Met Asp 340 Gly HiS Gin Thr Leu Vai Phe Ser 355 360
Ile Ile 10 Ala Phe Leu Ser Gly 15 Met Vai 25 Leu Leu Ile Met Pro 30 Thr Asn Phe Ile Lys Trp Thr 45 Pro Gly Met Ser Lys Asp Glu 60 Arg Thr Arg Asn Gly Vai Ile 75 Ile Thr Thr Tyr Gin 80 Leu Ser 90 Ser Phe Arg Gly Gin 95 Glu Asp 105 Glu Ala His Lys Ile 110 Lys Thr Ala Arg Ala Ile Pro 125 Ala Ser Asn Ile Gin Asn Asn 140 Leu Gin Glu Leu Gin Gly Ser 155 Leu Leu Gly Thr Leu 160 Asn Pro 170 Ile Thr Arg Ala Arg 175 Glu Ala 185 Leu Gly Phe Lys Ile 190 Ser Glu Tyr Phe Leu Arg Arg 205 Thr Lys Glu Asn Pro Glu Ala 220 Arg Leu Asn Glu Cys Glu Met 235 Pro Ser Leu Ser Arg 240 Arg Leu 250 Vai Pro Leu Gin Glu 255 Glu Asp 265 His Ile Lys Glu Leu 270 Leu Met Leu Gly Vai Leu Lys 285 Lys Leu Cys Arg Ala Cys Cys 300 Leu Leu Asn Leu Asn Glu Gly 315 Glu Asp Ser Pro Asp 320 Asp Asp 330 Thr Leu Met Glu Glu 335 Ser Leu 345 Leu Lys Arg Leu Arg 350 Asp Glu Gin Ser Arg Gin Ile 365 Leu Asn Ile 196 lie Glu 370 Arg Leu Gly 385 Thr Vai Thr Gin Gin Asn Lys Gly Vai Gly Leu 420 Pro Ser Trp 435 Asn Arg Ile 450 Gly Gin Gly 465 Thr Vai Glu Leu Ile Arg Gin Ser Lys Gin Glu 500 Ser Vai Thr 515 Gin Ser Asp 530 Ile Lys Ile 545 Ala Gly Ile Vai Lys Glu Glu Arg Vai Gin Lys 580 Glu Phe Leu 595 Met Arg Glu 610 Pro Vai Asn 625 Lys Pro Gin Gin Glu Glu Asp Leu Pro Lys Glu 660 Vai Thr Thr 675 Leu Ala Thr 690 Leu Pro Ser 705 Ser Leu Gly Gin Lys Glu Thr Asp Pro Leu Glu 740 Asp Ile Gly 755 Pro His Cys 770 Asn Pro Ala 785 Glu Ser Asn Ser His Ser Ala Glu Glu Pro Ser 820 Phe Leu Glu 835 Asp Leu Glu His Vai
Leu Lys Asn 375 Arg His Leu 390 Leu Glu Asp 405 Tyr Ser Vai Thr Leu Thr Ala Pro Ala Thr Asp 440 Lys Glu Asn 455 Vai Glu Lys 470 Ile Tyr Thr 485 Thr Gly Glu Leu Arg Glu Leu Leu Gin Leu Gin 520 Leu Asp Glu 535 His Ser ASp 550 His Asp Leu 565 Asp Vai Vai Ala Gin Phe Leu Glu Gin Gin Arg 600 Phe Pro Ser 615 Ser Pro Gin 630 Pro Ser Ile 645 Ser Ser Lys Gly Glu Lys Gin Gin Asp Gly Lys 680 Lys Gly Phe 695 Gly Met Glu 710 Lys Ser Leu 725 Gin Glu Gly Ser Phe Asn Tyr Asn Leu Asp Gin 760 Trp Pro Ile 775 Ile Vai Ser 790 Ile Ile Leu 805 Gin Asp Ala Ala Ser Ser Pro Ser Ala Asp Asn 840 Glu Lys Glu Asn
HiS Phe Lys Thr 380 Arg Glu Lys 395 Arg Phe Leu 410 Leu Thr Ala 425 Thr Arg Vai Ala Gin Ala Vai Vai Vai Tyr Arg 460 Arg Arg Gin 475 Vai Lys Lys 490 Asn Pro Phe 505 Thr Ile Glu Ser Leu His Ala Ile Ala Tyr Leu 540 Leu Met Tyr 555 Thr Glu Glu 570 Ser His Vai 585 Glu Phe Glu Thr Arg Asn Glu Thr Lys Lys Lys 620 Pro Leu Leu 635 Ser Met Ala 650 Ser Vai Asp 665 Leu Ser Ser Gly Thr Gly Ser Ser Vai Glu Glu 700 Phe Ala Thr 715 Lys Pro Lys 730 Gin Glu Vai 745 Leu Ser Lys Leu Lys Asp Asp Ser Ile Thr Asn 780 Glu Ile Ala 795 Asp Gin Ala 810 Ser Glu Gin 825 Tyr Ala Cys Arg Gin Asn Phe Ser Leu Cys Gly
Leu Arg Ile Asp Ile Asn Leu Phe Thr Gin Val 400 Gly Vai Ile 415 Phe Asp Asp 430 Arg Val Tyr 445 Leu Ile Thr Cys Phe Lys Asp Ser Phe Arg Tyr 480 Phe Asp Leu 495 Gin Asn Ala 510 Gin Arg Lys 525 Gin Ser Leu Gly Cys Asp Leu Ser Tyr Ile Gin 560 Gin Ser Gin 575 Asn Lys Gly 590 Ala Trp Leu 605 Cys Pro Lys Leu Thr His His Thr Val Ile Asp 640 Asp Ile Lys 655 Val Asn Ala 670 Asp Ser Ile 585 Leu Cys Thr Asn Asn Glu Ala Val Ala Leu Gin 720 Glu Ser Thr 735 Lys Ala Glu 750 Ile Leu Arg 765 Glu Ser Gin Asn Asp Leu Ser Ala Ala Lys Leu 800 Glu Asp Phe 815 Asn Leu Ser 830 Ser Gin Ser 845 Ser Ala Pro Asn 197 850 855 860 Ser Arg Ala Gly Phe Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe 865 870 875 880 Ser Glu Lys Asp Asp Glu Pro Glu Glu Val Val Val Lys Ala Lys Ile 885 890 895 Arg Ser Lys Ala Arg Arg Ile val Ser Asp Gly Glu Asp Glu Asp Asp 900 905 910 Ser Phe Lys Asp Thr Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe 915 920 925 Gin Phe Ser Ser Vai Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp 930 935 940 Ile Ser Pro Pro Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Val 945 950 955 960 Asn Lys Ser Met Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu 965 970 975 Ile Asn Met Vai Leu Asp His Val Glu Asp Met Glu Glu Arg Leu Asp 980 985 990 Asp Ser Ser Glu Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Val 995 1000 1005 Glu Glu Ser Ser Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser 1010 1015 1020 Gly Glu Thr Leu Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser 1025 1030 1035 1040 Lys Pro Ser Ala Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro 1045 1050 1055 Leu Ser Gly Glu Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu 1060 1065 1070 Ala Thr Asn Asp Tyr Glu Thr Leu Val Lys Arg Gly Lys Glu Leu Lys 1075 1080 1085 Glu Cys Gly Lys Ile Gin Glu Ala Leu Asn Cys Leu Val Lys Ala Leu 1090 1095 1100 Asp Ile Lys Ser Ala Asp Pro Glu Val Met Leu Leu Thr Leu Ser Leu 1105 1110 1115 1120 Tyr Lys Gin Leu Asn Asn Asn 1125 <210> 14 <211> 1250 <212> PRT <213> Homo <400> 14 198
Met 1 Glu Ala Ser Arg 5 Arg Phe Pro Gin Ala Ala His 20 Tyr Leu Arg Tyr Lys Asn Gly 35 Asp Leu Glu Glu Ala 40 ftsp Ile 50 Phe Pro Asn Glu Lys 55 Vai Glu 65 Ala Leu Glu Glu Leu 70 Ala Glu Vai Cys Asn Ser Gly 85 Leu Leu Leu Phe Glu His Gin 100 Lys Glu Gly Ile Asp Gly Arg 115 Lys Gly Gly Ile Leu 120 Thr Vai 130 Gin Ile Ile Ala Phe 135 Leu
Glu Ala 10 Glu Ala Leu Ser Pro 15 Glu Vai 25 Lys Glu Ala Lys Glu 30 Ala Thr Phe Lys Leu Phe Asn 45 Leu Ala Lys Leu Ser Arg Ile 60 Gin Lys Ile Gin Gin Gly Asp 75 Asp Glu Phe Thr Asp 80 Tyr Arg 90 Glu Leu His Asn Gin 95 Leu Ala 105 Phe Leu Tyr Ser Leu 110 Tyr Arg Ala Asp Asp Met Gly 125 Leu Gly Lys Ser Gly Met Phe 140 Asp Ala Ser Leu 199
Val Asn Hls Val Leu Leu Ile Met Pro Thr Asn Leu Ile Asn Thr Trp 145 150 155 160 Val Lys Glu Phe Ile Lys Trp Thr Pro Gly Met Gly Val Lys Thr Phe 165 170 175 HÍS Gly Pro Ser Lys Asp Glu Arg Thr Arg Asn Leu Asn Arg Ile Gin 180 185 190 Gin Arg Asn Gly Val Ile Ile Thr Thr Tyr Gin Met Leu Ile Asn Asn 195 200 205 Trp Gin Gin Leu Ser Ser Phe Arg Gly Gin Glu Phe Val Trp Asp Tyr 210 215 220 Val Ile Leu ASp Glu Ala His Lys Ile Lys Thr Ser Ser Thr Lys Ser 225 230 235 240 Ala Ile Cys Ala Arg Ala Ile Pro Ala Ser Asn Arg Leu Leu Leu Thr 245 250 255 Gly Thr Pro Ile Gin Asn Asn Leu Gin Glu Leu Trp Ser Leu Phe Asp 260 265 270 Phe Ala Cys Gin Gly Ser Leu Leu Gly Thr Leu Lys Thr Phe Lys Met 275 280 285 Glu Tyr Glu Asn Pro Ile Thr Arg Ala Arg Glu Lys Asp Ala Thr Pro 290 295 300 Gly Glu Lys Ala Leu Gly Phe Lys Ile Ser Glu Asn Leu Met Ala Ile 305 310 315 320 Ue Lys Pro Tyr Phe Leu Arg Arg Thr Lys Glu Asp val Gin Lys Lys 325 330 335 Lys Ser Ser Asn Pro Glu Ala Arg Leu Asn Glu Lys Asn Pro Asp Val 340 345 350 Asp Ala Ile Cys Glu Met Pro Ser Leu Ser Arg Lys Asn Asp Leu Ile 355 360 365 Ile Trp Ile Arg Leu Val Pro Leu Gin Glu Glu Ile Tyr Arg Lys Phe 370 375 380 Val Ser Leu Asp Hls Ile Lys Glu Leu Leu Met Glu Thr Arg Ser Pro 385 390 395 4 00 Leu Ala Glu Leu Gly Val Leu Lys Lys Leu Cys Asp Hls Pro Arg Leu 40S 410 415 Leu Ser Ala Arg Ala Cys Cys Leu Leu Asn Leu Gly Thr Phe Ser Ala 420 425 430 Gin Asp Gly Asn Glu Gly Glu Asp Ser Pro Asp Val Asp His Ile Asp 435 440 445 Gin Val Thr Asp Asp Thr Leu Met Glu Glu Ser Gly Lys Met Ile Phe 450 455 460 Lâu Met Asp Leu Leu Lys Arg Leu Arg Asp Glu Gly His Gin Thr Leu 4 65 470 475 480 Val Phe Ser Gin Ser Arg Gin Ile Leu Asn Ile ile Glu Arg Leu Leu 435 490 495 Lys Asn Arg His Phe Lys Thr Leu Arg Ile Asp Gly Thr Val Thr His 500 505 510 Leu Leu Glu Arg Glu Lys Arg ile Asn Leu Phe Gin Gin Asn Lys Asp 515 520 525 Tyr Ser Val Phe Leu Leu Thr Thr Gin Val Gly Gly Val Gly Leu Thr 530 535 540 Leu Thr Ala Ala Thr Arg Val Val Ile Phe Asp Pro Ser Trp Asn Pro 545 550 555 560 Ala Thr Asp Ala Gin Ala Val Asp Arg Val Tyr Arg Ile Gly Gin Lys 565 570 575 Glu Asn Val Val Val Tyr Arg Leu Ile Thr Cys Gly Thr Val Glu Glu 580 585 590 Lys Ile Tyr Arg Arg Gin Val Phe Lys Asp Ser Leu Ile Arg Gin Thr 595 600 605 Thr Gly Glu Lys Lys Asn Pro Phe Arg Tyr Phe Ser Lys Gin Glu Leu 610 615 620 Arg Glu Leu Phe Thr Ile Glu Asp Leu Gin Asn Ser Val Thr Gin Leu 200 625 630 635 640 Gin Leu Gin Ser Leu His Ala Ala Gin Arg Lys Ser Asp Ile Lys Leu 645 650 655 Asp Glu His Ile Ala Tyr Leu Gin Ser Leu Gly Ile Ala Gly Ile Ser 660 665 670 Asp His Asp Leu Met Tyr Thr Cys Asp Leu Ser Vai Lys Glu Glu Leu 675 680 685 Asp Vai Vai Glu Glu Ser His Tyr Ile Gin Gin Arg Vai Gin Lys Ala 690 695 700 Gin Phe Leu Vai Glu Phe Glu Ser Gin Asn Lys Glu Phe Leu Met Glu 705 710 715 720 Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu Arg Glu Pro Vai Phe 725 730 735 Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu Asn Lys Pro Gin Pro 740 745 750 Gin Pro Ser Pro Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile 755 760 765 Ser Ser Lys Met Ala Ser Vai Vai Ile Asp Asp Leu Pro Lys Glu Gly 770 775 780 Glu Lys Gin Asp Leu Ser Ser Ile Lys Vai Asn Vai Thr Thr Leu Gin 785 790 795 800 Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys 805 810 815 Gly Phe Gly Ser Vai Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 820 825 830 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr Leu 835 840 845 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 850 855 860 Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn 865 870 875 880 Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro Trp 885 890 895 Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Vai 900 905 910 Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 915 920 925 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 930 935 940 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 945 950 955 960 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai Glu 965 970 975 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 980 985 990 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 995 1000 1005 Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala Arg 1010 1015 1020 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 1025 1030 1035 1040 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Vai 1045 1050 1055 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 1060 1065 1070 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met Asn 1075 1080 1085 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai Leu 1090 1095 1100 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 1105 1110 1115 1120 201 201 Glu Glu Ser Ser Gly 1135 Gly Glu Thr Leu Ser 1150 Lys Pro Ser Ala Leu 1165 Leu Ser Gly Glu Gin 1180
Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai 1125 1130
Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser 1140 1145
Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser 1155 1160
Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro 1170 1175
Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1185 1190 1195 1200
Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1205 1210 1215
Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser Ala 1220 1225 1230
Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1235 1240 1245
Asn Asn 1250 <210> 15 <211> 1250 <212> PRT <213> Homo sapiens <400> 15 202
Met Glu Ala Ser Arg Arg Phe Pro 1 5 Gin Ala Ala His Tyr Leu Arg Tyr 20 Lys Asn Gly Asp Leu Glu Glu Ala 35 40 Asp Ile Phe Pro Asn Glu Lys Vai 50 55 Glu Ala Leu Glu Glu Leu Ala Glu 65 70 Vai Cys Asn Ser Gly Leu Leu Leu 85 Phe Glu His Gin Lys Glu Gly Ile 100 Asp Gly Arg Lys Gly Gly Ile Leu 115 120 Thr Vai Gin Ile Ile Ala Phe Leu 130 135 Vai Asn His Vai Leu Leu Ile Met 145 150 Vai Lys Glu Phe Ile Lys Trp Thr 165 His Gly Pro Ser Lys Asp Glu Arg 180 Gin Arg Asn Gly Vai Ile Ile Thr 195 200 Trp Gin Gin Leu Ser Ser Phe Arg 210 215 Vai Ile Leu Asp Glu Ala His Lys 225 230 Ala Ile Cys Ala Arg Ala Ile Pro 245 Gly Thr Pro Ile Gin Asn Asn Leu 260 Phe Ala Cys Gin Gly Ser Leu Leu
Glu Ala 10 Glu Ala Leu Ser Pro 15 Glu Vai 25 Lys Glu Ala Lys Glu 30 Ala Thr Phe Lys Leu Phe Asn 45 Leu Ala Lys Leu Ser Arg Ile 60 Gin Lys Ile Gin Gin Gly Asp 75 Asp Glu Phe Thr Asp 80 Tyr Arg 90 Glu Leu His Asn Gin 95 Leu Ala 105 Phe Leu Tyr Ser Leu 110 Tyr Arg Ala Asp Asp Met Gly 125 Leu Gly Lys Ser Gly Met Phe 140 Asp Ala Ser Leu Pro Thr Asn 155 Leu Ile Asn Thr Trp 160 Pro Gly 170 Met Arg Vai Lys Thr 175 Phe Thr 185 Arg Asn Leu Asn Arg 190 Ile Gin Thr Tyr Gin Met Leu 205 Ile Asn Asn Gly Gin Glu Phe 220 Vai Trp Asp Tyr Ile Lys Thr 235 Ser Ser Thr Lys Ser 240 Ala Ser 250 Asn Arg Leu Leu Leu 255 Thr Gin 265 Glu Leu Trp Ser Leu 270 Phe Asp Gly Thr Leu Lys Thr Phe Lys Met 203 275 280 Glu Tyr 290 Glu Asn Pro Ile Thr 295 Arg Gly Glu 305 Lys Ala Leu Gly 310 Phe Lys Ile Lys Pro Tyr Phe 325 Leu Arg Arg Lys Ser Ser Asn 340 Pro Glu Ala Arg Asp Ala Ile 355 Cys Glu Met Pro Ser 360 Ile Trp 370 Ile Arg Leu Vai Pro 375 Leu Vai 385 Ser Leu Asp His Ile 390 Lys Glu Leu Ala Glu Leu Gly 405 Vai Leu Lys Leu Ser Ala Arg 420 Ala Cys Cys Leu Gin Asp Gly 435 Asn Glu Gly Glu Asp 440 Gin Vai 450 Thr Asp Asp Thr Leu 455 Met Leu 4 65 Met Asp Leu Leu Lys 470 Arg Leu Vai Phe Ser Gin Ser 485 Arg Gin Ile Lys Asn Arg His 500 Phe Lys Thr Leu Leu Leu Glu 515 Arg Glu Lys Arg Ile 520 Tyr Ser 530 Vai Phe Leu Leu Thr 535 Thr Leu 545 Thr Ala Ala Thr Arg 550 Vai Val Ala Thr Asp Ala Gin 565 Ala val Asp Glu Asn Vai Vai 580 Vai Tyr Arg Leu Lys Ile Tyr 595 Arg Arg Gin Val Phe 600 Thr Gly 610 Glu Lys Lys Asn Pro 615 Phe Arg 625 Glu Leu Phe Thr Ile 630 Glu Asp Gin Leu Gin Ser Leu 645 His Ala Ala Asp Glu His Ile 660 Ala Tyr Leu Gin Asp His Asp 675 Leu Met Tyr Thr Cys 680 Asp Vai 690 Vai Glu Glu Ser His 695 Tyr Gin 705 Phe Leu Vai Glu Phe 710 Glu Ser Gin Gin Arg Thr Arg 725 Asn Glu Gly Pro Ser Ser Thr 740 Lys Lys Lys Cys Gin Pro Ser 755 Pro Leu Leu Ser Thr 760 285 Ala Arg Glu Lys 300 Asp Ala Thr Pro Ile Ser Glu 315 Asn Leu Met Ala Ile 320 Thr Lys 330 Glu Asp Val Gin Lys 335 Lys Leu 345 Asn Glu Lys Asn Pro 350 Asp Val Leu Ser Arg Arg Asn 365 Asp Leu Ile Gin Glu Glu Ile 380 Tyr Arg Lys Phe Leu Leu Met 395 Glu Thr Arg Ser Pro 400 Lys Leu 410 Cys Asp His Pro Arg 415 Leu Leu 425 Asn Leu Gly Thr Phe 430 Ser Ala Ser Pro Asp Val Asp 445 His I le Asp Glu Glu Ser Gly 460 Lys Met Ile Phe Arg Asp Glu 475 Gly His Gin Thr Leu 480 Leu Asn 490 Ile Ile Glu Arg Leu 495 Leu Arg 505 Ile Asp Gly Thr Val 510 Thr His Asn Leu Phe Gin Gin C^C Asn Lys Asp Gin Val Gly Gly 540 Val Gly Leu Thr Ile Phe Asp 555 Pro Ser Trp Asn Pro 560 Arg Val 570 Tyr Arg Ile Gly Gin 575 Lys Ile 585 Thr Cys Gly Thr Val 590 Glu Glu Lys Asp Ser Leu Ile 605 Arg Gin Thr Arg Tyr Phe Ser 620 Lys Gin Glu Leu Leu Gin Asn 635 Ser Val Thr Gin Leu 640 Gin Arg 650 Lys Ser Asp Ile Lys 655 Leu Ser 665 Leu Gly Ile Ala Gly 670 Ile Ser Asp Leu Ser Val Lys 685 Glu Glu Leu Ile Gin Gin Arg 700 Val Gin Lys Ala Gin Asn Lys 715 Glu Phe Leu Met Glu 720 Ala Trp 730 Leu Arg Glu Pro Val 735 Phe Pro 745 Lys Leu Asn Lys Pro 750 Gin Pro His His Thr Gin Glu 765 Glu Asp Ile 204
Ser ser Lys Met Ala Ser Vai Vai Ile Asp Asp Leu Pro Lys Glu Gly 770 775 780 Glu Lys Gin Asp Leu Ser Ser Ile Lys Vai Asn Vai Thr Thr Leu Gin 185 790 795 800 ASp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys 805 810 815 Gly Phe Gly Ser Vai Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 820 825 830 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr Leu 835 840 845 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu ASp Pro Leu Glu Ser 850 855 860 Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn 865 870 875 880 Leu ASp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro Trp 885 890 895 Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Vai 900 905 910 Ser Ile lie Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 915 920 925 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 930 935 940 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 945 950 955 960 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai Glu 965 970 975 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 980 985 990 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 995 1000 1005 Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala Arg 1010 1015 1020 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 1025 1030 1035 1040 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Vai 1045 1050 1055 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 1060 1065 1070 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met Asn 1075 1080 1085 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai Leu 1090 1095 1100 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 1105 1110 1115 1120 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser Gly 1125 1130 1135 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 1140 1145 1150 Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1155 1160 1165 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1170 1175 1180 Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1185 1190 1195 1200 Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1205 1210 1215 Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser Ala 1220 1225 1230 Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1235 1240 1245
Asn Asn 1250 205
<210> 16 <211> 1250 <212> PRT <213> Homo sapiens <4 0 0> 16 206
Met Glu Ala Ser Arg Arg Phe Pro Glu Ala Glu Ala Leu Ser Pro Glu 1 5 10 15 Gin Ala Ala His Tyr Leu Arg Tyr Vai Lys Glu Ala Lys Glu Ala Thr 20 25 30 Lys Asn Gly Asp Leu Glu Glu Ala Phe Lys Leu Phe Asn Leu Ala Lys 35 40 45 Asp Ile Phe Pro Asn Glu Lys Vai Leu Ser Arg Ile Gin Lys Ile Gin 50 55 60 Glu Ala Leu Glu Glu Leu Ala Glu ,Gln Gly Asp Asp Glu Phe Thr Asp 65 70 75 80 Vai Cys Asn Ser Gly Leu Leu Leu Tyr Arg Glu Leu His Asn Gin Leu 85 90 95 Phe Glu His Gin Lys Glu Gly Ile Ala Phe Leu Tyr Ser Leu Tyr Arg 100 105 110 Asp Gly Arg Lys Gly Gly Ile Leu Ala Asp Asp Met Gly Leu Gly Lys 115 120 125 Thr Vai Gin Ile Ile Ala Phe Leu Ser Gly Met Phe Asp Ala Ser Leu 130 135 140 Vai Asn His Vai Leu Leu Ile Met Pro Thr Asn Leu Ile Asn Thr Trp 145 150 155 160 Vai Lys Glu Phe Ile Lys Trp Thr Pro Gly Met Arg Vai Lys Thr Phe 165 170 175 His Gly Pro Ser Lys Asp Glu Arg Thr Arg Asn Leu Asn Arg Ile Gin 180 185 190 Gin Arg Asn Gly Vai Ile Ile Thr Thr Tyr Gin Met Leu Ile Asn Asn 195 200 205 Trp Gin Gin Leu Ser Ser Phe Arg Gly Gin Glu Phe Vai Trp Asp Tyr 210 215 220 Vai Ile Leu Asp Glu Ala His Lys Ile Lys Thr Ser Ser Thr Lys Ser 225 230 235 240 Ala Ile Cys Ala Arg Ala Ile Pro Ala Ser Asn Arg Leu Leu Leu Thr 245 250 255 Gly Thr Pro Ile Gin Asn Asn Leu Gin Glu Leu Trp Ser Leu Phe Asp 260 265 270 Phe Ala Cys Gin Gly Ser Leu Leu Gly Thr Leu Lys Thr Phe Lys Met 275 280 285 Glu Tyr Glu Asn Pro Ile Thr Arg Ala Arg Glu Lys Asp Ala Thr Pro 290 295 300 Gly Glu Lys Ala Leu Gly Phe Lys Ile Ser Glu Asn Leu Met Ala Ile 305 310 315 320 Ile Lys Pro Tyr Phe Leu Arg Arg Thr Lys Glu Asp Vai Gin Lys Lys 325 330 335 Lys Ser Ser Asn Pro Glu Ala Arg Leu Asn Glu Lys Asn Pro Asp Vai 340 345 350 Asp Ala Ile Cys Glu Met Pro Ser Leu Ser Arg Lys Asn Asp Leu Ile 355 360 365 Ile Trp Ile Arg Leu Vai Pro Leu Gin Glu Glu Ile Tyr Arg Lys Phe 370 375 380 Vai Ser Leu Asp His Ile Lys Glu Leu Leu Met Glu Thr Arg Ser Pro 385 390 395 400 Leu Ala Glu Leu Gly Vai Leu Lys Lys Leu Cys Asp His Pro Arg Leu 405 410 415 207
Leu Ser Ala Arg Ala Cys Cys Leu Leu Asn Leu Gly Thr Phe Ser Ala 420 425 430 Gin Asp Gly Asn Glu Gly Glu Asp Ser Pro Asp Val Asp His Ile Asp 435 440 445 Gin Vai Thr Asp Asp Thr Leu Met Glu Glu Ser Gly Lys Met Ile Phe 450 455 460 Leu Met Asp Leu Leu Lys Arg Leu Arg Asp Glu Gly His Gin Thr Leu 465 470 475 480 Vai Phe Ser Gin Ser Arg Gin Ile Leu Asn Ile Ile Glu Arg Leu Leu 485 490 495 Lys Asn Arg His Phe Lys Thr Leu Arg Ile Asp Gly Thr Val Thr His 500 505 510 Leu Leu Glu Arg Glu Lys Arg Ile Asn Leu Phe Gin Gin Asn Lys Asp S15 520 525 Tyr Ser Vai Phe Leu Leu Thr Thr Gin Val Gly Gly Val Gly Leu Thr 530 535 540 Leu Thr Ala Ala Thr Arg Val Val Ile Phe Asp Pro Ser Trp Asn Pro 545 550 555 560 Ala Thr Asp Ala Gin Ala Val Asp Arg Val Tyr Arg Ile Gly Gin Lys 565 570 575 Glu Asn Vai Vai val Tyr Arg Leu Ile Thr Cys Gly Thr Val Glu GlU 580 585 590 Lys ile Tyr Arg Arg Gin Val Phe Lys Asp Ser Leu ile Arg Gin Thr 595 600 605 Thr Gly Glu Lys Lys Asn Pro Phe Arg Tyr Phe Ser Lys Gin Glu Leu 610 615 620 Arg Glu Leu Phe Thr Ile Glu Asp Leu Gin Asn Ser Val Thr Gin Leu 625 630 635 640 Gin Leu Gin Ser Leu His Ala Ala Gin Arg Lys Ser Asp Ile Lys Leu 645 650 655 Asp Glu His Ile Ala Tyr Leu Gin Ser Leu Gly Ile Ala Gly Ile Ser 660 665 670 Asp His Asp Leu Met Tyr Thr Cys Asp Leu Ser Val Lys Glu Glu Leu 675 680 685 Asp Vai Vai Glu Glu Ser His Tyr Ile Gin Gin Arg Val Gin Lys Ala 690 695 700 Gin Phe Leu Vai Glu Phe Glu Ser Gin Asn Lys Glu Phe Leu Met Glu 705 710 715 720 Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu Arg Glu Pro Val Phe 725 730 735 Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu Asn Lys Pro Gin Pro 740 745 750 Gin Pro Ser Pro Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile 755 760 765 Ser Ser Lys Met Ala Ser Val Val Ile Asp Asp Leu Pro Lys Glu Gly 770 775 780 Glu Lys Gin Asp Leu Ser Ser Ile Lys Val Asn Val Thr Thr Leu Gin 785 790 795 800 Asp Gly Lys Gly Thr Gly Ser Ala ASp Ser Ile Ala Thr Leu Pro Lys 805 810 815 Gly Phe Gly Ser val Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 820 825 830 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Val Gin Lys Glu Thr Leu 835 840 845 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 850 855 860 Phe Asn Tyr val Leu Ser Lys Ser Thr Lys Ala Asp ile Gly Pro Asn 865 870 875 880 Leu Asp Gin Leu Lys Asp Asp Glu Val Leu Arg His Cys Asn Pro Trp 885 890 895 Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Val 208 900 905 910 Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 915 920 925 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 930 935 940 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 945 950 955 960 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Val Glu 965 970 975 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 980 985 990 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 995 1000 1005 Glu Pro Glu Glu Vai Vai Val Lys Ala Lys Ile Arg Ser Lys Ala Arg 1010 1015 1020 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 1025 1030 1035 1040 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Val 1045 1050 1055 Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 1060 1065 1070 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Val Asn Lys Ser Met Asn 1075 1080 1085 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Val Leu 1090 1095 1100 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 1105 1110 1115 1120 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Val Glu Glu Ser Ser Gly 1125 1130 1135 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 1140 1145 1150 Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1155 1160 1165 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1170 1175 1180 Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1185 1190 1195 1200 Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1205 1210 1215 Gin Glu Ala Leu Asn Cys Leu Val Lys Ala Leu Asp Ile Lys Ser Ala 1220 1225 1230 Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1235 1240 1245
Asn Asn 1250 209 <210> 17 <211> 1106 <212> PRT <213> Homo sapiens <400> 17
Met 1 Asn His Vai Leu 5 Leu Ile Met Vai Lys Glu Phe 20 lie Lys Trp Thr His Gly Pro 35 Ser Lys Asp Glu Arg 40 Gin Arg Asn 50 Gly Vai Ile Ile 55 Thr
Pro Thr 10 Asn Leu Ile Asn Thr 15 Trp Pro 25 Gly Met Gly Vai Lys 30 Thr Phe Thr Arg Asn Leu Asn 45 Arg Ile Gin Thr Tyr Gin Met 60 Leu Ile Asn Asn 210
Trp Gin Gin Leu 65 Vai Ile Leu Asp Ala Ile Cys Ala Gly Thr Pro 100 Ile Phe Ala 115 Cys Gin Glu 130 Tyr Glu Asn 145 Gly Glu Lys Ala Ilâ Lys Pro Tyr Lys Ser Ser 180 Asn Asp Ala 195 Ile Cys Ile 210 Trp Ile Arg 22 5 Vai Ser Leu Asp Leu Ala Glu Leu Leu Ser Ala 260 Arg Gin Asp 275 Gly Asn Gin 290 Vai Thr Asp 305 Leu Met Asp Leu Vai Phe Ser Gin Lys Asn Arg 340 His Leu Leu 355 Glu Arg Tyr 370 Ser Vai Phe 385 Leu Thr Ala Ala Ala Thr Asp Ala Glu Asn vai 420 Vai Lys Ile 435 Tyr Arg Thr 450 Gly Glu Lys 465 Arg Glu Leu Phe Gin Leu Gin Ser Asp Glu His 500 Ile Asp His 515 Asp Leu Asp 530 Vai Vai Glu
Ser Ser 70 Phe Arg Glu 85 Ala His Lys Arg Ala Ile Pro Gin Asn Asn Leu 120 Gly Ser Leu 135 Leu Pro Ile 150 Thr Arg Leu 165 Gly Phe Lys Phe Leu Arg Arg Pro Glu Ala Arg 200 Glu Met Pro 215 Ser Leu Vai 230 Pro Leu His 245 Ile Lys Glu Gly Vai Leu Lys Ala Cys Cys Leu 280 Glu Gly Glu 295 Asp Asp Thr 310 Leu Met Leu 325 Lys Arg Leu Ser Arg Gin Ile Phe Lys Thr Leu 360 Glu Lys Arg 375 Ile Leu Leu 390 Thr Thr Thr 405 Arg Vai val Gin Ala Vai Asp Vai Tyr Arg Leu 440 Arg Gin Vai 455 Phe Lys Asn 470 Pro Phe Thr 485 Ile Glu Asp Leu His Ala Ala Ala Tyr Leu Gin 520 Met Tyr Thr 535 Cys Glu Ser His Tyr
Gly Gin Glu Phe Ile Lys 75 Thr Ser Ala 90 Ser Asn Arg 105 Gin Glu Leu Trp Gly Thr Leu Lys Ala Arg Glu 140 Lys Ile Ser 155 Glu Asn Thr 170 Lys Glu Asp 185 Leu Asn Glu Lys Leu Ser Arg Lys Gin Glu Glu 220 Ile Leu Leu 235 Met Glu Lys 250 Leu Cys Asp 265 Leu Asn Leu Gly Ser Pro Asp Val Glu Glu Ser 300 Gly Arg Asp 315 Glu Gly Leu 330 Asn Ile Ile 345 Arg Ile Asp Gly Asn Leu Phe Gin Gin Val Gly 380 Gly Ile Phe 395 Asp Pro Arg 410 val Tyr Arg 425 Ile Thr Cys Gly Lys Asp Ser Leu Arg Tyr Phe 460 Ser Leu Gin 475 Asn Ser Gin 490 Arg Lys Ser 505 Ser Leu Gly Ile Asp Leu Ser Val Ile Gin Gin 540 Arg
Val Trp Asp Tyr 80 Ser Thr Lys 95 Ser Leu Leu 110 Leu Thr Ser 125 Leu Phe Asp Thr Phe Lys Met Asp Ala Thr Pro 160 Leu Met Ala 175 Ile Val Gin 190 Lys Lys Asn 205 Pro Asp Val Asn Asp Leu Ile Tyr Arg Lys Phe 240 Thr Arg Ser 255 Pro His Pro 270 Arg Leu Thr 285 Phe Ser Ala Asp His Ile Asp Lys Met Ile Phe 320 His Gin Thr 335 Leu Glu Arg 350 Leu Leu Thr 365 Val Thr His Gin Asn Lys Asp Val Gly Leu Thr 400 Ser Trp Asn 415 Pro Ile Gly 430 Gin Lys Thr 445 Val Glu Glu Ile Arg Gin Thr Lys Gin Glu Leu 480 Val Thr Gin 495 Leu Asp Ile 510 Lys Leu Ala 525 Gly Ile Ser Lys GlU Glu Leu Val Gin Lys Ala 211 545 550 555 560 Gin Phe Leu Vai Glu Phe Glu Ser Gin Asn Lys Glu Phe Leu Met Glu 565 570 575 Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu Arg Glu Pro Vai Phe 580 585 590 Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu Asn Lys Pro Gin Pro 595 600 605 Gin Pro Ser Pro Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile 610 615 620 Ser Ser Lys Met Ala Ser Vai Vai Ile Asp Asp Leu Pro Lys Glu Gly 625 630 635 64 0 Glu Lys Gin Asp Leu Ser Ser Ile Lys Vai Asn Vai Thr Thr Leu Gin 645 650 655 Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys 660 665 670 Gly Phe Gly Ser Vai Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 675 680 685 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr Leu 690 695 700 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 705 710 715 720 Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn 725 730 735 Leu Asp Gin Leu Lys Asp Asp Glu Vai Leu Arg His Cys Asn Pro Trp 740 745 750 Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Vai 755 760 765 Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 770 775 780 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 785 790 795 800 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 805 810 815 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai Glu 820 825 830 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 835 840 845 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 850 855 860 Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala Arg 865 870 875 880 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 885 890 895 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Vai 900 905 910 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 915 920 925 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met Asn 930 935 940 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai Leu 945 950 955 960 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 965 970 975 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser Gly 980 985 990 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 99S 1000 1005 Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1010 1015 1020 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1025 1030 1035 1040 212
Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1045 1050 1055
Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1060 1065 1070
Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser Ala 1075 1080 1085
Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1090 1095 1100
Asn Asn 1105 <210> 18 <211> 419 <212> PRT <213> Homo sapiens <400> 18 213
Met Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr 1 5 10 15 Leu Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu 20 25 30 Ser Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro 35 40 45 Asn Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro 50 55 60 Trp Pro lie lie Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn 65 70 75 80 Vai Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala 85 90 95 Leu Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Giu Pro Ser 100 105 110 Ala Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp 115 120 125 Ser Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai 130 135 140 Glu Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Lys Ala Gly 145 150 155 160 Phe Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp 165 170 175 Asp Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala 180 185 190 Arg Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp 195 200 205 Thr Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser 210 215 220 Vai Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro 225 230 235 240 Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met 245 250 255 Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai 260 265 270 Leu Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu 275 280 285 Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly vai Glu Glu Ser Ser 290 295 300 Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu 305 310 315 320 Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala 325 330 335 Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Giu 340 345 350 Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp 355 360 365 Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys 370 375 380 Ile Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser 385 390 395 400 Ala Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu 405 410 415 Asn Asn Asn
<210> 19 <211> 419 <212> PRT <213> Homo sapiens 214 <4 Ο 0> 19
Met Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr 1 5 10 15 Leu Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu 20 25 30 Ser Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro 35 40 45 Asn Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro 50 55 60 Trp Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn 65 70 75 80 Vai Ser He Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala 85 90 95 Leu Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser 100 105 110 Ala Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp 115 120 125 Ser Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai 130 135 140 Glu Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly 145 150 155 160 Phe Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp 165 170 175 Asp Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala 180 185 190 Arg Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp 195 200 205 Thr Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser 210 215 220 Vai Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro 225 230 235 240 Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met 245 250 255 Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai 260 265 270 Leu Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu 275 280 285 Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser 290 295 300 Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu 305 310 315 320 Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala 325 330 335 Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly G 340 345 350
Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp 355 360 365
Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys 370 375 380
Ile Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser 385 390 395 400
Ala Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu 405 410 415
Asn Asn Asn
<210> 20 <211> 1106 <212> PRT <213> Homo sapiens 215 <400> 20
Val Asn His Val 1 val Lys Glu Phe His Gly Pro 20 Ser Gin Arg 35 Asn Gly Trp 50 Gin Gin Leu 65 Val Ile Leu Asp Ala Ile Cys Ala Gly Thr Pro 100 Ile Phe Ala 115 Cys Gin Glu 130 Tyr Glu Asn 145 Gly Glu Lys Ala Ile Lys Pro Tyr Lys Ser Ser 180 Asn Asp Ala 195 Ile Cys Ile 210 Trp Ile Arg 225 Val Ser Leu Asp Leu Ala Glu Leu Leu Ser Ala 260 Arg Gin Asp 275 Gly Asn Gin 290 Val Thr Asp 305 Leu Met Asp Leu
Leu 5 Leu Ile Met Ile Lys Trp Thr Lys Asp Glu Arg 40 Val Ile Ile 55 Thr Ser Ser 70 Phe Arg Glu 85 Ala His Lys Arg Ala Ile Pro Gin Asn Asn Leu 120 Gly Ser Leu 135 Leu Pro Ile 150 Thr Arg Leu 165 Gly Phe Lys Phe Leu Arg Arg Pro Glu Ala Arg 200 Glu Met Pro 215 Ser Leu Val 230 Pro Leu His 245 Ile Lys Glu Gly Val Leu Lys Ala Cys Cys Leu 280 Glu Gly Glu 295 Asp Asp Thr 310 Leu Met Leu Lys Arg Leu
Pro Thr 10 Asn Leu Pro 25 Gly Met Arg Thr Arg Asn Leu Thr Tyr Gin Met 60 Gly Gin Glu 75 Phe Ile Lys 90 Thr Ser Ala 105 Ser Asn Arg Gin Glu Leu Trp Gly Thr Leu Lys 140 Ala Arg Glu 155 Lys Ile Ser 170 Glu Asn Thr 185 Lys Glu Asp Leu Asn Glu Lys Leu Ser Arg Lys 220 Gin Glu Glu 235 Ile Leu Leu 250 Met Glu Lys 265 Leu Cys Asp Leu Asn Leu Gly Ser Pro Asp Val 300 Glu Glu Ser 315 Gly Arg Asp Glu Gly
Ile Asn Thr 15 Trp val Lys 30 Thr Phe Asn 45 Arg Ile Gin Leu Ile Asn Asn Val Trp Asp Tyr 80 Ser Thr Lys 95 Ser Leu Leu 110 Leu Thr Ser 125 Leu Phe Asp Thr Phe Lys Met Asp Ala Thr Pro 160 Leu Met Ala 175 Ile Val Gin 190 Lys Lys Asn 205 Pro Asp Val Asn Asp Leu Ile Tyr Arg Lys Phe 240 Thr Arg Ser 255 Pro His Pro 270 Arg Leu Thr 285 Phe Ser Ala Asp His Ile Asp Lys Met Ile Phe 320 His Gin Thr Leu 216
Val Phe Ser Gin 340 Lys Asn Arg 355 His Leu Leu 370 Glu Arg Tyr 385 Ser Val Phe Leu Thr Ala Ala Ala Thr Asp Ala 420 Glu Asn Val 435 Val Lys Ile 450 Tyr Arg Thr Gly 465 Glu Lys Arg Glu Leu Phe Gin Leu Gin Ser 500 Asp Glu His 515 Ile Asp His 530 Asp Leu Asp 545 Val Val Glu Gin Phe Leu Val Gin Gin Arg Thr 580 Pro Ser Ser 595 Thr Gin Pro 610 Ser Pro Ser 625 Ser Lys Met Glu Lys Gin Asp Asp Gly Lys Gly 660 Gly Phe Gly 675 Ser Glu Lys 690 Ser Phe Gin 705 Glu Gly Pro Phe Asn Tyr Val Leu Asp Gin Leu 740 Pro Ile Ile 755 Ser Ser Ile 770 Ile Glu Gin 785 Asp Ala Gin Ser Ser Pro Gin 325 Ser Arg Gin Ile Phe Lys Thr Leu 360 Glu Lys Arg 375 Ile Leu Leu 390 Thr Thr Thr 405 Arg Val Val Gin Ala Val Asp Val Tyr Arg Leu 440 Arg Gin Val 455 Phe w >1 1-3 Asn 470 Pro Phe Thr 485 Ile Glu Asp Leu His Ala Ala Ala Tyr Leu Gin 520 Met Tyr Thr 535 Cys Glu Ser 550 His Tyr Glu 565 Phe Glu Ser Arg Asn Glu Gly Lys Lys Lys Cys 600 Leu Leu Ser 615 Thr Ala Ser 630 Val Val Leu 645 Ser Ser Ile Thr Gly Ser Ala Val Glu Glu Leu 680 Ala Thr Lys 695 Asn Lys Gin 710 Glu Ala Leu 725 Ser Lys Ser Lys Asp Asp Glu Ile Thr Asn Glu 760 Ile Ala Asp 775 Asp Ala Ser 790 Glu Ala Tyr 805 Ala Cys Asp
Leu 330 Asn Ile Ile 345 Arg Ile Asp Gly Asn Leu Phe Gin Gin Val Gly 380 Gly Ile Phe 395 Asp Pro Arg 410 Val Tyr Arg 425 Ile Thr Cys Gly Lys Asp Ser Leu Arg Tyr Phe 460 Ser Leu Gin 475 Asn Ser Gin 490 Arg Lys Ser 505 Ser Leu Gly Ile Asp Leu Ser Val Ile Gin Gin 540 Arg Gin Asn 555 Lys Glu Ala 570 Trp Leu Arg 585 Pro Lys Leu Asn His His Thr Gin Ile Asp Asp 620 Leu Lys Val 635 Asn Val Asp 650 Ser Ile Ala 665 Cys Thr Asn Ser Glu Ala Val Gin Leu Gin Glu 700 Asp Thr Lys 715 Ala Asp Ile 730 Leu Arg His 745 Ser Gin Asn Ala Leu Ser Ala Ser Lys Leu Glu 780 Glu Phe Asn 795 Leu Phe 810 335 Glu Arg 350 Leu Leu Thr 365 Val Thr His Gin Asn Lys Asp Val Gly Leu Thr 400 Ser Trp Asn 415 Pro Ile Gly 430 Gin Lys Thr 445 Val Glu Glu Ile Arg Gin Thr Lys Gin Glu Leu 480 Val Thr Gin 495 Leu Asp Ile 510 Lys Leu Ala 525 Gly Ile Ser Lys Glu Glu Leu Val Gin Lys Ala 560 Phe Leu Met 575 Glu Glu Pro 590 Val Phe Lys 605 Pro Gin Pro Glu Glu Asp Ile Pro Lys Glu Gly 640 Thr Thr Leu 655 Gin Thr Leu 670 Pro Lys Ser 685 Leu Gly Met Lys Glu Thr Leu Pro Leu Glu Ser 720 Ile Gly Pro 735 Asn Cys Asn 750 Pro Trp Glu 765 Ser Asn Val His Ser Ala Leu Glu Pro Ser Ala 800 Leu Glu Asp 815 Ser 217
Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai Glu 820 825 830 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 835 840 845 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 850 855 860 Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala Arg 865 870 875 880 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 885 890 895 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Vai 900 905 910 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 915 920 925 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met Asn 930 935 940 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai Leu 94 5 950 955 960 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 965 970 975 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser Gly 980 985 990 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 995 1000 1005 Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1010 1015 1020 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1025 1030 1035 1040 Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1045 1050 1055 Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1060 1065 1070 Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser Ala 1075 1080 1085 Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1090 1095 1100
Asn Asn 1105 218
<210> 21 <211> 1106 <212> PRT <213> Homo sapiens <4 0 0> 21 Met Asn His Vai 1 Vai Lys Glu Phe 20 His Gly Pto 35 Ser Gin Arg 50 Asn Gly Trp Gin Gin Leu 65 Vai Ile Leu Asp Ala Ile Cys Ala 100
Leu Leu Ile Met 5 Ile Lys Trp Thr Lys Asp Glu Arg 40 Vai Ile Ile 55 Thr Ser Ser 70 Phe Arg Glu Ala His Lys 85 Arg Ala Ile Pro
Pro Thr 10 Asn Leu Pro 25 Gly Met Gly Thr Arg Asn Leu Thr Tyr Gin Met 60 Gly Gin Glu 75 Phe Ile Lys 90 Thr Ser Ala 105 Ser Asn Arg
Ile Asn Thr 15 Trp Vai Lys 30 Thr Phe Asn 45 Arg Ile Gin Leu Ile Asn Asn Vai Trp Asp Tyr 80 Ser Thr Lys 95 Ser Leu Leu 110 Leu Thr 219
Gly Thr Pro 115 Ile Phe Ala 130 Cys Gin Glu 145 Tyr Glu Asn Gly Glu Lys Ala Ile Lys Pro Tyr 180 Lys Ser Ser 195 Asn Asp Ala 210 Ile Cys Ile 225 Trp Ile Arg Vai Ser Leu Asp Leu Ala Glu Leu 260 Leu Ser Ala 275 Arg Gin Asp 290 Gly Asn Gin 305 Vai Thr Asp Leu Met Asp Leu Vai Phe Ser Gin 340 Lys Asn Arg 355 His Leu Leu 370 Glu Arg Tyr 385 Ser Vai Phe Leu Thr Ala Ala Ala Thr Asp Ala 420 Glu Asn Vai 435 Vai Lys Ile 450 Tyr Arg Thr Gly 465 Glu Lys Arg Glu Leu Phe Gin Leu Gin Ser 500 Asp Glu His 515 Ile Asp Hls 530 ASp Leu Asp 545 Vai Vai Glu Gin Phe Leu Vai Gin Gin Arg Thr 580 Pro Ser Ser Thr
Gin Asn Asn Leu 120 Gly Ser Leu 135 Leu Pro Ile 150 Thr Arg Leu 165 Gly Phe Lys Phe Leu Arg Arg Pro Glu Ala Arg 200 Glu Met Pro 215 Ser Leu Vai 230 Pro Leu His 245 Ile Lys Glu Gly Vai Leu Lys Ala Cys Cys Leu 280 Glu Gly Glu 295 Asp Asp Thr 310 Leu Met Leu 325 Lys Arg Leu Ser Arg Gin Ile Phe Τ.ν.ς —j — Thr Leu 360 Glu Lys Arg 375 Ile Leu Leu 390 Thr Thr Thr 405 Arg Vai Vai Gin Ala Vai Asp Vai Tyr Arg Leu 440 Arg Gin Vai 455 Phe Lys Asn 470 Pro Phe Thr 485 Ile Glu ASp Leu His Ala Ala Ala Tyr Leu Gin 520 Met Tyr Thr 535 Cys Glu Ser 550 His Tyr Glu 565 Phe Glu Ser Arg Asn Glu Gly Lys Lys Lys Cys
Gin Glu Leu Trp Gly Thr Leu Lys Ala Arg Glu 140 Lys Ile Ser 155 Glu Asn Thr 170 Lys Glu Asp 185 Leu Asn Glu Lys Leu Ser Arg Lys Gin Glu Glu 220 Ile Leu Leu 235 Met Glu Lys 250 Leu Cys Asp 265 Leu Asn Leu Gly Ser Pro Asp Val Glu Glu Ser 300 Gly Arg Asp 315 Glu Gly Leu 330 Asn Ile Ile 345 Arg Ile Asp f!l« --J Asn Leu Phe Gin Gin Vai Gly 380 Gly Ile Phe 395 Asp Pro Arg 410 Vai Tyr Arg 425 Ile Thr Cys Gly Lys Asp Ser Leu Arg Tyr Phe 4 60 Ser Leu Gin 475 Asn Ser Gin 490 Arg Lys Ser 505 Ser Leu Gly lie Asp Leu Ser Val Ile Gin Gin 540 Arg Gin Asn 555 Lys Glu Ala 570 Trp Leu Arg 585 Pro Lys Leu Asn
Ser 125 Leu Phe Asp Thr Phe Lys Met Asp Ala Thr Pro 160 Leu Met Ala 175 Ile Val Gin 190 Lys Lys Asn 205 Pro Asp Val Asn Asp Leu Ile Tyr Arg Lys Phe 240 Thr Arg Ser 255 Pro His Pro 270 Arg Leu Thr 285 Phe Ser Ala Asp His Ile Asp Lys Met Ile Phe 320 His Gin Thr 335 Leu Glu Arg 350 Leu Leu Thr 365 Val Thr His Gin Asn Lys Asp Val Gly Leu Thr 400 Ser Trp Asn 415 Pro Ile Gly 430 Gin Lys Thr 445 Val Glu Glu Ile Arg Gin Thr Lys Gin Glu Leu 430 Val Thr Gin 495 Leu Asp Ile 510 Lys Leu Ala 525 Gly lie Ser Lys Glu Glu Leu Val Gin Lys Ala 560 Phe Leu Met 575 Glu Glu Pro 590 Val Phe Lys Pro Gin Pro 220 595 600 605 Gin Pro Ser Pro Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile 610 615 620 Ser Ser Lys Met Ala Ser vai Vai Ile Asp Asp Leu Pro Lys Glu Gly 625 630 635 640 Glu Lys Gin Asp Leu Ser Ser Ile Lys Vai Asn Vai Thr Thr Leu Gin 645 650 655 Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys 660 665 670 Gly Phe Gly Ser Vai Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 675 680 685 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr Leu 690 695 700 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 705 710 715 720 Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn 725 730 735 Leu Asp Gin Leu Lys Asp Asp Glu Vai Leu Arg His Cys Asn Pro Trp 740 745 750 Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Vai 755 760 765 Ser ILe Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 770 775 780 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 785 790 795 800 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 805 810 815 1—t Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu HiS Vai Glu 820 825 830 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 835 840 845 Vai Hls Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 850 855 860 Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala Arg 865 870 875 880 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 885 890 895 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Vai 900 905 910 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 915 920 925 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met Asn 930 935 940 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai Leu 945 950 955 960 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 965 970 97 5 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser Gly 980 985 990 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 995 1000 1005 Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1010 1015 1020 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1025 1030 1035 1040 Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1045 1050 1055 Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1060 1065 1070 221
Gin Glu fila Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser Ala 1075 1080 1085
Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1090 1095 1100
Asn Asn 1105 <210> 22 <211> 419 <212> PRT <213> Homo sapiens <400> 22 222 Met Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Val Gin Lys Glu Thr 1 5 10 15 Leu Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu 20 25 30 Ser Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro 35 40 45 Asn Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro 50 55 60 Trp Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn 65 70 75 80 Vai Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala 85 90 95 Leu Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser 100 105 110 Ala Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp 115 120 125 Ser Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Val 130 135 140 Glu Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly 145 150 155 160 Phe Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp 165 170 175 Asp Glu Pro Glu Glu Vai val Val Lys Ala Lys Ile Arg Ser Lys Ala 180 185 190 Arg Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp 195 200 205 Thr Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser 210 215 220 Vai Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro 225 230 235 240 Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Val Asn Lys Ser Met 245 250 255 Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu lie Asn Met Val 260 265 270 Leu Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu 275 280 285 Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Val Glu Glu Ser Ser 290 2 95 300 Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu 305 310 315 320 Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala 325 330 335 Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu 340 345 350 Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp 355 360 365 Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys 370 375 380 Ile 385 Gin Glu Ala Leu Asn 390 Cys Leu Val Lys Ala 395 Leu Asp Ile Lys Ser 400 Ala Asp Pro Glu Val 405 Met Leu Leu Thr Leu 410 Ser Leu Tyr Lys Gin 415 Leu Asn Asn Asn <210> 23 <211> 419 <212> PRT<213> Homo sapiens 223 <400> 23
Met Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala vai Gin Lys Glu Thr 1 5 10 15 Leu Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu 20 25 30 Ser Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro 35 40 45 Asn Leu Asp Gin Leu Lys Asp Asp Glu lie Leu Arg His Cys Asn Pro 50 55 60 Trp Pro Ile Ile Ser lie Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn 65 70 75 80 Vai Ser Ile lie Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala 85 90 95 Leu Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser 100 105 110 Ala Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp 115 120 125 Ser Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai 130 135 140 Glu Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Lys Ala Gly 145 150 155 160 Phe Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp 165 170 175 Asp Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala 180 185 190 Arg Arg Ile Vai Ser ASp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp 195 200 205 Thr Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser 210 215 220 Vai Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro 225 230 235 240 Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met 245 250 255 Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai 260 265 270 Leu Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu 275 280 285 Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser 290 295 300 Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu 305 310 315 320 Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala 325 330 335 Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu 340 345 350 Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp 355 360 365 Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys : Gly Lys 370 375 380 Ile Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile ! Lys Ser 385 390 395 400 Ala Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys ; Gin Leu 405 410 415 Asn Asn Asn <210> 24
<211> 1248 <212> PRT 224 <213> Homo sapiens <400> 24
Met Glu Ala Ser Arg Arg Phe Pro 1 5 Gin Ala Ala His Tyr Leu Arg Tyr 20 Lys Asn Gly Asp Leu Glu Glu Ala 35 40 Asp Ile Phe Pro Asn Glu Lys Vai 50 55 Glu Ala Leu Glu Glu Leu Ala Glu 65 70 Vai Cys Asn Ser Gly Leu Leu Leu 85 Phe Glu His Gin Lys Glu Gly Ile 100 Asp Gly Arg Lys Gly Gly Ile Leu 115 120 Thr Vai Gin Ile Ile Ala Phe Leu 130 135 Vai Asn His Vai Leu Leu Ile Met 14 5 150 Vai Lys Glu Phe Ile Lys Trp Thr 165 His Gly Pro Ser Lys Asp Glu Arg 180 Gin Arg Asn Gly Vai Ile Ile Thr 195 200 Trp Gin Gin Leu Ser Ser Phe Arg 210 215 Vai Ile Leu Asp Glu Ala His Lys 225 230 Ala Ile Cys Ala Arg Ala Ile Pro 245 Gly Thr Pro Ile Gin Asn Asn Leu 260 Phe Ala Cys Gin Gly Ser Leu Leu 275 280 Glu Tyr Glu Asn Pro Ile Thr Arg 290 295 Gly Glu Lys Ala Leu Gly Phe Lys 305 310 Ile Lys Pro Tyr Phe Leu Arg Arg 325 Lys Ser Ser Asn Pro Glu Ala Arg 340
Glu Ala 10 Glu Ala Leu Ser Pro 15 Glu Vai 25 Lys Glu Ala Lys Glu 30 Ala Thr Phe Lys Leu Phe Asn 45 Leu Ala Lys Leu Ser Arg Ile 60 Gin Lys Ile Gin Gin Gly Asp 75 Asp Glu Phe Thr Asp 80 Tyr Arg 90 Glu Leu His Asn Gin 95 Leu Ala 105 Phe Leu Tyr Ser Leu 110 Tyr Arg Ala Asp Asp Met Gly 125 Leu Gly Lys Ser Gly Met Phe 140 Asp Ala Ser Leu Pro Thr Asn 155 Leu Ile Asn Thr Trp 160 Pro Gly 170 Met Arg Vai Lys Thr 175 Phe Thr 185 Arg Asn Leu Asn Arg 190 Ile Gin Thr Tyr Gin Met Leu 205 Ile Asn Asn Gly Gin Glu Phe 220 Vai Trp Asp Tyr Ile Lys Thr 235 Ser Ser Thr Lys Ser 240 Ala Ser 250 Asn Arg Leu Leu Leu 255 Thr Gin 265 Glu Leu Trp Ser Leu 270 Phe Asp Gly Thr Leu Lys Thr 285 Phe Lys Met Ala Arg Glu Lys 300 Asp Ala Thr Pro Ile Ser Glu 315 Asn Leu Met Ala Ile 320 Thr Lys 330 Glu Asp Vai Gin Lys 335 Lys Leu 345 Asn Glu Lys Asn Pro 350 Asp Vai 225
Asp Ala Ile Cys Glu Met Pro Ser 355 360 Ile Trp Ile Arg Leu Vai Pro Leu 370 375 Vai Ser Leu Asp His Ile Lys Glu 385 390 Leu Ala Glu Leu Gly Vai Leu Lys 405 Leu Ser Ala Arg Ala Cys Cys Leu 420 Gin Asp Gly Asn Glu Gly Glu Asp 435 440 Gin Vai Thr Asp Asp Thr Leu Met 450 455 Leu Met Asp Leu Leu Lys Arg Leu 465 470 Vai Phe Ser Gin Ser Arg Gin Ile 485 Lys Asn Arg His Phe Lys Thr Leu 500 Leu Leu Glu Arg Glu Lys Arg Ile 515 520 Tyr Ser Vai Phe Leu Leu Thr Thr 530 535 Leu Thr Ala Ala Thr Arg Vai vai 545 550 Ala Thr Asp Ala Gin Ala Vai Asp 565 Glu Asn Vai Vai Vai Tyr Arg Leu 580 Lys Ile Tyr Arg Arg Gin Vai Phe 595 600 Thr Gly Glu Lys Lys Asn Pro Phe 610 615 Arg Glu Leu Phe Thr Ile Glu Asp 625 630 Gin Leu Gin Ser Leu His Ala Ala 645 Asp Glu HiS Ile Ala Tyr Leu Gin 660 Asp His Asp Leu Met Tyr Thr Cys 675 680 Asp Vai Vai Glu Glu Ser His Tyr 690 695 Gin Phe Leu Vai Glu Phe Glu Ser 705 710 Gin Gin Arg Thr Arg Asn Glu Gly 725 Pro Ser Ser Thr Lys Lys Lys Cys 740 Gin Pro Ser Pro Leu Leu Ser Thr 755 760 Ser Ser Lys Met Ala Ser Vai Vai 770 775 Glu Lys Gin Asp Leu Ser Ser Ile 785 790 Asp Gly Lys Gly Thr Gly Ser Ala 805 Gly Phe Gly Ser Vai Glu Glu Leu 820
Leu Ser Arg Lys Asn 365 Asp Leu Ile Gin Glu Glu Ile 380 Tyr Arg Lys Phe Leu Leu Met 395 Glu Thr Arg Ser Pro 400 Lys Leu 410 Cys Asp His Pro Arg 415 Leu Leu 425 Asn Leu Gly Thr Phe 430 Ser Ala Ser Pro Asp Vai Asp 445 His Ile Asp Glu Glu Ser Gly 460 Lys Met Ile Phe Arg Asp Glu 475 Gly His Gin Thr Leu 480 Leu Asn 490 Ile Ile Glu Arg Leu 495 Leu Arg 505 Ile Asp Gly Thr Vai 510 Thr His Asn Leu Phe Gin Gin 525 Asn Lys Asp Gin Vai Gly Gly 540 Vai Gly Leu Thr Ile Phe Asp 555 Pro Ser Trp Asn Pro 560 Arg Vai 570 Tyr Arg Ile Gly Gin 575 Lys Ile 585 Thr Cys Gly Thr Vai 590 Glu Glu Lys Asp Ser Leu Ile 605 Arg Gin Thr Arg Tyr Phe Ser 620 Lys Gin Glu Leu Leu Gin Asn 635 Ser Vai Thr Gin Leu 64 0 Gin Arg 650 Lys Ser Asp Ile Lys 655 Leu Ser 665 Leu Gly Ile Ala Gly 670 Ile Ser ASp Leu Ser Vai Lys 685 Glu Glu Leu Ile Gin Gin Arg 700 Vai Gin Lys Ala Gin Asn Lys 715 Glu Phe Leu Met Glu 720 Ala Trp 730 Leu Arg Glu Pro Vai 735 Phe Pro 74S Lys Leu Asn Lys Pro 750 Gin Pro His His Thr Gin Glu 765 Glu Asp Ile Ile Asp Asp Leu 780 Pro Lys Glu Gly Lys Vai Asn 795 Vai Thr Thr Leu Gin 800 Asp Ser 810 Ile Ala Thr Leu Pro 815 Lys Cys 825 Thr Asn Ser Ser Leu 830 Gly Met 226
Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Val Gin Lys Glu Thr Leu 835 840 845 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 8S0 855 860 Phe Asn Tyr Val Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn 865 870 875 880 Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro Trp 885 890 895 Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Val 900 905 910 Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 915 920 925 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 930 935 940 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 945 950 955 960 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Val Glu 965 970 975 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 980 985 990 val His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 995 1000 1005 Glu Pro Glu Glu Val Val Val Lys Ala Lys Ile Arg Ser Lys Ala Arg 1010 1015 1020 Arg Ile Val Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 1025 1030 1035 1040 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Val 1045 1050 1055 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 1060 1065 1070 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Val Asn Lys Ser Met Asn 1075 1080 1085 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Val Leu 1090 1095 1100 Asp His Val Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 1105 1110 1115 1120 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Val Glu Glu Ser Ser Gly 1125 1130 1135 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 1140 1145 1150 Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1155 1160 1165 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1170 1175 1180 Leu Val Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1185 1190 1195 1200 Glu Thr Leu Val Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1205 1210 1215 Gin Glu Ala Leu Asn Cys Leu Val Lys Ala Leu Asp Ile Lys Ser Ala 1220 1225 1230 Asp Pro Glu Val Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1235 1240 1245 227
<210> 25 <211> 1229 <212> PRT <213> Homo sapiens <4Ο0> 25
Met Glu Ala Ser Gin Gly Leu Ala Glu Vai Gly Thr Leu ser Pro Gin 228 1 5 10 15 Leu Ala Glu Ser Tyr Leu Arg Tyr Ser Gin Glu Ala Lys Glu Ala Ala 20 25 30 Lys Asn Gly Asp Leu Glu Glu Ala Leu Lys Leu Phe Asn Leu Ala Lys 35 40 45 Asp Ile Phe Pro Thr Lys Lys Val Ile Ser Arg Ile Gin Lys Leu Gin 50 55 60 Glu Ala Leu Glu Gin Leu Ala Glu Glu Glu Asp Asp Glu Phe Thr Asp 65 70 75 80 Vai Cys Asn Ser Gly Leu Leu Leu Tyr Arg Glu Leu Tyr Glu Lys Leu 85 90 95 Phe Glu His Gin Lys Glu Gly Ile Ala Phe Leu Tyr Ser Leu Tyr Lys 100 105 110 Asn Gly Arg Lys Gly Gly Ile Leu Ala Asp Asp Met Gly Leu Gly Lys 115 120 125 Thr Val Gin Ile Ile Ala Phe Leu Ser Gly Met Phe Asp Ala Ser Leu 130 135 140 val Asn His Val Leu Leu Ile Met Pro Thr Asn Leu Ile Asn Thr Trp 145 150 155 160 Val Lys Glu Phe Ala Lys Trp Thr Pro Gly Met Arg Val Lys Thr Phe 165 170 175 His Gly Ser Ser Lys Asn Glu Arg Ile Arg Asn Leu Thr Arg Ile Gin 180 185 190 Gin Arg Asn Gly Val Val Ile Thr Thr Tyr Gin Met Leu Leu Asn Asn 195 200 205 Trp Gin Gin Leu Ala ser Phe Asn Gly Gin Ala Phe Val Trp Asp Tyr 210 215 220 Val Ile Leu Asp Glu Ala His Lys Ile Lys Ser Ala Ser Thr Lys Ser 225 230 235 240 Ala Val Cys Ala Arg Ala Val Pro Ala Ser Asn Arg Leu Leu Leu Thr 245 250 255 Gly Thr Pro Ile Gin Asn Asn Leu Gin Glu Leu Trp Ser Leu Phe Asp 260 265 270 Phe Ala Cys Gin Gly Ser Leu Leu Gly Thr Leu Lys Thr Phe Lys Met 275 280 285 Glu Tyr Glu Asn Pro Ile Ile Arg Ala Arg Glu Lys Asp Ala Thr Pro 290 295 300 Gly Glu Lys Ala Leu Gly Phe Lys Met Ser Glu Asn Leu Met Glu Ile 305 310 315 320 Ile Lys Pro Tyr Phe Leu Arg Arg Thr Lys Glu Glu Val His Met Lys 325 330 335 Lys Ala Asp Lys Pro Glu Val Arg Pro Gly Glu Lys Asn Ser Gly Val 340 345 350 Glu Asp Ile Cys Glu Met Leu Ser Leu Thr Arg Lys Asn Asp Leu Ile 355 360 365 Val Trp Ile Arg Leu Val Pro Leu Gin Glu Glu Ile Tyr Arg Lys Phe 370 375 380 Val Ser Leu Asp His Ile Lys Glu Leu Leu Met Glu Thr Arg Ser Pro 385 390 395 400 Leu Ala Glu Leu Gly Val Leu Lys Lys Leu Cys Asp His Pro Arg Leu 405 410 415 Leu Ser Ala Arg Ala Cys His Leu Leu Asn Leu Gly Thr Val Thr Phe 420 425 430 Ser Ala Glu Asp Glu Asn Glu Gin Glu Asp Ala Ser Asn Met Gly Ser 435 440 445 Ile Asp His Leu Ser Asp Asn Ala Leu Met Gin Glu Ser Gly Lys Met 450 455 460 Ile Phe Leu Met Ala Leu Leu Glu Arg Leu Gin Asp Glu Gly His Gin 465 470 475 480 Thr Leu Val Phe Ser Gin Ser Arg Gin Ile Leu Asn Ile Ile Glu Arg 229
Leu Leu Lys Asn 500 Thr His Leu 515 Trp Lys Glu 530 Tyr Ser Leu 54 5 Thr Leu Thr Asn Pro Ala Thr Gin Lys Glu Asn 580 Glu Glu Lys 595 Ile Gin Thr 610 Thr Gly Glu 625 Leu Lys Glu Gin Met Gin Leu Lys Leu Asp Glu 660 Ile Ser Asp 675 His Glu Leu 690 Asp Met Lys 705 Ala Gin Phe Pro Ser Glu Glu Arg Lys Lys Gly 740 Asn Pro Thr 755 Gin Ile Tyr 770 Asp Gin His 785 Asp Vai Thr Ser Asp Ala Gly >1 H O Gly Vai Trp 820 Ala Asp Asn 835 Glu Gin Glu 850 Ala Leu Gin 865 Ser Ser Lys Vai Vai Leu Tyr Glu Ser Asn Glu 900 Pro Ser Ala 915 Leu Lys Lys 930 Asp Pro Leu 945 Phe Leu Glu Phe Leu Glu His 485 Lys His Phe Lys Glu Arg Glu Lys Vai Phe Leu 520 Leu Ala Ala 535 Ser Arg Asp 550 Ala Gin Ala 565 Vai Vai Vai Tyr Tyr Arg Arg Gin Asp Lys Lys 600 Asn Leu Phe 615 Thr Vai Gin 630 Cys Leu His 645 His Ile Ala Tyr Asp Leu Met Phe Leu Glu Asp 680 Ala Leu Vai 695 Glu Ser Asn 710 Trp Leu Lys 725 Asn Lys Pro Gin Vai Glu Ala Ile Ser Thr Glu 760 Ser Ser Leu 775 Gin Gly Thr 790 Ile Ala Ser 805 Thr Asp Ser Leu Ala Vai Gin Lys Ser Glu Asn 840 Leu Ala Asp S55 Leu Glu His 870 Gin Ser Pro 885 Pro Met Ile Glu Gin Gly Ala Gin Leu Glu Ser 920 Pro Asp Ser 935 Ala Asp Vai 950 Glu Lys Glu
Thr 490 Leu Arg Ile 505 Arg Ile Gin Leu Thr Thr Gin Vai Vai Vai Ile 540 Phe Vai Asp 555 Arg Vai Arg 570 Leu Ile Thr 585 Vai Phe Lys Asp Pro Phe Arg Tyr Gly Asp Leu 620 Leu Ala Ala 635 Gin Arg Leu 650 His Ser Leu 665 Thr Cys Asp Leu Gin Tyr Ile Gin Glu Ser Gin 700 Asn Ala Gin 715 Glu Phe Pro 730 Gin Pro Ser 745 Ser Ser Gin Met Glu Pro Gin Glu Asp Gin His 780 His Leu Pro 795 Gin Gly Leu 810 Ser Pro Ala 825 Asn Glu Leu Gin Gly Ser Phe His Pro Asn Leu 860 Asp Thr Ala 875 Asn Glu Ile 890 Ser Asp Asp 905 Ala Met Glu Ala Pro Gin Tyr Glu Thr Arg Gin 940 Asn Asn Ser 955 Leu Gin
Asp Gly 495 Thr Vai Phe 510 Gin Gin Asn 525 Gly Gly Vai Gly Asp Pro Ser Trp Tyr Arg 560 Ile Gly Cys Gly 575 Thr Vai Ser 590 Leu Ile Arg 605 Phe Thr Lys Gin Asn Ser Ala Thr Lys Ser Asp 640 Glu Gly Ile 655 AIq Gly Ser 670 Vai Lys Glu 685 His Arg Vai Gin Thr Lys Glu Arg Pro Ser Gin 720 Gin Arg Leu 735 Leu Ala Ala 750 Ser Ile Ser 765 Leu Ser Glu Ala Phe Glu Ser Thr Ala Glu Ser 800 Ile Lys Gly 815 Phe Ala Ala 830 Ser Pro Gly 845 Tyr Leu Pro Arg Vai Gin Asp Ser Asn Gin Asn 830 Leu Leu Ser 895 Ala Ser Gin 910 Leu Glu Leu 925 Cys Asp Phe Asn Leu Ser Ser Lys Arg Pro Ala 960 Gly 230 965 970 975 Asn Ser Gly Glu Glu Ser Ala His Asn Leu Ser Leu Asp Ser Ser Asn 980 985 990 Lys Ile Asp Glu Glu Ser Glu Vai Ile Thr Vai Lys Thr Lys Asn Lys 995 1000 1005 Ala Arg Arg Ile Leu Ser Asp Asp Glu Asp Glu Glu Asp Ala Phe Lys 1010 1015 1020 Asp Thr Ser Thr Asn Ser Phe Ser Vai Ser Pro Leu Thr Phe Ser Ser 1025 1030 1035 1040 Vai Lys His Phe Asp Ala Ser Thr Pro Gin Asn Asp Ser Asn Pro Ser 1045 1050 1055 Arg Arg Phe Phe Ser Pro Lys Ile Pro Asp Asp Vai Asn Thr Ser Leu 1060 1065 1070 His Pro Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Vai Vai 1075 1080 1085 Leu Asp Asp Met Glu Asp Met Glu Glu Arg Leu Asp Thr Ser Ser Glu 1090 1095 1100 Glu Glu Ser Glu Pro Glu Leu Ser Glu Asp Ser Asn Glu Glu Ala Vai 1105 1110 1115 1120 Ala Cys Thr Glu Glu Gin Arg Ser Gly Ala Thr Leu Ala Ser Gly Asn 1125 1130 1135 Lys His Ser Ser Leu Thr Glu Ser Glu Pro Thr Ser Pro Ala Pro Gin 1140 1145 1150 Ser Ser Pro Cys Ala Pro Glu Pro Ser Ser Ser Asp Pro Leu Leu Asp 1155 1160 1165 Pro Pro Gin Asp Pro Ala Vai Glu Ala Ala Asn Asp Tyr Glu Ser Leu 1170 1175 1180 Vai Ala Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Thr Gin Glu Ala 1185 1190 1195 1200 Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser Ala Asp Pro Glu 1205 1210 1215 Vai Met Arg Met Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1220 1225
<210> 26 <211> 14 <212> PRT <213> Clostridium tetani <400> 26
Gin Tyr Ile Lys Ala Asn Ser Lys Phe Ile Gly Ile Thr Glu 15 10 <210> 27 <211> 21 <212> PRT <213> Plasmodlum falciparum <400> 27
Asp Ile Glu Lys Lys Ile Ala Lys Met Glu Lys Ala Ser Ser Vai Phe 15 10 15
Asn Vai Vai Asn Ser 20 231
<210> 28 <211> 16 <212> PRT <213> Streptococcus aureus <4Ο0> 28
Gly Ala Vai Asp Ser Ile Leu Gly Gly Vai Ala Thr Tyr Gly Ala Ala 15 10 15 <210> 29 <211> 12
<212> PRT <213> Sequência artificial <220> <221> VARIANTE <222> 3 <223> Xaa ou é ciclohexilalanina, fenilalanina, ou tirosina <221> VARIANTE <222> 1, 13 <223> Xaa é ou D-alanina ou L-alanina <223> Péptido sintetizado artificialmente <400> 29
Xaa Lys Xaa Vai Ala Ala Trp Thr Leu Lys Ala Xaa 1 5 10 <210> 30 <211> 14
<212> ADN <213> Homo sapiens <400> 30 ttttgatcaa gctt 14
<210> 31 <211> 42 <212> ADN 232 <213> Homo sapiens <400> 31 ctaatacgac tcactatagg gctcgagcgg ccgcccgggc ag 42 <210> 32 <211> 12 <212> ADN <213> Homo sapiens <400> 32 gatcctgccc gg 12 <210> 33 <211> 40 <212> ADN <213> Homo sapiens <400> 33 gtaatacgac tcactatagg gcagcgtggt cgcggccgag 40 <210> 34 <211> 10 <212> ADN <213> Homo sapiens <400> 34 gatcctcggc 10 <210> 35 <211> 22 <212> ADN <213> Homo sapiens <400> 35 233 ctaatacgac tcactatagg gc 22 <210> 36 <211> 22 <212> ADN <213> Homo sapiens <400> 36 tcgagcggcc gcccgggcag ga 22 <210> 37 <211> 20 <212> ADN <213> Homo sapiens <400> 37 agcgtggtcg cggccgagga 20 <210> 38 <211> 25 <212> ADN <213> Homo sapiens <400> 38 atatcgccgc gctcgtcgtc gacaa 25 <210> 39 <211> 26 <212> ADN <213> Homo sapiens <400> 39 agccacacgc agctcattgt agaagg 26 <210> 40 234
<211> 27 <212> ADN <213> Homo sapiens <400> 40 gctagtgctc agaataccag actatgg 27
<210> 41 <211> 25 <212> ADN <213> Homo sapiens <400> 41 cgcttgacat aaaaagtgca gatcc 25
<210> 42 <211> 24 <212> ADN <213> Homo sapiens <400> 42
gattacaagg atgacgacga taag 24 <210> 43 <211> 4 <212> PRT <213> Homo sapiens <400> 43 ftsn Vai Thr Thr 1
<210> 44 <211> 4 <212> PRT <213> Homo sapiens 235 <400> 44 Asn Ser Ser Leu 1 <210> 45 <211> 4 <212> PRT <213> Homo sapiens <400> 45 Asn Glu Ser Gin 1 <210> 46 <211> 4 <212> PRT <213> Homo sapiens <400> 46 Asn Vai Ser Ile 1 <210> 47 <211> 4 <212> PRT <213> Homo sapiens <400> 47 Asn Phe Ser Ser 1 <210> 48 <211> 4 <212> PRT <213> Homo sapiens <400> 48 Asn Thr Ser Leu 1 236
<210> 49 <211> 4 <212> PRT <213> Homo sapiens <4Ο Ο> 49
Asn Lys Ser Met 1
<210> 50 <211> 4 <212> PRT <213> Homo sapiens <400> 50
Asn Lys Ser Ser 1
<210> 51 <211> 15 <212> PRT <213> Homo sapiens <400> 51
Glu Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu 15 10 15
<210> 52 <211> 15 <212> PRT <213> Homo sapiens <400> 52
Ser Ser Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly 15 10 15
<210> 53 <211> 19 <212> PRT 237 <213> Homo sapiens <400> 53
Ala Ala Glu Ala Thr Asn Asp Tyr Glu Thr Leu vai Lys Arg Gly Lys 15 10 15
Lys Lys Ser
<210> 54 <211> 4 <212> PRT <213> Homo sapiens <400> 54 Lys Lys Lys Ser 1
<210> 55 <211> 4 <212> PRT <213> Homo sapiens <400> 55 Lys Lys Ser Ser 1
<210> 56 <211> 4 <212> PRT <213> Homo sapiens <400> 56 Ser Lys Asp Glu 1
<210> 57 <211> 4 <212> PRT <213> Homo sapiens <400> 57
Ser Leu Phe Asp 1
<210> 58 <211> 4 <212> PRT 238
<213> Homo sapiens <40 0> 58 Thr Pro Gly Glu 1 <210> 59 <211 > 4 <212> PRT <213> Homo sapiens <400> 59 Thr Lys Glu Asp 1 <210> 60 <211> 4 <212> PRT <213> Homo sapiens <4 0 0> 60 Ser Asn Pro Glu 1 <210> 61 <211 > 4 <212> PRT <213> Homo sapiens <400> 61 Ser Ala Gin Asp 1 <210> 62 <211> 4 <212> PRT <213> Homo sapiens <4 0 0> 62 Thr Leu Met Glu 1 <210> 63 <211 > 4 <212> PRT 239 <213> Homo sapiens <400> 63
Thr Vai Glu Glu 1
<210> 64 <211> 4 <212> PRT <213> Homo sapiens <400> 64 Thr Thr Gly Glu 1
<210> 65 <211> 4 <212> PRT <213> Homo sapiens <400> 65
Ser Lys Gin Glu 1
<210> 66 <211> 4 <212> PRT <213> Homo sapiens <400> 6 6 Thr Ile Glu Asp 1
<210> 67 <211> 4 <212> PRT <213> Homo sapiens <400> 67
Ser Asp His Asp 1
<210> 68 <211> 4 <212> PRT 240 <213> Homo sapiens <400> 68
Ser Val Lys Glu 1
<210> 69 <211> 4 <212> PRT <213> Homo sapiens <400> 6 9 Thr Arg Asn Glu 1
<210> 70 <211> 4 <212> PRT <213> Homo sapiens <400> 70 Thr Gin Glu Glu 1
<210> 71 <211> 4 <212> PRT <213> Homo sapiens <400> 71 Thr Leu Gin Asp 1
<210> 72 <211> 4 <212> PRT <213> Homo sapiens <400> 72
Ser Val Glu Glu 1
<210> 73 <211> 4 <212> PRT 241
<213> Homo sapiens <4 0 0> 73 Thr Lys Asn Glu 1 <210> 74 <211 > 4 <212> PRT <213> Homo sapiens <400> 74 Thr Leu Gin Glu 1 <210> 75 <211> 4 <212> PRT <213> Homo sapiens <40 0> 75 Thr Lys Ala Asp 1 <210> 76 <211 > 4 <212> PRT <213> Homo sapiens <400> 76 Ser Ile Ile Glu 1 <210> 77 <211> 4 <212> PRT <213> Homo sapiens <400> 77 Ser Glu Lys Asp 1 <210> 78 <211> 4 <212> PRT 242 <213> Homo sapiens <400> 78
Ser Asp Gly Glu 1
<210> 79 <211> 4 <212> PRT <213> Homo sapiens <400> 79 Ser Phe Lys Asp 1
<210> 80 <211> 4 <212> PRT <213> Homo sapiens <400> 80
Ser Ser Gly Glu 1
<210> 81 <211> 4 <212> PRT <213> Homo sapiens <400> 81 Thr Glu Glu Asp 1
<210> 82 <211> 4 <212> PRT <213> Homo sapiens <400> 82 Ser Pro Gin Asp 1
<210> 83 <211> 8 <212> PRT
243 <213> Homo sapiens <400> 83 Lys Leu Asp Glu His Ile Ala Tyr 1 5 <210> 84 <211> 6 <212> PRT <213> Homo sapiens <400> 84 Gly Gly Ile Leu Ala Asp 1 5 <210> 85 <211> 6 <212> PRT <213> Homo sapiens <400> 85 Gly Leu Gly Lys Thr Vai 1 5 <210> 86 <211> 6 <212> PRT <213> Homo sapiens <400> 86 Gly Met Phe Asp Ala Ser 1 5 <210> 87 <211> 6 <212> PRT <213> Homo sapiens <400> 87 Gly Vai Ile Ile Thr Thr 1 5 <210> 88 <211> 6 <212> PRT 244 <213> Homo sapiens <400> Gly Ser 1 88 Leu Leu Gly Thr 5 <210> 89 <211> 6 <212> PRT <213> Homo sapiens <400> Gly Thr 1 89 Leu Lys Thr Phe 5 <210> 90 <211> 6 <212> PRT <213> Homo sapiens <400> 90
Gly ThrPhe Ser Ala Gin
<210> 91 <211> 6 <212> PRT <213> Homo sapiens <400> Gly Vai 1 91 Gly Leu Thr Leu 5 <210> 92 <211> 6 <212> PRT <213> Homo sapiens <400> Gly Leu 1 92 Thr Leu Thr ftla 5 <210> 93 <211> 6 <212> PRT 245 <213> Homo sapiens <400> 93
Gly Gin Lys Glu Asn Vai 1 5 <210> 94 <211> 6
<212> PRT <213> Homo sapiens <400> 94
Gly Thr Gly Ser Ala Asp 1 5
<210> 95 <211> 6 <212> PRT <213> Homo sapiens <400> 95
Gly Ser Ala Asp Ser Ile 1 5
<210> 96 <211> 6 <212> PRT <213> Homo sapiens <400> 9 6
Gly Met Glu Lys Ser Phe 1 5 <210> 97 <211> 6
<212> PRT <213> Homo sapiens <400> 97
Gly Ser Ala Pro Asn Ser 1 5 <210> 98 <211> 6
<212> PRT 246 <213> Homo sapiens <400> 98
Gly Vai Glu Glu Ser Ser 1 5
<210> 99 <211> 4 <212> PRT <213> Homo sapiens <400> 99 Asp Gly Arg Lys 1
<210> 100 <211> 1250 <212> PRT <213> Homo sapiens <400> 100
Met Glu Ala Ser Arg Arg Phe Pro 1 5 Gin Ala Ala His Tyr Leu Arg Tyr 20 Lys Asn Gly Asp Leu Glu Glu Ala 35 40 Asp Ile Phe Pro Asn Glu Lys Vai 50 55 Glu Ala Leu Glu Glu Leu Ala Glu 65 70 Vai Cys Asn Ser Gly Leu Leu Leu 85 Phe Glu His Gin Lys Glu Gly Ile 100 Asp Gly Arg Lys Gly Gly Ile Leu 115 120 Thr Vai Gin Ile Ile Ala Phe Leu 130 135 Vai Asn His Vai Leu Leu Ile Met
Glu Ala 10 Glu Ala Leu Ser Pro 15 Glu Vai 25 Lys Glu Ala Lys Glu 30 Ala Thr Phe Lys Leu Phe Asn 45 Leu Ala Lys Leu Ser Arg Ile 60 Gin Lys Ile Gin Gin Gly Asp 75 Asp Glu Phe Thr Asp 80 Tyr Arg 90 Glu Leu His Asn Gin 95 Leu Ala 105 Phe Leu Tyr Ser Leu 110 Tyr Arg Ala Asp Asp Met Gly 125 Leu Gly Lys Ser Gly Met Phe 140 Asp Ala Ser Leu Pro Thr Asn Leu Ile Asn Thr Trp 247 145 150 Vai Lys Glu Phe Ile Lys Trp Thr 165 His G1y Pro Ser Lys Asp Glu Arg 180 Gin Arg Asn Gly Vai Ile Ile Thr 195 200 Trp Gin Gin Leu Ser Ser Phe Arg 210 215 Vai Ile Leu Asp Glu Ala His Lys 225 230 Ala Ile Cys Ala Arg Ala Ile Pro 245 Gly Thr Pro Ile Gin Asn Asn Leu 260 Phe Ala Cys Gin Gly Ser Leu Leu 275 280 Glu Tyr Glu Asn Pro Ile Thr Arg 290 295 Gly Glu Lys Ala Leu Gly Phe Lys 305 310 Ile Lys Pro Tyr Phe Leu Arg Arg 325 Lys Ser Ser Asn Pro Glu Ala Arg 340 Asp Ala Ile Cys Glu Met Pro Ser 355 360 Ile Trp Ile Arg Leu Val Pro Leu 370 375 Vai Ser Leu Asp His Ile Lys Glu 385 390 Leu Ala Glu Leu Gly Val Leu Lys 405 Leu Ser Ala Arg Ala Cys Cys Leu 420 Gin Asp Gly Asn Glu Gly Glu Asp 435 440 Gin Vai Thr Asp Asp Thr Leu Met 450 455 Leu Met Asp Leu Leu Lys Arg Leu 465 470 Vai Phe Ser Gin Ser Arg Gin ile 485 Lys Asn Arg His Phe Lys Thr Leu 500 Leu Leu Glu Arg Glu Lys Arg Ile 515 520 Tyr Ser Vai Phe Leu Leu Thr Thr 530 535 Leu Thr Ala Ala Thr Arg Val Val 545 550 Ala Thr Asp Ala Gin Ala Val Asp 565 Glu Asn Vai Vai Vai Tyr Arg Leu 580 Lys Ile Tyr Arg Arg Gin Val Phe 595 600 Thr Gly Glu Lys Lys Asn Pro Phe 610 615 Arg Glu Leu Phe Thr Ile Glu Asp 625 630 155 160 Pro Gly 170 Met Arg Val Lys Thr 175 Phe Thr 185 Arg Asn Leu Asn Arg 190 Ile Gin Thr Tyr Gin Met Leu 205 Ile Asn Asn Gly Gin Glu Phe 220 Val Trp Asp Tyr Ile Lys Thr 235 Ser Ser Thr Lys Ser 240 Ala Ser 250 Asn Arg Leu Leu Leu 255 Thr Gin 2 65 Glu Leu Trp Ser Leu 270 Phe Asp Gly Thr Leu Lys Thr 285 Phe Lys Met Ala Arg Glu Lys 300 Asp Ala Thr Pro Ile Ser Glu 315 Asn Leu Met Ala Ile 320 Thr Lys 330 Glu Asp Val Gin Lys 335 Lys Leu 345 Asn Glu Lys Asn Pro 350 Asp Val Leu Ser Arg Lys Asn 365 Asp Leu Ile Gin Glu Glu Ile 380 Tyr Arg Lys Phe Leu Leu Met 395 Glu Thr Arg Ser Pro 4 00 Lys Leu 410 Cys Asp His Pro Arg 415 Leu Leu 425 Asn Leu Gly Thr Phe 430 Ser Ala Ser Pro Asp Val Asp 445 His Ile Asp Glu Glu Ser Gly 460 Lys Met Ile Phe Arg Asp Glu 475 Gly His Gin Thr Leu 480 Leu Asn 490 Ile Ile Glu Arg Leu 495 Leu Arg 505 Ile Asp Gly Thr Val 510 Thr His Asn Leu Phe Gin Gin 525 Asn Lys Asp Gin Val Gly Gly 540 Val Gly Leu Thr Ile Phe Asp 555 Pro Ser Trp Asn Pro 560 Arg Val 570 Tyr Arg Ile Gly Gin 575 Lys Ile 585 Thr Cys Gly Thr Val 590 Glu Glu Lys Asp Ser Leu Ile 605 Arg Gin Thr Arg Tyr Phe Ser 620 Lys Gin Glu Leu Leu Gin Asn 635 Ser Val Thr Gin Leu 640 248
Gin Leu Gin Ser Leu His Ala Ala Gin Arg Lys Ser Asp Ile Lys Leu 645 650 655 Asp Glu His Ile Ala Tyr Leu Gin Ser Leu Gly Ile Ala Gly Ile Ser 660 665 670 Asp His Asp Leu Met Tyr Thr Cys Asp Leu Ser Vai Lys Glu Glu Leu 675 680 685 Asp Vai Vai Glu Glu Ser His Tyr Ile Gin Gin Arg Vai Gin Lys Ala 690 695 700 Gin Phe Leu Vai Glu Phe Glu Ser Gin Asn Lys Glu Phe Leu Met Glu 705 710 715 720 Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu Arg Glu Pro Vai Phe 725 730 735 Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu Asn Lys Pro Gin Pro 740 745 750 Gin Pro Ser Pro Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile 755 760 765 Ser Ser Lys Met Ala Ser Vai Vai Ile Asp Asp Leu Pro Lys Glu Gly 770 775 780 Glu Lys Gin Asp Leu Ser Ser Ile Lys Vai Asn Vai Thr Thr Leu Gin 785 790 795 800 Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys 805 810 815 Gly Phe Gly Ser Vai Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 820 825 830 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr Leu 835 840 845 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 850 855 860 Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn 865 870 875 880 Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro Trp 885 890 895 Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Vai 900 905 910 Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 915 920 925 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 930 935 940 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 945 950 955 960 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai Glu 965 97 0 975 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 980 985 990 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 995 1000 1005 Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala Arg 1010 1015 1020 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 1025 1030 1035 1040 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Vai 1045 1050 1055 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 1060 1065 1070 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met Asn 1075 1080 1085 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai Leu 1090 1095 1100 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 1105 1110 1115 1120 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser Gly 249 1125 1130 1135
Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 1140 1145 1150
Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1155 1160 1165
Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1170 1175 1180
Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1185 1190 1195 1200
Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1205 1210 1215
Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser Ala 1220 1225 1230
Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1235 1240 1245
Asn Asn 1250
<210> 101 <211> 17 <212> PRT <213> Homo sapiens <400> 101
Phe Ile Lys Trp Thr Pro Gly Met Gly Vai Lys Thr Phe His Gly Pro 15 10 15
Ser
<210> 102 <211> 19 <212> PRT <213> Homo sapiens <400> 102
Glu Phe Ile Lys Trp Thr Pro Gly Met Gly Vai Lys Thr Phe His Gly 15 10 15
Pro Ser Lys
<210> 103 <211> 29 <212> PRT <213> Homo sapiens <400> 103
Asn Thr Trp Vai Lys Glu Phe Ile Lys Trp Thr Pro Gly Met Gly Vai 15 10 15
Lys Thr Phe His Gly Pro Ser Lys Asp Glu Arg Thr Arg 20 25 <210> 104 250
<211> 17 <212> PRT <213> Homo sapiens <400> 104
Cys Glu Met Pro Ser Leu Ser Arg Arg Asn Asp Leu Ile Ile Trp He 15 10 15
Arg <210> 105
<211> 19 <212> PRT <213> Homo sapiens <400> 105
Ile Cys Glu Met Pro Ser Leu Ser Arg Arg Asn Asp Leu Ile Ile Trp 15 10 15
Ile Arg Leu <210> 106 <211> 29
<212> PRT <213> Homo sapiens <400> 106
Pro Asp Vai Asp Ala Ile Cys Glu Met Pro Ser Leu Ser Arg Arg Asn 15 10 15
Asp Leu Ile Ile Trp Ile Arg Leu vai Pro Leu Gin Glu 20 25
<210> 107 <211> 17 <212> PRT <213> Homo sapiens <400> 107
Leu Asp Gin Leu Lys Asp Asp Glu Vai Leu Arg His Cys Asn Pro Trp 15 10 is
Pro
<210> 108 <211> 19 <212> PRT <213> Homo sapiens 251 <400> 108
Asn Leu Asp Gin Leu Lys Asp Asp Glu Vai Leu Arg His Cys Asn Pro 15 10 15
Trp Pro Ile <210> 109 <211> 29
<212> PRT <213> Homo sapiens <400> 109
Ala Asp Ile Gly Pro Asn Leu Asp Gin Leu Lys Asp Asp Glu Vai Leu 15 10 15
Arg His Cys Asn Pro Trp Pro Ile Ile Ser Ile Thr Asn 20 25
<210> 110 <211> 4334 <212> ADN <213> Homo sapiens <400> 110 252 atgcgcgggg cgggagtgag cgaaattcaa gctccaaact ctaagctcca agctccaagc 60 tccaagctcc aagctccaaa ctcccgccgg ggtaactgga acccaatccg agggtcatgg 120 aggcatcccg aaggtttccg gaagccgagg ccttgagccc agagcaggct gctcattacc 180 taagggtctt gctgtgtcgc ccagactgga attcagtggc ctgatcatag ttcactgcag 240 cctcgaactc ctgggctcaa gcagtcctcc tgccccagcc tccctagtag ctgggactta 300 agatatgtga aagaggccaa agaagcaact aagaatggag acctggaaga agcatttaaa 360 cttttcaatt tggcaaagga catttttccc aatgaaaaag tgctgagcag aatccaaaaa 420 atacaggaag ccttggagga gttggcagaa cagggagatg atgaatttac agatgtgtgc 480 aactctggct tgctacttta tcgagaactg cacaaccaac tctttgagca ccagaaggaa 540 ggcatagctt tcctctatag cctgtatagg gatggaagaa aaggtggtat attggctgat 600 gatatgggat tagggaagac tgttcaaatc attgctttcc tttccggtat gtttgatgca 660 tcacttgtga atcatgtgct gctgatcatg ccaaccaatc ttattaacac atgggtaaaa 720 gaattcatca agtggactcc aggaatgaga gtcaaaacct ttcatggtcc tagcaaggat 780 gaacggacca gaaacctcaa tcggattcag caaaggaatg gtgttattat cactacatac 840 caaatgttaa tcaataactg gcagcaactt tcaagcttta ggggccaaga gtttgtgtgg 900 gactatgtca tcctcgatga agcacataaa ataaaaacct catctactaa gtcagcaata 960 tgtgctcgtg ctattcctgc aagtaatcgc ctcctcctca caggaacccc aatccagaat 1020 aatttacaag aactatggtc cctatttgat tttgcttgtc aagggtccct gctgggaaca 1080 ttaaaaactt ttaagatgga gtatgaaaat cctattacta gagcaagaga gaaggatgct 1140 accccaggag aaaaagcctt gggatttaaa atatctgaaa acttaatggc aatcataaaa 1200 ccctattttc tcaggaggac taaagaagac gtacagaaga aaaagtcaag caacccagag 1260 gccagactta atgaaaagaa tccagatgtt gatgccattt gtgaaatgcc ttccctttcc 1320 aggaaaaatg atttaattat ttggatacga cttgtgcctt tacaagaaga aatatacagg 1380 aaatttgtgt ctttagatca tatcaaggag ttgctaatgg agacgcgctc acctttggct 1440 gagctaggtg tcttaaagaa gctgtgtgat catcctaggc tgctgtctgc acgggcttgt 1500 tgtttgctaa atcttgggac attctctgct caagatggaa atgaggggga agattcccca 1560 gatgtggacc atattgatca agtaactgat gacacattga tggaagaatc tggaaaaatg 1620 atattcctaa tggacctact taagaggctg cgagatgagg gacatcaaac tctggtgttt 1680 tctcaatcga ggcaaattct aaacatcatt gaacgcctct taaagaatag gcactttaag 1740 acattgcgaa tcgatgggac agttactcat cttttggaac gagaaaaaag aattaactta 1800 ttccagcaaa ataaagatta ctctgttttt ctgcttacca ctcaagtagg tggtgtcggt 1860 ttaacattaa ctgcagcaac tagagtggtc atttttgacc ctagctggaa tcctgcaact 1920 gatgctcaag ctgtggatag agtttaccga attggacaaa aagagaatgt tgtggtttat 1980 aggctaatca cttgtgggac tgtagaggaa aaaatataca gaagacaggt tttcaaggac 2040 tcattaataa gacaaactac tggtgaaaaa aagaaccctt tccgatattt tagtaaacaa 2100 gaattaagag agctctttac aatcgaggat cttcagaact ctgtaaccca gctgcagctt 2160 cagtctttgc atgctgctca gaggaaatct gatataaaac tagatgaaca tattgcctac 2220 ctgcagtctt tggggatagc tggaatctca gaccatgatt tgatgtacac atgtgatctg 2280 tctgttaaag aagagcttga tgtggtagaa gaatctcact atattcaaca aagggttcag 2340 aaagctcaat tcctcgttga attcgagtct caaaataaag agttcctgat ggaacaacaa 2400 agaactagaa atgagggggc ctggctaaga gaacctgtat ttccttcttc aacaaagaag 2460 aaatgcccta aattgaataa accacagcct cagccttcac ctcttctaag tactcatcat 2520 actcaggaag aagatatcag ttccaaaatg gcaagtgtag tcattgatga tctgcccaaa 2580 gagggtgaga aacaagatct ctccagtata aaggtgaatg ttaccacctt gcaagatggt 2640 aaaggtacag gtagtgctga ctctatagct actttaccaa aggggtttgg aagtgtagaa 2700 gaactttgta ctaactcttc attgggaatg gaaaaaagct ttgcaactaa aaatgaagct 2760 gtacaaaaag agacattaca agaggggcct aagcaagagg cactgcaaga ggatcctctg 2820 gaaagtttta attatgtact tagcaaatca accaaagctg atattgggcc aaatttagat 2880 caactaaagg atgatgagat tttacgtcat tgcaatcctt ggcccattat ttccataaca 2940 253 aatgaaagtc aaaatgcaga atcaaatgta gcatcccata gtgcactgca ggatgctcaa tcagcatctt caccacagta tgcatgtgat aacagacaaa atttttccag tcagtcttta ggctctgcac ctaattccag agcagggttt ttttctgaga aagacgatga accagaagaa gctagaagga ttgtttcaga tggcgaagat ataaatccat tcaacacatc tctctttcaa actcccaaaa atgacatcag tccaccagga gtaaataagt ctatgaactc tagaagatct gttttagacc acgtggagga catggaggaa cctgaagatt atccagaaga aggggtggag gaagaggatc cttccggaga aacactgtct tctaagccta gtgctctagc tcaagagacc gaacagttgg ttggttctCC ccaggataag cttgtaaagc gtggaaaaga actaaaagag ttagttaaag cgcttgacat aaaaagtgca ttgtataagc aacttaataa caattgagaa actgaatatg agggaatttt tgttcccata ggcttaaggc aagaaagatc tcaaaaagca agtctggtat tctgagcact agcttaatat catattctat aaatttaact gtgttgtttc ttcttaattt tactctgaaa gtgatcatct aagttacttt tctc tccattattg aaatagctga tgacctttca 3000 gcaagtgagg ccaagttgga agaggaacct 3060 ttcaatcttt tcttggaaga ctcagcagac 3120 gagcatgttg agaaagaaaa tagcttgtgt 3180 gtgcatagca aaacatgtct cagttgggag 3240 gtagtagtta aagcaaaaat cagaagtaaa 3300 gaagatgatt cttttaaaga tacctcaagc 3360 ttctcatctg tgaaacaatt tgatgcttca 3420 aggttctttt catctcaaat acccagtagt 3480 ctggcttcta ggaggtctct tattaatatg 3540 agacttgacg acagcagtga agcaaagggt 3600 gaaagcagtg gcgaagcctc caagtataca 3660 tcagaaaaca agtccagctg gttaatgacg 3720 tctcttggtg cccctgagcc tttgtctggt 3780 gcggcagagg ctacaaatga ctatgagact 3840 tgtggaaaaa tccaggaggc cctaaactgc 3900 gatcctgaag ttatgctctt gactttaagt 3960 tgtaacctgt ttattgtatt ttaaagtgaa 4020 attggattct ttgggaacat gaagcattca 4080 acttctgccc tgcaacgccc cccactccat 4140 ttcttcactt gaatattctt atattttagg 4200 ttggaaagtt ttgtaaaatt attctggtca 4260 ttgtatataa cagttcagat aagaaaatta 4320 4334
<210> 111 <211> 4312 <212> ADN <213> Homo sapiens <400> 111 254 aaattcaagc tccaaactct aagctccaag ctccaagctc caagctccaa gctccaaact 60 cccgccgggg taactggaac ccaatccgag ggtcatggag gcatcccgaa ggtttccgga 120 agccgaggcc ttgagcccag agcaggctgc tcattaccta agggtcttgc tgtgtcgccc 180 agactggaat tcagtggcct gatcatagtt cactgcagcc tcgaactcct gggctcaagc 240 agtcctcctg ccccagcctc cctagtagct gggacttaag atatgtgaaa gaggccaaag 300 aagcaactaa gaatggagac ctggaagaag catttaaact tttcaatttg gcaaaggaca 360 tttttcccaa tgaaaaagtg ctgagcagaa tccaaaaaat acaggaagcc ttggaggagt 420 tggcagaaca gggagatgat gaatttacag atgtgtgcaa ctctggcttg ctactttatc 480 gagaactgca caaccaactc tttgagcacc agaaggaagg catagctttc ctctatagcc 540 tgtataggga tggaagaaaa ggtggtatat tggctgatga tatgggatta gggaagactg 600 ttcaaatcat tgctttcctt tccggtatgt ttgatgcatc acttgtgaat catgtgctgc 660 tgatcatgcc aaccaatctt attaacacat gggtaaaaga attcatcaag tggactccag 720 gaatgagagt caaaaccttt catggtccta gcaaggatga acggaccaga aacctcaatc 780 ggattcagca aaggaatggt gttattatca ctaoatacca aatgttaatc aataactggc 840 agcaactttc aagctttagg ggccaagagt ttgtgtggga ctatgtcatc ctcgatgaag 900 cacataaaat aaaaacctca tctactaagt cagcaatatg tgctcgtgct attcctgcaa 960 gtaatcgcct cctcctcaca ggaaccccaa tccagaataa tttacaagaa ctatggtccc 1020 tatttgattt tgcttgtcaa gggtccctgc tgggaacatt aaaaactttt aagatggagt 1080 atgaaaatcc tattactaga gcaagagaga aggatgctac cccaggagaa aaagccttgg 1140 gatttaaaat atctgaaaac ttaatggcaa tcataaaacc ctattttctc aggaggacta 1200 aagaagacgt acagaagaaa aagtcaagca acccagaggc cagacttaat gaaaagaatc 1260 cagatgttga tgccatttgt gaaatgcctt ccctttccag gaaaaatgat ttaattattt 1320 ggatacgact tgtgccttta caagaagaaa tatacaggaa atttgtgtct ttagatcata 1380 tcaaggagtt gctaatggag acgcgctcac ctttggctga gctaggtgtc ttaaagaagc 1440 tgtgtgatca tcctaggctg ctgtctgcac gggcttgttg tttgctaaat cttgggacat 1500 tctctgctca agatggaaat gagggggaag attccccaga tgtggaccat attgatcaag 1560 taactgatga cacattgatg gaagaatctg gaaaaatgat attcctaatg gacctactta 1620 agaggctgcg agatgaggga catcaaactc tggtgttttc tcaatcgagg caaattctaa 1680 acatcattga acgcctctta aagaataggc actttaagac attgcgaatc gatgggacag 1740 ttactcatct tttggaacga gaaaaaagaa ttaacttatt ccagcaaaat aaagattact 1800 255 ctgtttttct gcttaccact caagtaggtg gtgtcggttt aacattaact gcagcaacta 1860 gagtggtcat ttttgaccct agctggaatc ctgcaactga tgctcaagct gtggatagag 1920 tttaccgaat tggacaaaaa gagaatgttg tggtttatag gctaatcact tgtgggactg 1980 tagaggaaaa aatatacaga agacaggttt tcaaggactc attaataaga caaactactg 2040 gtgaaaaaaa gaaccctttc cgatatttta gtaaacaaga attaagagag ctctttacaa 2100 tcgaggatct tcagaactct gtaacccagc tgcagcttca gtctttgcat gctgctcaga 2160 ggaaatctga tataaaacta gatgaacata ttgcctacct gcagtctttg gggatagctg 2220 gaatctcaga ccatgatttg atgtacacat gtgatctgtc tgttaaagaa gagcttgatg 2280 tggtagaaga atctcactat attcaacaaa gggttcagaa agctcaattc ctcgttgaat 2340 tcgagtctca aaataaagag ttcctgatgg aacaacaaag aactagaaat gagggggcct 2400 ggctaagaga acctgtattt ccttcttcaa caaagaagaa atgccctaaa ttgaataaac 2460 cacagcctca gccttcacct cttctaagta ctcatcatac tcaggaagaa gatatcagtt 2520 ccaaaatggc aagtgtagtc attgatgatc tgcccaaaga gggtgagaaa caagatctct 2580 ccagtataaa ggtgaatgtt accaccttgc aagatggtaa aggtacaggt agtgctgact 2640 ctatagctac tttaccaaag gggtttggaa gtgtagaaga actttgtact aactcttcat 2700 tgggaatgga aaaaagcttt gcaactaaaa atgaagctgt acaaaaagag acattacaag 2760 aggggcctaa gcaagaggca ctgcaagagg atcctctgga aagttttaat tatgtactta 2820 gcaaatcaac caaagctgat attgggccaa atttagatca actaaaggat gatgagattt 2880 tacgtcattg caatccttgg cccattattt ccataacaaa tgaaagtcaa aatgcagaat 2940 caaatgtatc cattattgaa atagctgatg acctttcagc atcccatagt gcactgcagg 3000 atgctcaagc aagtgaggcc aagttggaag aggaaccttc agcatcttca ccacagtatg 3060 catgtgattt caatcttttc ttggaagact cagcagacaa cagacaaaat ttttccagtc 3120 agtctttaga gcatgttgag aaagaaaata gcttgtgtgg ctctgcacct aattccagag 3180 cagggtttgt gcatagcaaa acatgtctca gttgggagtt ttctgagaaa gacgatgaac 3240 cagaagaagt agtagttaaa gcaaaaatca gaagtaaagc tagaaggatt gtttcagatg 3300 gcgaagatga agatgattct tttaaagata cctcaagcat aaatccattc aacacatctc 3360 tctttcaatt ctcatctgtg aaacaatttg atgcttcaac tcccaaaaat gacatcagtc 3420 caccaggaag gttcttttca tctcaaatac ccagtagtgt aaataagtct atgaactcta 3480 gaagatctct ggcttctagg aggtctctta ttaatatggt tttagaccac gtggaggaca 3540 tggaggaaag acttgacgac agcagtgaag caaagggtcc tgaagattat ccagaagaag 3600 gggtggagga aagcagtggc gaagcctcca agtatacaga agaggatcct tccggagaaa 3660 cactgtcttc agaaaacaag tccagctggt taatgacgtc taagcctagt gctctagctc 3720 aagagacctc tcttggtgcc cctgagcctt tgtctggtga acagttggtt ggttctcccc 3780 aggataaggc ggcagaggct acaaatgact atgagactct tgtaaagcgt ggaaaagaac 3840 taaaagagtg tggaaaaatc caggaggccc taaactgctt agttaaagcg cttgacataa 3900 aaagtgcaga tcctgaagtt atgctcttga ctttaagttt gtataagcaa cttaataaca 3960 attgagaatg taacctgttt attgtatttt aaagtgaaac tgaatatgag ggaatttttg 4020 ttcccataat tggattcttt gggaacatga agcattcagg cttaaggcaa gaaagatctc 4080 aaaaagcaac ttctgccctg caacgccccc cactccatag tctggtattc tgagcactag 4140 cttaatattt cttcacttga atattcttat attttaggca tattctataa atttaactgt 4200 gttgtttctt ggaaagtttt gtaaaattat tctggtcatt cttaatttta ctctgaaagt 4260 gatcatcttt gtatataaca gttcagataa gaaaattaaa gttacttttc tc 4312 <210> 112 <211> 4194
<212> ADN <213> Homo sapiens <400> 112 256 aaattcaagc cccgccgggg agccgaggcc agaagcaact catttttccc gttggcagaa tcgagaactg cctgtatagg tgttcaaatc gctgatcatg aggaatgaga tcggattcag tccaaactct taactggaac ttgagcccag aagaatggag aatgaaaaag cagggagatg cacaaccaac gatggaagaa attgctttcc ccaaccaatc gtcaaaacct caaaggaatg aagctccaag ccaatccgag agcaggctgc acctggaaga tgctgagcag atgaatttac tctttgagca aaggtggtat tttccggtat ttattaacac tteatggtce gtgttattat ctccaagctc ggtcatggag tcattaccta agcatttaaa aatccaaaaa agatgtgtgc ccagaaggaa attggctgat gtttgatgca atgggtaaaa tagcaaggat cactacatac caagctccaa gcatcccgaa agatatgtga cttttcaatt atacaggaag aactctggct ggcatagctt gatatgggat tcacttgtga gaattcatca gaacggacca eaaatgttaa gctccaaact ggtttccgga aagaggccaa tggcaaagga ccttggagga tgctacttta tcctctatag tagggaagac atcatgtgct agtggactcc gaaacctcaa tcaataactg 60 120 180 240 300 360 420 480 540 600 660 720 257 gcagcaactt tcaagcttta ggggccaaga gtttgtgtgg gactatgtca tcctcgatga 780 agcacataaa ataaaaacct catctactaa gtcagcaata tgtgctcgtg ctattcctgc 840 aagtaatcgc ctcctcctca caggaacccc aatccagaat aatttacaag aactatggtc 900 cctatttgat tttgcttgtc aagggtccct gctgggaaca ttaaaaactt ttaagatgga 960 gtatgaaaat cctattacta gagcaagaga gaaggatgct accccaggag aaaaagcctt 1020 gggatttaaa atatctgaaa acttaatggc aatcataaaa ccctattttc tcaggaggac 1080 taaagaagac gtacagaaga aaaagtcaag caacccagag gccagactta atgaaaagaa 1140 tccagatgtt gatgccattt gtgaaatgcc ttccctttcc aggaaaaatg atttaattat 1200 ttggatacga cttgtgcctt tacaagaaga aatatacagg aaatttgtgt ctttagatca 1260 tatcaaggag ttgctaatgg agacgcgctc acctttggct gagctaggtg tcttaaagaa 1320 gctgtgtgat catcctaggc tgctgtctgc acgggcttgt tgtttgctaa atcttgggac 1380 attctctgct caagatggaa atgaggggga agattcccca gatgtggacc atattgatca 1440 agtaactgat gacacattga tggaagaatc tggaaaaatg atattcctaa tggacctact 1500 taagaggctg cgagatgagg gacatcaaac tctggtgttt tctcaatcga ggcaaattct 1560 aaacatcatt gaacgcctct taaagaatag gcactttaag acattgcgaa tcgatgggac 1620 agttactcat cttttggaac gagaaaaaag aattaactta ttccagcaaa ataaagatta 1680 ctctgttttt ctgcttacca ctcaagtagg tggtgtcggt ttaacattaa ctgcagcaac Π40 tagagtggtc atttttgacc ctagctggaa tcctgcaact gatgctcaag ctgtggatag 1800 agtttaccga attggacaaa aagagaatgt tgtggtttat aggctaatca cttgtgggac 1860 tgtagaggaa aaaatataca gaagacaggt tttcaaggac tcattaataa gacaaactac 1920 tggtgaaaaa aagaaccctt tccgatattt tagtaaacaa gaattaagag agctctttac 1980 aatcgaggat cttcagaact ctgtaaccca gctgcagctt cagtctttgc atgctgctca 2040 gaggaaatct gatataaaac tagatgaaca tattgcctac ctgcagtctt tggggatagc 2100 tggaatctca gaccatgatt tgatgtacac atgtgatctg tctgttaaag aagagcttga 2160 tgtggtagaa gaatctcact atattcaaca aagggttcag aaagctcaat tcctcgttga 2220 attcgagtct caaaataaag agttcctgat ggaacaacaa agaactagaa atgagggggc 2280 ctggctaaga gaacctgtat ttccttcttc aacaaagaag aaatgcccta aattgaataa 2340 accacagcct cagccttcac ctcttctaag tactcatcat actcaggaag aagatatcag 2400 ttccaaaatg gcaagtgtag tcattgatga tctgcccaaa gagggtgaga aacaagatct 2460 ctccagtata aaggtgaatg ttaccacctt gcaagatggt aaaggtacag gtagtgctga 2520 ctctatagct actttaccaa aggggtttgg aagtgtagaa gaactttgta ctaactcttc 2580 attgggaatg gaaaaaagct ttgcaactaa aaatgaagct gtacaaaaag agacattaca 2640 agaggggcct aagcaagagg cactgcaaga ggatcctctg gaaagtttta attatgtact 2700 tagcaaatca accaaagctg atattgggcc aaatttagat caactaaagg atgatgagat 2760 tttacgtcat tgcaatcctt ggcccattat ttccataaca aatgaaagtc aaaatgcaga 2820 atcaaatgta tccattattg aaatagctga tgacctttca gcatcccata gtgcactgca 2880 ggatgctcaa gcaagtgagg ccaagttgga agaggaacct tcagcatctt caccacagta 2940 tgcatgtgat ttcaatcttt tcttggaaga ctcagcagac aaoagacaaa atttttccag 3000 tcagtcttta gagcatgttg agaaagaaaa tagcttgtgt ggctctgcac ctaattccag 3060 agcagggttt gtgcatagca aaacatgtct cagttgggag ttttctgaga aagacgatga 3120 accagaagaa gtagtagtta aagcaaaaat cagaagtaaa gctagaagga ttgtttcaga 3180 tggcgaagat gaagatgatt cttttaaaga tacctcaagc ataaatccat tcaacacatc 3240 tctctttcaa ttctcatctg tgaaacaatt tgatgcttca actcccaaaa atgacatcag 3300 tccaccagga aggttctttt catctcaaat acccagtagt gtaaataagt ctatgaactc 3360 tagaagatct ctggcttcta ggaggtctct tattaatatg gttttagacc acgtggagga 3420 catggaggaa agacttgacg acagcagtga agcaaagggt cctgaagatt atccagaaga 3480 aggggtggag gaaagcagtg gcgaagcctc caagtataca gaagaggatc cttccggaga 3540 aacactgtct tcagaaaaca agtccagctg gttaatgacg tctaagccta gtgctctagc 3600 tcaagagacc tctcttggtg cccctgagcc tttgtctggt gaacagttgg ttggttctcc 3660 ccaggataag gcggcagagg ctacaaatga ctatgagact cttgtaaagc gtggaaaaga 3720 actaaaagag tgtggaaaaa tccaggaggc cctaaactgc ttagttaaag cgcttgacat 3780 aaaaagtgca gatcctgaag ttatgctctt gactttaagt ttgtataagc aacttaataa 3840 caattgagaa tgtaacctgt ttattgtatt ttaaagtgaa actgaatatg agggaatttt 3900 tgttcccata attggattct ttgggaacat gaagcattca ggcttaaggc aagaaagatc 3960 tcaaaaagca acttctgccc tgcaacgccc cccactccat agtctggtat tctgagcact 4020 agcttaatat ttcttcactt gaatattctt atattttagg catattctat aaatttaact 4080 gtgttgtttc ttggaaagtt ttgtaaaatt attctggtca ttcttaattt tactctgaaa 4140 gtgatcatct ttgtatataa cagttcagat aagaaaatta aagttacttt tctc 4194 258
<210> 113 <211> 1127 <212> PRT <213> Homo sapiens <4 Ο 0> 113 259
Met Gly Leu Gly Lys Thr Vai Gin Ile Ile Ala Phe Leu Ser Gly Met 1 5 10 15 Phe Asp Ala Ser Leu Vai Asn His Vai Leu Leu Ile Met Pro Thr Asn 20 25 30 Leu Ile Asn Thr Trp Vai Lys Glu Phe Ile Lys Trp Thr Pro Gly Met 35 40 45 Arg Vai Lys Thr Phe His Gly Pro Ser Lys Asp Glu Arg Thr Arg Asn 50 55 60 Leu Asn Arg Ile Gin Gin Arg Asn Gly Vai Ile Ile Thr Thr Tyr Gin 65 70 75 80 Met Leu Ile Asn Asn Trp Gin Gin Leu Ser Ser Phe Arg Gly Gin Glu 85 90 95 Phe Vai Trp Asp Tyr Vai Ile Leu Asp Glu Ala His Lys Ile Lys Thr 100 105 110 Ser Ser Thr Lys Ser Ala Ile Cys Ala Arg Ala Ile Pro Ala Ser Asn 115 120 125 Arg Leu Leu Leu Thr Gly Thr Pro Ile Gin Asn Asn Leu Gin Glu Leu 130 135 140 Trp Ser Leu Phe Asp Phe Ala Cys Gin Gly Ser Leu Leu Gly Thr Leu 145 150 155 160 Lys Thr Phe Lys Met Glu Tyr Glu Asn Pro Ile Thr Arg Ala Arg Glu 165 170 175 Lys Asp Ala Thr Pro Gly Glu Lys Ala Leu Gly Phe Lys Ile Ser Glu 180 185 190 Asn Leu Met Ala Ile Ile Lys Pro Tyr Phe Leu Arg Arg Thr Lys Glu 195 200 205 Asp Vai Gin Lys Lys Lys Ser Ser Asn Pro Glu Ala Arg Leu Asn Glu 210 215 220 Lys Asn Pro Asp Vai Asp Ala Ile Cys Glu Met Pro Ser Leu Ser Arg 225 230 235 240 Lys Asn Asp Leu Ile Ile Trp Ile Arg Leu Vai Pro Leu Gin Glu Glu 245 250 255 Ile Tyr Arg Lys Phe Vai Ser Leu Asp His Ile Lys Glu Leu Leu Met 260 265 270 Glu Thr Arg Ser Pro Leu Ala Glu Leu Gly Vai Leu Lys Lys Leu Cys 275 280 285 Asp His Pro Arg Leu Leu Ser Ala Arg Ala Cys Cys Leu Leu Asn Leu 290 295 300 Gly Thr Phe Ser Ala Gin Asp Gly Asn Glu Gly Glu Asp Ser Pro Asp 305 310 315 320 Vai Asp His Ile Asp Gin Vai Thr Asp Asp Thr Leu Met Glu Glu Ser 325 330 335 Gly Lys Met Ile Phe Leu Met Asp Leu Leu Lys Arg Leu Arg Asp Glu 340 345 350 Gly His Gin Thr Leu Vai Phe Ser Gin Ser Arg Gin Ile Leu Asn Ile 355 360 365 Ile Glu Arg Leu Leu Lys Asn Arg His Phe Lys Thr Leu Arg Ile Asp 370 375 380 Gly Thr Vai Thr His Leu Leu Glu Arg Glu Lys Arg Ile Asn Leu Phe 385 390 395 400 Gin Gin Asn Lys Asp Tyr Ser Vai Phe Leu Leu Thr Thr Gin vai Gly 405 410 415 Gly Vai Gly Leu Thr Leu Thr Ala Ala Thr Arg Vai Vai Ile Phe Asp 420 425 430 Pro Ser Trp Asn Pro Ala Thr Asp Ala Gin Ala Vai Asp Arg Vai Tyr 435 440 445 Arg Ile Gly Gin Lys Glu Asn Vai Vai Vai Tyr Arg Leu Ile Thr Cys 450 260
Gly 465 Thr Vai Glu Leu Ile Arg Gin Ser Lys Gin Glu 500 Ser Vai Thr 515 Gin Ser Asp 530 Ile Lys Ile 545 Ala Gly Ile Vai Lys Glu Glu Arg Vai Gin Lys 580 Glu Phe Leu 595 Met Arg Glu 610 Pro Vai Asn 625 Lys Pro Gin Gin Glu Glu Asp Leu Pro Lys Glu 660 vai Thr Thr 675 Leu Ala Thr 690 Leu Pro Ser 705 Ser Leu Gly Gin Lys Glu Thr Asp Pro Leu Glu 740 Asp Ile Gly 755 Pro His Cys 770 Asn Pro Ala 785 Glu Ser Asn Ser His Ser Ala Glu Glu Pro Ser 820 Phe Leu Glu 835 Asp Leu Glu 850 His val Ser Arg 865 Ala Gly Ser Glu Lys Asp Arg Ser Lys Ala 900 Ser Phe Lys 915 Asp Gin Phe 930 Ser Ser 4 55 Glu Lys 470 Ile Tyr Thr 485 Thr Gly Glu Leu Arg Glu Leu Leu Gin Leu Gin 520 Leu Asp Glu 535 His Ser Asp 550 His Asp Leu 565 Asp Val Val Ala Gin Phe Leu Glu Gin Gin Arg 600 Phe Pro Ser 615 Ser Pro Gin 630 Pro Ser Ile 645 Ser Ser Lys Gly Glu Lys Gin Gin Asp Gly Lys 680 Lys Gly Phe 695 Gly Met Glu 710 Lys Ser Leu 725 Gin Glu Gly Ser Phe Asn Tyr Asn Leu Asp Gin 760 Trp Pro Ile 775 Ile Val Ser 790 Ile Ile Leu 805 Gin Asp Ala Ala Ser Ser Pro Ser Ala Asp Asn 840 Glu Lys Glu 855 Asn Phe Val 870 His Ser Asp 885 Glu Pro Glu Arg Arg Ile Val Thr Ser Ser Ile 920 Val Lys Gin 935 Phe
Arg Arg Gin 4 60 Val Lys Lys 475 Asn Pro Phe 4 90 Thr Ile Glu 505 Ser Leu His Ala Ile Ala Tyr Leu Leu Met Tyr 540 Thr Glu Glu 555 Ser His Val 570 Glu Phe Glu 585 Thr Arg Asn Glu Thr Lys Lys Lys Pro Leu Leu 620 Ser Met Ala 635 Ser Val Asp 650 Leu Ser Ser 665 Gly Thr Gly Ser Ser val Glu Glu Phe Ala Thr 700 Lys Pro Lys 715 Gin Glu Val 730 Leu Ser Lys 745 Leu Lys Asp Asp Ser Ile Thr Asn Glu Ile Ala 780 Asp Gin Ala 795 Ser Glu Gin 810 Tyr Ala Cys 825 Arg Gin Asn Phe ser Leu Cys Gly Lys Thr Cys 860 Leu Glu Val 875 Val Val Ser 890 Asp Gly Glu 905 Asn Pro Phe Asn Asp Ala Ser Thr 940
Phe Lys Asp Ser 480 Phe Arg Tyr 495 Phe Asp Leu 510 Gin Asn Ala 525 Gin Arg Lys Gin Ser Leu Gly Cys Asp Leu Ser 560 Tyr Ile Gin 575 Gin Ser Gin 590 Asn Lys Gly 605 Ala Trp Leu Cys Pro Lys Leu Thr His His Thr 640 Val Ile Asp Asp 655 Ile Lys 670 Val Asn Ala 685 Asp Ser Ile Leu Cys Thr Asn Asn Glu Ala Val 720 Ala Leu Gin 735 Glu Ser Thr 750 Lys Ala Glu 765 Ile Leu Arg Glu Ser Gin Asn Asp Leu Ser Ala 800 Ala Lys Leu 815 Glu Asp Phe 830 Asn Leu Ser 845 Ser Gin Ser Ser Ala Pro Asn Ser Trp Glu Phe 880 Lys Ala Lys 895 Ile Asp Glu 910 Asp Asp Thr 925 Ser Leu Phe Pro Lys Asn Asp 261
Ile Ser Pro Pro Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai 945 950 955 960 Asn Lys Ser Met Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu 965 970 975 Ile Asn Met Vai Leu Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp 980 985 990 Asp Ser Ser Glu Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai 995 1000 1005 Glu Glu Ser Ser Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser 1010 1015 1020 Gly Glu Thr Leu Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser 1025 1030 1035 1040 Lys Pro Ser Ala Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro 1045 1050 1055 Leu Ser Gly Glu Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu 1060 1065 1070 Ala Thr Asn Asp Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys 1075 1080 1085 Glu Cys Gly Lys Ile Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu 1090 1095 1100 Asp Ile Lys Ser Ala Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu 1105 1110 1115 1120 Tyr Lys Gin Leu Asn Asn Asn 1125 <210> 114
<211> 1127 <212> PRT <213> Homo sapiens 262 <400> 114
Met Gly Leu Gly Lys Thr Vai Gin 1 5 Phe Asp Ala Ser Leu Vai Asn His 20 Leu Ile Asn Thr Trp Vai Lys Glu 35 40 Arg vai Lys Thr Phe His Gly Pro 50 55 Leu Asn Arg Ile Gin Gin Arg Asn 65 70 Met Leu Ile Asn Asn Trp Gin Gin 85 Phe Vai Trp Asp Tyr Vai Ile Leu 100 Ser Ser Thr Lys Ser Ala Ile Cys 115 120 Arg Leu Leu Leu Thr Gly Thr Pro 130 135 Trp Ser Leu Phe Asp Phe Ala Cys 145 150 Lys Thr Phe Lys Met Glu Tyr Glu 165 Lys Asp Ala Thr Pro Gly Glu Lys 180 Asn Leu Met Ala Ile Ile Lys Pro 195 200 Asp Vai Gin Lys Lys Lys Ser Ser 210 215 Lys Asn Pro Asp Vai Asp Ala Ile
Ile Ile 10 Ala Phe Leu Ser Gly 15 Met Vai 25 Leu Leu Ile Met Pro 30 Thr Asn Phe Ile Lys Trp Thr 45 Pro Gly Met Ser Lys Asp Glu 60 Arg Thr Arg Asn Gly Vai Ile 75 Ile Thr Thr Tyr Gin 80 Leu Ser 90 Ser Phe Arg Gly Gin 95 Glu Asp 105 Glu Ala His Lys Ile 110 Lys Thr Ala Arg Ala Ile Pro 125 Ala Ser Asn Ile Gin Asn Asn 140 Leu Gin Glu Leu Gin Gly Ser 155 Leu Leu Gly Thr Leu 160 Asn Pro 170 Ile Thr Arg Ala Arg 175 Glu Ala 185 Leu Gly Phe Lys Ile 190 Ser Glu Tyr Phe Leu Arg Arg 205 Thr Lys Glu Asn Pro Glu Ala 220 Arg Leu Asn Glu Cys Glu Met Pro Ser Leu Ser Arg 263 225 230 235 240 Lys Asn Asp Leu Ile Ile Trp Ile Arg Leu Vai Pro Leu Gin Glu Glu 245 250 255 Ile Tyr Arg Lys Phe Vai Ser Leu Asp His Ile Lys Glu Leu Leu Met 260 265 270 Glu Thr Arg ser Pro Leu Ala Glu Leu Gly Vai Leu Lys Lys Leu Cys 275 280 285 Asp His Pro Arg Leu Leu Ser Ala Arg Ala Cys Cys Leu Leu Asn Leu 290 295 300 Gly Thr Phe Ser Ala Gin Asp Gly Asn Glu Gly Glu Asp Ser Pro Asp 305 310 315 320 Vai Asp His Ile Asp Gin Vai Thr Asp Asp Thr Leu Met Glu Glu Ser 325 330 335 Gly Lys Met Ile Phe Leu Met Asp Leu Leu Lys Arg Leu Arg Asp Glu 340 345 350 Gly His Gin Thr Leu Vai Phe Ser Gin Ser Arg Gin Ile Leu Asn lie 355 360 365 Ile Glu Arg Leu Leu Lys Asn Arg His Phe Lys Thr Leu Arg Ile Asp 370 375 380 Gly Thr Vai Thr His Leu Leu Glu Arg Glu Lys Arg Ile Asn Leu Phe 385 390 395 400 Gin Gin Asn Lys Asp Tyr Ser Vai Phe Leu Leu Thr Thr Gin Vai Gly 405 410 415 Gly Vai Gly Leu Thr Leu Thr Ala Ala Thr Arg Vai Vai Ile Phe Asp 420 425 430 Pro Ser Trp Asn Pro Ala Thr Asp Ala Gin Ala Vai Asp Arg Vai Tyr 435 440 445 Arg Ile Gly Gin Lys Glu Asn Vai Vai Vai Tyr Arg Leu Ile Thr Cys 450 455 460 Gly Thr Vai Glu Glu Lys Ile Tyr Arg Arg Gin Vai Phe Lys Asp Ser 465 470 475 480 Leu Ile Arg Gin Thr Thr Gly Glu Lys Lys Asn Pro Phe Arg Tyr Phe 485 490 495 Ser Lys Gin Glu Leu Arg Glu Leu Phe Thr Ile Glu Asp Leu Gin Asn 500 505 510 Ser Vai Thr Gin Leu Gin Leu Gin Ser Leu His Ala Ala Gin Arg Lys 515 520 525 Ser Asp Ile Lys Leu Asp Glu His Ile Ala Tyr Leu Gin Ser Leu Gly 530 535 540 Ile Ala Gly Ile Ser Asp His Asp Leu Met Tyr Thr Cys Asp Leu Ser 545 550 555 560 Vai Lys Glu Glu Leu Asp Vai Vai Glu Glu Ser His Tyr Ile Gin Gin 565 570 575 Arg Vai Gin Lys Ala Gin Phe Leu Vai Glu Phe Glu Ser Gin Asn Lys 580 585 590 Glu Phe Leu Met Glu Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu 595 600 605 Arg Glu Pro Vai Phe Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu 610 615 620 Asn Lys Pro Gin Pro Gin Pro Ser Pro Leu Leu Ser Thr His His Thr 625 630 635 640 Gin Glu Glu Asp Ile Ser Ser Lys Met Ala Ser Vai Vai Ile Asp Asp 645 650 655 Leu Pro Lys Glu Gly Glu Lys Gin Asp Leu Ser Ser Ile Lys Vai Asn 660 665 670 Vai Thr Thr Leu Gin Asp Gly Lys Gly Thr Gly Ser Ala ASp Ser lie 675 680 685 Ala Thr Leu Pro Lys Gly Phe Gly Ser Vai Glu Glu Leu Cys Thr Asn 690 695 700 Ser Ser Leu Gly Met Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai 705 710 715 720 264
Gin Lys Glu Thr Leu Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu 725 730 735 Asp Pro Leu Glu Ser Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala 740 745 750 Asp Ile Gly Pro Asn Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg 755 760 765 His Cys Asn Pro Trp Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn 770 775 780 Ala Glu Ser Asn Vai Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala 785 790 795 800 Ser His Ser Ala Leu Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu 805 810 815 Glu Glu Pro Ser Ala Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu 820 825 830 Phe Leu Glu Asp Ser Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser 835 840 845 Leu Glu His Vai Glu Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn 850 855 860 Ser Arg Ala Gly Phe Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe 865 870 875 880 Ser Glu Lys Asp Asp Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile 885 890 895 Arg Ser Lys Ala Arg Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp 900 905 910 Ser Phe Lys Asp Thr Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe 915 920 925 Gin Phe Ser Ser Vai Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp 930 935 940 Ile Ser Pro Pro Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai 945 950 955 960 Asn Lys Ser Met Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu 965 970 975 Ile Asn Met Vai Leu Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp 980 985 990 Asp Ser Ser Glu Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai 995 1000 1005 Glu Glu Ser Ser Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser 1010 1015 1020 Gly Glu Thr Leu Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser 1025 1030 1035 1040 Lys Pro Ser Ala Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro 1045 1050 1055 Leu Ser Gly Glu Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu 1060 1065 1070 Ala Thr Asn Asp Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys 1075 1080 1085 Glu Cys Gly Lys Ile Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu 1090 1095 1100 Asp Ile Lys Ser Ala Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu 1105 1110 1115 1120 Tyr Lys Gin Leu Asn Asn Asn 1125
<210> 115 <211> 1127 <212> PRT <213> Homo sapiens <400> 115 265
Met Gly Leu Gly Lys Thr Vai Gin Ile Ile Ala Phe Leu Ser Gly Met 266 1 5 10 15 Phe Asp Ala Ser Leu Val Asn His Val Leu Leu Ile Met Pro Thr Asn 20 25 30 Leu Ile Asn Thr Trp Val Lys Glu Phe Ile Lys Trp Thr Pro Gly Met 35 40 45 Arg Vai Lys Thr Phe His Gly Pro Ser Lys Asp Glu Arg Thr Arg Asn 50 55 60 Leu Asn Arg Ile Gin Gin Arg Asn Gly Val Ile Ile Thr Thr Tyr Gin 65 70 75 80 Met Leu Ile Asn Asn Trp Gin Gin Leu Ser Ser Phe Arg Gly Gin Glu 85 90 95 Phe Vai Trp Asp Tyr Val Ile Leu Asp Glu Ala His Lys Ile Lys Thr 100 105 110 Ser Ser Thr Lys Ser Ala Ile Cys Ala Arg Ala Ile Pro Ala Ser Asn 115 120 125 Arg Leu Leu Leu Thr Gly Thr Pro Ile Gin Asn Asn Leu Gin Glu Leu 130 135 140 Trp Ser Leu Phe Asp Phe Ala Cys Gin Gly Ser Leu Leu Gly Thr Leu 145 150 155 160 Lys Thr Phe Lys Met Glu Tyr Glu Asn Pro Ile Thr Arg Ala Arg Glu 165 170 175 Lys Asp Ala Thr Pro Gly Glu Lys Ala Leu Gly Phe Lys Ile Ser Glu 180 185 190 Asn Leu Met Ala Ile Ile Lys Pro Tyr Phe Leu Arg Arg Thr Lys Glu 195 200 205 Asp Vai Gin Lys Lys Lys Ser Ser Asn Pro Glu Ala Arg Leu Asn Glu 210 215 220 Lys Asn Pro Asp Val Asp Ala Ile Cys Glu Met Pro Ser Leu Ser Arg 225 230 235 240 Lys Asn Asp Leu Ile Ile Trp Ile Arg Leu Val Pro Leu Gin Glu Glu 245 250 255 Ile Tyr Arg Lys Phe Val Ser Leu Asp His Ile Lys Glu Leu Leu Met 260 265 270 Glu Thr Arg Ser Pro Leu Ala Glu Leu Gly Val Leu Lys Lys Leu Cys 275 280 285 Asp His Pro Arg Leu Leu Ser Ala Arg Ala Cys Cys Leu Leu Asn Leu 290 295 300 Gly Thr Phe Ser Ala Gin Asp Gly Asn Glu Gly Glu Asp Ser Pro Asp 305 310 315 320 Vai Asp His Ile Asp Gin Val Thr Asp Asp Thr Leu Met Glu Glu Ser 325 330 338 Gly Lys Met Ile Phe Leu Met Asp Leu Leu Lys Arg Leu Arg Asp Glu 340 345 350 Gly His Gin Thr Leu val Phe Ser Gin Ser Arg Gin Ile Leu Asn Ile 355 360 365 Ile Glu Arg Leu Leu Lys Asn Arg His Phe Lys Thr Leu Arg Ile Asp 370 375 380 Gly Thr Vai Thr His Leu Leu Glu Arg Glu Lys Arg Ile Asn Leu Phe 385 390 395 400 Gin Gin Asn Lys Asp Tyr Ser Val Phe Leu Leu Thr Thr Gin Val Gly 405 410 415 Gly Vai Gly Leu Thr Leu Thr Ala Ala Thr Arg Val Val Ile Phe Asp 420 425 430 Pro Ser Trp Asn Pro Ala Thr Asp Ala Gin Ala Val Asp Arg Val Tyr 435 440 445 Arg Ile Gly Gin Lys Glu Asn Val Val Val Tyr Arg Leu Ile Thr Cys 450 455 460 Gly Thr val Glu Glu Lys Ile Tyr Arg Arg Gin Val Phe Lys Asp Ser 465 470 475 480 Leu Ile Arg Gin Thr Thr Gly Glu Lys Lys Asn Pro Phe Arg Tyr Phe 485 490 495 267
Ser Lys Gin Glu Leu Arg Glu Leu Phe Thr Ile Glu Asp Leu Gin Asn 500 505 510 Ser Vai Thr Gin Leu Gin Leu Gin Ser Leu His Ala Ala Gin Arg Lys 515 520 525 Ser Asp Ile Lys Leu Asp Glu His Ile Ala Tyr Leu Gin Ser Leu Gly 530 535 54 0 lie Ala Gly Ile Ser Asp His Asp Leu Met Tyr Thr Cys Asp Leu Ser 545 550 555 560 Vai Lys Glu Glu Leu Asp Val Val Glu Glu Ser His Tyr Ile Gin Gin 565 570 575 Arg Vai Gin Lys Ala Gin Phe Leu Val Glu Phe Glu Ser Gin Asn Lys 580 585 590 Glu Phe Leu Met Glu Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu 595 600 605 Arg Glu Pro Vai Phe Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu 610 61S 620 Asn Lys Pro Gin Pro Gin Pro Ser Pro Leu Leu Ser Thr His His Thr 625 630 635 640 Gin Glu Glu Asp Ile Ser Ser Lys Met Ala Ser Val Val Ile Asp Asp 645 650 655 Leu Pro Lys Glu Gly Glu Lys Gin Asp Leu Ser Ser Ile Lys Val Asn 660 665 670 Vai Thr Thr Leu Gin Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile 675 680 685 Ala Thr Leu Pro Lys Gly Phe Gly Ser Val Glu Glu Leu Cys Thr Asn 690 695 700 Ser Ser Leu Gly Met Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Val 705 710 715 720 Gin Lys Glu Thr Leu Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu 725 730 735 Aõp Pro Leu kj J. u Ser Phe Asn Tyr Val Lêu Ser Lys Ser TK ItIJr Lys Ala 740 745 750 Asp Ile Gly Pro Asn Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg 755 760 765 His Cys Asn Pro Trp Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn 770 775 780 Ala Glu Ser Asn Val Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala 785 790 795 800 Ser His Ser Ala Leu Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu 805 810 815 Glu Glu Pro Ser Ala Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu 820 825 830 Phe Leu Glu Asp Ser Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser 835 840 845 Leu Glu His Val Glu Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn 850 855 860 Ser Arg Ala Gly Phe Val His Ser Lys Thr Cys Leu Ser Trp Glu Phe 865 870 875 880 Ser Glu Lys Asp Asp Glu Pro Glu Glu Val Val Val Lys Ala Lys Ile 885 890 895 Arg Ser Lys Ala Arg Arg Ile Val Ser Asp Gly Glu Asp Glu Asp Asp 900 905 910 Ser Phe Lys Asp Thr Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe 915 920 925 Gin Phe Ser Ser Val Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp 930 935 940 Ile Ser Pro Pro Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Val 945 950 955 960 Asn Lys Ser Met Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu 965 970 975 Ile Asn Met Val Leu Asp His Val Glu Asp Met Glu Glu Arg Leu Asp 268 980 985 990 Asp Set Ser Glu Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai 995 1000 1005 Glu Glu Ser Ser Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser 1010 1015 1020 Gly Glu Thr Leu Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser 1025 1030 1035 1040 Lys Pro Ser Ala Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro 1045 1050 1055 Leu Ser Gly Glu Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu 1060 1065 1070 Ala Thr Asn Asp Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys 1075 1080 1085 Glu Cys Gly Lys Ile Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu 1090 1095 1100 Asp Ile Lys Ser Ala Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu 1105 1110 1115 1120 Tyr Lys Gin Leu Asn Asn Asn 1125<210> 116 <211> 3671 <212> ADN<213> Homo sapiens <400> 116 269 aaaatgaatc atgtgctgct gatcatgcca accaatctta ttaacacttg ggtaaaagaa 60 ttcatcaagt ggactccagg aatgggagtc aaaacctttc atggtcctag caaggatgaa 120 cggaccagaa acctcaatcg gattcagcaa aggaatggtg ttattatcac tacataccaa 180 atgttaatca ataactggca gcaactttca agctttaggg gccaagagtt tgtgtgggac 240 tatgtcatcc tcgatgaagc acataaaata aaaacctcat ctactaagtc agcaatatgt 300 gctcgtgcta ttcctgcaag taatcgcctc ctcctcacag gaaccccaat ccagaataat 360 ttacaagaac tatggtccct atttgatttt gcttgtcaag ggtccctgct gggaacatta 420 aaaactttta agatggagta tgaaaatcct attactagag caagagagaa ggatgctacc 480 ccaggagaaa aagccttggg atttaaaata tctgaaaact taatggcaat cataaaaccc 540 tattttctca ggaggactaa agaagacgta cagaagaaaa agtcaagcaa cccagaggcc 600 agacttaatg aaaagaatcc agatgttgat gccatttgtg aaatgccttc cctttccagg 660 aaaaatgatt taattatttg gatacgactt gtgcctttac aagaagaaat atacaggaaa 720 tttgtgtctt tagatcatat caaggagttg ctaatggaga cgcgctcacc tttggctgag 780 ctaggtgtct taaagaagct gtgtgatcat cctaggctgc tgtctgcacg ggcttgttgt 840 ttgctaaatc ttgggacatt ctctgctcaa gatggaaatg agggggaaga ttccccagat 900 gtggaccata ttgatcaagt aactgatgac acattgatgg aagaatctgg aaaaatgata 960 ttcctaatgg acctacttaa gaggctgcga gatgagggac atcaaactct ggtgttttct 1020 caatcgaggc aaattctaaa catcattgaa cgcctcttaa agaataggca ctttaagaca 1080 ttgcgaateg atgggacagt tactcatctt ttggaacgag aaaaaagaat taacttattc 1140 cagcaaaata aagattactc tgtttttctg cttaccactc aagtaggtgg tgtcçgttta 1200 acattaactg cagcaactag agtggtcatt tttgacccta gctggaatcc tgcaactgat 1260 gotcaagctg tggatagagt ttaccgaatt ggacaaaaag agaatgttgt ggtttatagg 1320 ctaatcactt gtgggactgt agaggaaaaa atatacagaa gacaggtttt caaggactca 1380 ttaataagac aaactactgg tgaaaaaaag aaccctttcc gatattttag taaacaagaa 1440 ttaagagagc tctttacaat cgaggatctt cagaactctg taacccagct gcagcttcag 1500 tctttgcatg ctgctcagag gaaatctgat ataaaactag atgaacatat tgcctacctg 1560 cagtctttgg ggatagctgg aatetcagac catgatttga tgtacacatg tgatctgtct 1620 gttaaagaag agcttgatgt ggtagaagaa tctcactata ttcaacaaag ggttcagaaa 1680 gctcaattcc tcgttgaatt cgagtctcaa aataaagagt tcctgatgga acaacaaaga 1740 actagaaatg agggggcctg gctaagagaa cctgtatttc cttcttcaac aaagaagaaa 1800 tgccctaaat tgaataaacc acagcctcag ccttcacctc ttctaagtac tcatcatact 1860 caggaagaag atatcagttc caaaatggca agtgtagtca ttgatgatct gcccaaagag 1920 ggtgagaaac aagatctctc cagtataaag gtgaatgtta ccaccttgca agatggtaaa 1980 tatagctact ttaccaaagg ggtttggaag tgtagaagaa 2040 gggaatggaa aaaagctttg caactaaaaa tgaagctgta 2100 ggggcctaag caagaggcac tgcaagagga tcctctggaa 2160 caaatcaacc aaagctgata ttgggccaaa tttagatcaa 2220 acgtcattgc aatccttggc ccattatttc cataacaaat 2280 aaatgtatcc attattgaaa tagctgatga cctttcagca 2340 tgctcaagca agtgaggcca agttggaaga ggaaccttca 2400 atgtgatttc aatcttttct tggaagactc agcagacaac 2460 gtctttagag catgttgaga aagaaaatag cttgtgtggc 2520 agggtttgtg catagcaaaa catgtctcag ttgggagttt 2580 agaagaagta gtagttaaag caaaaatcag aagtaaagct 2640 cgaagatgaa gatgattctt ttaaagatac ctcaagcata 2700 ctttcaattc tcatctgtga aacaatttga tgcttcaact 2760 accaggaagg ttcttttcat ctcaaatacc cagtagtgta 2820 aagatctctg gcttctagga ggtctcttat taatatggtt 2880 ggaggaaaga cttgacgaca gcagtgaagc aaagggtcct 2940 ggtggaggaa agcagtggcg aagcctccaa gtatacagaa 3000 actgtcttca gaaaacaagt ccagctggtt aatgacgtct 3060 agagacctct cttggtgccc ctgagccttt gtctggtgaa 3120 ggataaggcg gcagaggcta caaatgacta tgagactctt 3180 aaaagagtgt ggaaaaatcc aggaggccct aaactgctta 3240 aagtgcagat cctgaagtta tgctcttgac tttaagtttg 3300 ttgagaatgt aacctgttta ttgtatttta aagtgaaact 3360 tcccataatt ggattctttg ggaacatgaa gcattcaggc 3420 aaaagcaact tctgccctgc aacgcccccc actccatagt 3480 ttaatatttc ttcacttgaa tattcttata ttttaggcat 3540 ttgtttcttg gaaagttttg taaaattatt ctggtcattc 3600 atcatctttg tatataacag ttcagataag aaaattaaag 3660 3671 ggtacaggta ctttgtacta caaaaagaga agttttaatt ctaaaggatg gaaagtcaaa tcccatagtg gcatcttcac agacaaaatt tctgcaccta tctgagaaag agaaggattg aatccattca cccaaaaatg aataagtcta ttagaccacg gaagattatc gaggatcctt aagcctagtg cagttggttg gtaaagcgtg gttaaagcgc tataagcaac gaatatgagg ttaaggcaag ctggtattct attctataaa ttaattttac ttacttttct gtgctgactc actcttcatt cattacaaga atgtacttag atgaggtttt atgcagaatc cactgcagga cacagtatgc tttccagtca attccagagc acgatgaacc tttcagatgg acacatctct acatcagtcc tgaactctag tggaggacat cagaagaagg ccggagaaac ctctagctca gttcccccca gaaaagaact ttgacataaa ttaataacaa gaatttttgt aaagatctca gagcactagc tttaactgtg tctgaaagtg c 270 <210> 117 <211> 3694 <212> ADN <213> Homo sapiens <400> 117 tttccggtat gtttgatgca tcacttgtga atcatgtgct gctgatcatg ccaaccaatc 60 ttattaacac atgggtaaaa gaattcatca agtggactcc aggaatgaga gtcaaaacct 120 ttcatggtcc tagcaaggat gaacggacca gaaacctcaa tcggattcag caaaggaatg 180 gtgttattat cactacatac caaatgttaa tcaataactg gcagcaactt tcaagcttta 240 ggggccaaga gtttgtgtgg gactatgtca tcctcgatga agcacataaa ataaaaacct 300 catctactaa gtcagcaata tgtgctcgtg ctattcctgc aagtaatcgc ctcctcctca 360 caggaacccc aatccagaat aatttacaag aactatggtc cctatttgat tttgcttgtc 420 aagggtccct gctgggaaca ttaaaaactt ttaagatgga gtatgaaaat cctattacta 480 gagcaagaga gaaggatgct accccaggag aaaaagcctt gggatttaaa atatctgaaa 540 acttaatggc aatcataaaa ccctattttc tcaggaggac taaagaagac gtacagaaga 600 aaaagtcaag caacccagag gccagactta atgaaaagaa tccagatgtt gatgccattt 660 gtgaaatgcc ttccctttcc aggaaaaatg atttaattat ttggatacga cttgtgcctt 720 tacaagaaga aatatacagg aaatttgtgt ctttagatca tatcaaggag ttgctaatgg 780 agacgcgctc acctttggct gagctaggtg tcttaaagaa gctgtgtgat catcctaggc 840 tgctgtctgc acgggcttgt tgtttgctaa atcttgggac attctctgct caagatggaa 900 atgaggggga agattcccca gatgtggacc atattgatca agtaactgat gacacattga 960 tggaagaatc tggaaaaatg atattcctaa tggacctact taagaggctg cgagatgagg 1020 gacatcaaac tctggtgttt tetcaatcga ggcaaattct aaacatcatt gaacgcctct 1080 taaagaatag gcactttaag acattgcgaa tcgatgggac agttactcat cttttggaac 1140 gagaaaaaag aattaactta ttccagcaaa ataaagatta ctctgttttt ctgcttacca 1200 ctcaagtagg tggtgtcggt ttaacattaa ctgcagcaac tagagtggtc atttttgacc 1260 ctagctggaa tcctgcaact gatgctcaag ctgtggatag agtttaccga attggacaaa 1320 aagagaatgt tgtggtttat aggctaatca cttgtgggac tgtagaggaa aaaatataca 1380 271 gaagacaggt tttcaaggac tcattaataa gacaaactac tggtgaaaaa aagaaccctt 1440 tccgatattt tagtaaacaa gaattaagag agctctttac aatcgaggat cttcagaact 1500 ctgtaaccca gctgcagctt cagtctttgc atgctgctea gaggaaatct gatataaaac 1560 tagatgaaca tattgcctac ctgcagtctt tggggatagc tggaatctca gaccatgatt 1620 tgatgtacac atgtgatctg tctgttaaag aagagcttga tgtggtagaa gaatctcact 1680 atattcaaca aagggttcag aaagctcaat tcctcgttga attcgagtct caaaataaag 1740 agttcctgat ggaacaacaa agaactagaa atgagggggc ctggctaaga gaacctgtat 1800 ttccttcttc aacaaagaag aaatgcccta aattgaataa accacagcct cagccttcac 1860 ctcttctaag tactcatcat actcaggaag aagatatcag ttccaaaatg gcaagtgtag 1920 tcattgatga tctgcccaaa gagggtgaga aacaagatct ctccagtata aaggtgaatg 1980 ttaccacctt gcaagatggt aaaggtacag gtagtgctga ctctatagct actttaccaa 2040 aggggtttgg aagtgtagaa gaactttgta ctaactcttc attgggaatg gaaaaaagct 2100 ttgcaactaa aaatgaagct gtacaaaaag agacattaca agaggggcct aagcaagagg 2160 cactgcaaga ggatcctctg gaaagtttta attatgtact tagcaaatca accaaagctg 2220 atattgggcc aaatttagat caactaaagg atgatgagat tttacgtcat tgcaatcctt 2280 ggcccattat ttccataaca aatgaaagtc aaaatgcaga atcaaatgta tccattattg 2340 aaatagctga tgacctttca gcatcccata gtgcactgca ggatgctcaa gcaagtgagg 2400 ccaagttgga agaggaacct tcagcatctt caccacagta tgcatgtgat ttcaatcttt 2460 tcttggaaga ctcagcagac aacagacaaa atttttccag tcagtcttta gagcatgttg 2520 agaaagaaaa tagcttgtgt ggctctgcac ctaattccag agcagggttt gtgcatagca 2580 aaacatgtct cagttgggag ttttctgaga aagacgatga accagaagaa gtagtagtta 2640 aagcaaaaat cagaagtaaa gctagaagga ttgtttcaga tggcgaagat gaagatgatt 2700 cttttaaaga tacctcaagc ataaatccat tcaacacatc tctctttcaa ttctcatctg 2760 tgaaacaatt tgatgcttca actcccaaaa atgacatcag tccaccagga aggttctttt 2820 catctcaaat acccagtagt gtaaataagt ctatgaactc tagaagatct ctggcttcta 2880 ggaggtctct tattaatatg gttttagacc acgtggagga catggaggaa agacttgacg 2940 acagcagtga agcaaagggt cctgaagatt atccagaaga aggggtggag gaaagcagtg 3000 gcgaagcctc caagtataca gaagaggatc cttccggaga aacactgtct tcagaaaaca 3060 agtccagctg gttaatgacg tctaagccta gtgctctagc tcaagagacc tctcttggtg 3120 cccctgagcc tttgtctggt gaacagttgg ttggttctcc ccaggataag gcggcagagg 3180 ctacaaatga ctatgagact cttgtaaagç gtggaaaaga actaaaagag tgtggaaaaa 3240 tccaggaggc cctaaactgc ttagttaaag cgcttgacat aaaaagtgca gatcctgaag 3300 ttatgctctt gactttaagt ttgtataagc aacttaataa caattgagaa tgtaacctgt 3360 ttattgtatt ttaaagtgaa actgaatatg agggaatttt tgttcccata attggattct 3420 ttgggaacat gaagcattca ggcttaaggc aagaaagatc tcaaaaagca acttctgccc 3480 tgcaacgccc cccactccat agtctggtat tctgagcact agcttaatat ttcttcactt 3540 gaatattctt atattttagg catattctat aaatttaact gtgttgtttc ttggaaagtt 3600 ttgtaaaatt attctggtca ttcttaattt tactctgaaa gtgatcatct ttgtatataa 3660 cagttcagat aagaaaatta aagttacttt tctc 3694
<210> 118 <211> 3671 <212> ADN <213> Homo sapiens <400> 118 272 aaaatgaatc atgtgctgct gatcatgcca ttcatcaagt ggactccagg aatgggagtc cggaccagaa acctcaatcg gattcagcaa atgttaatca ataactggca gcaactttca tatgtcatcc tcgatgaagc acataaaata gctcgtgcta ttcctgcaag taatcgcctc ttacaagaac tatggtccct atttgatttt aaaactttta agatggagta tgaaaatcct ccaggagaaa aagccttggg atttaaaata tattttctca ggaggactaa agaagacgta agacttaatg aaaagaatcc agatgttgat aaaaatgatt taattatttg gatacgactt tttgtgtctt tagatcatat caaggagttg ctaggtgtct taaagaagct gtgtgatcat ttgctaaatc ttgggacatt ctctgctcaa accaatctta ttaacacttg ggtaaaagaa 60 aaaacctttc atggtcctag caaggatgaa 120 aggaatggtg ttattatcac tacataccaa 180 agctttaggg gccaagagtt tgtgtgggac 240 aaaacctcat ctactaagtc agcaatatgt 300 ctcctcacag gaaccccaat ccagaataat 360 gcttgtcaag ggtccctgct gggaacatta 420 attactagag caagagagaa ggatgctacc 480 tctgaaaact taatggcaat cataaaaccc 540 cagaagaaaa agtcaagcaa cccagaggcc 600 gccatttgtg aaatgccttc cctttccagg 660 gtgcctttac aagaagaaat atacaggaaa 720 ctaatggaga cgcgctcacc tttggctgag 780 cctaggctgc tgtctgcacg ggcttgttgt 840 gatggaaatg agggggaaga ttccccagat 900 273 gtggaccata ttcctaatgg caatcgaggc ttgcgaatcg cagcaaaata acattaactg gctcaagctg ctaatcactt ttaataagac ttaagagagc tctttgcatg cagtctttgg gttaaagaag gctcaattcc actagaaatg tgccctaaat caggaagaag ggtgagaaac ggtacaggta ctttgtacta caaaaagaga agttttaatt ctaaaggatg gaaagtcaaa tcccatagtg gcatcttcac agacaaaatt tctgcaccta tctgagaaag agaaggattg aatccattca cccaaaaatg aataagtcta ttagaccacg gaagattatc gaggatcctt aagcctagtg cagttggttg gtaaagcgtg gttaaagcgc tataagcaac gaatatgagg ttaaggcaag ctggtattct attctataaa ttaattttac ttacttttct ttgatcaagt acctacttaa aaattctaaa atgggacagt aagattactc cagcaactag tggatagagt gtgggactgt aaactactgg tctttacaat ctgctcagag ggatagctgg agcttgatgt tcgttgaatt agggggcctg tgaataaacc atatcagttc aagatctctc gtgctgactc actcttcatt cattacaaga atgtacttag atgaggtttt atgcagaatc cactgcagga cacagtatgc tttccagtca attccagagc acgatgaacc tttcagatgg acacatctct acatcagtcc tgaactctag tggaggacat cagaagaagg ccggagaaac ctctagctca gttcccccca gaaaagaact ttgacataaa ttaataacaa gaatttttgt aaagatctca gagcactagc tttaactgtg tctgaaagtg c aactgatgac gaggctgcga catcattgaa tactcatctt tgtttttctg agtggtcatt ttaccgaatt agaggaaaaa tgaaaaaaag cgaggatctt gaaatctgat aatctcagac ggtagaagaa cgagtctcaa gctaagagaa acagcctcag caaaatggca cagtataaag tatagctact gggaatggaa ggggcctaag caaatcaacc acgtcattgc aaatgtatcc tgctcaagca atgtgatttc gtctttagag agggtttgtg agaagaagta cgaagatgaa ctttcaattc accaggaagg aagatctctg ggaggaaaga ggtggaggaa actgtcttca agagacctct ggataaggcg aaaagagtgt aagtgcagat ttgagaatgt tcccataatt aaaagcaact ttaatatttc ttgtttcttg atcatctttg acattgatgg gatgagggac cgcctcttaa ttggaacgag cttaccactc tttgacccta ggacaaaaag atatacagaa aaccctttcc cagaactctg ataaaactag catgatttga tctcactata aataaagagt cctgtatttc ccttcacctc agtgtagtca gtgaatgtta ttaccaaagg aaaagctttg caagaggcac aaagctgata aatccttggc attattgaaa agtgaggcca aatcttttct catgttgaga catagcaaaa gtagttaaag gatgattctt tcatctgtga ttcttttcat gcttctagga cttgacgaca agcagtggcg gaaaacaagt cttggtgccc gcagaggcta ggaaaaatcc cctgaagtta aacctgttta ggattctttg tctgccctgc ttcacttgaa gaaagttttg tatataacag aagaatctgg atcaaactct agaataggca aaaaaagaat aagtaggtgg gctggaatcc agaatgttgt gacaggtttt gatattttag taacccagct atgaacatat tgtacacatg ttcaacaaag tcctgatgga cttcttcaac ttctaagtac ttgatgatct ccaccttgca ggtttggaag caactaaaaa tgcaagagga ttgggccaaa ccattatttc tagctgatga agttggaaga tggaagactc aagaaaatag catgtctcag caaaaatcag ttaaagatac aacaatttga ctcaaatacc ggtctcttat gcagtgaagc aagcctccaa ccagctggtt ctgagccttt caaatgacta aggaggccct tgctcttgac ttgtatttta ggaacatgaa aacgcccccc tattcttata taaaattatt ttcagataag aaaaatgata ggtgttttct ctttaagaca taacttattc tgtcggttta tgcaactgat ggtttatagg caaggactca taaacaagaa gcagcttcag tgcctacctg tgatctgtct ggttcagaaa acaacaaaga aaagaagaaa tcatcatact gcccaaagag agatggtaaa tgtagaagaa tgaagctgta tcctctggaa tttagatcaa cataacaaat cctttcagca ggaaccttca agcagacaac cttgtgtggc ttgggagttt aagtaaagct ctcaagcata tgcttcaact cagtagtgta taatatggtt aaagggtcct gtatacagaa aatgacgtct gtctggtgaa tgagactctt aaactgctta tttaagtttg aagtgaaact gcattcaggc actccatagt ttttaggcat ctggtcattc aaaattaaag 960 1020 1080 1140 1200 1260 1320 1380 1440 1500 1560 1620 1680 1740 1800 1860 1920 1980 2040 2100 2160 2220 2280 2340 2400 2460 2520 2580 2640 2700 2760 2820 2880 2940 3000 3060 3120 3180 3240 3300 3360 3420 3480 3540 3600 3660 3671
<210> 119 <211> 1106 <212> PRT <213> Homo sapiens <400> 119 274
Met 1 Asn His Vai Vai Lys Glu Phe 20 His Gly Pro 35 Ser Gin Arg Asn Gly
Leu 5 Leu Ile Met Ile Lys Trp Thr Lys Asp Glu Arg 40 Vai Ile Ile Thr
Pro Thr 10 Asn Leu Pro 25 Gly Met Gly Thr Arg Asn Leu Thr Tyr Gin Met
Ile Asn Thr 15 Trp Vai Lys 30 Thr Phe Asn 45 Arg Ile Gin Leu Ile Asn Asn 275 50
Trp Gin 65 Gin Leu Vai Ile Leu Asp Ais Ile Cys ALa 100 Gly Thr Pro 115 Ile Phe Ala 130 Cys Gin Glu 145 Tyr Glu Asn Gly Glu Lys Ala Ile Lys Pro Tyr 130 Lys Ser Ser 195 Asn Asp Ala 210 Ile Cys Ile 225 Trp Ile Arg Vai Ser Leu Asp Leu Ala Glu Leu 260 Leu Ser Ala 275 Arg Gin Asp 290 Gly Asn Gin 305 Val Thr Asp Leu Met Asp Leu Val Phe Ser Gin 340 Lys Asn Arg 355 His Leu Leu 370 Glu Arg Tyr 335 Ser Val Phe Leu Thr Ala Ala Ala Thr Asp Ala 420 Glu Asn Val 435 Val Lys Ile 450 Tyr Arg Thr 465 Gly Glu Lys Arg Glu Leu Phe Gin Leu Gin Ser SOO Asp Glu His 515 Ile Asp His 530 Asp Leu 55
Ser Ser 70 Phe Arg Glu 85 Ala His Lys Arg Ala Ile Pro Gin Asn Asn Leu 120 Gly Ser Leu 135 Leu Pro Ile 150 Thr Arg Leu 165 Gly Phe Lys Phe Leu Arg Arg Pro Glu Ala Arg 200 Glu Met Pro 215 Ser Leu Val 230 Pro Leu His 245 Ile Lys Glu Gly Val Leu Lys Ala Cys Cys Leu 280 Glu Gly Glu 295 Asp Asp Thr 310 Leu Met Leu 325 Lys Arg Leu Ser Arg Gin lie Phe Lys Thr Leu 360 Glu Lys Arg 375 Ile Leu Leu 390 Thr Thr Thr 405 Arg Val Val Gin Ala Val Asp Val Tyr Arg Leu 440 Arg Gin Val 455 Phe Lys Asn 470 Pro Phe Thr 485 Ile Glu Asp Leu His Ala Ala Ala Tyr Leu Gin 520 Met Tyr Thr 535 Cys
Gly Gin Glu 60 Phe Ile Lys 75 Thr Ser Ala 90 Ser Asn Arg 105 Gin Glu Leu Trp Gly Thr Leu Lys Ala Arg Glu 140 Lys Ile Ser 155 Glu Asn Thr 170 Lys Glu Asp 185 Leu Asn Glu Lys Leu Ser Arg Lys Gin Glu Glu 220 Ile Leu Leu 235 Met Glu Lys 250 Leu Cys Asp 265 Leu Asn Leu Gly Ser Pro Asp Val Glu Glu Ser 300 Gly Arg Asp 315 Glu Gly Leu 330 Asn Ile Ile 345 Arg Ile Asp Gly Asn Leu Phe Gin Gin Val Gly 380 Gly Ile Phe 395 Asp Pro Arg 410 Val Tyr Arg 425 Ile Thr Cys Gly Lys Asp Ser Leu Arg Tyr Phe 460 Ser Leu Gin 475 Asn Ser Gin 490 Arg Lys Ser 505 Ser Leu Gly Ile Asp Leu Ser Val 540
Val Trp Asp Tyr 80 Ser Thr Lys 95 Ser Leu Leu 110 Leu Thr Ser 125 Leu Phe Asp Thr Phe Lys Met Asp Ala Thr Pro 160 Leu Met Ala 175 Ile Val Gin 190 Lys Lys Asn 205 Pro Asp val Asn Asp Leu Ile Tyr Arg Lys Phe 240 Thr Arg Ser 255 Pro His Pro 270 Arg Leu Thr 285 Phe Ser Ala Asp His Ile Asp Lys Met Ile Phe 320 His Gin Thr 335 Leu Glu Arg 350 Leu Leu Thr 365 Val Thr His Gin Asn Lys Asp Val Gly Leu Thr 400 Ser Trp Asn 415 Pro Ile Gly 430 Gin Lys Thr 445 Val Glu Glu Ile Arg Gin Thr Lys Gin Glu Leu 480 Val Thr Gin 495 Leu Asp Ile 510 Lys Leu Ala 525 Gly Ile Ser Lys Glu Glu Leu 276 ASp Vai Vai Glu Glu Ser His Tyr Ile Gin Gin Arg Vai Gin Lys Ala 545 550 555 560 Gin Phe Leu Vai Glu Phe Glu Ser Gin Asn Lys Glu Phe Leu Met Glu 565 570 575 Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu Arg Glu Pro Vai Phe 580 585 S90 Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu Asn Lys Pro Gin Pro 595 600 605 Gin Pro Ser Pro Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile 610 615 620 Ser Ser Lys Met Ala Ser Vai Vai Ile Asp Asp Leu Pro Lys Glu Gly 625 630 635 640 Glu Lys Gin Asp Leu Ser Ser Ile Lys vai Asn Vai Thr Thr Leu Gin 645 650 655 Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys 660 665 670 Gly Phe Gly Ser Vai Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 675 680 685 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr Leu 690 695 700 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 705 710 715 720 Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp ile Gly Pro Asn 725 730 735 Leu Asp Gin Leu Lys Asp Asp Glu Vai Leu Arg His Cys Asn Pro Trp 740 745 750 Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Vai 755 760 765 Ser lie Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 770 775 780 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 785 790 795 800 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 805 810 815 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai Glu 820 825 830 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 835 840 845 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 850 855 860 Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala Arg 865 870 875 880 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 885 890 895 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Vai 900 905 910 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 915 920 925 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met Asn 930 935 940 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai Leu 945 950 955 960 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 965 970 975 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser Gly 980 985 990 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 995 1000 1005 Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1010 1015 1020 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 277 1025 1030 1035 1040
Leu Val Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 1045 1050 1055
Glu Thr Leu Val Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1060 1065 1070
Gin Glu Ala Leu Asn Cys Leu Val Lys Ala Leu Asp Ile Lys Ser Ala 1075 1080 1085
Asp Pro Glu Val Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1090 1095 1100
Asn Asn 1105
<210> 120 <211> 1150 <212> PRT <213> Homo sapiens <400> 120 278
Lys Glu Gly Ile Ala Phe Leu Tyr 1 5 Gly Gly Ile Leu Ala Asp Asp Met 20 Ile Ala Phe Leu Ser Gly Met Phe 35 40 Leu Leu Ile Met Pro Thr Asn Leu 50 55 Ile Lys Trp Thr Pro Gly Met Arg 65 70 Lys Asp Glu Arg Thr Arg Asn Leu 85 Vai Ile Ile Thr Thr Tyr Gin Met 100 Ser Ser Phe Arg Gly Gin Glu Phe 115 120 Glu Ala His Lys Ile Lys Thr Ser 130 135 Arg Ala Ile Pro Ala Ser Asn Arg 145 150 Gin Asn Asn Leu Gin Glu Leu Trp 165 Gly Ser Leu Leu Gly Thr Leu Lys 180 Pro Ile Thr Arg Ala Arg Glu Lys 195 200 Leu Gly Phe Lys Ile Ser Glu Asn 210 215 Phe Leu Arg Arg Thr Lys Glu Asp 225 230 Pro Glu Ala Arg Leu Asn Glu Lys 245 Glu Met Pro Ser Leu Ser Arg Lys 260 Leu Vai Pro Leu Gin Glu Glu Ile 275 280 His Ile Lys Glu Leu Leu Met Glu 290 295 Gly Vai Leu Lys Lys Leu Cys Asp 305 310 Ala Cys Cys Leu Leu Asn Leu Gly 325
Ser Leu 10 Tyr Arg Asp Gly Arg 15 Lys Gly 25 Leu Gly Lys Thr Vai 30 Gin Ile Asp Ala Ser Leu Vai 45 Asn His Vai Ile Asn Thr Trp 60 Vai Lys Glu Phe Vai Lys Thr 75 Phe His Gly Pro Ser 80 Asn Arg 90 Ile Gin Gin Arg Asn 95 Gly Leu 105 Ile Asn Asn Trp Gin 110 Gin Leu Vai Trp Asp Tyr Vai 125 Ile Leu Asp Ser Thr Lys Ser 140 Ala Ile Cys Ala Leu Leu Leu 155 Thr Gly Thr Pro Ile 160 Ser Leu 170 Phe Asp Phe Ala Cys 175 Gin Thr 185 Phe Lys Met Glu Tyr 190 Glu Asn Asp Ala Thr Pro Gly 205 Glu Lys Ala Leu Met Ala Ile 220 Ile Lys Pro Tyr Vai Gin Lys 235 Lys Lys Ser Ser Asn 240 Asn Pro 250 Asp Vai Asp Ala Ile 255 Cys Asn 265 Asp Leu Ile Ile Trp 270 lie Arg Tyr Arg Lys Phe Vai 285 Ser Leu Asp Thr Arg Ser Pro 300 Leu Ala Glu Leu His Pro Arg 315 Leu Leu Ser Ala Arg 320 Thr Phe 330 Ser Ala Gin Asp Gly 335 Asn 279
Glu Gly Glu Asp Ser Pro Asp Vai Asp His Ile Asp Gin Val Thr Asp 340 345 350 Asp Thr Leu Met Glu Glu Ser Gly Lys Met Ile Phe Leu Met Asp Leu 355 360 365 Leu Lys Arg Leu Arg Asp Glu Gly His Gin Thr Leu val Phe Ser Gin 370 375 380 Ser Arg Gin Ile Leu Asn Ile Ile Glu Arg Leu Leu Lys Asn Arg His 385 390 395 400 Phe Lys Thr Leu Arg Ile Asp Gly Thr Vai Thr His Leu Leu Glu Arg 405 410 415 Glu Lys Arg Ile Asn Leu Phe Gin Gin Asn Lys Asp Tyr Ser Val Phe 420 425 430 Leu Leu Thr Thr Gin Vai Gly Gly Vai Gly Leu Thr Leu Thr Ala Ala 435 440 445 Thr Arg Vai Vai Ile Phe Asp Pro Ser Trp Asn Pro Ala Thr Asp Ala 450 455 460 Gin Ala Vai Asp Arg Vai Tyr Arg Ile Gly Gin Lys Glu Asn Val Val 465 470 475 480 Vai Tyr Arg Leu Ile Thr Cys Gly Thr Vai Glu Glu Lys Ile Tyr Arg 485 490 495 Arg Gin Vai Phe Lys Asp Ser Leu Ile Arg Gin Thr Thr Gly Glu Lys 500 505 510 Lys Asn Pro Phe Arg Tyr Phe Ser Lys Gin Glu Leu Arg Glu Leu Phe 515 520 525 Thr Ile Glu Asp Leu Gin Asn Ser Vai Thr Gin Leu Gin Leu Gin Ser 530 535 54 0 Leu His Ala Ala Gin Arg Lys Ser Asp Ile Lys Leu Asp Glu His Ile 545 550 555 560 Ala Tyr Leu Gin Ser Leu Gly Ile Ala Gly Ile Ser Asp His Asp Leu 565 570 575 Met Tyr Thr Cys Asp Leu Ser Vai Lys Glu Glu Leu Asp Val Val Glu 580 585 590 Glu Ser His Tyr Ile Gin Gin Arg Vai Gin Lys Ala Gin Phe Leu Val 595 600 605 Glu Phe Glu Ser Gin Asn Lys Glu Phe Leu Met Glu Gin Gin Arg Thr 610 615 620 Arg Asn Glu Gly Ala Trp Leu Arg Glu Pro Vai Phe Pro Ser Ser Thr 625 630 63S 640 Lys Lys Lys Cys Pro Lys Leu Asn Lys Pro Gin Pro Gin Pro Ser Pro 645 650 655 Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile Ser Ser Lys Met 660 665 670 Ala Ser Vai Vai Ile Asp Asp Leu Pro Lys Glu Gly Glu Lys Gin Asp 675 680 685 Leu Ser Ser Ile Lys Vai Asn Vai Thr Thr Leu Gin Asp Gly Lys Gly 690 695 700 Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys Gly Phe Gly Ser 705 710 715 720 Vai Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met Glu Lys Ser Phe 725 730 735 Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr Leu Gin Glu Gly Pro 740 745 750 Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser Phe Asn Tyr Val 755 760 765 Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn Leu Asp Gin Leu 770 775 780 Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro Trp Pro Ile Ile Ser 785 790 795 800 Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Vai Ser Ile Ile Glu 805 810 815 280 lie Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu Gin Asp Ala Gin 820 825 830 Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala Ser Ser Pro Gin 835 840 845 Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser Ala Asp Asn Arg 850 855 860 Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai Glu Lys Glu Asn Ser 865 870 875 880 Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe Vai His Ser Lys 885 890 895 Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp Glu Pro Glu Glu 900 905 910 Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala Arg Arg Ile Vai Ser 915 920 925 Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr Ser Ser Ile Asn 930 935 940 Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Vai Lys Gin Phe Asp 945 950 955 960 Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly Arg Phe Phe Ser 965 970 975 Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met Asn Ser Arg Arg Ser 980 985 990 Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai Leu Asp His Vai Glu 995 1000 1005 Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala Lys Gly Pro Glu 1010 1015 1020 Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser Gly Glu Ala Ser Lys 1025 1030 1035 1040 Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser Ser Glu Asn Lys 1045 1050 1055 Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu Ala Gin Glu Thr 1060 1065 1070 Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin Leu Vai Gly Ser 1075 1080 1085 Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr Glu Thr Leu vai 1090 1095 1100 Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile Gin Glu Ala Leu 1105 1110 1115 1120 Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser Ala Asp Pro Glu Vai 1125 1130 1135 Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn Asn Asn 1140 1145 1150
<210> 121 <211> 1106 <212> PRT <213> Homo sapiens <4 0 0> 121 281
Met 1 Asn His Vai Leu 5 Leu Ile Met Vai Lys Glu Phe 20 Ile Lys Trp Thr His Gly Pro 35 Ser Lys Asp Glu Arg 40 Gin Arg 50 Asn Gly Vai Ile Ile 55 Thr Trp Gin Gin Leu Ser Ser Phe Arg
Pro Thr 10 Asn Leu Ile Asn Thr 15 Trp Pro 25 Gly Met Gly Vai Lys 30 Thr Phe Thr Arg Asn Leu Asn 45 Arg Ile Gin Thr Tyr Gin Met 60 Leu Ile Asn Asn Gly Gin Glu Phe Vai Trp Asp Tyr 282 65 70 Vai Ile Leu Asp Glu 85 Ala His Lys Ala lie Cys Ala 100 Arg Ala Ile Pro Gly Thr Pro 115 Ile Gin Asn Asn Leu 120 Phe Ala 130 Cys Gin Gly Ser Leu 135 Leu Glu 145 Tyr Glu Asn Pro Ile 150 Thr Arg Gly Glu Lys Ala Leu 165 Gly Phe Lys lie Lys Pro Tyr 180 Phe Leu Arg Arg Lys Ser Ser 195 Asn Pro Glu Ala Arg 200 Asp Ala 210 Ile Cys Glu Met Pro 215 Ser Ile 225 Trp Ile Arg Leu Vai 230 Pro Leu Vai Ser Leu Asp His 245 Ile Lys Glu Leu Ala Glu Leu 260 Gly Vai Leu Lys Leu Ser Ala 275 Arg Ala Cys Cys Leu 280 Gin Asp 290 Gly Asn Glu Gly Glu 298 Asp Gin 305 Vai Thr Asp Asp Thr 310 Leu Met Leu Met Asp Leu Leu 325 Lys Arg Leu Vai Phe Ser Gin 340 Ser Arg Gin Ile Lys Asn Arg 355 His Phe Lys Thr Leu 360 Leu Leu 370 Glu Arg Glu Lys Arg 375 Ile Tyr 385 Ser Vai Phe Leu Leu 390 Thr Thr Leu Thr Ala Ala Thr 405 Arg Vai Vai Ala Thr Asp Ala 420 Gin Ala Vai Asp Glu Asn Vai 435 Vai Vai Tyr Arg Leu 440 Lys Ile 450 Tyr Arg Arg Gin Vai 455 Phe Thr 465 Gly Glu Lys Lys Asn 470 Pro Phe Arg Glu Leu Phe Thr 485 Ile Glu Asp Gin Leu Gin Ser 500 Leu His Ala Ala Asp Glu His 515 Ile Ala Tyr Leu Gin 520 Asp His 530 Asp Leu Met Tyr Thr 535 Cys Asp 545 Vai Vai Glu Glu Ser 550 His Tyr 75 80 Ile Lys 90 Thr Ser Ser Thr Lys 95 Ser Ala 105 Ser Asn Arg Leu Leu 110 Leu Thr Gin Glu Leu Trp Ser 125 Leu Phe Asp Gly Thr Leu Lys 140 Thr Phe Lys Met Ala Arg Glu 155 Lys Asp Ala Thr Pro 160 Ile Ser 170 Glu Asn Leu Met Ala 175 Ile Thr 185 Lys Glu Asp Vai Gin 190 Lys Lys Leu Asn Glu Lys Asn 205 Pro Asp Vai Leu Ser Arg Lys 220 Asn Asp Leu Ile Gin Glu Glu 235 Ile Tyr Arg Lys Phe 240 Leu Leu 250 Met Glu Thr Arg Ser 255 Pro Lys 265 Leu Cys Asp His Pro 270 Arg Leu Leu Asn Leu Gly Thr 285 Phe Ser Ala Ser Pro Asp Vai 300 Asp His Ile Asp Glu Glu Ser 315 Gly Lys Met Ile Phe 320 Arg Asp 330 Glu Gly His Gin Thr 335 Leu Leu 345 Asn Ile Ile Glu Arg 350 Leu Leu Arg Ile Asp Gly Thr 365 Vai Thr His Asn Leu Phe Gin 380 Gin Asn Lys Asp Gin vai Gly 395 Gly Vai Gly Leu Thr 400 Ile Phe 410 Asp Pro Ser Trp Asn 415 Pro Arg 425 Vai Tyr Arg Ile Gly 430 Gin Lys Ile Thr Cys Gly Thr 445 Vai Glu Glu Lys Asp Ser Leu 460 Ile Arg Gin Thr Arg Tyr Phe 475 Ser Lys Gin Glu Leu 480 Leu Gin 4 90 Asn Ser Vai Thr Gin 495 Leu Gin 505 Arg Lys Ser Asp Ile 510 Lys Leu Ser Leu Gly Ile Ala 525 Gly Ile Ser Asp Leu Ser Vai 540 Lys Glu Glu Leu Ile Gin Gin 555 Arg Vai Gin Lys Ala 560 283
Gin Phe Leu Val Glu Phe Glu Ser Gin Asn Lys Glu Phe Leu Met Glu 565 570 575 Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu Arg Glu Pro Val Phe 580 585 590 Pro Ser Ser thr Lys Lys Lys Cys Pro Lys Leu Asn Lys Pro Gin Pro 595 600 605 Gin Pro Ser Pro Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile 610 615 620 Ser Ser Lys Met Ala Ser Val Val Ile Asp Asp Leu Pro Lys Glu Gly 625 630 635 640 Glu Lys Gin Asp Leu Ser Ser Ile Lys Val Asn Val Thr Thr Leu Gin 645 650 655 Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys 660 665 670 Gly Phe Gly Ser Val Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 675 680 685 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Val Gin Lys Glu Thr Leu 690 695 700 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 705 710 715 720 Phe Asn Tyr Val Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn 725 730 735 Leu Asp Gin Leu Lys Asp Asp Glu Val Leu Arg His Cys Asn Pro Trp 740 745 750 Pro Ile ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Val 755 760 765 Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 770 775 780 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 785 790 795 800 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 805 810 815 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Val Glu 820 825 830 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 835 840 845 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 850 855 860 Glu Pro Glu Glu Val Val Val Lys Ala Lys Ile Arg Ser Lys Ala Arg 865 870 875 880 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 885 890 895 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Val 900 905 910 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 915 920 925 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Val Asn Lys Ser Met Asn 930 935 940 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Val Leu 945 950 955 960 Asp His Val Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 965 970 975 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Val Glu Glu Ser Ser Gly 980 985 990 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 995 1000 1005 Ser Glu Asn Lys Ser Ser Trp Leu Mét Thr Ser Lys Pro Ser Ala Leu 1010 1015 1020 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1025 1030 1035 1040 Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp Tyr 284 1045 1050 1055
Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys Ile 1060 1065 1070
Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser Ala 1075 1080 1085
Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu Asn 1090 1095 1100
Asn Asn 1105
<210> 122 <211> 2294 <212> ADN <213> Homo sapiens <400> 122 tcattaataa gacaaactac tggtgaaaaa gaattaagag agctctttac aatcgaggat cagtctttgc atgctgctca gaggaaatct ctgcagtctt tggggatagc tggaatctca tctgttaaag aagagcttga tgtggtagaa aaagctcaat tcctcgttga attcgagtct agaactagaa atgagggggc ctggctaaga aaatgcccta aattgaataa accacagcct acteaggaag aagatatcag ttccaaaatg gagggtgaga aacaagatct ctccagtata taaggtacag gtagtgctga ctctataact gaactttgta ctaactcttc attgggaatg gtacaaaaag agacattaca agaggggcct gaaagtttta attatgtact tagcaaatca caactaaagg atgatgagat tttacgtcat aatgaaagtc aaaatgcaga atcaaatgta gcatcccata gtgcactgca ggatgctcaa tcagcatctt caccacagta tgcatgtgat aacagacaaa atttttccag tcagtcttta ggctctgcac ctaattccaa agcagggttt ttttctgaga aagacgatga accagaagaa gctagaagga ttgtttcaga tggcgaagat ataaatccat tcaacacatc tctctttcaa actcccaaaa atgacatcag tccaccagga gtaaataagt ctatgaactc tagaagatct gttttagacc acgtggagga catggaggaa cctgaagatt atccagaaga aggggtggag gaagaggatc cttccggaga aacactgtct tctaagccta gtgctctagc tcaagagacc gaacagttgg ttggttctcc ccaggataag cttgtaaagc gtggaaaaga actaaaagag ttagttaaag cgcttgacat aaaaagtgca ttgtataagc aacttaataa caattgagaa actgaatatg agggaatttt tgttcccata ggcttaaggc aagaaagatc tcaaaaagca agtctggtat tctgagcact agcttaatat catattctat aaatttaact gtgttgtttc ttcttaattt tactctgaaa gtgatcatct aagttacttt tctc aagaaccctt tccgatattt tagtaaacaa 60 cttcagaact ctgtaaccca gctgcagctt 120 gatataaaac tagatgaaca tattgcctac 180 gaccatgatt tgatgtacac atgtgatctg 240 gaatctcact atattcaaca aagggttcag 300 caaaataaag agttcctgat ggaacaacaa 360 gaacctgtat ttccttcttc aacaaagaag 420 cagccttcac ctcttctaag tactcatcat 480 gcaagtgtag tcattgatga tctgcccaaa 540 aaggtgaatg ttaccacctt gcaagatggg 600 actttaccaa aggggtttgg aagtgtagaa 660 gaaaaaagct ttgcaactaa aaatgaagct 720 aagcaggagg cactgcaaga ggatcctctg 780 accaaagctg atattgggcc aaatttagat 840 tgcaatcctt ggcccattat ttccataaca 900 tccattattg aaatagctga tgacctttca 960 gcaagtgagg ccaagttgga agaggaacct 1020 ttcaatcttt tcttggaaga ctcagcagac 1080 gagcatgttg agaaagaaaa tagcttgtgt 1140 gtgcatagca aaacatgtct cagttgggag 1200 gtagtagtta aagcaaaaat cagaagtaaa 1260 gaagatgatt cttttaaaga tacctcaagc 1320 ttctcatctg tgaaacaatt tgatgcttca 1380 aggttctttt catctcaaat acccagtagt 1440 ctggcttcta ggaggtctct tattaatatg 1500 agacttgacg acagcagtga agcaaagggt 1560 gaaagcagtg gcgaagcctc caagtataca 1620 tcagaaaaca agtccagctg gttaatgacg 1680 tctcttggtg cccctgagcc tttgtctggt 1740 gcggcagagg ctacaaatga ctatgagact 1800 tgtggaaaaa tccaggaggc cctaaactgc 1860 gatcctgaag ttatgctctt gactttaagt 1920 tgtaacctgt ttattgtatt ttaaagtgaa 1980 attggattct ttgggaacat gaagcattca 2040 acttctgccc tgcaacgccc cccactccat 2100 ttcttcactt gaatattctt atattttagg 2160 ttggaaagtt ttgtaaaatt attctggtca 2220 ttgtatataa cagttcagat aagaaaatta 2280 2294 285
<210> 123 <211> 2294 <212> ADN <213> Homo sapiens <4 Ο 0> 123 tcattaataa gacaaactac tggtgaaaaa gaattaagag agctctttac aatcgaggat cagtctttgc atgctgctca gaggaaatct ctgcagtctt tggggatagc tggaatctca tctgttaaag aagagcttga tgtggtagaa aaagctcaat tcctcgttga attcgagtct agaactagaa atgagggggc ctggctaaga aaatgcccta aattgaataa accacagcct actcaggaag aagatatcag ttccaaaatg gagggtgaga aacaagatct ctccagtata aaaggtacag gtagtgctga ctctatagct gaactttgta ctaactcttc attgggaatg gtacaaaaag agacattaca agaggggcct gaaagtttta attatgtact tagcaaatca caactaaagg atgatgagat tttacgtcat aatgaaagtc aaaatgcaga atcaaatgta gcatcccata gtgcactgca ggatgctcaa tcagcatctt caccacagta tgcatgtgat aacagacaaa atttttccag tcagtcttta ggctctgcac ctaattccag agcagggttt ttttctgaga aagacgatga accagaagaa gctagaagga ttgtttcaga tggcgaagat ataaatccat tcaacacatc tctctttcaa actcccaaaa atgacatcag tccaccagga gtaaataagt ctatgaactc tagaagatct gttttagacc acgtggagga catggaggaa cctgaagatt atccagaaga aggggtggag gaagaggatc cttccggaga aacactgtct tctaagccta gtgctctagc tcaagagacc gaacagttgg ttggttctcc ccaggataag cttgtaaagc gtggaaaaga actaaaagag ttagttaaag cgcttgacat aaaaagtgca ttgtataagc aacttaataa caattgagaa actgaatatg agggaatttt tgttcccata ggcttaaggc aagaaagatc tcaaaaagca agtctggtat tctgagcact agcttaatat catattctat aaatttaact gtgttgtttc ttcttaattt tactctgaaa gtgatcatct aagttacttt tctc aagaaccctt tccgatattt tagtaaacaa 60 cttcagaact ctgtaaccca gctgcagctt 120 gatataaaac tagatgaaca tattgcctac 180 gaccatgatt tgatgtacac atgtgatctg 240 gaatctcact atattcaaca aagggttcag 300 caaaataaag agttcctgat ggaacaacaa 360 gaacctgtat ttccttcttc aacaaagaag 420 cagccttcac ctcttctaag tactcatcat 480 gcaagtgtag tcattgatga tctgcccaaa 540 aaggtgaatg ttaccacctt gcaagatggt 600 actttaccaa aggggtttgg aagtgtagaa 660 gaaaaaagct ttgcaactaa aaatgaagct 720 aagcaagagg cactgcaaga ggatcctctg 780 accaaagctg atattgggcc aaatttagat 840 tgcaatcctt ggcccattat ttccataaca 900 tccattattg aaatagctga tgacctttca 960 gcaagtgagg ccaagttgga agaggaacct 1020 ttcaatcttt tcttggaaga ctcagcagac 1080 gagcatgttg agaaagaaaa tagcttgtgt 1140 gtgcatagca aaacatgtct cagttgggag 1200 gtagtagtta aagcaaaaat cagaagtaaa 1260 gaagatgatt cttttaaaga tacctcaagc 1320 ttctcatctg tgaaacaatt tgatgcttca 1380 aggttctttt catctcaaat acccagtagt 1440 ctggcttcta ggaggtctct tattaatatg 1500 agacttgacg acagcagtga agcaaagggt 1560 gaaagcagtg gcgaagcctc caagtataca 1620 tcagaaaaca agtccagctg gttaatgacg 1680 tctcttggtg cccctgagcc tttgtctggt 1740 gcggcagagg ctacaaatga ctatgagact 1800 tgtggaaaaa tccaggaggc cctaaactgc 1860 gatcctgaag ttatgctctt gactttaagt 1920 tgtaacctgt ttattgtatt ttaaagtgaa 1980 attggattct ttgggaacat gaagcattca 2040 acttctgccc tgcaacgccc cccactccat 2100 ttcttcactt gaatattctt atattttagg 2160 ttggaaagtt ttgtaaaatt attctggtca 2220 ttgtatataa cagttcagat aagaaaatta 2280 2294
<210> 124 <211> 2294 <212> ADN <213> Homo sapiens <400> 124 286 286 tcattaataa gaattaagag cagtctttgc ctgcagtctt tctgttaaag aaagctcaat agaactagaa aaatgcccta actcaggaag gagggtgaga taaggtacag gaactttgta gtacaaaaag gaaagtttta caactaaagg aatgaaagtc gcatcccata tcagcatctt aacagacaaa ggctctgcac ttttctgaga gctagaagga ataaatccat actcccaaaa gtaaataagt gttttagacc cctgaagatt gaagaggatc tctaagccta gaacagttgg cttgtaaagc ttagttaaag ttgtataagc actgaatatg ggcttaaggc agtctggtat catattctat ttcttaattt aagttacttt gacaaactac agctctttac atgctgctca tggggatagc aagagcttga tcctcgttga atgagggggc aattgaataa aagatatcag aacaagatct gtagtgctga ctaactcttc agacattaca attatgtact atgatgagat aaaatgcaga gtgcactgca caccacagta atttttccag ctaattccaa aagacgatga ttgtttcaga tcaacacatc atgacatcag ctatgaactc acgtggagga atccagaaga cttccggaga gtgctctagc ttggttctcc gtggaaaaga cgcttgacat aacttaataa agggaatttt aagaaagatc tctgagcact aaatttaact tactctgaaa tctc tggtgaaaaa aatcgaggat gaggaaatct tggaatctca tgtggtagaa attcgagtct ctggctaaga accacagcct ttccaaaatg ctccagtata ctctataact attgggaatg agaggggcct tagcaaatca tttacgtcat atcaaatgta ggatgctcaa tgcatgtgat tcagtcttta agcagggttt accagaagaa tggcgaagat tctctttcaa tccaccagga tagaagatct catggaggaa aggggtggag aacactgtct tcaagagacc ccaggataag actaaaagag aaaaagtgca caattgagaa tgttcccata tcaaaaagca agcttaatat gtgttgtttc gtgatcatct aagaaccctt tccgatattt tagtaaacaa 60 cttcagaact ctgtaaccca gctgcagctt 120 gatataaaac tagatgaaca tattgcctac 180 gaccatgatt tgatgtacac atgtgatctg 240 gaatctcact atattcaaca aagggttcag 300 caaaataaag agttcctgat ggaacaacaa 360 gaacctgtat ttccttcttc aacaaagaag 420 cagccttcac ctcttctaag tactcatcat 480 gcaagtgtag tcattgatga tctgcccaaa 540 aaggtgaatg ttaccacctt gcaagatggg 600 actttaccaa aggggtttgg aagtgtagaa 660 gaaaaaagct ttgcaactaa aaatgaagct 720 aagcaggagg caetgcaaga ggatcctctg 780 accaaagctg atattgggcc aaatttagat 840 tgcaatcctt ggcccattat ttccataaca 900 tccattattg aaatagctga tgacctttca 960 gcaagtgagg ccaagttgga agaggaacct 1020 ttcaatcttt tcttggaaga ctcagcagac 1080 gagcatgttg agaaagaaaa tagcttgtgt 1140 gtgcatagca aaacatgtct cagttgggag 1200 gtagtagtta aagcaaaaat cagaagtaaa 1260 gaagatgatt cttttaaaga tacctcaagc 1320 ttctcatctg tgaaacaatt tgatgcttca 1380 aggttctttt catctcaaat acccagtagt 1440 ctggcttcta ggaggtctct tattaatatg 1500 agacttgacg acagcagtga agcaaagggt 1560 gaaagcagtg gcgaagcctc caagtataca 1620 tcagaaaaca agtccagctg gttaatgacg 1680 tctcttggtg cccctgagcc tttgtctggt 1740 gcggcagagg ctacaaatga ctatgagact 1800 tgtggaaaaa tccaggaggc cctaaactgc 1860 gatcctgaag ttatgctctt gactttaagt 1920 tgtaacctgt ttattgtatt ttaaagtgaa 1980 attggattct ttgggaacat gaagcattca 2040 acttctgccc tgcaacgccc cccactccat 2100 ttcttcactt gaatattctt atattttagg 2160 ttggaaagtt ttgtaaaatt attctggtca 2220 ttgtatataa cagttcagat aagaaaatta 2280 2294
<210> 125 <211> 419 <212> PRT <213> Homo sapiens <400> 125 287
Met Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr 1 5 10 15 Leu Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu 20 25 30 Ser Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro 35 40 45 Asn Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro 50 55 60 Trp Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn 65 70 75 80 Vai Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala 85 90 95 Leu Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser 100 105 110 Ala Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp 115 120 125 Ser Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai 130 135 140 Glu Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Lys Ala Gly 145 150 155 160 Phe Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp 165 170 175 Asp Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala 180 185 190 Arg Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp 195 200 205 Thr Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser 210 215 220 Vai Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro 225 230 235 240 Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met 245 250 255 Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai 260 265 270 Leu Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu 275 280 285 Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser 290 295 300 Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu 305 310 315 320 Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala 325 330 335 Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu 340 345 350 Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp 355 360 365 Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys 370 375 380 Ile Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser 385 390 395 400 Ala Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu 405 410 415 Asn Asn Asn <210> 126 <211> 450 <212> PRT 288 <213> Homo sapiens <400> 126
Asp 1 Gly Lys Gly Gly Phe Gly Ser 20 Glu Lys Ser 35 Phe Gin Glu 50 Gly Pro Phe 65 Asn Tyr Vai Leu Asp Gin Leu Pro Ile Ile Ser 100 Ser Ile Ile 115 Glu Gin Asp 130 Ala Gin Ser 145 Ser Pro Gin Ala Asp Asn Arg Lys Glu Asn Ser 180 Vai His Ser 195 Lys Glu Pro Glu Glu
Thr Gly Ser Ala 5 Vai Glu Glu Leu Ala Thr Lys Asn Lys Gin Glu 40 Ala Leu Ser 55 Lys Ser Lys 70 Asp Asp Glu 85 lie Thr Asn Glu Ile Ala Asp Asp Ala Ser Glu 120 Ala Tyr Ala 135 Cys Asp Gin 150 Asn Phe Ser 165 Leu Cys Gly Ser Thr Cys Leu Ser Vai Vai Vai 200 Lys
Asp Ser 10 Ile Ala Cys 25 Thr Asn Ser Glu Ala Vai Gin Leu Gin Glu Asp 60 Thr Lys Ala 75 Asp Ile Leu 90 Arg His Ser 105 Gin Asn Ala Leu Ser Ala Ser Lys Leu Glu Glu 140 Phe Asn Leu 155 Phe Ser Gin 170 Ser Leu Ala 185 Pro Asn Ser Trp Glu Phe Ser Ala Lys Ile Arg
Thr Leu Pro 15 Lys Ser Leu 30 Gly Met Lys 45 Glu Thr Leu Pro Leu Glu Ser Ile Gly Pro Asn 80 Cys Asn Pro 95 Trp Glu Ser 110 Asn Vai His 125 Ser Ala Leu Glu Pro Ser Ala Leu Glu Asp Ser 160 Glu His Vai 175 Glu Arg Ala 190 Gly Phe Glu 205 Lys Asp Asp Ser Lys Ala Arg 289 210 215 Arg Ile Vai Ser Asp Gly Glu Asp 225 230 Ser Ser Ile Asn Pro Phe Asn Thr 245 Lys Gin Phe Asp Ala Ser Thr Pro 260 Arg Phe Phe Ser Ser Gin Ile Pro 275 280 Ser Arg Arg Ser Leu Ala Ser Arg 290 295 Asp His Vai Glu Asp Met Glu Glu 305 310 Lys Gly Pro Glu Asp Tyr Pro Glu 325 Glu Ala Ser Lys Tyr Thr Glu Glu 340 Ser Glu Asn Lys Ser Ser Trp Leu 355 360 Ala Gin Glu Thr Ser Leu Gly Ala 370 375 Leu Vai Gly Ser Pro Gin Asp Lys 385 390 Glu Thr Leu Vai Lys Arg Gly Lys 405 Gin Glu Ala Leu Asn Cys Leu Vai 420 Asp Pro Glu Vai Met Leu Leu Thr 435 440 Asn Asn 450 220 Glu Asp Asp 235 Ser Phe Lys Asp Thr 240 Ser Leu 250 Phe Gin Phe Ser Ser 255 Vai Lys 265 Asn Asp Ile Ser Pro 270 Pro Gly Ser Ser Vai Asn Lys 285 Ser Met Asn Arg Ser Leu Ile 300 Asn Met Vai Leu Arg Leu Asp 315 Asp Ser Ser Glu Ala 320 Glu Gly 330 Vai Glu Glu Ser Ser 335 Gly Asp 345 Pro Ser Gly Glu Thr 350 Leu Ser Met Thr Ser Lys Pro 365 Ser Ala Leu Pro Glu Pro Leu 380 Ser Gly Glu Gin Ala Ala Glu 395 Ala Thr Asn Asp Tyr 400 Glu Leu 410 Lys Glu Cys Gly Lys 415 Ile Lys 425 Ala Leu Asp Ile Lys 430 Ser Ala Leu Ser Leu Tyr Lys 445 Gin Leu Asn <210> 127 <211> 419 <212> PRT <213> Homo <4 Ο 0> 127 290
Met Glu Lys Ser 1 Leu Gin Glu Gly Ser Phe Asn 20 Tyr Asn Leu 35 Asp Gin Trp 50 Pro Ile Ile 65 Vai Ser Ile Ile Leu Gin Asp Ala Ala Ser Ser 100 Pro Ser Ala 115 Asp Asn Glu 130 Lys Glu Asn 145 Phe Vai His Ser Asp Glu Pro Glu Arg Arg Ile 180 Vai Thr Ser 195 Ser Ile Vai 210 Lys Gin Phe 225 Gly Arg Phe Phe Asn Ser Arg Arg Leu Asp His 260 Vai Ala Lys 275 Gly Pro 290 Gly Glu Ala Ser 305 Ser Ser Glu Asn Leu Ala Gin Glu Gin Leu Vai 340 Gly Tyr Glu 355 Thr Leu Ile 370 Gin Glu Ala 385 Ala Asp Pro Glu Asn Asn Asn
Phe 5 Ala Thr Lys Pro Lys Gin Glu Val Leu Ser Lys 40 Leu Lys Asp 55 Asp Ser Ile 70 Thr Asn Glu 85 Ile Ala Asp Gin Ala Ser Glu Gin Tyr Ala Cys 120 Arg Gin Asn 135 Phe Seu Leu 150 Cys Gly Lys 165 Thr Cys Leu Glu Val Val Val Ser Asp Gly Glu 200 Asn Pro Phe 215 Asn Asp Ala 230 Ser Thr Ser 245 Ser Gin Ile Ser Leu Ala Ser Glu Asp Met Glu 280 Glu Asp Tyr 295 Pro Lys Tyr 310 Thr Glu Lys 325 Ser Ser Trp Thr Ser Leu Gly Ser Pro Gin Asp 360 Val Lys Arg 375 Gly Leu Asn 390 Cys Leu Val 405 Met Leu Leu
Asn Glu 10 Ala Val Ala 25 Leu Gin Glu Ser Thr Lys Ala Glu Ile Leu Arg 60 Glu Ser Gin 75 Asn Asp Leu 90 Ser Ala Ala 105 Lys Leu Glu Asp Phe Asn Leu Ser Ser Gin Ser 140 Ser Ala Pro 155 Asn Ser Trp 170 Glu Phe Lys 185 Ala Lys Ile Asp Glu Asp Asp Thr Ser Leu Phe 220 Pro Lys Asn 235 Asp Pro Ser 250 Ser Val Arg 265 Arg Ser Leu Glu Arg Leu Asp Glu Glu Gly Val 300 Glu Asp Pro 315 Ser Leu Met 330 Thr Ser Ala 345 Pro Glu Pro Lys Ala Ala Glu Lys Glu Leu Lys 380 Val Lys Ala 395 Leu Thr Leu 410 Ser Leu
Gin Lys Glu 15 Thr Asp Pro 30 Leu Glu Asp 45 Ile Gly Pro His Cys Asn Pro Ala Glu Ser Asn 80 Ser His Ser 95 Ala Glu Glu 110 Pro Ser Phe 125 Leu Glu Asp Leu Glu His Val Ser Lys Ala Gly 160 Ser Glu Lys 175 Asp Arg Ser 190 Lys Ala Ser 205 Phe Lys Asp Gin Phe Ser Ser Ile Ser Pro Pro 240 Asn Lys Ser 255 Met Ile Asn 270 Met Val Asp 285 Ser Ser Glu Glu Glu Ser Ser Gly Glu Thr Leu 320 Lys Pro Ser 335 Ala Leu Ser 350 Gly Glu Ala 365 Thr Asn Asp Glu Cys Gly Lys Asp Ile Lys Ser 400 Tyr Lys Gin 415 Leu
<210> 128 <211> 1720 <212> ADN <213> Homo sapiens 291 291 <4 Ο 0> 128 ggcacgaggc taccaaaggg aaagctttgc aagaggcact aagctgatat atccttggcc ttattgaaat gtgaggccaa atcttttctt atgttgagaa atagcaaaac tagttaaagc atgattcttt catctgtgaa tcttttcatc cttctaggag ttgacgacag gcagtggcga aaaacaagtc ttggtgcccc cagaggctac gaaaaatcca ctgaagttat acctgtttat gattctttgg ctgccctgca tcacttgaat aaagttttgt atataacagt gatggtaaag gtagaagaac gaagctgtac cctctggaaa ttagatcaac ataacaaatg ctttcagcat gaaccttcag gcagacaaca ttgtgtggct tgggagtttt agtaaagcta tcaagcataa gcttcaactc agtagtgtaa aatatggttt aagggtcctg tatacagaag atgacgtcta tctggtgaac gagactcttg aactgcttag ttaagtttgt agtgaaactg cattcaggct ctccatagtc tttaggcata tggtcattct aaattaaagt tgctgactct ctcttcattg attacaagag tgtacttagc tgagatttta tgcagaatca actgcaggat acagtatgca ttccagtcag ttccagagca cgatgaacca ttcagatggc cacatctctc catcagtcca gaactctaga ggaggacatg agaagaaggg cggagaaaca tctagctcaa ttctccccag aaaagaacta tgacataaaa taataacaat aatttttgtt aagatctcaa agcactagct ttaactgtgt ctgaaagtga 60 120 180 240 300 360 420 480 540 600 660 720 780 840 900 960 1020 1080 1140 1200 1260 1320 1380 1440 1500 1560 1620 1680 1720 caccttgcaa gtttggaagt aactaaaaat gcaagaggat tgggccaaat cattatttcc agctgatgac gttggaagag ggaagactca agaaaatagc atgtctcagt aaaaatcaga taaagatacc acaatttgat tcaaataccc gtctcttatt cagtgaagca agcctccaag cagctggtta tgagcctttg aaatgactat ggaggcccta gctcttgact tgtattttaa gaacatgaag acgcccccca attcttatat aaaattattc tcagataaga gtacaggtag tttgtactaa aaaaagagac gttttaatta taaaggâtga aaagtcaaaa cccatagtgc catcttcacc gacaaaattt ctgcacctaa ctgagaaaga gaaggattgt atccattcaa ccaaaaatga ataagtctat tagaccacgt aagattatcc aggatccttc agcctagtgc agttggttgg taaagcgtgg ttaaagcgct ataagcaact aatatgaggg taaggcaaga tggtattctg ttctataaat taattttact tacttttctc atagctactt ggaatggaaa gggcctaagc aaatcaacca cgtcattgca aatgtatcca gctcaagcaa tgtgatttca tctttagagc gggtttgtgc gaagaagtag gaagatgaag tttcaattct ccaggaaggt agatctctgg gaggaaagac gtggaggaaa ctgtcttcag gagacctctc gataaggcgg aaagagtgtg agtgcagatc tgagaatgta cccataattg aaagcaactt taatatttct tgtttcttgg tcatctttgt
<210> 129 <211> 1744 <212> ADN <213> Homo sapiens <400> 129 292 aacaagatct gtagtgctga ctaactcttc agacattaca attatgtact atgatgagat aaaatgcaga gtgcactgca caccacagta atttttccag ctaattccag aagacgatga ttgtttcaga tcaacacatc atgacatcag ctatgaactc acgtggagga atccagaaga cttccggaga gtgctctagc ttggttctcc gtggaaaaga cgcttgacat aacttaataa agggaatttt aagaaagatc tctgagcact aaatttaact tactctgaaa tctc ctccagtata ctctatagct attgggaatg agaggggcct tagcaaatca tttacgtcat atcaaatgta ggatgctcaa tgcatgtgat tcagtcttta agcagggttt accagaagaa tggcgaagat tctctttcaa tccaccagga tagaagatct catggaggaa aggggtggag aacactgtct tcaagagacc ccaggataag actaaaagag aaaaagtgca caattgagaa tgttcccata tcaaaaagca agcttaatat gtgttgtttc gtgatcatct aaggtgaatg actttaccaa gaaaaaagct aagcaagagg accaaagctg tgcaatcctt tccattattg gcaagtgagg ttcaatcttt gagcatgttg gtgcatagca gtagtagtta gaagatgatt ttctcatctg aggttctttt ctggcttcta agacttgacg gaaagcagtg tcagaaaaca tctcttggtg gcggcagagg tgtggaaaaa gatcctgaag tgtaacctgt attggattct acttctgccc ttcttcactt ttggaaagtt ttgtatataa ttaccacctt aggggtttgg ttgcaactaa cactgcaaga atattgggcc ggcccattat aaatagctga ccaagttgga tcttggaaga agaaagaaaa aaacatçtct aagcaaaaat cttttaaaga tgaaacaatt catctcaaat ggaggtctct acagcagtga gcgaagcctc agtccagctg cccctgagcc ctacaaatga tccaggaggc ttatgctctt ttattgtatt ttgggaacat tgcaacgccc gaatattctt ttgtaaaatt cagttcagat gcaagatggt aagtgtagaa aaatgaagct ggatcctctg aaatttagat ttccataaca tgacctttca agaggaacct ctcagcagac tagcttgtgt cagttgggag cagaagtaaa tacctcaagc tgatgcttca acccagtagt tattaatatg agcaaagggt caagtataca gttaatgacg tttgtctggt ctatgagact cctaaactgc gactttaagt ttaaagtgaa gaagcattca cccactccat atattttagg attctggtca aagaaaatta aaaggtacag gaactttgta gtacaaaaag gaaagtttta caactaaagg aatgaaagtc gcatcccata tcagcatctt aacagacaaa ggctctgcac ttttctgaga gctagaagga ataaatccat actcccaaaa gtaaataagt gttttagacc cctgaagatt gaagaggatc tctaagccta gaacagttgg cttgtaaagc ttagttaaag ttgtataagc actgaatatg ggcttaaggc agtctggtat catattctat ttcttaattt aagttacttt 60 120 180 240 300 360 420 480 540 600 660 720 780 840 900 960 1020 1080 1140 1200 1260 1320 1380 1440 1500 1560 1620 1680 1740 1744
<210> 130 <211> 1711 <212> ADN <213> Homo sapiens <400> 130 293 ccaccttgca agatggtaaa ggtacaggta gtgctgactc tatagctact ttaccaaagg 60 ggtttggaag tgtagaagaa ctttgtacta actcttcatt gggaatggaa aaaagctttg 120 caactaaaaa tgaagctgta caaaaagaga cattacaaga ggggcctaag caagaggcac 180 tgcaagagga tcctctggaa agttttaatt atgtacttag caaatcaacc aaagctgata 240 ttgggccaaa tttagatcaa ctaaaggatg atgagatttt acgtcattgc aatccttggc 300 ccattatttc cataacaaat gaaagtcaaa atgcagaatc aaatgtatcc attattgaaa 360 tagctgatga cctttcagca tcccatagtg cactgcagga tgctcaagca agtgaggcca 420 agttggaaga ggaaccttca gcatcttcac cacagtatgc atgtgatttc aatcttttct 480 tggaagactc agcagacaac agacaaaatt tttccagtca gtctttagag catgttgaga 540 aagaaaatag cttgtgtggc tctgcaccta attccagagc agggtttgtg catsgcaaaa 600 catgtctcag ttgggagttt tctgagaaag acgatgaacc agaagaagta gtagttaaag 660 caaaaatcag aagtaaagct agaaggattg tttcagatgg cgaagatgaa gatgattctt 720 ttaaagatac ctcaagcata aatccattca acacatctct ctttcaattc tcatctgtga 780 aacaatttga tgcttcaact cccaaaaatg acatcagtcc accaggaagg ttcttttcat 840 ctcaaatacc cagtagtgta aataagtcta tgaactctag aagatctctg gcttctagga 900 ggtctcttat taatatggtt ttagaccacg tggaggacat ggaggaaaga cttgacgaca 960 gcagtgaagc aaagggtcct gaagattatc cagaagaagg ggtggaggaa agcagtggcg 1020 aagcctccaa gtatacagaa gaggatcctt ccggagaaac actgtcttca çaaaacaagt 1080 ccagctggtt aatgacgtct aagcctagtg ctctagctca agagacctct cttggtgccc 1140 ctgagccttt gtctggtgaa cagttggttg gttctcccca ggataaggcg gcagaggcta 1200 caaatgacta tgagactctt gtaaagcgtg gaaaagaact aaaagagtgt ggaaaaatcc 1260 aggaggccct aaactgctta gttaaagcgc ttgacataaa aagtgcagat cctgaagtta 1320 tgctcttgac tttaagtttg tataagcaac ttaataacaa ttgagaatgt aacctgttta 1380 ttgtatttta aagtgaaact gaatatgagg gaatttttgt tcccataatt ggattctttg 1440 ggaacatgaa gcattcaggc ttaaggcaag aaagatctca aaaagcaact tctgccctgc 1500 aacgcccccc actccatagt ctggtattct gagcactagc ttaatatttc ttcacttgaa 1560 tattcttata ttttaggcat attctataaa tttaactgtg ttgtttcttg gaaagttttg 1620 taaaattatt ctggtcattc ttaattttac tctgaaagtg atcatctttg tatataacag 1680 ttcagataag aaaattaaag ttacttttct c 1711
<210> 131 <211> 419 <212> PRT <213> Homo sapiens <400> 131 294
Met Glu Lys Ser 1 Leu Gin Glu Gly Ser Phe Asn 20 Tyr Asn Leu 35 Asp Gin Trp 50 Pro Ile Ile 65 Vai Ser Ile Ile Leu Gin Asp Ala Ala Ser Ser 100 Pro Ser Ala 115 Asp Asn Glu 130 Lys Glu Asn 145 Phe Vai His Ser Asp Glu Pro Glu Arg Arg Ile 180 Vai Thr Ser 195 Ser Ile Vai 210 Lys Gin Phe 225 Gly Arg Phe Phe Asn Ser Arg Arg Leu Asp His 260 Vai Ala Lys 275 Gly Pro Gly 290 Glu Ala Ser 305 Ser Ser Glu Asn Leu Ala Gin Glu Gin Leu Vai 340 Gly Tyr Glu 355 Thr Leu Ile 370 Gin Glu Ala 385 Ala Asp Pro Glu
Asn Asn Asn
Phe 5 Ala Thr Lys Pro Lys Gin Glu Vai Leu Ser Lys 40 Leu Lys Asp 55 Asp Ser Ile 70 Thr Asn Glu 85 Ile Ala Asp Gin Ala Ser Glu Gin Tyr Ala Cys 120 Arg Gin Asn 135 Phe Ser Leu 150 Cys Gly Lys 165 Thr Cys Leu Glu Vai Vai Vai Ser Asp Gly Glu 200 Asn Pro Phe 215 Asn Asp Ala 230 Ser Thr Ser 245 Ser Gin Ile Ser Leu Ala Ser
Glu Asp Met Glu 280 Glu Asp Tyr 295 Pro Lys Tyr 310 Thr Glu Lys 325 Ser Ser Trp Thr Ser Leu Gly Ser Pro Gin Asp 360 Vai Lys Arg 375 Gly Leu Asn 390 Cys Leu Val 405 Met Leu Leu
Asn Glu 10 Ala Val Ala 25 Leu Gin Glu Ser Thr Lys Ala Glu Ile Leu Arg 60 Glu Ser Gin 75 Asn Asp Leu 90 Ser Ala Ala 105 Lys Leu Glu Asp Phe Asn Leu Ser Ser Gin Ser 140 Ser Ala Pro 155 Asn Ser Trp 170 Glu Phe Lys 185 Ala Lys Ile Asp Glu Asp Asp Thr Ser Leu Phe 220 Pro Lys Asn 235 Asp Pro Ser 250 Ser Val Arg Arg Ser Leu 265
Glu Arg Leu Asp Glu Glu Gly Val 300 Glu Asp Pro 315 Ser Leu Met 330 Thr Ser Ala 345 Pro Glu Pro Lys Ala Ala Glu Lys Glu Leu Lys 380 Val Lys Ala 395 Leu Thr Leu 410 Ser Leu
Gin Lys Glu 15 Thr Asp Pro 30 Leu Glu Asp 45 Ile Gly Pro His Cys Asn Pro Ala Glu Ser Asn 80 Ser His Ser 95 Ala Glu Glu 110 Pro Ser Phe 125 Leu Glu Asp Leu Glu His Val Ser Arg Ala Gly 160 Ser Glu Lys 175 Asp Arg Ser 190 Lys Ala Ser 205 Phe Lys Asp Gin Phe Ser Ser Ile Ser Pro Pro 240 Asn Lys Ser 255 Met Ile Asn Met Val 270
Asp 285 Ser Ser Glu Glu Glu Ser Ser Gly Glu Thr Leu 320 Lys Pro Ser 335 Ala Leu Ser 350 Gly Glu Ala 365 Thr Asn Asp Glu Cys Gly Lys Asp Ile Lys Ser 400 Tyr Lys Gin 415 Leu 295
<210> 132 <211> 450 <212> PRT <213> Homo sapiens <4 0 0> 132 296
Asp Gly Lys Gly Thr Gly Ser Ala 1 5 Gly Phe Gly Ser Vai Glu Glu Leu 20 Glu Lys Ser Phe Ala Thr Lys Asn 35 40 Gin Glu Gly Pro Lys Gin Glu Ala 50 55 Phe Asn Tyr Vai Leu Ser Lys Ser 65 70 Leu Asp Gin Leu Lys Asp Asp Glu 85 Pro Ile Ile Ser Ile Thr Asn Glu 100 Ser Ile Ile Glu Ile Ala Asp Asp 115 120 Gin Asp Ala Gin Ala Ser Glu Ala 130 135 Ser Ser Pro Gin Tyr Ala Cys Asp 145 150 Ala Asp Asn Arg Gin Asn Phe Ser 165 Lys Glu Asn Ser Leu Cys Gly Ser 180 vai His Ser Lys Thr Cys Leu Ser 19S 200 Glu Pro Glu Glu Vai Vai Vai Lys 210 215 Arg lie Vai Ser Asp Gly Glu Asp 225 230 Ser Ser lie Asn Pro Phe Asn Thr 245
Lys Gin Phe Asp 260 Ala Ser Thr Pro Arg Phe Phe 275 Ser Ser Gin Ile Pro 280 Ser Arg 290 Arg Ser Leu Ala Ser 295 Arg Asp 305 His Vai Glu Asp Met 310 Glu Glu Lys Gly Pro Glu Asp 325 Tyr Pro Glu Glu Ala Ser Lys 340 Tyr Thr Glu Glu Ser Glu Asn 355 Lys Ser Ser Trp Leu 360 Ala Gin 370 Glu Thr Ser Leu Gly 375 Ala Leu 385 Vai Gly Ser Pro Gin 390 Asp Lys Glu Thr Leu Vai Lys 405 Arg Gly Lys Gin Glu Ala Leu 420 Asn Cys Leu Vai Asp Asn Pro Asn 450 Glu 435 Vai Met Leu Leu Thr 440
Asp Ser 10 Ile Ala Thr Leu Pro 15 Lys Cys 25 Thr Asn Ser Ser Leu 30 Gly Met Glu Ala Vai Gin Lys 45 Glu Thr Leu Leu Gin Glu Asp 60 Pro Leu Glu Ser Thr Lys Ala 75 Asp Ile Gly Pro Asn 80 Ile Leu 90 Arg His Cys Asn Pro 95 Trp Ser 105 Gin Asn Ala Glu Ser 110 Asn Vai Leu Ser Ala Ser His 125 Ser Ala Leu Lys Leu Glu Glu 140 Glu Pro Ser Ala Phe Asn Leu 155 Phe Leu Glu Asp Ser 160 Ser Gin 170 Ser Leu Glu His Vai 175 Glu Ala 185 Pro Asn Ser Arg Ala 190 Gly Phe Trp Glu Phe Ser Glu 205 Lys Asp Asp Ala Lys Ile Arg 220 Ser Lys Ala Arg Glu Asp Asp 235 Ser Phe Lys Asp Thr 240 Ser Leu 250 Phe Gin Phe Ser Ser 255 Vai Lys 265 Asn Asp Ile Ser Pro 270 Pro Gly Ser Ser Vai Asn Lys 285 Ser Met Asn Arg Ser Leu Ile 300 Asn Met Vai Leu Arg Leu Asp 315 Asp Ser Ser Glu Ala 320 Glu Gly 330 Vai Glu Glu Ser Ser 335 Gly Asp 345 Pro Ser Gly Glu Thr 350 Leu Ser Met Thr Ser Lys Pro 365 Ser Ala Leu Pro Glu Pro Leu 380 Ser Gly Glu Gin Ala Ala Glu 395 Ala Thr Asn Asp Tyr 400 Glu Leu 410 Lys Glu Cys Gly Lys 415 Ile Lys 425 Ala Leu Asp Ile Lys 430 Ser Ala Leu Ser Leu Tyr Lys 445 Gin Leu Asn 297
<210> 133 <211> 419 <212> PRT <213> Homo sapiens <400> Met Glu 133 Lys Ser 1 Leu Gin Glu Gly Ser Phe Asn 20 Tyr Asn Leu 35 Asp Gin Trp 50 Pro Ile Ile 65 Vâl Ser Ile Ile Leu Gin Asp Ala Ala Ser Ser 100 Pro Ser Ala 115 Asp Asn Glu 130 Lys Glu Asn 145 Phe Vai His Ser Asp Glu Pro Glu Arg Arg Ile 180 Vai Thr Ser 195 Ser Ile
Phe 5 Ala Thr Lys Pro Lys Gin Glu Vai Leu Ser Lys 40 Leu Lys Asp 55 Asp Ser Ile 70 Thr Asn Glu 85 Ile Ala Asp Gin Ala Ser Glu Gin Tyr Ala Cys 120 Arg Gin Asn 135 Phe Ser Leu 150 Cys Gly Lys 165 Thr Cys Leu Glu Vai Vai Vai Ser Asp Gly Glu 200 Asn Pro Phe Asn
Asn Glu 10 Ala Vai Ala 25 Leu Gin Glu Ser Thr Lys Ala Glu Ile Leu Arg 60 Glu Ser Gin 75 Asn Asp Leu 90 Ser Ala Ala 105 Lys Leu Glu Asp Phe Asn Leu Ser Ser Gin Ser 140 Ser Ala Pro 155 Asn Ser Trp 170 Glu Phe Lys 185 Ala Lys Ile Asp Glu Asp Asp Thr Ser Leu Phe
Gin Lys Glu 15 Thr Asp Pro 30 Leu Glu Asp 45 Ile Gly Pro His Cys Asn Pro Ala Glu Ser Asn 80 Ser His Ser 95 Ala Glu Glu 110 Pro Ser Phe 125 Leu Glu Asp Leu Glu His Vai Ser Arg Ala Gly 160 Ser Glu Lys 175 Asp Arg Ser 190 Lys Ala Ser 205 Phe Lys Asp Gin Phe Ser Ser 298 210 215 220 Vai Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp lie Ser Pro Pro 225 230 235 240 Gly Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met 245 250 255 Asn Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai 260 265 270 Leu Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu 275 280 285 Ala Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser 290 295 300 Gly Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu 305 310 315 320 Ser Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala 325 330 335 Leu Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu 340 345 350 Gin Leu Vai Gly Ser Pro Gin Asp Lys Ala Ala Glu Ala Thr Asn Asp 355 360 365 Tyr Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu Cys Gly Lys 370 375 380 Ile Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp Ile Lys Ser 385 390 395 400 Ala Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr Lys Gin Leu 405 410 415
Asn Asn Asn
<210> 134 <211> 1250 <212> PRT <213> Homo sapiens <400> 134 299
Met Glu Ala Ser Arg Arg Phe Pro 1 5 Gin Ala Ala His Tyr Leu Arg Tyr 20 Lys Asn Gly Asp Leu Glu Glu Ala 35 40 Asp Ile Phe Pro Asn Glu Lys Vai 50 55 Glu Ala Leu Glu Glu Leu Ala Glu 65 70 Vai Cys Asn Ser Gly Leu Leu Leu 85 Phe Glu His Gin Lys Glu Gly Ile 100 Asp Gly Arg Lys Gly Gly Ile Leu 115 120 Thr Vai Gin Ile Ile Ala Phe Leu 130 135 Vai Asn His Vai Leu Leu Ile Met 145 150 Vai Lys Glu Phe Ile Lys Trp Thr 165 His Gly Pro Ser Lys Asp Glu Arg 180 Gin Arg Asn Gly Vai Ile Ile Thr 195 200
Glu Ala 10 Glu Ala Leu Ser Pro 15 Glu Vai 25 Lys Glu Ala Lys Glu 30 Ala Thr Phe Lys Leu Phe Asn 45 Leu Ala Lys Leu Ser Arg Ile 60 Gin Lys Ile Gin Gin Gly Asp 75 Asp Glu Phe Thr Asp 80 Tyr Arg 90 Glu Leu His Asn Gin 95 Leu Ala 105 Phe Leu Tyr Ser Leu 110 Tyr Arg Ala Asp Asp Met Gly 125 Leu Gly Lys Ser Gly Met Phe 140 Asp Ala Ser Leu Pro Thr Asn 155 Leu Ile Asn Thr Trp 160 Pro Gly 170 Met Arg Vai Lys Thr 175 Phe Thr 185 Arg Asn Leu Asn Arg 190 Ile Gin Thr Tyr Gin Met Leu 205 Ile Asn Asn 300
Trp Gin Gin Leu Ser Ser Phe Arg Gly Gin Glu Phe Vai Trp Asp Tyr 210 215 220 Vai Ile Leu Asp Glu Ala His Lys Ile Lys Thr Ser Ser Thr Lys Ser 225 230 235 240 Ala Ile Cys Ala Arg Ala Ile Pro Ala Ser Asn Arg Leu Leu Leu Thr 245 250 255 Gly Thr Pro Ile Gin Asn Asn Leu Gin Glu Leu Trp Ser Leu Phe Asp 260 265 270 Phe Ala Cys Gin Gly Ser Leu Leu Gly Thr Leu Lys Thr Phe Lys Met 275 280 285 Glu Tyr Glu Asn Pro Ile Thr Arg Ala Arg Glu Lys Asp Ala Thr Pro 290 295 300 Gly Glu Lys Ala Leu Gly Phe Lys Ile Ser Glu Asn Leu Met Ala Ile 305 310 315 320 lie Lys Pro Tyr Phe Leu Arg Arg Thr Lys Glu Asp Val Gin Lys Lys 325 330 335 Lys Ser Ser Asn Pro Glu Ala Arg Leu Asn Glu Lys Asn Pro Asp Val 340 345 350 Asp Ala Ile Cys Glu Met Pro Ser Leu Ser Arg Lys Asn Asp Leu Ile 355 360 365 Ile Trp Ile Arg Leu Vai Pro Leu Gin Glu Glu Ile Tyr Arg Lys Phe 370 375 380 vai Ser Leu Asp His Ile Lys Glu Leu Leu Met Glu Thr Arg Ser Pro 385 390 395 400 Leu Ala Glu Leu Gly Vai Leu Lys Lys Leu Cys Asp His Pro Arg Leu 405 410 415 Leu Ser Ala Arg Ala Cys Cys Leu Leu Asn Leu Gly Thr Phe Ser Ala 420 425 430 Gin Asp Gly Asn Glu Gly Glu Asp Ser Pro Asp Vai Asp His Ile Asp 435 440 445 Gin Vai Thr Asp Asp Thr Leu Met Glu Glu Ser Gly Lys Met Ile Phe 450 455 460 Leu Met Asp Leu Leu Lys Arg Leu Arg Asp Glu Gly His Gin Thr Leu 465 470 475 480 Vai Phe Ser Gin Ser Arg Gin Ile Leu Asn Ile Ile Glu Arg Leu Leu 485 490 495 Lys Asn Arg His Phe Lys Thr Leu Arg Ile Asp Gly Thr Val Thr His 500 505 510 Leu Leu Glu Arg Glu Lys Arg Ile Asn Leu Phe Gin Gin Asn Lys Asp 515 520 525 Tyr Ser Vai Phe Leu Leu Thr Thr Gin Vai Gly Gly Val Gly Leu Thr 530 535 540 Leu Thr Ala Ala Thr Arg Vai vai Ile Phe Asp Pro Ser Trp Asn Pro 545 550 555 560 Ala Thr Asp Ala Gin Ala Vai Asp Arg Vai Tyr Arg Ile Gly Gin Lys 565 570 575 Glu Asn Vai Vai Vai Tyr Arg Leu Ile Thr Cys Gly Thr Val Glu Glu 580 585 590 Lys Ile Tyr Arg Arg Gin Vai Phe Lys Asp Ser Leu Ile Arg Gin Thr 595 600 605 Thr Gly Glu Lys Lys Asn Pro Phe Arg Tyr Phe Ser Lys Gin Glu Leu 610 615 620 Arg Glu Leu Phe Thr Ile Glu Asp Leu Gin Asn Ser Val Thr Gin Leu 625 630 635 640 Gin Leu Gin Ser Leu His Ala Ala Gin Arg Lys Ser Asp Ile Lys Leu 645 650 655 Asp Glu His Ile Ala Tyr Leu Gin Ser Leu Gly Ile Ala Gly Ile Ser 660 665 670 Asp His Asp Leu Met Tyr Thr Cys Asp Leu Ser Vai Lys Glu Glu Leu 675 680 685 Asp Vai Vai Glu Glu Ser His Tyr Ile Gin Gin Arg Val Gin Lys Ala 301 690 695 700 Gin Phe Leu Vai Glu Phe Glu Ser Gin Asn Lys Glu Phe Leu Met Glu 705 710 715 720 Gin Gin Arg Thr Arg Asn Glu Gly Ala Trp Leu Arg Glu Pro Vai Phe 725 730 735 Pro Ser Ser Thr Lys Lys Lys Cys Pro Lys Leu Asn Lys Pro Gin Pro 740 745 750 Gin Pro Ser Pro Leu Leu Ser Thr His His Thr Gin Glu Glu Asp Ile 755 760 765 Ser Ser Lys Met Ala Ser Vai Vai Ile Asp Asp Leu Pro Lys Glu Gly 770 775 780 Glu Lys Gin Asp Leu Ser Ser Ile Lys Vai Asn Vai Thr Thr Leu Gin 785 790 795 800 Asp Gly Lys Gly Thr Gly Ser Ala Asp Ser Ile Ala Thr Leu Pro Lys 805 810 815 Gly Phe Gly Ser Vai Glu Glu Leu Cys Thr Asn Ser Ser Leu Gly Met 820 825 830 Glu Lys Ser Phe Ala Thr Lys Asn Glu Ala Vai Gin Lys Glu Thr Leu 835 840 845 Gin Glu Gly Pro Lys Gin Glu Ala Leu Gin Glu Asp Pro Leu Glu Ser 850 855 860 Phe Asn Tyr Vai Leu Ser Lys Ser Thr Lys Ala Asp Ile Gly Pro Asn 865 870 875 880 Leu Asp Gin Leu Lys Asp Asp Glu Ile Leu Arg His Cys Asn Pro Trp 885 890 895 Pro Ile Ile Ser Ile Thr Asn Glu Ser Gin Asn Ala Glu Ser Asn Vai 900 905 910 Ser Ile Ile Glu Ile Ala Asp Asp Leu Ser Ala Ser His Ser Ala Leu 915 920 925 Gin Asp Ala Gin Ala Ser Glu Ala Lys Leu Glu Glu Glu Pro Ser Ala 930 935 940 Ser Ser Pro Gin Tyr Ala Cys Asp Phe Asn Leu Phe Leu Glu Asp Ser 945 950 955 960 Ala Asp Asn Arg Gin Asn Phe Ser Ser Gin Ser Leu Glu His Vai Glu 965 970 975 Lys Glu Asn Ser Leu Cys Gly Ser Ala Pro Asn Ser Arg Ala Gly Phe 980 985 990 Vai His Ser Lys Thr Cys Leu Ser Trp Glu Phe Ser Glu Lys Asp Asp 995 1000 1005 Glu Pro Glu Glu Vai Vai Vai Lys Ala Lys Ile Arg Ser Lys Ala Arg 1010 1015 1020 Arg Ile Vai Ser Asp Gly Glu Asp Glu Asp Asp Ser Phe Lys Asp Thr 1025 1030 1035 1040 Ser Ser Ile Asn Pro Phe Asn Thr Ser Leu Phe Gin Phe Ser Ser Vai 1045 1050 1055 Lys Gin Phe Asp Ala Ser Thr Pro Lys Asn Asp Ile Ser Pro Pro Gly 1060 1065 1070 Arg Phe Phe Ser Ser Gin Ile Pro Ser Ser Vai Asn Lys Ser Met Asn 1075 1080 1085 Ser Arg Arg Ser Leu Ala Ser Arg Arg Ser Leu Ile Asn Met Vai Leu 1090 1095 1100 Asp His Vai Glu Asp Met Glu Glu Arg Leu Asp Asp Ser Ser Glu Ala 1105 1110 1115 1120 Lys Gly Pro Glu Asp Tyr Pro Glu Glu Gly Vai Glu Glu Ser Ser Gly 1125 1130 1135 Glu Ala Ser Lys Tyr Thr Glu Glu Asp Pro Ser Gly Glu Thr Leu Ser 1140 1145 1150 Ser Glu Asn Lys Ser Ser Trp Leu Met Thr Ser Lys Pro Ser Ala Leu 1155 1160 1165 Ala Gin Glu Thr Ser Leu Gly Ala Pro Glu Pro Leu Ser Gly Glu Gin 1170 1175 1180 302
Leu Vai Gly Ser Pro Gin Asp Lys Aia Ala Glu Ala 1185 1190 1195
Glu Thr Leu Vai Lys Arg Gly Lys Glu Leu Lys Glu 1205 1210
Gin Glu Ala Leu Asn Cys Leu Vai Lys Ala Leu Asp 1220 1225
Asp Pro Glu Vai Met Leu Leu Thr Leu Ser Leu Tyr 1235 1240
Asn Asn 1250
Thr Asn Asp Tyr 1200 Cys Gly Lys Ile 1215 Ile Lys Ser Ala 1230 Lys Gin Leu Asn 1245 303
Literatura não relacionada com patentes referida na descrição
DOCUMENTOS REFERIDOS NA DESCRIÇÃO
Esta lista de documentos referidos pelo autor do presente pedido de patente foi elaborada apenas para informação do leitor. Não é parte integrante do documento de patente europeia. Não obstante o cuidado na sua elaboração, o IEP não assume qualquer responsabilidade por eventuais erros ou omissões. • US 5559410 A [0056] • US 5585639 A [0056] • US 5576220 A [0056] • US 5541061 A [0056] • US 5837501 A [0119] • US 5382510 A [0128] • US 5952170 A [0128] • EP 03788558 A [0266] • US 2003025665 W [0266] • US 60404306 B [0266] • US 60423290 B [0266]
Documentos de patente referidos na descrição • Klein et al. Nat. Med.f 1997, vol. 3, 402 [0006] • Su et al. Proc. Natl. Acad. Sei. USA, 1996, vol. 93, 7252 [0006] • Pinto et al. Clin Câncer Res, 02 September 1996, 1445- 51 [0006] • Hubert et al. Proc Natl Acad Sei USA., 07 December 1999, vol. 96 (25), 14523-8 [0006] • Reiter et al. Proc. Natl. Acad. Sei. USA, 1998, vol. 95, 1735 [0006] • Hopp T.P. ; Woods K.R. Proc. Natl. Acad. Sei. U.S.A., 1981, vol. 78, 3824-3828 [0033] [0224] 304 • Kyte J. ; Doolittle R.F. J. Mol. Biol., 1982, vol. 157, 105-132 [0034] [0224] • Janin J. Nature, 1979, vol. 277, 491-492 [0035] [0224] • Bhaskaran R. ; Ponnuswamy P.K. Int. J. Pept. Protein
Res., 1988, vol. 32, 242-255 [0036] [0224] • Deleage, G. ; Roux B. Protein Engineering, 1987, vol. 1, 289-294 [0037] [0224] • Combet C. ; Blanchet C. ; Geourjon C. ; Deléage G.
Network Protein Sequence Analysis TIBS, March 2000,vol. 25 (3), 147-150, https//pbíl.ibcp.ib-cp- fr/çgi-bin/npsa_automat. pl ?paqe:::npsa_nn . html [0041] • K. Hofmann ; W. Stoffel. TMBASE - A database of membrane spanning protein segments. Biol. Chem. Hoppe-Seyler, 1993, vol. 374, 166 [0041] • A hidden Markov model for predicting transmem-brane helices in protein sequences. Erik L.L. Sonnharamer ; Gunnar von Heijne ; Anders Krogh. Proc. of Sixth Int. Conf. on Intelligent Systems for Molecular Biology. AAAI Press, 1998, 175-182 [0041] • Sambrook et al. Molecular Cloning: A Laboratory
Manual. Cold Spring Harbor Laboratory Press, 1989 [0050] • Stites et al. IMMUNOLOGY. Lange Publishing, 1994 [0059] • Ausubel et al. Current Protocols in Molecular Biology. Wiley Interscience Publishers, 1995 [0070] • Sambrook et al. Molecular Cloning: A Laboratory
Manual. Cold Spring Harbor Press, 1989 [0071] • Krajinovic et al. Mutat. Res., 1998, vol. 382 (3-4), 81-83 [0089] • Johansson et al. Blood, 1995, vol. 86 (10), 3905-3914 [0089] • Finger et al. P.N.A.S., 1988, vol. 85 (23), 9158-9162 [0089] • Evans et al. Am. J. Obstet. Gynecol, 1994, vol. 171 305 (4), 1055-1057 [0089]
Marrogi et al. J. Cutan. Pathol., 199 9, vol. 2 6 (8), 369-378 [0090] [0127]
Jack Cohen. Oligodeoxynucleotides, Antisense In-hibitors of Gene Expression, 1989 [0092]
Synthesis, 1988, vol. 1, 1-5 [0092] lyer, R P. et al. J. Org. Chem., 1990, vol. 55, 4693-4698 [0092] lyer, R. P. et al. J. Am. Chem. Soc., 1990, vol. 112, 1253-1254 [0092]
Partridge et al. Antisense & Nucleic Acid Drug De-velopment, 1996, vol. 6, 169-175 [0092] L. A. Couture ; D. T. Stinchcomb. Trends Genet, 1996, vol. 12, 510-515 [0093]
Sambrook, J. et al. Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Press, 1989 [0098]
Current Protocols in Molecular Biology. Wiley and Sons, 1995 [0098]
Current Protocols in Molecular Biology, 1995 [0101] Kozak. Mol. Cell Biol., 1989, vol. 9, 5073-5080 [0104] Kozak. PNAS, 1995, vol. 92 (7), 2662-2666 [0104]
Kozak. NAR, 1987, vol. 15 (20), 8125-8148 [0104] Biochemistry. 13-15 [0108]
Henikoff et al. PNAS, 1992, vol. 89, 10915-10919 [0108]
Lei et al. J Biol Chem, 19 May 1995, vol. 270 (20) , 11882-6 [0108] Cárter et al. Nucl. Acids Res., 1986, vol. 13, 4331 [0109] Zoller et al. Nucl. Acids Res., 1987, vol. 10, 6487 [0109]
Wells et al. Gene, 1985, vol. 34, 315 [0109]
Wells et al. Philos. Trans. R. Soc. London SerA, 1986, vol. 317, 415 [0109]
Alers et al. Lab Invest., 1997, vol. 77 (5), 437-438 [0119] 306 • Isaacs et al. Câncer Surv., 1995, vol. 23, 19-32 [0119] • Grever et al. J. Comp. Neurol., 0 9 December 19 96, vol. 376 (2), 306-14 [0119] • Current Protocols in Molecular Biology. 1995 [0121] • Murphy et al. Prostate, 2000, vol. 42 (4), 315-317 [0124] • Su et al. Semin. Surg. Oncol., 2000, vol. 18 (1), 17- 28 [0124] • Freeman et al. J Urol, August 1995, vol. 154, 474-8 [0124] • De Marzo et al. Am. J. Pathol., 1999, vol. 155 (6), 1985-1992 [0129] • Brooks et al. Câncer Epidemiol. Biomarkers Prev., 1998, vol. 7, 531-536 [0129] • Lethe et al. Int. J. Câncer, 1998, vol. 76 (6), 903- 908 [0129] • Current Protocols In Molecular Biology. 1995 [0129] • Thomas. Proc. Natl. Acad. Sei. USA, 1980, vol. 77, 5201-5205 [0130] • Verkaik et al. Urol. Res., vol. 25, 373-384 [0131] • Ghossein et al. J. Clin. Oncol., 1995, vol. 13, 1195- 2000 [0131] • Heston et al. Clin. Chem., 1995, vol. 41, 1687-1688 [0131] • Bocking et al. Anal. Quant. Cytol., 1984, vol. 6 (2), 74-88 [0135] • Epstein. Hum. Pathol., 1995, vol. 26 (2), 223-9 [0135] • Thorson et al. Mod. Pathol., 1998, vol. 11 (6), 543-51 [0135] • Baisden et al. Am. J. Surg. Palhol., 1999, vol. 23 (8), 918-24 [0135] • Merrill et al. J. Urol., 2000, vol. 163 (2), 503-5120 [0139] 307
Polascik et al. J. Urol., August 1999, vol. 162 (2), 293-306 [0139]
Fortier et al. J. Nat. Câncer lnst., 1999, vol. 91 (19), 1635-1640 [0139]
Tulchinsky et al. Int J Mol Med, 0 4 July 1999, 99-102 [0139]
Minimoto et al. Câncer Detect Prev, 2000, vol. 24 (1), 1-12 [0139]
Sharief et al. Biochem. Mol. Biol. Int., 1994, vol. 33 (3), 567-74 [0140]
Okegawa et al. J. Urol., 2000, vol. 163 (4), 1189-1190 [0140]
Alanen et al. Pathol. Res. Pract., 1996, vol. 192 (3), 233-237 [0142] [0144]
Caetano-Anolles, G. Biotechniques, 1998, vol. 25 (3), 472-476478-480 [0143]
Robertson et al. Methods Mol. Biol., 1998, vol. 98, 121-154 [0143]
Sawai et al. Fetal Diagn. Ther., November 1996, vol. 11 (6), 407-13 [0143]
Current Protocols In Molecular Biology. 1995, vol. 2 [0143]
Takahama K. Forensic Sei Int, 28 June 1996, vol. 80 (1-2), 63-9 [0145]
Walter et al. Nature Genetics, 1994, vol. 7, 22 [0183] A. Salamov ; V. Solovyev. Ab initio gene finding in Drosophila genomic DNA. Genome Research, April 2000, vol. 10 (4), 516-22 [0195]
Southan, C. A genomic perspective on human proteases. FEBS Lett., 08 June 2001, vol. 498 (2-3), 214-8 [0195] de Souza, S.J. et al. Identification of human chro-mosome 22 transcribed sequences with ORF expressed sequence tags. Proc. Natl. Acad. Sei USA., 07 November 2000, vol. 97 (23), 12690-3 [0195]
Brennan, S.O. et al. Albumin banks península: a new 308 termination variant characterized by electrospray mass spectrometry. Biochem Biophys Acta., 17 August 1999, vol. 1433 (1-2), 321-6 [0196]
Ferranti P et al. Differential splicing of pre-messen-ger RNA produces multiple forms of mature caprine alpha(sl)-casein. Eur J Biochem., 01 October 1997, vol. 249 (1), 1-7 [0196]
Wellmann S et al. Specific reverse transcrip-fion-PCR quantification of vascular endothelial growth factor (VEGF) splice variants by LightCycter technology. Clin Chem., April 2001, vol. 47 (4), 654-60 [0196]
Jia, H.P. et al. Discovery of new human beta-de-fensins using a genomics-based approach. Gene, 24 January 2001, vol. 263 (1-2), 211-8 [0196]
Brigle, K.E. et al. Organization of the murine reduced folate carrier gene and Identification of variant splice forms. Biochem Biophys Acta., 07 August 1997, vol. 1353 (2), 191-8 [0196] P. Nowotny ; J. M. Kwon ; A. M. Goate. SNP analysis to dissect human traits. Curr. Opin. Neurobiol., October 2001, vol. 11 (5), 637-641 [0199] M. Pirmohamed ; B. K. Park. Genetic susceptibility to adverse drug reactions. Trends Pharmacol. Sei., June 2001, vol. 22 (6), 298-305 [0199] J. H. Riley ; C. J. Allan ; E. Lai ; A. Roses. The use of single nucleotide polymorphisms in the isolation of coiranon disease genes. Pharmacogenomics, February 2000, vol. 1 (1), 39-47 [0199] R. Judson ; J. C. Stephens ; A. Windemuth. The predictive power of haplotypes in clinicai response. Pharmacogenomics, February 2000, vol. 1 (1), 15-26 [0199] P. Bean. The promising voyage of SNP target discovery. Am Clin. Lab., October 2001, vol. 20 (9), 18-20 [0200] K. M. Weiss. In search of human variation. Genome 309
Res., July 1998, vol. 8 ( 7), 691-697 [0200] • Μ. M. She. Enabling large-scale pharmacogenetic studies by high-throughput mutation detection and genotyping technologies. Clin. Chem., February 2001, vol. 47 (2), 164-172 [0200] • Z. Gu ; L. Hillier ; P. Y. Kwok. Single nucleotide polymorphism hunting in cyberspace. Hum Mutat, 1998, vol. 12 (4), 221-225 [0200] • P. Y. Kwok. Methods for genotyping single nucleotide polymorphisms. Annul. Rev. Genomics Hum. Genet., 2001, vol. 2, 235-258 [0200] • M. Kokoris ; K. Dix ; K. Moynihan ; J. Mathis ; B.
Erwin ; P. Grass ; B. Hines ; A. Duesterhoeft.
High-throughput SNP genotyping with the Masscode system. Mol. Diagn., December 2000, vol. 5 (4), 329-340 [0200] • Combet C. ; Blanchet C. ; Geourjon C. ; Deléage G.
Network Protein Sequence Analysis TIBS, March 2000, vol. 25 (3), 147-150, ht b i n/nps a_au t ornat.pi?page-npsa_n tp://pbil.ib-n.htrnl [0229] -cp.f r/cgi- • Gulukota et al. J. Mol. Biol., 126 [0234] 1997, vol. 267, 1258- • Sidney et al. Human Immunol., [0234] 1996, vol. 45, 79-93 • Southwood et al. J. Immunol., 3373 [0234] 1998, vol. 160, 3363- • Alexeev A ; Mazin A ; Kowalczykowski SC. Nat Struct
Biol., 2003, vol. 10, 182 [0244] • Solinger JA ; Kiianitsa K ; Heyer WD. Mol Ce 11, 2 002, vol. 10, 1175 [0244] • Martens JA ; Winston F. Genes Dev., 2 002, vol. 16, 2231 [0244] • Fan HY et al. Mol Cell, 2003, vol. 11, 1311 [0244] • Kingston, R.E. ; Narlikar, G.J. Genes & Dev., 1999, vol. 13, 2339-2352 [0244] • Muchardt C ; Yaniv M. Oncogene, 2001, vol. 20, 3067 [0244] 310
Lee D et al. Câncer Res., 2000, vol. 60, 3612 [0244] J Neurochem., 2001, vol. 76, 217-223 [0246]
Neeley K. Biochim Biophys Acta, 2002, vol. 1603, 19 [0246]
Cell Growth Differ, 2000, vol. 11, 279 [0246] J Biol Chem., 1999, vol. 274, 801 [0246]
Oncogene, 2000, vol. 19, 3003 [0246] J. Cell Blol., 1997, vol. 138, 913 [0246]
Fraser SP ; Grimes JA ; Djamgoz MB. Prostate, 2 000, vol. 44, 61 [0251]
Johnson DE ; Ochieng J ; Evans SL. Anticancer Drugs, 1996, vol. 7, 288 [0251]
Song Z et al. Câncer Res., 2000, vol. 60, 6730 [0252] Câncer Res., 1999, vol. 5 9, 6010 [0253]
Abdel-Malek ZA. J Cell Physlol., 1988, vol. 136, 247 [0254]
Hanahan D ; Folkman J. Cell, 1996, vol. 86, 353 [0256] Folkman J. Endocrlnology, 1998, vol. 139, 441 [0256] Smid-Koopman E et al. Br J Câncer, 2000, vol. 83, 246 [0260]
Chen K et al. Thyrold, 2001, vol. 11, 41 [0260]
Claims (9)
1 REIVINDICAÇÕES 1. Um polinucleotídeo isolado compreendendo a sequência de: (a) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847; (b) SEQ. ID N.°4, dos resíduos de nucleotídeos números 604 a 3987; (c) SEQ. ID N.°8, dos resíduos de nucleotídeos números 688 a 1947; (d) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 571 é T; (e) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 608 é G; (f) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 1185 é G; (g) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 2759 é A; (h) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 3658 é C; ou (i) SEQ. ID N.°2, dos resíduos de nucleotídeos números 95 a 3847, em que o resíduo de nucleotídeo em 3850 é A.
2. Um vetor recombinante compreendendo o polinucleotídeo de acordo com a reivindicação 1.
3. Uma célula hospedeira recombinante que contém o vetor da reivindicação 2.
4. Um método in vitro para detetar a presença de um polinucleotídeo de acordo com a reivindicação 1 numa amostra teste que compreende: colocar a amostra em contacto com um polinucleotídeo que se liga especificamente ao polinucleotídeo de acordo com a reivindicação 1; e detetar a ligação do polinucleotídeo na 2 amostra a ele.
5. 0 método da reivindicação 4, em que o polinucleotideo é um ARNm.
6. 0 método da reivindicação 4, em que o polinucleotideo é um ADNc produzido a partir da amostra por transcrição reversa.
7. 0 método de qualquer uma das reivindicações 4 a 6, em que a etapa determinante compreende comparar uma quantidade de ligação do polinucleotideo que se liga especificamente ao polinucleotideo da reivindicação 1 à presença do polinucleotideo da reivindicação 1 numa amostra normal correspondente.
8. 0 método da reivindicação 7, em que a presença do polinucleotideo elevado na amostra teste relativa à amostra de tecido normal providencia uma indicação da presença de cancro.
9. 0 método da reivindicação 8, em que o cancro é selecionado a partir do grupo que consiste em leucemia e cancro da próstata, de bexiga, do rim, dos ossos, da pele, colo do útero, do ovário, da mama, dos gânglios linfáticos, do estômago, do útero, do pâncreas, do cólon, e do pulmão.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US40430602P | 2002-08-16 | 2002-08-16 | |
US42329002P | 2002-11-01 | 2002-11-01 |
Publications (1)
Publication Number | Publication Date |
---|---|
PT1576132E true PT1576132E (pt) | 2012-10-31 |
Family
ID=31891426
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PT03726484T PT1576170E (pt) | 2002-08-16 | 2003-04-23 | Ácidos nucleicos e proteínas correspondentes intituladas 191p4d12(b) úteis no tratamento e na detecção do cancro |
PT03788558T PT1576132E (pt) | 2002-08-16 | 2003-08-15 | Ácidos nucleicos e proteínas correspondentes designadas 273p4b7 úteis no tratamento e deteção de cancro |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PT03726484T PT1576170E (pt) | 2002-08-16 | 2003-04-23 | Ácidos nucleicos e proteínas correspondentes intituladas 191p4d12(b) úteis no tratamento e na detecção do cancro |
Country Status (12)
Country | Link |
---|---|
US (16) | US20040081653A1 (pt) |
EP (6) | EP1576170B1 (pt) |
JP (6) | JP2006513724A (pt) |
AU (6) | AU2003243151A1 (pt) |
CA (5) | CA2493923C (pt) |
CY (1) | CY1113247T1 (pt) |
DK (2) | DK1576170T3 (pt) |
ES (2) | ES2392341T3 (pt) |
IL (6) | IL166532A (pt) |
PT (2) | PT1576170E (pt) |
SI (2) | SI1576170T1 (pt) |
WO (5) | WO2004016733A2 (pt) |
Families Citing this family (43)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7271240B2 (en) | 2001-03-14 | 2007-09-18 | Agensys, Inc. | 125P5C8: a tissue specific protein highly expressed in various cancers |
WO2004013311A2 (en) * | 2002-08-06 | 2004-02-12 | Diadexus, Inc. | Compositions and methods relating to ovarian specific genes and proteins |
WO2004016733A2 (en) | 2002-08-16 | 2004-02-26 | Agensys, Inc. | Nucleic acid and corresponding protein entitled 251p5g2 useful in treatment and detection of cancer |
EP1697750B1 (en) * | 2003-12-01 | 2013-03-20 | Dako Denmark A/S | Methods and compositions for immuno-histochemical detection |
US20060019396A1 (en) * | 2004-06-07 | 2006-01-26 | Tissuegene, Inc. | Retroviral vectors with enhanced efficiency of transgene expression and safety |
JP2009509510A (ja) * | 2005-09-26 | 2009-03-12 | メダレックス インコーポレーティッド | Cd70に対するヒトモノクローナル抗体 |
TW200745163A (en) | 2006-02-17 | 2007-12-16 | Syntonix Pharmaceuticals Inc | Peptides that block the binding of IgG to FcRn |
IN2009KN02404A (pt) * | 2006-12-14 | 2015-08-07 | Medarex Inc | |
EP2124988B1 (en) * | 2007-02-23 | 2014-11-12 | The Trustees of Columbia University in the City of New York | Methods to activate or block the hla-e/qa-1 restricted cd8+ t cell regulatory pathway to treat immunological disease |
MX2010001363A (es) | 2007-08-09 | 2010-03-09 | Syntonix Pharmaceuticals Inc | Peptidos inmunomoduladores. |
US20120135005A1 (en) * | 2009-04-16 | 2012-05-31 | Harding Fiona A | ANTI-TNF-a ANTIBODIES AND THEIR USES |
CN102725634B (zh) * | 2009-08-24 | 2016-01-20 | 纽约哥伦比亚大学理事会 | 用于测定cd8+t细胞的健康的测试法 |
WO2011112599A2 (en) | 2010-03-12 | 2011-09-15 | The United States Of America, As Represented By The Secretary. Department Of Health & Human Services | Immunogenic pote peptides and methods of use |
US8449512B2 (en) | 2010-04-09 | 2013-05-28 | Davinci Biomedical Research Products Inc. | Stoma stabilitating device and method |
UA110495C2 (en) * | 2010-09-29 | 2016-01-12 | Agensys Inc | Antibody drug conjugates (adc's) that bind to 191p4d12 protein |
WO2012154272A1 (en) * | 2011-02-25 | 2012-11-15 | Wellstat Diagnostics, Llc | Assays for detecting enzymatic activity |
WO2012164004A1 (en) | 2011-06-01 | 2012-12-06 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Novel antigen peptide and uses thereof |
WO2013055929A1 (en) | 2011-10-12 | 2013-04-18 | The General Hospital Corporation | Non-n-glycosylated recombinant human annexin a2 |
EP2934585B1 (en) | 2012-12-21 | 2018-06-13 | Seattle Genetics, Inc. | Anti-ntb-a antibodies and related compositions and methods |
WO2014138188A1 (en) | 2013-03-07 | 2014-09-12 | The General Hospital Corporation | Human ctla4 mutants and use thereof |
US20160340659A1 (en) * | 2014-01-30 | 2016-11-24 | Yissum Research And Development Company Of The Hebrew University Of Jerusalem Ltd. | Actin binding peptides and compositions comprising same for inhibiting angiogenesis and treating medical conditions associated with same |
KR101503341B1 (ko) | 2014-03-12 | 2015-03-18 | 국립암센터 | 자가암항원 특이적 cd8+ t 세포의 분리 및 증식방법 |
US9616114B1 (en) | 2014-09-18 | 2017-04-11 | David Gordon Bermudes | Modified bacteria having improved pharmacokinetics and tumor colonization enhancing antitumor activity |
US11318163B2 (en) | 2015-02-18 | 2022-05-03 | Enlivex Therapeutics Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11304976B2 (en) | 2015-02-18 | 2022-04-19 | Enlivex Therapeutics Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11497767B2 (en) | 2015-02-18 | 2022-11-15 | Enlivex Therapeutics R&D Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11000548B2 (en) | 2015-02-18 | 2021-05-11 | Enlivex Therapeutics Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
WO2016132366A1 (en) | 2015-02-18 | 2016-08-25 | Enlivex Therapeutics Ltd. | Combination immune therapy and cytokine control therapy for cancer treatment |
US11596652B2 (en) | 2015-02-18 | 2023-03-07 | Enlivex Therapeutics R&D Ltd | Early apoptotic cells for use in treating sepsis |
US10857181B2 (en) | 2015-04-21 | 2020-12-08 | Enlivex Therapeutics Ltd | Therapeutic pooled blood apoptotic cell preparations and uses thereof |
US11730761B2 (en) | 2016-02-18 | 2023-08-22 | Enlivex Therapeutics Rdo Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11246905B2 (en) | 2016-08-15 | 2022-02-15 | President And Fellows Of Harvard College | Treating infections using IdsD from Proteus mirabilis |
US10350280B2 (en) * | 2016-08-31 | 2019-07-16 | Medgenome Inc. | Methods to analyze genetic alterations in cancer to identify therapeutic peptide vaccines and kits therefore |
US11129906B1 (en) | 2016-12-07 | 2021-09-28 | David Gordon Bermudes | Chimeric protein toxins for expression by therapeutic bacteria |
US11180535B1 (en) | 2016-12-07 | 2021-11-23 | David Gordon Bermudes | Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria |
ES2905890T3 (es) | 2017-01-06 | 2022-04-12 | Eutilex Co Ltd | Anticuerpos anti-4-1BB humano y usos de los mismos |
JP7106810B2 (ja) * | 2018-04-19 | 2022-07-27 | 学校法人 埼玉医科大学 | 新規肺がんマーカー |
CN108875628A (zh) * | 2018-06-14 | 2018-11-23 | 攀枝花学院 | 行人检测方法 |
JP2022520875A (ja) | 2019-02-25 | 2022-04-01 | ノバルティス アーゲー | Biettiクリスタリン網膜症を治療するための組成物及び方法 |
US20220154210A1 (en) | 2019-02-25 | 2022-05-19 | Novartis Ag | Compositions and methods to treat bietti crystalline dystrophy |
CN110147939B (zh) * | 2019-04-24 | 2022-04-08 | 中国食品药品检定研究院 | 一种仿制药品的工艺评价方法和系统 |
US20230331867A1 (en) | 2020-09-04 | 2023-10-19 | Novarock Biotherapeutics, Ltd. | Nectin-4 antibodies and uses thereof |
CA3223690A1 (en) * | 2021-08-13 | 2023-02-16 | Christopher CAROSINO | Methods for treating non-muscle invasive bladder cancer (nmibc) with antibody drug conjugates (adc) that bind to 191p4d12 proteins |
Family Cites Families (252)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
NL6903384A (pt) | 1969-03-05 | 1970-09-08 | ||
US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
JPS6023084B2 (ja) | 1979-07-11 | 1985-06-05 | 味の素株式会社 | 代用血液 |
US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
US4722848A (en) | 1982-12-08 | 1988-02-02 | Health Research, Incorporated | Method for immunizing animals with synthetically modified vaccinia virus |
US4870009A (en) | 1982-11-22 | 1989-09-26 | The Salk Institute For Biological Studies | Method of obtaining gene product through the generation of transgenic animals |
US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
US4736866B1 (en) | 1984-06-22 | 1988-04-12 | Transgenic non-human mammals | |
US5430136A (en) | 1984-10-16 | 1995-07-04 | Chiron Corporation | Oligonucleotides having selectably cleavable and/or abasic sites |
US5019369A (en) | 1984-10-22 | 1991-05-28 | Vestar, Inc. | Method of targeting tumors in humans |
US5506337A (en) | 1985-03-15 | 1996-04-09 | Antivirals Inc. | Morpholino-subunit combinatorial library and method |
EP0206448B1 (en) | 1985-06-19 | 1990-11-14 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
US5124246A (en) | 1987-10-15 | 1992-06-23 | Chiron Corporation | Nucleic acid multimers and amplified nucleic acid hybridization assays using same |
US5359100A (en) | 1987-10-15 | 1994-10-25 | Chiron Corporation | Bifunctional blocked phosphoramidites useful in making nucleic acid mutimers |
GB8724885D0 (en) | 1987-10-23 | 1987-11-25 | Binns M M | Fowlpox virus promotors |
US5254678A (en) | 1987-12-15 | 1993-10-19 | Gene Shears Pty. Limited | Ribozymes |
WO1989006692A1 (en) * | 1988-01-12 | 1989-07-27 | Genentech, Inc. | Method of treating tumor cells by inhibiting growth factor receptor function |
US5785973A (en) * | 1988-02-01 | 1998-07-28 | Praxis Biologics, Inc. | Synthetic peptides representing a T-cell epitope as a carrier molecule for conjugate vaccines |
US5010175A (en) | 1988-05-02 | 1991-04-23 | The Regents Of The University Of California | General method for producing and selecting peptides with specific properties |
CA1340323C (en) | 1988-09-20 | 1999-01-19 | Arnold E. Hampel | Rna catalyst for cleaving specific rna sequences |
DE69020143T2 (de) * | 1989-02-17 | 1996-01-25 | Chiron Mimotopes Pty Ltd | Verfahren zur verwendung und herstellung von peptiden. |
US5225538A (en) | 1989-02-23 | 1993-07-06 | Genentech, Inc. | Lymphocyte homing receptor/immunoglobulin fusion proteins |
JPH04503957A (ja) | 1989-03-07 | 1992-07-16 | ジェネンテク,インコーポレイテッド | 脂質とオリゴヌクレオチドの共有結合コンジュゲート |
US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
WO1991004753A1 (en) | 1989-10-02 | 1991-04-18 | Cetus Corporation | Conjugates of antisense oligonucleotides and therapeutic uses thereof |
US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
CA2044593C (en) | 1989-11-03 | 2004-04-20 | Kenneth L. Brigham | Method of in vivo delivery of functioning foreign genes |
US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
US6673986B1 (en) | 1990-01-12 | 2004-01-06 | Abgenix, Inc. | Generation of xenogeneic antibodies |
DK0463151T3 (da) | 1990-01-12 | 1996-07-01 | Cell Genesys Inc | Frembringelse af xenogene antistoffer |
US5279833A (en) | 1990-04-04 | 1994-01-18 | Yale University | Liposomal transfection of nucleic acids into animal cells |
US5204253A (en) | 1990-05-29 | 1993-04-20 | E. I. Du Pont De Nemours And Company | Method and apparatus for introducing biological substances into living cells |
IE66205B1 (en) | 1990-06-14 | 1995-12-13 | Paul A Bartlett | Polypeptide analogs |
US5723286A (en) | 1990-06-20 | 1998-03-03 | Affymax Technologies N.V. | Peptide library and screening systems |
ES2264239T3 (es) | 1990-06-27 | 2006-12-16 | Princeton University | Complejo de proteinas p53/p90'. |
US5650489A (en) | 1990-07-02 | 1997-07-22 | The Arizona Board Of Regents | Random bio-oligomer library, a method of synthesis thereof, and a method of use thereof |
SE9002480D0 (sv) | 1990-07-23 | 1990-07-23 | Hans Lilja | Assay of free and complexed prostate-specific antigen |
US5733731A (en) | 1991-10-16 | 1998-03-31 | Affymax Technologies N.V. | Peptide library and screening method |
WO1993016178A2 (en) | 1992-02-12 | 1993-08-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Sequences characteristic of human gene transcription product |
US5573905A (en) | 1992-03-30 | 1996-11-12 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
US5541061A (en) | 1992-04-29 | 1996-07-30 | Affymax Technologies N.V. | Methods for screening factorial chemical libraries |
IL105914A0 (en) | 1992-06-04 | 1993-10-20 | Univ California | Methods and compositions for in vivo gene therapy |
EP1704868A1 (en) | 1992-08-07 | 2006-09-27 | Pharmexa Inc. | HLA binding peptides and their uses |
JP3472587B2 (ja) * | 1992-08-28 | 2003-12-02 | アベンティス ファーマ株式会社 | 骨関連カルボキシペプチダーゼ様タンパク質およびその製造法 |
US5288514A (en) | 1992-09-14 | 1994-02-22 | The Regents Of The University Of California | Solid phase and combinatorial synthesis of benzodiazepine compounds on a solid support |
US5652138A (en) * | 1992-09-30 | 1997-07-29 | The Scripps Research Institute | Human neutralizing monoclonal antibodies to human immunodeficiency virus |
EP0604289B1 (fr) | 1992-12-17 | 1997-09-24 | Valeo Systemes D'essuyage | Procédé et dispositif d'alimentation d'un moteur électrique d'entrainement d'un bras d'essuie-glace de véhicule automobile |
US5576220A (en) | 1993-02-19 | 1996-11-19 | Arris Pharmaceutical Corporation | Thin film HPMP matrix systems and methods for constructing and displaying ligands |
BR9406652A (pt) | 1993-03-05 | 1996-09-10 | Cytel Corp | Composição |
CA2163129A1 (en) | 1993-05-17 | 1994-11-24 | Flossie Wong-Staal | Ribozyme gene therapy for hiv infection and aids |
US5837501A (en) | 1993-07-09 | 1998-11-17 | Akzo Nobel N.V. | Nucleic acid quantitation by co-amplification of target with multiple internal controls |
US5679647A (en) | 1993-08-26 | 1997-10-21 | The Regents Of The University Of California | Methods and devices for immunizing a host against tumor-associated antigens through administration of naked polynucleotides which encode tumor-associated antigenic peptides |
US5804566A (en) | 1993-08-26 | 1998-09-08 | The Regents Of The University Of California | Methods and devices for immunizing a host through administration of naked polynucleotides with encode allergenic peptides |
ATE415173T1 (de) | 1993-09-14 | 2008-12-15 | Pharmexa Inc | Pan dr-bindeproteinen zur erhöhung der immunantwort |
US5681697A (en) | 1993-12-08 | 1997-10-28 | Chiron Corporation | Solution phase nucleic acid sandwich assays having reduced background noise and kits therefor |
CH686982A5 (fr) | 1993-12-16 | 1996-08-15 | Maurice Stroun | Méthode pour le diagnostic de cancers. |
US5519134A (en) | 1994-01-11 | 1996-05-21 | Isis Pharmaceuticals, Inc. | Pyrrolidine-containing monomers and oligomers |
US5593853A (en) | 1994-02-09 | 1997-01-14 | Martek Corporation | Generation and screening of synthetic drug libraries |
US5539083A (en) | 1994-02-23 | 1996-07-23 | Isis Pharmaceuticals, Inc. | Peptide nucleic acid combinatorial libraries and improved methods of synthesis |
US5739118A (en) | 1994-04-01 | 1998-04-14 | Apollon, Inc. | Compositions and methods for delivery of genetic material |
US7625697B2 (en) * | 1994-06-17 | 2009-12-01 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for constructing subarrays and subarrays made thereby |
US5525735A (en) | 1994-06-22 | 1996-06-11 | Affymax Technologies Nv | Methods for synthesizing diverse collections of pyrrolidine compounds |
US5549974A (en) | 1994-06-23 | 1996-08-27 | Affymax Technologies Nv | Methods for the solid phase synthesis of thiazolidinones, metathiazanones, and derivatives thereof |
EP0773952B1 (en) | 1994-07-20 | 2003-11-12 | The General Hospital Corporation | Interaction trap systems for detecting protein interactions |
US5597909A (en) | 1994-08-25 | 1997-01-28 | Chiron Corporation | Polynucleotide reagents containing modified deoxyribose moieties, and associated methods of synthesis and use |
US5580731A (en) | 1994-08-25 | 1996-12-03 | Chiron Corporation | N-4 modified pyrimidine deoxynucleotides and oligonucleotide probes synthesized therewith |
US5681702A (en) | 1994-08-30 | 1997-10-28 | Chiron Corporation | Reduction of nonspecific hybridization by using novel base-pairing schemes |
US5919652A (en) | 1994-11-09 | 1999-07-06 | The Regents Of The University Of California | Nucleic acid molecules comprising the prostate specific antigen (PSA) promoter and uses thereof |
US5736524A (en) | 1994-11-14 | 1998-04-07 | Merck & Co.,. Inc. | Polynucleotide tuberculosis vaccine |
US5614372A (en) * | 1995-02-24 | 1997-03-25 | Lilja; Hans | Early detection of prostate cancer (CAP) by employing prostate specific antigen (PSA) and human glandular kallikrein (hGK-1) |
US5962428A (en) | 1995-03-30 | 1999-10-05 | Apollon, Inc. | Compositions and methods for delivery of genetic material |
WO1996032503A1 (en) | 1995-04-11 | 1996-10-17 | The General Hospital Corporation | Reverse two-hybrid systems |
CA2230925C (en) | 1995-04-14 | 2010-10-12 | University Of Alabama Research Foundation | Fusion protein delivery system and uses thereof |
US6576607B1 (en) | 1995-04-19 | 2003-06-10 | Acorda Therapeutics | Methods using CNS neurite outgrowth modulators |
CZ330197A3 (cs) | 1995-04-19 | 1998-04-15 | Acorda Therapeutics | Růstové modulátory neuritů centrální nervové soustavy (CNS), farmaceutické prostředky je obsahující, buňky je exprimující, způsoby jejich použití, které vedou k modulaci, podpoře a zesílení nervového růstu v CNS, zlepšení paměti, zvýšení synaptické výkonnosti v CNS, a způsob testování schopnosti látky modulovat aktivitu nervové adhezní molekuly |
US5922687A (en) | 1995-05-04 | 1999-07-13 | Board Of Trustees Of The Leland Stanford Junior University | Intracellular delivery of nucleic acids using pressure |
US5759776A (en) * | 1995-06-05 | 1998-06-02 | California Pacific Medical Center | Targets for breast cancer diagnosis and treatment |
US5861160A (en) * | 1995-06-07 | 1999-01-19 | Ambico, Inc. | Isospora suis sporozoite antigen |
US5585639A (en) | 1995-07-27 | 1996-12-17 | Hewlett-Packard Company | Optical scanning apparatus |
US5569588A (en) | 1995-08-09 | 1996-10-29 | The Regents Of The University Of California | Methods for drug screening |
US6248555B1 (en) * | 1995-08-31 | 2001-06-19 | The General Hospital Corporation | Genetic alterations related to familial alzheimer's disease |
US20030125536A1 (en) | 1996-01-11 | 2003-07-03 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of breast cancer |
US6344550B1 (en) * | 1996-01-11 | 2002-02-05 | Corixa Corporation | Compositions and methods for the treatment and diagnosis of breast cancer |
EP1876241A3 (en) | 1996-01-11 | 2008-07-30 | Corixa Corporation | Compositions and methods for the treatment and diagnosis of breast cancer |
US7241876B2 (en) * | 1996-01-11 | 2007-07-10 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of breast cancer |
US20020068285A1 (en) | 1996-01-11 | 2002-06-06 | Frudakis Tony N. | Compositions and methods for the therapy and diagnosis of breast cancer |
CU22559A1 (es) | 1996-01-17 | 1999-05-03 | Ct Ingenieria Genetica Biotech | Sistema de expresión de antígenos heterologos en e. coli como proteínas de fusión |
US5840839A (en) * | 1996-02-09 | 1998-11-24 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Alternative open reading frame DNA of a normal gene and a novel human cancer antigen encoded therein |
JP2001504799A (ja) | 1996-03-11 | 2001-04-10 | エピミューン インコーポレイテッド | Hla分子への結合アフィニティーが増加したペプチド |
EP0907750B1 (en) | 1996-04-26 | 2002-09-18 | Massachusetts Institute Of Technology | Three-hybrid screening assay |
US6294378B1 (en) | 1996-07-26 | 2001-09-25 | Sloan-Kettering Institute For Cancer Research | Method and reagents for genetic immunization |
US5925523A (en) | 1996-08-23 | 1999-07-20 | President & Fellows Of Harvard College | Intraction trap assay, reagents and uses thereof |
US6183988B1 (en) * | 1996-10-02 | 2001-02-06 | The General Hospital Corporation | Leukocyte-specific protein and gene, and methods of use thereof |
US6365797B1 (en) | 1997-10-15 | 2002-04-02 | The Regents Of The University Of California | Mice models of human prostate cancer progression |
JP2001502537A (ja) | 1996-10-15 | 2001-02-27 | ザ・リージェンツ・オブ・ザ・ユニバーシティ・オブ・カリフォルニア | ヒト前立腺ガンの進行の動物モデル |
US5846722A (en) | 1996-10-16 | 1998-12-08 | Terrapin Technologies, Inc. | System to detect small molecule/peptide interaction |
US5840501A (en) | 1996-10-25 | 1998-11-24 | Bayer Corporation | Determination of cPSA |
JP4215172B2 (ja) | 1996-12-03 | 2009-01-28 | アムジェン フレモント インク. | 複数のV▲下H▼およびV▲下κ▼領域を含むヒトIg遺伝子座を有するトランスジェニック哺乳動物、ならびにそれから産生される抗体 |
US20030185830A1 (en) * | 1997-02-25 | 2003-10-02 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of prostate cancer |
US6800746B2 (en) * | 1997-02-25 | 2004-10-05 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of prostate cancer |
US7033827B2 (en) * | 1997-02-25 | 2006-04-25 | Corixa Corporation | Prostate-specific polynucleotide compositions |
US7026447B2 (en) * | 1997-10-09 | 2006-04-11 | Human Genome Sciences, Inc. | 53 human secreted proteins |
ZA982968B (en) | 1997-04-09 | 1998-10-27 | Corixa Corp | Compositions and methods for the treatment and diagnosis of breast cancer |
AU6891098A (en) | 1997-04-10 | 1998-10-30 | Genetics Institute Inc. | Secreted expressed sequence tags (sests) |
EP0973898A2 (en) | 1997-04-10 | 2000-01-26 | Genetics Institute, Inc. | SECRETED EXPRESSED SEQUENCE TAGS (sESTs) |
EP0973550B1 (en) * | 1997-04-11 | 2002-10-09 | G.D. SEARLE & CO. | Antagonistic anti-avb3 integrin antibodies |
JP2001512013A (ja) | 1997-08-01 | 2001-08-21 | ジェンセット | 前立腺に発現される分泌タンパク質の5’est |
EP1042342A4 (en) | 1997-10-09 | 2003-04-09 | Human Genome Sciences Inc | 53 PROTEINS OF HUMAN ORIGIN |
CA2311572A1 (en) | 1997-12-17 | 1999-06-24 | Genset S.A. | Extended cdnas for secreted proteins |
US20030215803A1 (en) | 2000-12-07 | 2003-11-20 | Garcia Pablo Dominguez | Human genes and gene expression products isolated from human prostate |
ID27813A (id) | 1998-01-28 | 2001-04-26 | Corixa Corp | Senyawa-senyawa untuk terapi dan diagnosa kanker paru-paru dan metoda untuk penggunaannya |
EP1053319A2 (en) | 1998-01-28 | 2000-11-22 | Chiron Corporation | Human genes and gene expression products ii |
US6500938B1 (en) * | 1998-01-30 | 2002-12-31 | Incyte Genomics, Inc. | Composition for the detection of signaling pathway gene expression |
WO1999052942A2 (en) * | 1998-04-15 | 1999-10-21 | Genset | Genomic sequence of the 5-lipoxygenase-activating protein (flap), polymorphic markers thereof and methods for detection of asthma |
US6476212B1 (en) | 1998-05-26 | 2002-11-05 | Incyte Genomics, Inc. | Polynucleotides and polypeptides derived from corn ear |
US20030118599A1 (en) * | 1999-04-02 | 2003-06-26 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of lung cancer |
HUP0203035A3 (en) | 1998-07-14 | 2007-12-28 | Corixa Corp | Compositions and methods for therapy and diagnosis of prostate cancer |
JP2003530816A (ja) | 1998-09-28 | 2003-10-21 | カイロン コーポレイション | ヒト遺伝子および遺伝子発現産物 |
US6264949B1 (en) * | 1998-09-29 | 2001-07-24 | Mount Sinai School Of Medicine Of New York University | Noninvasive agents for diagnosis and prognosis of the progression of fibrosis |
WO2000021991A1 (en) | 1998-10-15 | 2000-04-20 | Genetics Institute, Inc. | SECRETED EXPRESSED SEQUENCE TAGS (sESTs) |
US20020137160A1 (en) * | 1998-12-17 | 2002-09-26 | Byatt John C | Nucleic acid and other molecules associated with lactation and muscle and fat deposition |
CA2296792A1 (en) | 1999-02-26 | 2000-08-26 | Genset S.A. | Expressed sequence tags and encoded human proteins |
CA2368482A1 (en) | 1999-03-26 | 2000-10-05 | Craig A. Rosen | 50 human secreted proteins |
AU3774500A (en) | 1999-03-31 | 2000-10-16 | Curagen Corporation | Nucleic acids including open reading frames encoding polypeptides; "orfx" |
AU4185100A (en) * | 1999-04-02 | 2000-10-23 | Corixa Corporation | Compounds for therapy and diagnosis of lung cancer and methods for their use |
BR0009573A (pt) | 1999-04-09 | 2002-04-16 | Corixa Corp | Composições e métodos para o tratamento e diagnose do câncer de mama |
CA2381319A1 (en) | 1999-06-01 | 2000-12-07 | Incyte Genomics, Inc. | Molecules for diagnostics and therapeutics |
US7160694B2 (en) * | 1999-06-14 | 2007-01-09 | Millennium Pharmaceuticals, Inc. | Nucleic acids encoding TANGO405 and functional fragments and uses thereof |
US6114123A (en) * | 1999-06-14 | 2000-09-05 | Incyte Pharmaceuticals, Inc. | Lipocalin family protein |
EP1396543A3 (en) | 1999-07-08 | 2004-03-31 | Research Association for Biotechnology | Primers for synthesizing full length cDNA clones and their use |
EP1074617A3 (en) * | 1999-07-29 | 2004-04-21 | Research Association for Biotechnology | Primers for synthesising full-length cDNA and their use |
JP2002191363A (ja) * | 1999-07-29 | 2002-07-09 | Herikkusu Kenkyusho:Kk | 全長cDNA合成用プライマー、およびその用途 |
WO2001018176A1 (en) * | 1999-09-03 | 2001-03-15 | Human Genome Sciences, Inc. | Immunoglobulin superfamily polynucleotides, polypeptides, and antibodies |
AU6063900A (en) * | 1999-09-10 | 2001-04-10 | Millennium Pharmaceuticals, Inc. | Novel genes encoding proteins having prognostic, diagnostic, preventive, therapeutic, and other uses |
WO2001025272A2 (en) | 1999-10-04 | 2001-04-12 | Corixa Corporation | Compositions and methods for therapy and diagnosis of prostate cancer |
US6893818B1 (en) * | 1999-10-28 | 2005-05-17 | Agensys, Inc. | Gene upregulated in cancers of the prostate |
JP2004537252A (ja) | 1999-11-12 | 2004-12-16 | コリクサ コーポレイション | 前立腺癌の治療及び診断のための組成物及び方法 |
WO2001051659A2 (en) | 2000-01-13 | 2001-07-19 | Genset | Biallelic markers derived from genomic regions carrying genes involved in central nervous system disorders |
EP1261708A2 (en) | 2000-01-14 | 2002-12-04 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of prostate cancer |
AU2001229340A1 (en) | 2000-01-14 | 2001-07-24 | Millennium Pharmaceuticals, Inc. | Genes compositions, kits, and methods for identification, assessment, prevention, and therapy of breast cancer |
US20020090672A1 (en) * | 2000-01-31 | 2002-07-11 | Rosen Craig A. | Nucleic acids, proteins, and antibodies |
US20030013649A1 (en) * | 2000-01-31 | 2003-01-16 | Rosen Craig A. | Nucleic acids, proteins, and antibodies |
US20020132767A1 (en) * | 2000-01-31 | 2002-09-19 | Rosen Craig A. | Nucleic acids, proteins, and antibodies |
WO2001059063A2 (en) | 2000-01-31 | 2001-08-16 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
WO2001055321A2 (en) | 2000-01-31 | 2001-08-02 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
WO2001055326A2 (en) | 2000-01-31 | 2001-08-02 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
AU2001243142A1 (en) | 2000-02-03 | 2001-08-14 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
GB2373500B (en) | 2000-02-04 | 2004-12-15 | Aeomica Inc | Methods and apparatus for predicting, confirming, and displaying functional information derived from genomic sequence |
US20030170246A1 (en) | 2000-02-11 | 2003-09-11 | Corixa Corporation | Lipophilin complexes for use in cancer diagnosis and therapy |
WO2001060860A2 (en) * | 2000-02-17 | 2001-08-23 | Millennium Predictive Medicine, Inc. | Genes differentially expressed in human prostate cancer and their use |
AU2001241511A1 (en) | 2000-02-28 | 2001-09-12 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
JP2001245671A (ja) | 2000-03-07 | 2001-09-11 | Chiba Prefecture | ヒト神経芽細胞腫においてクローニングされた新規遺伝子及び新規遺伝子の断片 |
AU2001245619A1 (en) | 2000-03-09 | 2001-09-17 | Chiron Corporation | Human genes and gene expression products |
US20030165831A1 (en) * | 2000-03-21 | 2003-09-04 | John Lee | Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of ovarian cancer |
WO2001073032A2 (en) | 2000-03-27 | 2001-10-04 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of prostate cancer |
CZ20023567A3 (cs) | 2000-03-29 | 2003-11-12 | Corixa Corporation | Sloučeniny a způsoby pro terapii a diagnostiku karcinomu plic |
US6436703B1 (en) | 2000-03-31 | 2002-08-20 | Hyseq, Inc. | Nucleic acids and polypeptides |
AU2001253079A1 (en) | 2000-04-03 | 2001-10-15 | Corixa Corporation | Methods, compositions and kits for the detection and monitoring of breast cancer |
US20020192763A1 (en) * | 2000-04-17 | 2002-12-19 | Jiangchun Xu | Compositions and methods for the therapy and diagnosis of prostate cancer |
US6682888B1 (en) | 2000-05-05 | 2004-01-27 | Incyte Corporation | Genes expressed in alzheimer's disease |
WO2001085791A1 (en) | 2000-05-11 | 2001-11-15 | Lifespan Biosciences, Inc. | Nucleic acid sequences for novel gpcrs |
AU2001263006A1 (en) * | 2000-05-18 | 2001-11-26 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
JP2004511212A (ja) | 2000-05-26 | 2004-04-15 | コリクサ コーポレイション | 卵巣癌の治療および診断のための組成物および方法 |
US20020082206A1 (en) * | 2000-05-30 | 2002-06-27 | Leach Martin D. | Novel polynucleotides from atherogenic cells and polypeptides encoded thereby |
AU2001264559A1 (en) | 2000-06-05 | 2001-12-17 | Avalon Pharmaceuticals | Cancer gene determination and therapeutic screening using signature gene sets |
GB0014185D0 (en) * | 2000-06-09 | 2000-08-02 | Novartis Res Found | Compound and method |
US6974667B2 (en) | 2000-06-14 | 2005-12-13 | Gene Logic, Inc. | Gene expression profiles in liver cancer |
AU2001268471A1 (en) | 2000-06-16 | 2002-01-02 | Incyte Genomics, Inc. | G-protein coupled receptors |
US20040072996A1 (en) * | 2001-06-15 | 2004-04-15 | Lal Preeti G | G-protein coupled receptors |
US20030165843A1 (en) | 2000-07-28 | 2003-09-04 | Avi Shoshan | Oligonucleotide library for detecting RNA transcripts and splice variants that populate a transcriptome |
KR100870486B1 (ko) | 2000-09-01 | 2008-12-11 | 에피제노믹스 아게 | 게놈 디엔에이 시료의 서열 콘택스트 5'-씨피쥐-3'에서 특정 시토신의 메틸화 정도 측정방법 |
CN1345964A (zh) | 2000-09-29 | 2002-04-24 | 上海博德基因开发有限公司 | 一种新的多肽——己糖激酶10.01和编码这种多肽的多核苷酸 |
US20040110668A1 (en) | 2000-10-02 | 2004-06-10 | Burgess Christopher C. | Nucleic acid sequences differentially expressed in cancer tissue |
US20030134283A1 (en) * | 2000-10-03 | 2003-07-17 | Peterson David P. | Genes regulated in dendritic cell differentiation |
WO2002028902A2 (en) * | 2000-10-05 | 2002-04-11 | Immunex Corporation | Nectin polypeptides, polynucleotides, methods of making and use thereof |
EP1474528A4 (en) * | 2000-10-13 | 2006-06-14 | Protein Design Labs Inc | METHODS FOR DIAGNOSING PROSTATE CANCER, COMPOSITIONS AND METHODS FOR SCREENING PROSTATE CANCER MODULATORS |
US20070014801A1 (en) * | 2001-01-24 | 2007-01-18 | Gish Kurt C | Methods of diagnosis of prostate cancer, compositions and methods of screening for modulators of prostate cancer |
WO2002055700A2 (en) | 2000-12-07 | 2002-07-18 | Chiron Corp | Human genes and gene expression products isolated from human prostate |
WO2002050105A1 (en) | 2000-12-19 | 2002-06-27 | Smithkline Beecham Corporation | Novel compounds |
US20040072264A1 (en) | 2000-12-22 | 2004-04-15 | Morris David W. | Novel compositions and methods for cancer |
US7820447B2 (en) | 2000-12-22 | 2010-10-26 | Sagres Discovery Inc. | Compositions and methods for cancer |
CN1363678A (zh) | 2001-01-05 | 2002-08-14 | 上海博德基因开发有限公司 | 一种新的多肽——信号肽酶9.79和编码这种多肽的多核苷酸 |
CA2440703A1 (en) * | 2001-01-24 | 2002-08-01 | Protein Design Labs, Inc. | Methods of diagnosis of breast cancer, compositions and methods of screening for modulators of breast cancer |
US20040029114A1 (en) * | 2001-01-24 | 2004-02-12 | Eos Technology, Inc. | Methods of diagnosis of breast cancer, compositions and methods of screening for modulators of breast cancer |
AU2002253878A1 (en) | 2001-01-25 | 2002-08-06 | Gene Logic, Inc. | Gene expression profiles in breast tissue |
AU2002251841A1 (en) | 2001-01-30 | 2002-08-12 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of pancreatic cancer |
DE20103510U1 (de) | 2001-02-28 | 2001-06-07 | Lion Bioscience Ag | Genbibliothek |
WO2003008583A2 (en) | 2001-03-02 | 2003-01-30 | Sagres Discovery | Novel compositions and methods for cancer |
US20040053250A1 (en) * | 2001-03-05 | 2004-03-18 | Tang Y. Tom | Novel arginine-rich protein-like nucleic acids and polypeptides |
US6783969B1 (en) * | 2001-03-05 | 2004-08-31 | Nuvelo, Inc. | Cathepsin V-like polypeptides |
WO2002071928A2 (en) * | 2001-03-14 | 2002-09-19 | Millennium Pharmaceuticals, Inc. | Nucleic acid molecules and proteins for the identification, assessment, prevention, and therapy of ovarian cancer |
US7271240B2 (en) * | 2001-03-14 | 2007-09-18 | Agensys, Inc. | 125P5C8: a tissue specific protein highly expressed in various cancers |
US20070042361A1 (en) | 2001-03-27 | 2007-02-22 | Rosen Craig A | Human secreted proteins |
WO2002097031A2 (en) | 2001-03-28 | 2002-12-05 | Incyte Genomics, Inc. | Molecules for diagnostics and therapeutics |
WO2002083876A2 (en) | 2001-03-29 | 2002-10-24 | Incyte Genomics, Inc. | Secretory molecules |
WO2002078516A2 (en) | 2001-03-30 | 2002-10-10 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of cancer |
JP2004532630A (ja) | 2001-03-30 | 2004-10-28 | インサイト・ゲノミックス・インコーポレイテッド | Gタンパク質共役受容体 |
WO2002080852A2 (en) | 2001-04-04 | 2002-10-17 | Digital Gene Technologies, Inc. | Genes expressed in intestinal epithelium and peyer's patch m cells |
AU2002307466A1 (en) | 2001-04-20 | 2002-11-05 | Millennium Pharmaceutical, Inc. | Method for detecting breast cancer cells |
US20030083263A1 (en) * | 2001-04-30 | 2003-05-01 | Svetlana Doronina | Pentapeptide compounds and uses related thereto |
US6794501B2 (en) * | 2001-05-04 | 2004-09-21 | Ludwig Institute For Cancer Research | Colon cancer antigen panel |
EP1515982A4 (en) | 2001-05-09 | 2005-10-26 | Corixa Corp | METHODS AND COMPOSITIONS FOR THE THERAPY AND DIAGNOSIS OF PROSTATE CANCER |
AU2002311909A1 (en) | 2001-05-11 | 2002-11-25 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of lung cancer |
US7189507B2 (en) * | 2001-06-18 | 2007-03-13 | Pdl Biopharma, Inc. | Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer |
US7171311B2 (en) | 2001-06-18 | 2007-01-30 | Rosetta Inpharmatics Llc | Methods of assigning treatment to breast cancer patients |
US20040076955A1 (en) * | 2001-07-03 | 2004-04-22 | Eos Biotechnology, Inc. | Methods of diagnosis of bladder cancer, compositions and methods of screening for modulators of bladder cancer |
US20040249128A1 (en) | 2001-07-09 | 2004-12-09 | Thornton Michael B | Molecules for disease detection and treatment |
US20050118582A1 (en) | 2001-07-12 | 2005-06-02 | Anita Swarnakar | Nucleic acid-associated proteins |
US20030099974A1 (en) * | 2001-07-18 | 2003-05-29 | Millennium Pharmaceuticals, Inc. | Novel genes, compositions, kits and methods for identification, assessment, prevention, and therapy of breast cancer |
AU2002337657A1 (en) | 2001-07-25 | 2003-02-17 | Millennium Pharmaceuticals, Inc. | Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of prostate cancer |
AU2002367815A1 (en) | 2001-08-09 | 2003-10-08 | Nuvelo Inc. | Novel nucleic acids and secreted polypeptides |
US20070015145A1 (en) | 2001-08-14 | 2007-01-18 | Clifford Woolf | Nucleic acid and amino acid sequences involved in pain |
WO2003016478A2 (en) | 2001-08-20 | 2003-02-27 | Bristol-Myers Squibb Company | G-protein coupled receptor polynucleotides and methods of use thereof |
EP1293569A3 (en) | 2001-09-14 | 2004-03-31 | Research Association for Biotechnology | Full-length cDNAs |
JP2003088388A (ja) * | 2001-09-14 | 2003-03-25 | Herikkusu Kenkyusho:Kk | 新規な全長cDNA |
NZ531674A (en) * | 2001-09-18 | 2009-03-31 | Genentech Inc | Compositions and methods for the diagnosis and treatment of tumor |
CN1412309A (zh) | 2001-10-08 | 2003-04-23 | 中国人民解放军军事医学科学院放射医学研究所 | 人支气管上皮细胞恶性转化差异表达基因的cDNA文库及与肺癌病变相关的克隆 |
WO2003038129A2 (en) | 2001-10-30 | 2003-05-08 | Ortho-Clinical Diagnostics, Inc. | Methods for assessing and treating leukemia |
AU2002351828A1 (en) | 2001-11-05 | 2003-05-19 | Deutsches Krebsforschungszentrum | Novel genetic markers for leukemias |
EP1537140B1 (en) * | 2001-11-07 | 2013-01-02 | Agensys, Inc. | Nucleic acid and corresponding protein entitled 161p2f10b useful in treatment and detection of cancer |
US20030232350A1 (en) * | 2001-11-13 | 2003-12-18 | Eos Biotechnology, Inc. | Methods of diagnosis of cancer, compositions and methods of screening for modulators of cancer |
US20040115629A1 (en) * | 2002-01-09 | 2004-06-17 | Panzer Scott R | Molecules for diagnostics and therapeutics |
WO2003062376A2 (en) | 2002-01-16 | 2003-07-31 | Incyte Genomics, Inc. | Molecules for diagnostics and therapeutics |
AU2003210266A1 (en) | 2002-02-14 | 2003-09-04 | Bioinvent International Ab | Treatment, diagnosis and imaging of disease |
WO2003074674A2 (en) | 2002-03-01 | 2003-09-12 | Exelixis, Inc. | MSRAs AS MODIFIERS OF THE p53 PATHWAY AND METHODS OF USE |
AU2003217992A1 (en) | 2002-03-06 | 2003-09-22 | Incyte Corporation | Nucleic acid-associated proteins |
JP2003259877A (ja) | 2002-03-11 | 2003-09-16 | Sumitomo Pharmaceut Co Ltd | 肝線維症疾患マーカーおよびその利用 |
WO2003083074A2 (en) | 2002-03-28 | 2003-10-09 | Idec Pharmaceuticals Corporation | Novel gene targets and ligands that bind thereto for treatment and diagnosis of colon carcinomas |
US20030194704A1 (en) * | 2002-04-03 | 2003-10-16 | Penn Sharron Gaynor | Human genome-derived single exon nucleic acid probes useful for gene expression analysis two |
US20040101874A1 (en) | 2002-04-12 | 2004-05-27 | Mitokor Inc. | Targets for therapeutic intervention identified in the mitochondrial proteome |
DK1545613T3 (da) * | 2002-07-31 | 2011-11-14 | Seattle Genetics Inc | Auristatinkonjugater og deres anvendelse til behandling af cancer, en autoimmun sygdom eller en infektiøs sygdom |
JP2004121218A (ja) | 2002-08-06 | 2004-04-22 | Jenokkusu Soyaku Kenkyusho:Kk | 気管支喘息または慢性閉塞性肺疾患の検査方法 |
EP1534833A4 (en) * | 2002-08-09 | 2006-06-07 | Melbourne Health | GRAINYHEAD MAMMALIAN TRANSCRIPTION FACTORS |
WO2004016733A2 (en) * | 2002-08-16 | 2004-02-26 | Agensys, Inc. | Nucleic acid and corresponding protein entitled 251p5g2 useful in treatment and detection of cancer |
CN1477123A (zh) | 2002-08-23 | 2004-02-25 | 上海博德基因开发有限公司 | 一种多肽——转录因子43和编码这种多肽的多核苷酸 |
AU2003289716A1 (en) | 2002-09-12 | 2004-04-30 | Incyte Corporation | Molecules for diagnostics and therapeutics |
EP2500438A3 (en) | 2002-09-25 | 2012-11-28 | Genentech, Inc. | Novel compositions and methods for the treatment of psoriasis |
EP1560597A4 (en) | 2002-10-29 | 2007-06-27 | Pharmacia Corp | DIFFERENTIALLY EXPRESSED GENES INVOLVED IN CANCER, POLYPEPTIDES CODED THEREWITH, AND METHODS OF USING GENES |
WO2004046342A2 (en) | 2002-11-20 | 2004-06-03 | Biogen Idec Inc. | Novel gene targets and ligands that bind thereto for treatment and diagnosis of carcinomas |
WO2004048599A2 (en) | 2002-11-22 | 2004-06-10 | Incyte Corporation | Transporters and ion channels |
US20040253606A1 (en) | 2002-11-26 | 2004-12-16 | Protein Design Labs, Inc. | Methods of detecting soft tissue sarcoma, compositions and methods of screening for soft tissue sarcoma modulators |
WO2004066948A2 (en) | 2003-01-29 | 2004-08-12 | Exelixis Inc. | Mapcaxs as modifiers of the apc and axin pathways and methods of use |
EP1447413A3 (en) | 2003-02-14 | 2006-01-04 | Research Association for Biotechnology | Full-length human cDNA |
US20050164324A1 (en) * | 2003-06-04 | 2005-07-28 | Gygi Steven P. | Systems, methods and kits for characterizing phosphoproteomes |
NZ583292A (en) * | 2003-11-06 | 2012-03-30 | Seattle Genetics Inc | Monomethylvaline compounds capable of conjugation to ligands |
EP2975057A1 (en) * | 2006-07-10 | 2016-01-20 | Fujita Health University | Novel anti-cd73 antibody |
JO3421B1 (ar) | 2011-06-20 | 2019-10-20 | H Lundbeck As | طريقة لإعطاء 1-((1ار.3س)-6-كلورو-3-فينيل-اندان-1-ايل)-1.2.2-ترايميثيل- بيبيرازين واملاجها لمعالجة انفصام الشخصية |
US9701019B2 (en) | 2011-09-15 | 2017-07-11 | Convergent Information Technologies Gmbh | System and method for the automatic generation of robot programs |
-
2003
- 2003-04-17 WO PCT/US2003/012354 patent/WO2004016733A2/en active Search and Examination
- 2003-04-17 US US10/418,972 patent/US20040081653A1/en not_active Abandoned
- 2003-04-17 AU AU2003243151A patent/AU2003243151A1/en not_active Abandoned
- 2003-04-23 WO PCT/US2003/013013 patent/WO2004016799A2/en active Application Filing
- 2003-04-23 US US10/422,571 patent/US20040083497A1/en not_active Abandoned
- 2003-04-23 PT PT03726484T patent/PT1576170E/pt unknown
- 2003-04-23 SI SI200332206T patent/SI1576170T1/sl unknown
- 2003-04-23 CA CA2493923A patent/CA2493923C/en not_active Expired - Lifetime
- 2003-04-23 ES ES03726484T patent/ES2392341T3/es not_active Expired - Lifetime
- 2003-04-23 EP EP03726484A patent/EP1576170B1/en not_active Expired - Lifetime
- 2003-04-23 CA CA3066279A patent/CA3066279A1/en not_active Expired - Lifetime
- 2003-04-23 AU AU2003228717A patent/AU2003228717B2/en not_active Expired
- 2003-04-23 EP EP10012141A patent/EP2332966A1/en not_active Withdrawn
- 2003-04-23 JP JP2005502039A patent/JP2006513724A/ja active Pending
- 2003-04-23 DK DK03726484.3T patent/DK1576170T3/da active
- 2003-05-09 JP JP2005502040A patent/JP2006511232A/ja active Pending
- 2003-05-09 AU AU2003232116A patent/AU2003232116B2/en not_active Ceased
- 2003-05-09 WO PCT/US2003/014921 patent/WO2004016734A2/en active Application Filing
- 2003-05-09 US US10/435,751 patent/US7115727B2/en active Active
- 2003-05-09 EP EP10012129A patent/EP2301954A3/en not_active Withdrawn
- 2003-05-09 CA CA2493921A patent/CA2493921C/en not_active Expired - Lifetime
- 2003-05-09 EP EP03788229A patent/EP1576130A4/en not_active Withdrawn
- 2003-06-16 WO PCT/US2003/018906 patent/WO2004016736A2/en not_active Application Discontinuation
- 2003-06-16 CA CA002493925A patent/CA2493925A1/en not_active Abandoned
- 2003-06-16 EP EP03737110A patent/EP1576104A4/en not_active Withdrawn
- 2003-06-16 AU AU2003236553A patent/AU2003236553C1/en not_active Ceased
- 2003-06-16 US US10/463,782 patent/US20040192597A1/en not_active Abandoned
- 2003-08-15 PT PT03788558T patent/PT1576132E/pt unknown
- 2003-08-15 AU AU2003258269A patent/AU2003258269B2/en not_active Ceased
- 2003-08-15 SI SI200332210T patent/SI1576132T1/sl unknown
- 2003-08-15 EP EP03788558A patent/EP1576132B1/en not_active Expired - Lifetime
- 2003-08-15 ES ES03788558T patent/ES2391892T3/es not_active Expired - Lifetime
- 2003-08-15 WO PCT/US2003/025665 patent/WO2004016762A2/en active IP Right Grant
- 2003-08-15 US US10/641,633 patent/US7250498B2/en not_active Expired - Fee Related
- 2003-08-15 CA CA2493928A patent/CA2493928C/en not_active Expired - Fee Related
- 2003-08-15 DK DK03788558.9T patent/DK1576132T3/da active
-
2005
- 2005-01-27 IL IL166532A patent/IL166532A/en not_active IP Right Cessation
- 2005-01-27 IL IL166531A patent/IL166531A/en active IP Right Grant
- 2005-01-30 IL IL166564A patent/IL166564A/en not_active IP Right Cessation
- 2005-02-02 IL IL166655A patent/IL166655A/en active IP Right Grant
-
2006
- 2006-05-23 US US11/438,944 patent/US7612172B2/en not_active Expired - Lifetime
- 2006-10-11 US US11/548,626 patent/US8057996B2/en not_active Expired - Fee Related
- 2006-10-16 US US11/549,900 patent/US7696336B2/en not_active Expired - Lifetime
-
2007
- 2007-02-20 US US11/708,975 patent/US20070298424A1/en not_active Abandoned
-
2008
- 2008-08-26 AU AU2008207531A patent/AU2008207531A1/en not_active Abandoned
-
2009
- 2009-01-08 JP JP2009002970A patent/JP4490502B2/ja not_active Expired - Fee Related
- 2009-03-09 US US12/400,679 patent/US20090252747A1/en not_active Abandoned
- 2009-06-05 JP JP2009135785A patent/JP2009278977A/ja active Pending
- 2009-07-15 JP JP2009167283A patent/JP2009278988A/ja not_active Withdrawn
- 2009-08-13 IL IL200404A patent/IL200404A/en active IP Right Grant
- 2009-12-17 JP JP2009286607A patent/JP2010142228A/ja active Pending
- 2009-12-31 US US12/651,336 patent/US8604169B2/en not_active Expired - Lifetime
-
2010
- 2010-06-22 US US12/821,016 patent/US20100297006A1/en not_active Abandoned
- 2010-06-22 US US12/821,045 patent/US20100297669A1/en not_active Abandoned
-
2011
- 2011-02-04 US US13/021,202 patent/US8426571B2/en not_active Expired - Fee Related
-
2012
- 2012-10-17 CY CY20121100966T patent/CY1113247T1/el unknown
-
2013
- 2013-01-24 US US13/749,461 patent/US20130177569A1/en not_active Abandoned
- 2013-06-07 US US13/913,360 patent/US20130267024A1/en not_active Abandoned
-
2014
- 2014-06-18 IL IL233223A patent/IL233223A/en active IP Right Grant
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP1576132B1 (en) | Nucleic acids entitled 273p4b7 and their use in detection of cancer | |
US8298776B2 (en) | Antibodies to tumor associated proteins | |
US8460881B2 (en) | Nucleic acids and corresponding proteins entitled 254P1D6B useful in treatment and detection of cancer | |
US7968090B2 (en) | Nucleic acids and corresponding proteins entitled 191P4D12(b) useful in treatment and detection of cancer | |
MXPA04009728A (es) | Acido nucleico y proteina correspondiente titulada 98p4b6 en el tratamiento y deteccion del cancer. | |
IL167892A (en) | Nucleic acid and protein entitled 24p4c12 and compositions containing the same and uses thereof | |
AU2008202217A1 (en) | Nucleic acids and corresponding proteins entitled 191PAD12(b) useful in treatment and detection of cancer | |
PT1553980E (pt) | Ácido nucleico e proteína correspondente intitulada 238p1b2 útil no tratamento e detecção do cancro | |
AU2012202262A1 (en) | Nucleic acids and corresponding proteins entitled 282P1G3 useful in treatment and detection of cancer |