EP2737102A2 - Verwendung speziell belegter, pulverförmiger beschichtungsmaterialien und beschichtungsverfahren unter einsatz derartiger beschichtungsmaterialien - Google Patents

Verwendung speziell belegter, pulverförmiger beschichtungsmaterialien und beschichtungsverfahren unter einsatz derartiger beschichtungsmaterialien

Info

Publication number
EP2737102A2
EP2737102A2 EP12746062.4A EP12746062A EP2737102A2 EP 2737102 A2 EP2737102 A2 EP 2737102A2 EP 12746062 A EP12746062 A EP 12746062A EP 2737102 A2 EP2737102 A2 EP 2737102A2
Authority
EP
European Patent Office
Prior art keywords
coating
particles
coating material
spraying
preferred
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP12746062.4A
Other languages
German (de)
English (en)
French (fr)
Inventor
Sebastian HÖFENER
Markus Rupprecht
Christian Wolfrum
Andreas Reis
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Eckart GmbH
Original Assignee
Eckart GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Eckart GmbH filed Critical Eckart GmbH
Publication of EP2737102A2 publication Critical patent/EP2737102A2/de
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C23COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
    • C23CCOATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
    • C23C4/00Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge
    • C23C4/04Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge characterised by the coating material
    • C23C4/06Metallic material
    • CCHEMISTRY; METALLURGY
    • C23COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
    • C23CCOATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
    • C23C24/00Coating starting from inorganic powder
    • C23C24/02Coating starting from inorganic powder by application of pressure only
    • C23C24/04Impact or kinetic deposition of particles
    • CCHEMISTRY; METALLURGY
    • C23COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
    • C23CCOATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
    • C23C4/00Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge
    • C23C4/04Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge characterised by the coating material
    • CCHEMISTRY; METALLURGY
    • C23COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
    • C23CCOATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
    • C23C4/00Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge
    • C23C4/12Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge characterised by the method of spraying

Definitions

  • the present invention deals with the use of specially provided powdered coating materials. Furthermore, the present invention includes
  • the present invention comprises powdery coating materials which are suitable for the aforementioned uses and / or processes.
  • the coating material to be applied must be compatible with the basecoat and a remainder of the basecoat also remains on the Substrate.
  • PVD deposition requires large amounts of energy to vaporize low volatility material.
  • a variety of coating techniques have been developed to provide the desired properties for the particular application.
  • Known methods use for generating the coatings, for example, kinetic energy, thermal energy or mixtures thereof, wherein the thermal energy may for example come from a conventional combustion flame or a plasma flame.
  • the latter are further distinguished in thermal and non-thermal plasmas, which have in common that a gas is partially or completely separated into free charge carriers such as ions or electrons.
  • the formation of the coating takes place by applying a powder to a substrate surface, the powder particles being greatly accelerated.
  • a heated process gas is accelerated by expansion in a Laval nozzle to supersonic speed and then injected the powder. Due to the high kinetic energy, the particles form a dense layer upon impact with the substrate surface.
  • WO 2010/003396 A1 discloses the use of the
  • Flame spraying belongs to the group of thermal coating processes.
  • a powdery coating material is introduced into the flame of a fuel gas-oxygen mixture.
  • acetylene oxygen flames temperatures of up to about 3200 ° C. become. Details about the method can be found in publications such as EP 830 464 B1 and US Pat. No. 5,207,382.
  • thermal plasma spraying a powdery coating material is injected into a thermal plasma.
  • temperatures of up to about 20,000 K are reached, causing the injected powder to melt and as a coating on a substrate
  • Embodiments and process parameters are known to the person skilled in the art.
  • reference is made to WO 2004/016821 which describes the use of thermal plasma spraying for applying an amorphous coating.
  • EP 0 344 781 discloses the use of
  • EP 0 825 272 A2 discloses a
  • the non-thermal plasma spraying is largely analogous to thermal plasma spraying and flame spraying.
  • a powdered coating material is injected into a non-thermal plasma and thereby onto a
  • EP 2 104 750 A2 describes the use of this method and an apparatus for carrying it out.
  • EP 2 104 750 A2 describes the use of this method and an apparatus for carrying it out.
  • DE 103 20 379 A1 describes the production of an electrically heatable element using this method. Further disclosures regarding the method or devices for non-thermal plasma spraying can be found, for example, in EP 1 675 971 B1, DE 10 2006 061 435 A1, WO 03/064061 A1, WO 2005/031026 A1, DE 198 07 086 A1, DE 101 16 502 A1, WO 01/32949 A1, EP 0 254 424 B1, EP 1 024 222 A2, DE 195 32 412 A1, DE 199 55 880 A1 and DE 198 56 307 C1.
  • Coating materials form agglomerates that form an uneven coating when applied to the substrate surface.
  • novel processes should make novel coatings available and / or enable the production of known coatings of particularly high quality.
  • Another object of the present invention is to provide a powdery coating material suitable for any of the foregoing
  • the present invention relates to the use of a particle-containing powdery coating material whose surface is provided with at least one coating aid which has a boiling temperature or decomposition temperature below 500 ° C., in a coating process selected from the group consisting of cold gas spraying, flame spraying, high-speed flame spraying, thermal plasma spraying and
  • the weight proportion of the at least one coating aid is at least 0.01% by weight, based on the total weight of the coating material and the coating aid.
  • the weight fraction of the at least one coating aid is at most 80 Wt .-%, based on the total weight of the coating material and the coating aid.
  • the particles of powdered coating material are or are metal particles, wherein the metal is selected from the group consisting of silver, gold, platinum, palladium, vanadium, chromium, manganese, cobalt, germanium, antimony, aluminum, zinc, Tin, iron, copper, nickel, titanium, silicon, alloys and mixtures thereof.
  • the carbon content of the powdered coating material is from 0.01% to 15% by weight, based in each case on the total weight of the powdered coating material
  • Coating material and the coating aid are Coating material and the coating aid.
  • the compounds used as coating aids have at least 6
  • the coating process is selected from the group consisting of
  • the coating process is nonthermal plasma spraying.
  • the at least one coating aid is selected from the group consisting of polymers, monomers, silanes, waxes, oxidized waxes,
  • the at least one coating aid comprises no stearic acid and / or oleic acid and preferably no saturated and unsaturated C 18 carboxylic acids, more preferably no saturated and unsaturated C 14 to C 18 carboxylic acids, even more preferably no saturated and unsaturated C 12 to C 18 carboxylic acids.
  • the coating aid has been mechanically applied to the particles.
  • the powdery coating material has a particle size distribution with a D 50 value in the range from 1.5 to 53 ⁇ m.
  • the present invention relates to methods for coating a
  • Plasma spraying and non-thermal plasma spraying in which a particle-containing powdered Be Schweizerungsmatenal is used, wherein the particles with at least one coating aid, which has a boiling temperature or decomposition temperature of less than 500 ° C, are provided.
  • the particles with at least one coating aid which has a boiling temperature or decomposition temperature of less than 500 ° C.
  • the coating process is non-thermal plasma spraying.
  • the powdery coating material is conveyed as an aerosol.
  • the medium directed to the substrate is air or was generated from air.
  • powdery coating material in the context of the present invention refers to a particle mixture which acts on the substrate as
  • Coating is applied.
  • the provision of the surface of the particles of the powdery coating material according to the invention need not be complete. Without intending to be construed as limiting the invention, it is the view of the inventors that even a small application or a small coverage of the surface of the particles of the powdery coating material is sufficient to break up agglomerates under the conditions of the coating process. In particular, it is the view of the inventors that due to the large gas volume of the coating additive according to the invention or its decomposition products, even small amounts of the coating aid are sufficient to break up existing agglomerates.
  • the at least one coating aid according to the invention is in this case applied to the surface of the particles of the
  • Coating aid is applied. This offers the advantage that
  • compositions of the coating aid are prevented prior to application to the particles.
  • coating additive This can be, for example, a simple adaptation of the properties of the pulverulent powder according to the invention Allow coating materials to meet different requirements.
  • the substances used according to the invention as coating aids can be bound, for example, physically and / or chemically on the surface of the particles.
  • the coating aid for example in the form of coatings, can completely or partially envelop the particles of the powdered coating material.
  • Coating aid with a low boiling or decomposition temperature on the surface of the particles of the pulverulent Be Anlagenungsmatenals during storage or as a result of the promotion resulting agglomerates can be broken in the course of the coating process and particularly high quality coatings are obtained. Furthermore, the use of the pulverulent coating material according to the invention allows a more uniform coating, so that, for example, the production of particularly thin coatings is made possible.
  • Processes according to the invention which can be used to build up coatings are cold gas spraying, thermal plasma spraying,
  • the temperature of the gas stream is at least 250 ° C, preferably at least 350 ° C, more preferably at least 450 ° C, and even more preferably at least 500 ° C. Since the high speeds of the gas streams in cold gas spraying and high-speed flame spraying only a short residence time of the powdery coating material in the gas stream or the flame
  • the method is selected from the group consisting of thermal plasma spraying, non-thermal plasma spraying and flame spraying.
  • Coating should be achieved, uneconomical. For certain
  • the method is therefore selected from the group consisting of cold gas spraying, non-thermal plasma spraying, flame spraying and high-speed flame spraying, preferably from the group consisting of non-thermal plasma spraying and flame spraying.
  • the use of the plasma-based method offers, for example, the advantage that non-combustible gases can also be used. This facilitates storage of the gases used on an industrial scale, since, for example, the safety requirements are reduced. In the case of the use of air, the required gas may possibly even be taken directly from the atmosphere.
  • the coating process is therefore selected from the group consisting of thermal plasma spraying and non-thermal plasma spraying.
  • the method be the
  • non-thermal plasma spraying is.
  • Coating material applied coating aid is characterized by the aforementioned upper limit of the boiling or decomposition temperature.
  • the coating aid used in the decomposition releases a gas which breaks up existing agglomerates.
  • the boiling or decomposition temperature can be determined by methods known to the person skilled in the art. For example, the determination of the decomposition temperature of polymers by means of
  • the decomposition or boiling point of the coating aid to be applied according to the invention to the surface of the particles is below 500 ° C.
  • the decomposition or boiling temperature of the materials applied to the surface of the particles be below 400 ° C, preferably below 380 ° C, more preferably below 360 ° C and even more preferably below 340 ° C.
  • Coating aids need not be bound to the surface of the particles. In certain embodiments, however, it is preferred that the coating aids of the invention are chemically and / or physically bound to the surface of the particles. For example, in cases where the powder may also have to be subjected to greater mechanical stresses, it may be preferred for the coating aids to be particularly firmly bound to the surface of the particles. In certain embodiments, it is therefore preferred that the coating aids be bonded to the surface with at least one type of chemical bond. Examples of chemical bonds are covalent and ionic bonds. In other cases, in which the coating aid must be able to be peeled off again particularly easily, it may be preferred, however, that the coating aids are bound to the surface of the particles only by means of physical bonds. In certain embodiments, it is therefore preferred that the
  • the coating aid forms a stable shell around the particles according to the invention, so that, for example, no physical or chemical
  • Bindings are required to hold the particles within this envelope. Without it being to be understood as a limitation of the invention, it is the view of the inventors that such a coating aid in the form of a stable shell without strong bonds to the particles can be particularly easily peeled off, since the shell after a partial evaporation or Decomposition can easily detach. In certain embodiments, it is therefore preferred that the coating aid form a stable shell around the particle, which shell has no opening large enough to allow the particle to escape the shell.
  • stable shell in the sense of the present invention describes that the coating aid forms a shell around the particles of the powdered Be Anlagenungsmatenals that is not destroyed under the conditions of storage and promotion.
  • the coating auxiliaries according to the invention can be applied to the particles by a variety of methods. For example, you can
  • Coatings of the particles can be obtained by polymerization of a monomer and / or from sol-gel processes.
  • stable sheaths can be obtained from the coating aid.
  • the coating auxiliaries according to the invention for example, by
  • Coating aids with high carbon content due to the release of CO2 allows a particularly good breakup of the agglomerates.
  • Carbon atoms of the powdered coating material of the invention is at least 0.01% by weight, preferably at least 0.05% by weight, more preferably at least 0.1% by weight and even more preferably at least 0.17% by weight.
  • powdery Be Schweizerungsmatenals at least 0.22 wt .-%, preferably at least 0.28 wt .-%, more preferably at least 0.34 wt .-% and even more preferably at least 0.4 wt .-% is.
  • the abovementioned% by weight relates to the total weight of the coating material according to the invention and of the coating aid. The determination of the weight fraction of
  • Carbon atoms in the total weight of the pulverulent according to the invention Coating material, for example, with a CS 200 device from Leco Instruments GmbH.
  • the weight ratio of the carbon atoms of the powdery coating material of the present invention is at most 15% by weight, preferably at most 10% by weight, more preferably at most 7% by weight, and still more preferably at most 5% by weight. is. In particular, it is with certain of the aforementioned
  • the carbon content is at most 4 wt .-%, preferably at most 3 wt .-%, more preferably at most 2 wt .-% and even more preferably at most 1 wt .-%.
  • the aforementioned wt .-% refer to the total weight of the inventive
  • the weight fraction of the carbon atoms of the powdery coating material of the invention from a range between 0.01 wt .-% and 15% by weight, preferably from a range between 0.05 wt .-% and 10 wt %, more preferably from a range between 0.1% and 7%, and even more preferably from 0.17% to 5% by weight.
  • the weight fraction of the carbon atoms of the powdery coating material according to the invention is in a range between 0.22% by weight and 4% by weight, preferably from 0.28% by weight 3 wt .-%, more preferably from a range between 0.34 wt .-% and 2 wt%, and even more preferably from a range between 0.4 wt .-% and 1 wt .-% is.
  • the aforementioned wt .-% refer to the total weight of the coating material of the invention and the
  • Carbon atoms preferably at least 7 carbon atoms, more preferably at least 8 carbon atoms, and even more preferably at least 9
  • the compounds employed as coating aids contain at least 10 carbon atoms, preferably at least 1 1 carbon atoms, more preferably at least 12 carbon atoms and even more preferably at least 13 carbon atoms.
  • the number of carbon atoms contained in the coating auxiliary according to the invention can be determined, for example, by determining the particular coating aid. In this case, all methods known to the person skilled in the art for determining a substance can be used.
  • Solvent be removed from the particles of the powder coating material and then identified by HPLC, GCMS, NMR, CHN or combinations of the aforementioned with each other or with other routinely used methods. In certain embodiments, it is preferred to apply only a small amount of coating aid to the surface of the particles in order to prevent excessive disruption of, for example, the plasma flame used for coating by generating large quantities of gas. For certain
  • the amount of the coating assistant is at most 80% by weight, preferably at most 70% by weight, more preferably at most 65% by weight, and still more preferably at most 62% by weight. In particular it is with certain of the
  • Coating aid not more than 59% by weight, preferably not more than 57% by weight, more preferably not more than 55% by weight and even more preferably not more than 53% Wt .-% is.
  • the aforesaid% by weight refers to the total weight of the coating material including the coating aid.
  • the amount of coating aid is at least 0.02 wt.%, Preferably at least 0.08 wt.%, More preferably at least 0.17 wt.%, And even more preferably at least 0.30 Wt .-% is.
  • the amount of coating aid be at least 0.35 weight percent, preferably at least 0.42 weight percent, more preferably at least 0.54 weight percent, and even more preferably at least zero , 62 wt .-% is.
  • the above% by weight refers to the total weight of the coating material including the
  • the weight proportion of the coating aid is in a range between 0.02% by weight and 80% by weight, preferably from 0.08% by weight to 70% by weight. more preferably from a range between 0.17 wt.% and 65 wt.% and even more preferably from a range between 0.30 wt.% and 62 wt.
  • the weight fraction of the carbon atoms of the powdery coating material according to the invention from a range between 0.35 wt .-% and 59 wt .-%, preferably from a range between 0.42 wt .-% and 57 wt .-%, more preferably from a range between 0.54 wt .-% and 55 wt .-% and even more preferably from a range between 0.62 wt .-% and 53 wt .-% is.
  • the aforementioned weight% refer to the total weight of the invention
  • Coating material including the coating aid.
  • Polymers e.g., polysaccharides, plastics
  • monomers silanes, waxes, oxidized waxes
  • carboxylic acids e.g., fatty acids
  • phosphonic acids e.g., phosphonic acids
  • derivatives of the foregoing especially carboxylic acid derivatives and phosphoric acid derivatives
  • polysaccharides, plastics, silanes, waxes, oxidized waxes especially polysaccharides, plastics, silanes, waxes, oxidized waxes,
  • Carboxylic acids e.g., fatty acids
  • carboxylic acid derivatives e.g., carboxylic acid derivatives
  • phosphonic acids e.g., carboxylic acid derivatives, phosphonic acids
  • Phosphoric acid derivatives or mixtures thereof preferably polysaccharides, silanes, waxes, oxidized waxes, carboxylic acids (e.g., fatty acids)
  • Phosphoric acid derivatives or mixtures thereof be used as a coating aid.
  • the aforementioned waxes include natural waxes as well as synthetic waxes.
  • waxes are paraffin waxes, petroleum waxes, montan waxes, animal waxes (e.g., beeswax, shellac, wool wax), vegetable waxes (e.g., carnauba wax, candelilla wax, rice wax),
  • Fatty acid amide waxes such as erucamide
  • polyolefin waxes e.g.
  • Polyethylene waxes polypropylene waxes
  • grafted polyolefin waxes grafted polyolefin waxes
  • Fischer-Tropsch waxes grafted polyolefin waxes
  • oxidized polyethylene waxes and modified polyethylene and polypropylene waxes eg, metallocene waxes.
  • the waxes of the invention are bound in certain preferred embodiments only via physical bonds. However, it is not excluded that the Waxes in other specific embodiments have functional groups that allow alternatively or additionally a chemical bond, in particular an ionic and / or covalent bond.
  • polymer within the meaning of the present invention also includes
  • polymers used according to the invention are preferably composed of at least 25 monomer units, more preferably of at least 35 monomer units, even more preferably of at least 45 monomer units and most preferably of at least 50 monomer units.
  • the polymers may in this case be bound to the particles of the powdery coating material without covalent or ionic bonding being formed.
  • Coating aid can form at least one ionic or covalent bond to the particles of the powdered coating material. Such bonding preferably takes place in certain of the abovementioned embodiments via a phosphoric acid, carboxylic acid, silane or sulfonic acid group contained in the polymer.
  • the term "polysaccharide" within the meaning of the present invention also includes oligosaccharides. However, in certain preferred embodiments, the polysaccharides used in the present invention are preferably composed of at least 4 monomer units, more preferably at least 8 monomer units, even more preferably at least 10 monomer units, and most preferably at least 12 monomer units. For certain
  • Embodiments particularly preferred polysaccharides are cellulose, cellulose derivatives such as methylcellulose, ethylcellulose, carboxymethylcellulose, hydroxyethylcellulose, hydroxypropylmethylcellulose, nitrocellulose (eg Ethocel, or Methocel from Dow Wolff cellulosics), cellulose esters (eg Cellulose acetate, cellulose acetobutyrate, and cellulose propionate), starch such as corn starch, potato starch and wheat starch, and modified starches.
  • cellulose cellulose derivatives such as methylcellulose, ethylcellulose, carboxymethylcellulose, hydroxyethylcellulose, hydroxypropylmethylcellulose, nitrocellulose (eg Ethocel, or Methocel from Dow Wolff cellulosics), cellulose esters (eg Cellulose acetate, cellulose acetobutyrate, and cellulose propionate), starch such as corn starch, potato starch and wheat starch, and modified starches.
  • plastic in the sense of the present invention comprises
  • thermoplastic, thermosetting or elastomeric plastics Due to the possibility of specifically adapting the properties of the plastics, it is preferred in certain embodiments that the additive is a plastic.
  • the plastic used according to the invention is therefore an elastomer or thermoset, preferably a thermoset.
  • a particularly simple application of the plastic may be in the foreground, for example by means of mechanical forces, and the use of
  • the plastic used according to the invention is therefore a thermoplastic.
  • Distinguish boiling temperature are known in the art and can be found for example in the plastic paperback, Hrsg. Saechtling., 25th edition, Hanser Verlag, Kunststoff, 1992, and references cited therein, and in the Plastics Handbook, ed. G. Becker and D. Braun, Volumes 1 to 1 1, Hanser Verlag, Kunststoff, 1966 to 1996. Without being limited to this, are intended to
  • PC Polycarbonates
  • polyoxyalkylenes polyoxyalkylenes
  • polyolefins such as polyethylene
  • Polypropylene PP
  • polyarylene ethers such as polyphenylene ether (PPE), polysulfones, polyurethanes, polylactides, polyamides, vinylaromatic (co) polymers such as polystyrene, impact-modified polystyrene (such as HI-PS) or ASA, ABS or AES polymers, halogen-containing polymers, Polyester like
  • PBT Polybutylene terephthalate
  • PET polyethylene terephthalate
  • imide group-containing polymers cellulose esters, poly (meth) acrylates, silicone Polymers and thermoplastic elastomers. It is also possible to use mixtures of different plastics, in particular different thermoplastics, in the form of single- or multi-phase polymer blends. In certain embodiments, it is preferred that the
  • Coating process is not a non-thermal plasma spray if the additive is a plastic, especially if the additive is a thermoset or elastoplastic. In particular, it is with certain of the aforementioned
  • Non-thermal plasma spraying is when the additive is a thermoset.
  • the poly (meth) acrylates used according to the invention can be present as homopolymers or as block polymers.
  • Examples are polymethyl methacrylate (PMMA) and copolymers based on methyl methacrylate with up to 40% by weight of further copolymerizable monomers, e.g. n-butyl acrylate, t-butyl acrylate or 2-ethylhexyl acrylate.
  • Plastic layers particularly preferred in certain embodiments are synthetic resin layers of organofunctional silane and acrylate and / or methacrylate compound (s).
  • Such coatings according to the invention of the particles of the powdery coating material show, in addition to
  • the aforementioned synthetic resin layer may be relatively thin.
  • it may have an average layer thickness in a range of 10 nm to 300 nm, preferably 15 nm to 220 nm.
  • the average layer thickness is in a range of 25 to 170 nm, more preferably in a range from 35 to 145 nm.
  • the average layer thickness is determined by measuring the layer thicknesses of at least 30 randomly selected particles by means of SEM.
  • the organofunctional silane is present in the polyacrylate and / or polymethacrylate and / or is polymerized in.
  • Plastic layer in particular the synthetic resin layer, no inorganic network.
  • a pure and homogeneous plastic coating and in particular a pure and homogeneous resin coating has been found to be sufficient under the expected conditions of storage, preparation, etc., an application in one
  • the aforementioned organofunctional silane contained in a synthetic resin layer has at least one functional group which may be chemically reacted with an acrylate group and / or methacrylate group of the polyacrylate and / or polymethacrylate.
  • Free-radically polymerizable organic functional groups have proven to be very suitable.
  • the at least one functional group is selected from the group consisting of acrylic, methacrylic, vinyl, allyl, ethynyl and other organic groups having unsaturated functions.
  • the organofunctional silane has at least one acrylate and / or methacrylate group, since this with the to produce the polyacrylate and / or polymethacrylate used acrylate or methacrylate compounds without any problems to form a
  • the organofunctional silane may be present as a monomer or as a polymer. It is essential that the monomeric or polymeric, organofunctional silane has at least one functional group which allows a chemical reaction with an acrylate and / or methacrylate group. It can also be mixtures of
  • organofunctional silane is completely chemically reacted with the polyacrylate and / or polymethacrylate.
  • organofunctional silane and polyacrylate and / or polymethacrylate can only be partially carried out, so that, for example, only 30% or 40% of the present organofunctional silane, based on the total weight of organofunctional silane, are reacted with polyacrylate and / or polymethacrylate.
  • At least 60%, more preferably at least 70%, even more preferably at least 80% of the present organofunctional silane, in each case based on the total weight of the organofunctional silane, are reacted with polyacrylate and / or polymethacrylate.
  • at least 90% or at least 95% of the organofunctional silane are preferably present in a form reacted with polyacrylate and / or polymethacrylate.
  • Polymethacrylate with or composed of compounds with multiple acrylate and / or methacrylate groups It has come in certain embodiments proven particularly advantageous if the acrylate and / or methacrylate starting compounds used two or more acrylate and / or
  • the abovementioned synthetic resin coatings according to the invention may contain, in addition to the abovementioned acrylate and / or methacrylate compounds, further monomers and / or polymers.
  • the proportion of acrylate and / or methacrylate compounds including organofunctional silane at least 70 wt .-%, more preferably at least 80 wt .-%, even more preferably at least 90 wt .-%, each based on the total weight of the resin coating.
  • organofunctional silane at least 70 wt .-%, more preferably at least 80 wt .-%, even more preferably at least 90 wt .-%, each based on the total weight of the resin coating.
  • the proportion of acrylate and / or methacrylate compounds including organofunctional silane at least 70 wt .-%, more preferably at least 80 wt .-%, even more preferably at least 90 wt .-%, each based on the total weight of
  • Synthetic resin coating exclusively from acrylate and / or
  • Colored pigments, dyes, UV stabilizers, etc. or mixtures thereof may be included in the resin coating.
  • synthetic resin layers according to the invention having a plurality of acrylate groups and / or methacrylate groups each have at least three acrylate and / or methacrylate groups. With further preference these starting compounds may each also have four or five acrylate and / or methacrylate groups.
  • multi-functional acrylates and / or methacrylates are used for the production of the synthetic resin layer according to the invention.
  • the synthetic resin layers according to the invention in which 2 to 4 acrylate and / or methacrylate groups are contained per acrylate and / or methacrylate starting compound, surprisingly have an extraordinary tightness and strength, without being brittle.
  • 3 acrylate and / or methacrylate groups per acrylate and / or methacrylate starting compound proved.
  • Such optimized properties have proven to be particularly advantageous for providing a synthetic resin coating which is also suitable for conveying processes in which the particles are passed through pipelines, for example in the form of an aerosol, and in which a multiple impact of the individual particles on the conduit walls occurs.
  • the weight ratio of polyacrylate and / or polymethacrylate is particularly preferred that the weight ratio of polyacrylate and / or polymethacrylate to
  • organofunctional silane is 10: 1 to 0.5: 1. Further preferred is the weight ratio of polyacrylate and / or polymethacrylate
  • organofunctional silane in a range of 7: 1 to 1: 1.
  • difunctional acrylates examples include: allyl methacrylate, bisphenol A dimethacrylate, 1,3-butanediol dimethacrylate, 1,4-butanediol dimethacrylate,
  • Triethylene glycol dimethacrylate or mixtures thereof Triethylene glycol dimethacrylate or mixtures thereof.
  • Pentaerythritol triacrylate trimethylolpropane triacrylate
  • Trimethylolpropane trimethacrylate tris (2-hydroxyethyl) isocyanurate triacrylate, Pentaerythritol tetraacrylate, dipentaerythritol pentaacrylate, or mixtures thereof.
  • organofunctional silanes according to the invention for example, organofunctional silanes according to the invention
  • acrylate and / or methacrylate-functional silanes are particularly preferred.
  • 2-methacryloxyethyltrimethoxysilane, 2-methacryloxyethyltriethoxysilane, 3-methacryloxypropyltriethoxysilane, 3-methacryloxypropyltrimethoxysilane, (methacryloxymethyl) methyldimethoxysilane, vinyltrimethoxysilane or mixtures thereof have been found to be particularly suitable
  • organofunctional silanes proved.
  • Combustion flame or plasma flame such a coating so far is removed or at least relaxed, that the material used for the coating is not present as an impurity in the coating or at least present in such a small amount that there is no significant impairment of the properties of the coating produced by the coating process.
  • the material used for the coating is not present as an impurity in the coating or at least present in such a small amount that there is no significant impairment of the properties of the coating produced by the coating process.
  • the layer thickness and the composition of the synthetic resin layer are selected such that no detectable residues of the synthetic resin layer are contained in the coating produced during the coating process.
  • the other plastics mentioned above by way of example are known to the person skilled in the art and can be selected based on the invention disclosed herein in order to provide the effect according to the invention.
  • polycarbonates examples include DE 1 300 266 B1 (interfacial polycondensation) or DE 14 95 730 A1 (reaction of biphenyl carbonate with bisphenols).
  • the polymer backbone has at least 50 mole percent recurring units -CH 2 O-.
  • a particular example of this plastic group is (co) polyoxymethylene (POM).
  • Production of the homopolymers can be carried out, for example, by polymerization of formaldehyde or trioxane, preferably catalytically.
  • polystyrene resin examples include polyethylene and polypropylene and copolymers based on ethylene or propylene, optionally also with higher ⁇ -olefins.
  • polyolefin in the context of the present invention also includes, in particular, ethylene-propylene elastomers and ethylene-propylene terpolymers.
  • polyarylene ethers examples include polyarylene ethers themselves,
  • arylene groups may be, for example, an aromatic radical having 6 to 18 carbon atoms.
  • Exemplary arylene radicals are phenylene, bisphenylene, terphenylene, 1, 5-naphthylene, 1, 6-naphthylene, 1, 5-anthrylene, 9,10-anthrylene or 2,6-anthrylene. Specific information regarding the production of
  • Polyarylene ether sulfones can be found for example in EP 1 13 1 12 A1 and EP 135 130 A2.
  • particularly preferred polylactides are co-or block copolymers based on lactic acid and others
  • polyamides within the meaning of the present invention comprises
  • polyetheramides such as polyether block amides, polycaprolactams, polycapryllactams, polylaurolactams and polyamides which are obtained by reacting dicarboxylic acids with diamines. Disclosures concerning the preparation of polyetheramides can be found, for example, in US 2,071,250, US 2,071,251, US 2,130,523, US 2,130,948, US 2,241,322, US 2,312,966, US 2,512,606 and US 3,393,210.
  • Dicarboxylic acids which can be reacted with the abovementioned diamines are, for example, alkanedicarboxylic acids having 6 to 12, in particular 6 to 10, carbon atoms and aromatic
  • Dicarboxylic acids are, for example, alkanediamines having 6 to 12, in particular 6 to 8, carbon atoms and also m-xylylenediamine, di (4-aminophenyl) methane, di (4-aminocyclohexyl) methane, 2,2-di- (4-aminophenyl) Propane or 2,2-di (4-aminocyclohexyl) propane.
  • halogen-containing polymers are polymers of vinyl chloride, in particular polyvinyl chloride (PVC) such as rigid PVC and plasticized PVC, and
  • Copolymers of vinyl chloride such as PVC-U molding compounds.
  • polyester plastics which can be selected according to the invention are also known per se and described in the literature.
  • the polyesters can be prepared by reacting aromatic dicarboxylic acids, their esters or other ester-forming derivatives thereof with aliphatic dihydroxy compounds in a manner known per se.
  • the dicarboxylic acids used are naphthalenedicarboxylic acid, terephthalic acid and isophthalic acid or mixtures thereof.
  • Up to 10 mol% of the aromatic dicarboxylic acids can be replaced by aliphatic or cycloaliphatic dicarboxylic acids such as adipic acid, azelaic acid, sebacic acid, dodecanedioic acids and cyclohexanedicarboxylic acids. Examples of aliphatic
  • Dihydroxy compounds are diols having 2 to 6 carbon atoms, in particular 1,2-ethanediol, 1,4-butanediol, 1,6-hexanediol, 1,4-hexanediol, 1,4-cyclohexanediol and neopentyl glycol or mixtures thereof.
  • the imide group-containing polymers are polyimides, polyetherimides, and polyamide-imides. Such polymers are described, for example, in Römpp Chemie Lexikon, CD-ROM Version 1 .0, Thieme Verlag Stuttgart 1995.
  • fluorine-containing polymers such as polytetrafluoroethylene (PTFE), tetrafluoroethylene-perfluoropropylene copolymers (FEP), copolymers of the Tetrafluoroethylene with perfluoroalkyl vinyl ether, ethylene-tetrafluoroethylene copolymers (ETFE) polyvinylidene fluoride (PVDF), polyvinyl fluoride (PVF),
  • PTFE polytetrafluoroethylene
  • FEP tetrafluoroethylene-perfluoropropylene copolymers
  • ETFE ethylene-tetrafluoroethylene copolymers
  • PVDF polyvinylidene fluoride
  • PVF polyvinyl fluoride
  • PCTFE Polychlorotrifluoroethylene
  • ECTFE ethylene-chlorotrifluoroethylene copolymers
  • thermoplastic elastomers TPE
  • thermoplastics characterized in that they can be processed like thermoplastics, but have rubber-elastic properties. Further information can be found, for example, in G. Holden et al., Thermoplastic Elastomers, 2nd edition, Hanser Verlag, Kunststoff 1996.
  • thermoplastic polyurethane elastomers TPE-U or TPU
  • styrene-oligoblock copolymers TPE-S
  • SBS Styrene-butadiene-styrene-oxyBiocopolymer
  • SEES styrene-ethylene-butylene-styrene block copolymer obtainable by hydrogenating SBS
  • thermoplastic polyolefin elastomers TPE-O
  • thermoplastic polyester elastomers TPE-E
  • thermoplastic polyamide elastomers TPE-A
  • thermoplastic vulcanizates TPE-V
  • Coating adjuvants have a molecular weight of at most 200,000, preferably of at most 170,000, more preferably of at most 150,000 and even more preferably at most 130,000.
  • the compounds used as coating aids have a molecular weight of at most 1 10 000, preferably of at most 90 000, more preferably of at most 70 000 and even more preferably of at most 50 000.
  • Dicarboxylic acids Dicarboxylic acids, tricarboxylic acids and tetracarboxylic acids.
  • Examples of Dicarboxylic acids are succinic acid, glutaric acid, adipic acid, pimelic acid, suberic acid, azelaic acid and sebacic acid.
  • Carboxylic acid derivatives in particular aligned to carboxylic acid ester.
  • Examples of the aforementioned fatty acids are capric acid, undecanoic acid,
  • Lauric acid tridecanoic acid, myristic acid, pentadecanoic acid, palmitic acid, margaric acid, nonadecanoic acid, arachic acid, behenic acid, lignoceric acid, cerotic acid, melissic acid, undecylenic acid, palmitoleic acid, elaidic acid, vaccenic acid, icosenoic acid, cetoleic acid, erucic acid, nervonic acid,
  • the coating aids include no stearic and oleic acids, preferably no saturated and unsaturated C 18 carboxylic acids, more preferably no saturated and unsaturated C 14 to C 18 carboxylic acids, even more preferably no saturated and unsaturated C 12 to C 18 carboxylic acids and most preferably no saturated and unsaturated C10 to C20 carboxylic acids.
  • C followed by a number in the context of the present invention refers to those in a molecule or
  • Heterocycloalkyl groups C3-C30 heterocycloalkylalkyl groups, C1-C30
  • Arylalkylether phenomenon where the abovementioned groups may be substituted or unsubstituted and optionally straight-chain or branched.
  • substituted in the context of the present invention describes that at least one hydrogen atom of the group in question by a halogen, hydroxy, cyano, C1-C8 alkyl, C2-C8 alkenyl, C2-C8 alkynyl, C1-C5 alkanoyl , C3-C8 cycloalkyl, heterocyclic, aryl, heteroaryl, C1-C7 alkylcarbonyl, C1-C7 alkoxy, C2-C7 alkenyloxy, C2-C7 alkynyloxy, aryloxy, acyl, C1-C7 acryloxy, C1 -C7 methacryloxy, C1-C7 epoxy, C1-C7 vinyl, C1-C5 alkoxycarbonyl, aroyl, aminocarbonyl, alkylaminocarbonyl, dialkylaminocarbonyl, aminarbonyloxy, C1-C7 alkylaminocarbonyloxy,
  • Alkanoylamine C1-C7 alkoxycarbonylamine, C1-C7 alkylsulfonylamine,
  • Nitrogen atoms optionally independently of one another monosubstituted or disubstituted by C 1 -C 5 alkyl or aryl groups; or C1-C5 alkylthio group.
  • cycloalkyl group and heterocycloalkyl group in the context of the present invention include saturated, partially saturated and unsaturated systems, with the exception of aromatic systems which are referred to as "aryl groups" or
  • alkyl in the context of the present invention is, unless stated otherwise, preferably straight or branched C1 to C27, more preferably straight or branched C1 to C25 and even more preferably straight or branched C1 to C20 carbon chains.
  • alkenyl and alkynyl in the context of the present invention are, unless stated otherwise, preferably straight or branched C2 to C27, more preferably straight or branched C2 to C25 and even more preferably straight or branched C2 to C20 carbon chains .
  • aryl in the context of the present invention stands for aromatic carbon rings, preferably for aromatic
  • aryl groups are phenyl, hydroxyphenyl, biphenyl and naphthyl.
  • heteroaryl in the context of the present invention stands for aromatic rings in which formally a carbon atom of an analogous aryl ring has been replaced by a heteroatom, preferably against an atom selected from the group consisting of O, S and N.
  • silanes are characterized by a structure of the formula (II):
  • Alkyl groups C2-C30 alkenyl groups, C2-C30 alkynyl groups, C5-C30
  • Cycloalkylalkyl groups C2-C30 heterocycloalkyl groups, C3-C30
  • Heterocycloalkylalkyl groups C1-C30 ester groups, C1-C30 alkyl ether groups, C1-C30 cycloalkyl ether groups, C1-C30 cycloalkenyl ether groups, C6-C30 aryl ether groups, C7-C30 arylalkyl ether groups, where the abovementioned groups may be substituted or unsubstituted and optionally straight-chain or branched.
  • the coating aid may, for example, be chemically or physically bound to the surface of the particles of the powdery coating material. In this case, it is not necessary for a complete surface coverage of the particles to take place, although this is preferred in certain embodiments of the present invention. In certain embodiments, it is preferred that the
  • Coating aids are as easily as possible bound to the surface of the particles of the powder coating material.
  • Coating aids used according to the invention do not carry a functional group.
  • the term "functional group” in the sense of the present invention denotes molecular groups in molecules that significantly influence the material properties and the reaction behavior of the molecules. Examples of such functional groups are: carboxylic acid groups, sulfonic acid groups,
  • the coating aids for example due to friction, can not be too easily removed from the surface.
  • the coating auxiliaries used according to the invention carry at least one functional group, preferably at least two functional groups, more preferably at least three functional groups.
  • Substrate surface impact and the existing kinetic energy can be fully used for deformation of the particle. In the case of one
  • Uneven, ie localized, application of agglomerates may be a part of the kinetic energy by breaking up the agglomerates
  • Coating materials also used for the production of homogeneous layers when the melting point of the coating material measured in [K] is up to 50%, preferably up to 60%, more preferably up to 65% and even more preferably up to 70% of the temperature of the coating material measured in [K] is up to 50%, preferably up to 60%, more preferably up to 65% and even more preferably up to 70% of the temperature of the coating material measured in [K] is up to 50%, preferably up to 60%, more preferably up to 65% and even more preferably up to 70% of the temperature of the
  • Coating applied to the substrate directed medium such as the gas stream, the combustion flame and / or the
  • pulverulent coating materials coated with at least one coating aid may also be used to produce homogeneous layers if the melting point of the coating material measured in [K] is up to 75%, preferably up to 80%, more preferably up to 85%. and even more preferably up to 90% of that measured in [K]
  • Temperature of the medium used in the coating method directed to the substrate for example, the gas stream, the combustion flame and / or the plasma flame is.
  • the abovementioned percentages refer to the ratio of the melting temperature of the coating material to the temperature of the gas stream in cold gas spraying, the combustion flame in flame spraying and high-speed flame spraying or the plasma flame in non-thermal or thermal plasma spraying in [K].
  • the coating thus obtained has only a few free, preferably no, particle or
  • the aforementioned homogeneous layers are characterized in that the layers produced have less than 10%, preferably less than 5%, more preferably less than 3%, even more preferably less than 1% and most preferably less than 0.1% voids , In particular, it is preferred that no cavities are to be recognized.
  • the aforementioned term "cavity" in the sense of the present invention describes the proportion of the gaps enclosed in the coating on the
  • Two-dimensional surface of a transverse section of the coated substrate based on the coating contained in the two-dimensional surface.
  • a determination of this proportion takes place by means of REM at 30 randomly selected Placing the coating, wherein, for example, a length of 100 ⁇ the Substratbesch direction is considered.
  • the determination of the size distribution of the particles is preferably carried out by means of laser granulometry.
  • the particles can be measured in the form of a powder.
  • the scattering of the irradiated laser light is in
  • the particles are treated mathematically as spheres.
  • the determined diameters always relate to the equivalent spherical diameter determined over all spatial directions, irrespective of the actual shape of the particles. It determines the size distribution, which is calculated in the form of a volume average, based on the equivalent spherical diameter. This volume-averaged size distribution can be considered
  • Sum frequency distribution is simplified characterized by various characteristics, for example, the Di 0 , D 5 o or D 90 value.
  • the measurements can be carried out, for example, using the particle size analyzer HELOS from Sympatec GmbH, Clausthal-Zellerfeld, Germany.
  • the dispersion of a dry powder can take place here with a dispersion unit of the Rodos T4.1 type at a primary pressure of, for example, 4 bar.
  • size distribution curve of the particles for example, with a device from. Quantachrome (device: Cilas 1064) according to the manufacturer be measured. For this purpose, 1, 5 g of powdered
  • Coating material suspended in about 100 ml of isopropanol, 300 seconds in an ultrasonic bath (device: Sonorex IK 52, Fa. Bandelin) treated and then added using a Pasteur pipette in the sample preparation cell of the meter and measured several times. From the individual measurement results, the resulting averages are formed.
  • the evaluation of the scattered light signals is carried out according to the Fraunhofer method.
  • the powdered coating material has a particle size distribution with a D 50 -
  • the powdery coating material is a
  • Particle size at which 50% of the above-mentioned particle size distribution by means of laser granulometry is below the stated value The measurements may, for example, according to the aforementioned
  • the powdery coating material has a particle size distribution with a D 50 value of at least 1.5 ⁇ , preferably at least 2 ⁇ , more preferably at least 4 ⁇ and even more preferably at least 6 ⁇ .
  • a D 50 value of at least 1.5 ⁇ , preferably at least 2 ⁇ , more preferably at least 4 ⁇ and even more preferably at least 6 ⁇ .
  • the powder has a particle size distribution with a D 50 value from a range of 1.5 to 53 ⁇ m, preferably from a range from 2 to 51 ⁇ m, more preferably from a range from 4 to 50 ⁇ m and more preferably from a range of 6 to 49 ⁇ .
  • a D 50 value from a range of 1.5 to 53 ⁇ m, preferably from a range from 2 to 51 ⁇ m, more preferably from a range from 4 to 50 ⁇ m and more preferably from a range of 6 to 49 ⁇ .
  • the powder has a particle size distribution with a D 50 value from a range of 7 to 48 ⁇ , preferably from a range of 9 to 47 ⁇ , more preferably from a range of 1 1 to 46 ⁇ and even more preferably from a Range of 13 to 45 ⁇ has.
  • the powder has a particle size distribution with a D 50 value from a range of 1.5 to 45 ⁇ m, preferably from a range of 2 to 43 ⁇ m, more preferably from a range of 2.5 to 41 ⁇ and more preferably from a range of 3 to 40 ⁇ .
  • a D 50 value from a range of 1.5 to 45 ⁇ m, preferably from a range of 2 to 43 ⁇ m, more preferably from a range of 2.5 to 41 ⁇ and more preferably from a range of 3 to 40 ⁇ .
  • the powder has a particle size distribution with a D 50 value from a range of 3.5 to 38 ⁇ , preferably from a range of 4 to 36 ⁇ , more preferably from a range of 4.5 to 34 ⁇ and even more preferably from a range of 5 to 32 ⁇ .
  • the powder has a particle size distribution with a D 50 value from a range of 9 to 53 ⁇ , preferably from a range of 12 to 51 ⁇ , more preferably from a range of 15 to 50 ⁇ , more preferably one Range of 17 to 49 ⁇ has.
  • the powder is a
  • Grain size distribution with a D 50 value from a range of 19 to 48 ⁇ , preferably from a range of 21 to 47 ⁇ , more preferably from a range of 23 to 46 ⁇ and even more preferably from a range of 25 to 45 ⁇ .
  • the powdery coating material has a particle size distribution with a Dgo value of at most 103 ⁇ , preferably at most 99 ⁇ , more preferably at most 95 ⁇ , more preferably at most 91 ⁇ and most preferably at most 87 ⁇ having.
  • the powdery coating material has a particle size distribution with a Dgo value of at most 103 ⁇ , preferably at most 99 ⁇ , more preferably at most 95 ⁇ , more preferably at most 91 ⁇ and most preferably at most 87 ⁇ having.
  • the powdery coating material has a particle size distribution with a Dgo value of at most 103 ⁇ , preferably at most 99 ⁇ , more preferably at most 95 ⁇ , more preferably at most 91 ⁇ and most preferably at most 87 ⁇ having.
  • the powdery coating material has a particle size distribution with a Dgo value of at most 103 ⁇ , preferably at most 99 ⁇ , more preferably at most 95 ⁇ , more preferably at most 91 ⁇ and most preferably at most 87
  • Coating material has a D 90 value of at most 83 ⁇ , preferably at most 79 ⁇ , more preferably at most 75 ⁇ and even more preferably at most 71 ⁇ .
  • Particle size at which 90% of the above-mentioned particle size distribution by means of laser granulometry is below the stated value The measurements may, for example, according to the aforementioned
  • powdery coating material having a Dgo- value of at least 9 ⁇ , preferably at least 1 1 ⁇ , more preferably at least 13 ⁇ and even more preferably at least 15 ⁇ .
  • the powdery coating material is a
  • the powdery coating materials have a particle size distribution with a D 90 value from a range of 42 to 103 ⁇ , preferably from a range of 45 to 99 ⁇ , more preferably from a range of 48 to 95 ⁇ and even more preferably a range of 50 to 91 ⁇ .
  • a D 90 value from a range of 42 to 103 ⁇ , preferably from a range of 45 to 99 ⁇ , more preferably from a range of 48 to 95 ⁇ and even more preferably a range of 50 to 91 ⁇ .
  • powdery coating material a D 90 value from a range of 52 to 87 ⁇ , preferably from a range of 54 to 81 ⁇ , more preferably from a range of 56 to 75 ⁇ and even more preferably from a range of 57 to 71 ⁇ .
  • the powdery coating material has a particle size distribution with a Di 0 value of at most 5 ⁇ m, preferably at most 4 ⁇ m, more preferably at most 3 ⁇ m, and even more preferably at most 2.5 ⁇ m.
  • the powdery coating material is a
  • the powdery coating material according to the invention it is therefore preferable for the powdery coating material according to the invention to have a
  • the powdery coating material according to the invention has a particle size distribution with a Di 0 value of at least 0.7 ⁇ m, preferably 0.8 ⁇ m, more preferably 0.9 ⁇ m and even more preferably at least 1.0 ⁇ m.
  • the powdery coating material according to the invention is characterized in that it has a particle size distribution with a Di 0 value from a range of at least 0.2 to 5 ⁇ m, preferably at least 0.4 to 4 ⁇ m, more preferably from a range of 0 , 5 to 3 ⁇ , and more preferably from a range of 0.6 to 2.5 ⁇ have.
  • a Di 0 value from a range of at least 0.2 to 5 ⁇ m, preferably at least 0.4 to 4 ⁇ m, more preferably from a range of 0 , 5 to 3 ⁇ , and more preferably from a range of 0.6 to 2.5 ⁇ have.
  • Coating material a particle size distribution with a Di 0 value from a range of 0.7 to 2.2 ⁇ , preferably from a range of 0.8 to 2.1 ⁇ , more preferably from a range of 0.9 to 2.0 ⁇ and even more preferably from a range of 1, 0 to 1, 9 ⁇
  • the powdered coating material has a particle size distribution with a Di 0 value of 3.7 to 26 ⁇ m, a D 50 value of 6 to 49 ⁇ m, and a Dco value of 12 to 86 ⁇ m having.
  • Coating material has a particle size distribution with a Di 0 value of 5.8 to 26 ⁇ , a D 50 value of 1 1 to 46 ⁇ and a D 90 value of 16 to 83 ⁇ . In certain of the aforementioned embodiments, it is even more preferable that the powdery coating material has a
  • the powdery coating material has a particle size distribution with a Di 0 value of 0.8 to 28 ⁇ m, a D 50 value of 1.5 to 45 ⁇ m and a Dco value of 2.5 to 81 ⁇ has.
  • Coating material has a particle size distribution with a Di 0 value of 2.2 to 22 ⁇ , a D 50 value of 4 to 36 ⁇ and a D 90 value of 4 to 62 ⁇ . In certain of the aforementioned embodiments, it is even more preferable that the powdery coating material has a
  • Grain size distribution with a Di 0 value of 2.8 to 17 ⁇ , a D 50 value of 6 to 28 ⁇ and a D 90 value of 9 to 49 ⁇ has.
  • Di 0 value of 4.8 to 29 ⁇ m a D 50 value of 9 to 53 ⁇ m
  • Dco value of 13 to 97 ⁇ m For certain of the above
  • Coating material has a particle size distribution with a Di 0 value of 12 to 26 ⁇ , a D 50 value of 23 to 46 ⁇ and a D 90 value of 35 to 87 ⁇ has. In certain of the aforementioned embodiments, it is even more preferable that the powdery coating material has a
  • the inventors have found that by using a powdered coating material having a lower chip, in certain embodiments, for example, an even more uniform capability of the pulverulent coating material is achieved, whereby the formation of a more homogeneous and higher quality layer is further simplified.
  • the span of the powdered coating material is at most 2.9, preferably at most 2.6, more preferably at most 2.4 and even more preferably at most 2.1.
  • the span of the powdered coating material is at most 1, 9, preferably at most 1, 8, more preferably at most 1, 7 and even more preferably at most 1, 6.
  • the span of the powdered coating material is at least 0.4, preferably at least 0.5, more preferably at least 0.6, and even more preferably at least 0.7.
  • the span of the powdered coating material is at least 0.8, preferably at least 0.9, more preferably at least 1.0, and even more preferably at least 1.1.
  • the powdered coating material may have a span value in the range of 0.4 to 2.9, preferably in the range of 0.5 to 2.6, more preferably in the range of 0.6 to 2.4, and more preferably from a range of 0.7 to 2.1.
  • the powdered coating material it is with certain of the aforementioned
  • the powdery coating material has a span value from a range of 0.8 to 1, 9, preferably from a range of 0.9 to 1, 8, more preferably from a range of 1, 0 to 1, 7 and even more preferably from a range of 1.1 to 1.6.
  • Coating material in certain preferred embodiments, a particle size distribution with a span from a range of 0.4 to 2.9 and a D 50 value from a range of 1, 5 to 53 ⁇ , preferably from a range of 2 to 51 ⁇ , more preferably from a range of 4 to 50 ⁇ , even more preferably from a range of 6 to 49 ⁇ and most preferably from a range of 7 to 48 ⁇ .
  • Coating material having a particle size distribution with a span of from 0.5 to 2.6 and a D 50 value from a range of 1, 5 to 53 ⁇ , preferably from a range of 2 to 51 ⁇ , more preferably from a range of 4 to 50 ⁇ , more preferably from a range of 6 to 49 ⁇ and most preferably from a range of 7 to 48 ⁇ on.
  • the powdered coating material has a particle size distribution with a span of from 0.6 to 2.4 and a D 50 value from a range of 1.5 to 53 ⁇ m, preferably from a range of 2 to 51 ⁇ , more preferably from a range of 4 to 50 ⁇ , even more preferably from a range of 6 to 49 ⁇ and most preferably from a range of 7 to 48 ⁇ on.
  • the powdered coating material has a particle size distribution with a chip of a
  • Range of 0.7 to 2.1 and a D 50 value from a range of 1, 5 to 53 ⁇ , preferably from a range of 2 to 51 ⁇ , more preferably from a range of 4 to 50 ⁇ , even more preferably from a range of 6 to 49 ⁇ , and most preferably from a range of 7 to 48 ⁇ .
  • Span 0 K is the corrected upper span value
  • Span 0 is the upper span value
  • p A is the density of aluminum (2.7 g / cm 3 )
  • px is the density of the
  • Coating materials having a density less than the density of aluminum are therefore used with an uncorrected upper span powdery coating material.
  • Coating processes which can be used according to the invention are known to the person skilled in the art under the name of cold gas spraying, thermal plasma spraying, non-thermal plasma spraying, flame spraying and high-speed flame spraying.
  • the cold gas spraying is characterized in that the powder to be applied is not melted in the gas jet, but that the particles are greatly accelerated and form a coating on the surface of the substrate due to their kinetic energy.
  • a carrier gas such as nitrogen, helium, argon, air, krypton, neon, xenon, carbon dioxide, oxygen or mixtures thereof.
  • the gas used is air, helium or mixtures thereof.
  • cold gas spraying it is preferred that they have particles, for example, speeds between 300 m / s and 1600 m / s, preferably between 1000 m / s and 1600 m / s, more preferably between 1250 m / s and 1600 m / s to reach.
  • particles for example, speeds between 300 m / s and 1600 m / s, preferably between 1000 m / s and 1600 m / s, more preferably between 1250 m / s and 1600 m / s to reach.
  • a disadvantage for example, the large noise, which is caused by the high speeds of the gas streams used.
  • a powder is converted into the liquid or plastic state by means of a flame and then applied as a coating to a substrate.
  • a substrate e.g. a mixture of oxygen and a combustible gas such as acetylene or hydrogen burned.
  • Variants of flame spraying use part of the oxygen to convey the powdery coating material into the combustion flame.
  • the particles reach in conventional variants of this method
  • high-speed flame spraying converts a powder into a liquid or plastic state by means of a flame.
  • the particles are accelerated significantly faster compared to the aforementioned method.
  • a velocity of the gas stream of 1220 to 1525 m / s is called with a velocity of the particles of about 550 to 795 m / s.
  • gas velocities of over 2000 m / s are achieved.
  • the speed of Flannnne between 1000 and 2500 m / s.
  • the flame temperature is between 2200 ° C and 3000 ° C.
  • the temperature of the flame is thus comparable to the temperature during flame spraying. This is achieved by combustion of the gases under a pressure of about 515 to 621 kPa followed by the expansion of the combustion gases in a nozzle. Generally, it is believed that coatings produced thereby have a higher density compared to, for example, coatings obtained by the flame spraying process.
  • the detonation / explosive flame spraying can be classified as subspecies of the
  • the powdery coating material is greatly accelerated by repeated detonations of a gas mixture such as acetylene / oxygen, for example, particle velocities of about 730 m / s are achieved.
  • Detonation frequency of the method is in this case, for example, between about 4 to 10 Hz. In variants such as the so-called high frequency gas detonation spraying but also detonation frequencies are selected by about 100 Hz.
  • the resulting layers should usually have a particularly high hardness, strength, density and good bonding to the substrate surface.
  • a primary gas such as argon is passed through a DC arc furnace at a rate of 40 l / min and a secondary gas such as hydrogen at a rate of 2.5 l / min, thereby generating a thermal plasma.
  • a secondary gas such as hydrogen
  • the delivery rate of the powder coating material is between 5 g / min and 60 g / min, more preferably between 10 g / min and 40 g / min.
  • argon, helium or mixtures thereof as ionizable gas.
  • the total gas flow is also preferably 30 to 150 SLPM (standard liters per minute) for certain variants.
  • the electrical power used for the ionization of the gas flow without the heat energy dissipated as a result of cooling can be selected, for example, between 5 and 100 kW, preferably between 40 and 80 kW.
  • plasma temperatures between 4000 and a few 10000 K can be achieved.
  • a non-thermal plasma is used to activate the powdered coating material.
  • the plasma used here is, for example, with a barrier discharge or
  • the temperature of the plasma here is preferably less than 3000 K, preferably less than 2500 K and even more preferably less than 2000 K. This minimizes the technical complexity and keeps the energy input in the applied
  • Coating material as low as possible, which in turn is a gentle
  • the magnitude of the temperature of the plasma flame is thus preferably comparable to that in flame spraying or high-speed flame spraying.
  • non-thermal plasmas can also be produced whose core temperature is below 1 173 K or even below 773 K in the core area.
  • Such non-thermal plasmas are particularly suitable for coatings of very temperature-sensitive substrates.
  • the outlet opening of the plasma flame in such a way that the web widths of the coatings produced are between 0.2 mm and 10 mm.
  • This allows a very accurate, flexible, energy-efficient coating with the best possible utilization of the coating material used.
  • a distance of the spray lance to the substrate for example, a distance of 1 mm is selected. This allows for the greatest possible flexibility of the coatings while ensuring high-quality coatings.
  • the distance between the spray lance and the substrate is between 1 mm and 35 mm.
  • the ionizable gas various gases known to those skilled in the art and mixtures thereof can be used in the non-thermal plasma process.
  • Examples of these are helium, argon, xenon, nitrogen, oxygen, hydrogen or air, preferably argon or air.
  • a particularly preferred ionizable gas is air.
  • the speed of the plasma flow is below 200 m / s.
  • a flow rate for example, a value between 0.01 m / s and 100 m / s, preferably between 0.2 m / s and 10 m / s are selected.
  • the volume flow of the carrier gas is between 10 and 25 l / min, more preferably between 15 and 19 l / min.
  • the particles of the powdered coating material are preferably metallic particles or metal-containing particles.
  • the metal content of the metallic particles or metal-containing particles is at least 95% by weight, preferably at least 99% by weight, more preferably at least 99.9% by weight.
  • the metal or metals is selected from the group consisting of silver, gold, platinum, palladium, vanadium, chromium, manganese, cobalt, germanium, antimony, aluminum, zinc, tin, iron, copper, nickel, titanium, silicon , Alloys and mixtures thereof.
  • the metal or metals be selected from the group consisting of silver, gold, aluminum, zinc, tin, iron, copper, nickel, titanium, silicon, alloys, and mixtures thereof, preferably from the group consisting of silver, gold, aluminum, zinc, tin, iron, nickel, titanium, silicon, alloys and mixtures thereof.
  • powdery coating material selected from the group consisting of silver, aluminum, zinc, tin, copper, alloys and mixtures thereof. As particularly suitable in specific embodiments
  • Particles have been found to be particularly metallic particles or metal-containing particles, in which the metal or metals are selected from the group consisting of silver, aluminum and tin.
  • Coating material of inorganic particles preferably from the Group consisting of carbonates, oxides, hydroxides, carbides, halides, nitrides and mixtures thereof. Particularly suitable are mineral and / or metal oxide particles. In other embodiments, the inorganic particles are alternatively or additionally selected from the group consisting of carbon particles or
  • the powdery coating material may comprise or consist of glass particles. In certain embodiments, it is particularly preferred that the powdered coating material be coated
  • the powdered coating material includes certain
  • Embodiments organic or inorganic salts or consists of them.
  • the powdered coating material comprises or consists of plastic particles.
  • the abovementioned plastic particles are formed from, for example, pure or mixed homo-, co-, block- or prepolymers or mixtures thereof.
  • the plastic particles may be pure crystals or be mixed crystals or have amorphous phases.
  • the plastic particles can be obtained, for example, by mechanical comminution of plastics.
  • the powdery coating material comprises or consists of mixtures of particles of different materials. In certain preferred
  • the particles can be produced by different methods.
  • the metal particles can be obtained by atomization or atomization of molten metal.
  • Glass particles can be produced by mechanical comminution of glass or else from the melt. In the latter case, the molten glass can also be atomized or atomized. Alternatively, molten glass can also be used on rotating elements,
  • a drum be divided.
  • Mineral particles, metal oxide particles and inorganic particles selected from the group consisting of oxides, hydroxides, carbonates, carbides, nitrides, halides and mixtures thereof can be obtained by comminuting the naturally occurring minerals, rocks, etc. and subsequently size-classified.
  • Size classification can be carried out, for example, by means of cyclones, air separators, screening, etc.
  • the particles of powdered coating material have been added to the particles of powdered coating material
  • the aforesaid coating may comprise or be made of a metal.
  • a coating of a particle may be closed or particulate, with closed structure coatings being preferred.
  • the layer thickness of such a metallic coating is preferably below 1 ⁇ m, more preferably below 0.8 ⁇ m, and even more preferably below 0.5 ⁇ m. In certain embodiments, such
  • Coatings a thickness of at least 0.05 ⁇ , more preferably of at least 0.1 ⁇ on. Especially in certain embodiments
  • Preferred metals for use in any of the foregoing coatings are selected from the group consisting of copper, titanium, gold, silver, tin, zinc, iron, silicon, nickel and aluminum, preferably selected from the group consisting of gold, silver , Tin and zinc, more preferably from the group consisting of silver, tin and zinc.
  • the term main constituent in the sense of the abovementioned coating denotes that the metal in question or a mixture of the abovementioned metals represents at least 90% by weight, preferably 95% by weight, more preferably 99% by weight, of the metal content of the coating. It must be understood that in the case of a partial oxidation of the oxygen content of the corresponding oxide layer is not included.
  • the production of such metallic Coatings can take place, for example, by means of gas-phase synthesis or wet-chemical processes.
  • the particles of the powdery coating material according to the invention are additionally or alternatively coated with a metal oxide layer.
  • this metal oxide layer consists essentially of silicon oxide, aluminum oxide, boron oxide, zirconium oxide, cerium oxide, iron oxide, titanium oxide, chromium oxide, tin oxide, molybdenum oxide, their hydrated oxides, their hydroxides and mixtures thereof.
  • this metal oxide layer consists essentially of silicon oxide, aluminum oxide, boron oxide, zirconium oxide, cerium oxide, iron oxide, titanium oxide, chromium oxide, tin oxide, molybdenum oxide, their hydrated oxides, their hydroxides and mixtures thereof.
  • the metal oxide layer consists essentially of
  • Silicon oxide The aforementioned term "consists essentially of" in the sense of the present invention means that at least 90%, preferably
  • Metal oxide layer consists of the aforementioned metal oxides, in each case based on the number of particles of the metal oxide layer, wherein optionally contained water is not included. The determination of
  • composition of the metal oxide layer can be carried out by methods known to the person skilled in the art, for example sputtering in combination with XPS or TOF-SIMS. In particular, it is with certain of the aforementioned
  • the metal oxide layer is not an oxidation product of an underlying metal core.
  • the application of such a metal oxide layer can be carried out, for example, by the sol-gel method.
  • the substrate is selected from the group consisting of plastic substrates, inorganic substrates, and
  • the plastic substrates may be, for example, plastic films or molded plastic.
  • the shaped bodies can have geometrically simple or complex shapes.
  • the plastic molding may be, for example, a component of the automotive industry or the construction industry.
  • the cellulose-containing substrates may be cardboard, paper, wood, wood-containing substrates, etc.
  • the inorganic substrates may be, for example, metallic substrates, such as metal sheets or metallic moldings or ceramic or mineral substrates or moldings.
  • the inorganic substrates may also be solar cells or silicon wafers onto which, for example, electrically conductive coatings or contacts are applied.
  • Substrates made of glass can also be used as inorganic substrates.
  • the glass, in particular glass panes can be provided using the method according to the invention, for example with electrochromic coatings.
  • coated by the process according to the invention substrates are suitable for very different applications.
  • the coatings have optical and / or electromagnetic effects.
  • the coatings have optical and / or electromagnetic effects.
  • the coatings may be electrically conductive, semi-conductive or non-conductive.
  • Electrically conductive layers may, for example, be in the form of
  • Conductor tracks are applied to components. This can be done, for example be used to allow the power supply in the context of the electrical system in a motor vehicle component. Furthermore, however, such a track may also be shaped, for example, as an antenna, as a shield, as an electrical contact, etc. This is for example particularly advantageous for RFID applications (radio frequency identification). Furthermore, inventive
  • Coatings are used for example for heating purposes or for specific heating of special components or special parts of larger components.
  • Liquids, wear and / or corrosion protection coatings Furthermore, the coatings produced can influence the surface tension of liquids or have adhesion-promoting properties.
  • the coatings produced according to the invention can furthermore be described as
  • Sensor surfaces for example as a human-machine interface (HMI: Human Machine Interface), for example in the form of a touch screen (touch screen) can be used.
  • HMI Human Machine Interface
  • touch screen touch screen
  • the coatings may be used to shield from electromagnetic interference (EMI) or to protect against
  • ESD electrostatic discharges
  • the coatings can also be used to effect electromagnetic compatibility (EMC).
  • layers can be applied by the use of the particles according to the invention, which are applied, for example, to increase the stability of corresponding components after their repair.
  • An example is repairs in the aircraft sector, for example, a loss of material due to
  • the coatings serve as electrical contacts and permit electrical connection between different materials.
  • Coating material and the particles contained therein apply, and vice versa.
  • Figures 1 and 2 show a copper layer applied to a steel sheet. Examples
  • powdered coating materials were carried out by means of a HELOS device (Sympatec, Germany). For the measurement, 3 g of the powdered coating material was placed in the meter and sonicated for 30 seconds prior to measurement. For dispersion, a Rodos T4.1 dispersion unit was used, the primary pressure being 4 bar. The evaluation was carried out with the standard software of the device. The inventive method will now be explained in more detail with reference to the following examples, without being limited to the examples.
  • Example 1 1,10-decanedicarboxylic, powdered
  • Example 2 The application of the coating aid was carried out analogously to Example 1.
  • coating assistant 3 g of monoethyl fumarate
  • Example 3 powdered adipic acid monoethyl ester
  • Example 4 Powdered methyltriglycol
  • the application of the coating aid was carried out analogously to Example 1.
  • coating assistant 3 g of methyltriglycol were used.
  • Example 5 Powdered with adipic acid monoethyl ester
  • the application of the coating aid was carried out analogously to Example 1. Here, however, copper particles were used with a D 50 of 34 ⁇ .
  • As a coating aid 3 g Adipinsauremonoethylester were used.
  • the application of the coating aid was carried out analogously to Example 1. In this case, however, a copper particle with a D 50 of 34 ⁇ was used.
  • As coating assistant 3 g of methyltriglycol were used.
  • Example 7 Ethocel coated, powdery coating materials
  • the application of the coating aid was carried out analogously to Example 1.
  • copper particles with a D 50 value of 34 ⁇ m were used.
  • coating assistant 3 g of ethylcellulose (Ethocel Standard 10, Dow Wolff Cellulosics) were used.
  • Example 7-2 aluminum particles
  • the application of the coating aid was carried out analogously to Example 1. In this case, 100 g of aluminum particles with a D 50 value of 1, 6 ⁇ were used.
  • As coating assistant 3 g of ethylcellulose (Ethocel Standard 10, Dow Wolff Cellulosics) were used.
  • Example 8 Monoethyl fumarate-coated, powdery
  • Coating Materials The application of the coating aid was carried out analogously to Example 1. Here, a copper particle with a D 50 value of 34 ⁇ was used.
  • coating assistant 3 g of DEGALAN PM 381 (copolymer of methyl methacrylate and isobutyl methacrylate, Evonik) were used.
  • Example 9 Polyacrylate-coated, powdery coating materials
  • the copper paste or tin paste was dispersed in 600 g of ethanol to give a 35% by weight dispersion. Subsequently, 100 ml of a solution of 0.5 g of dimethyl 2,2'-azobis (2-methylpropionate) (trade name V 601, available from WAKO Chemicals GmbH, Fuggerstrasse 12, 41468 Neuss), 1 g
  • Methacryloxypropyltrimethoxysilane (MEMO) and 10 g
  • TPTMA Trimethylolpropane trimethacrylate
  • reaction mixture was Added reaction mixture. Subsequently, the mixture was stirred for a further 15 h at 75 ° C, the reaction mixture was filtered off, isolated as a paste and dried under reduced pressure.
  • the decomposition temperature of the polymer was in this case about 260 ° C determined in accordance with DIN EN ISO 1 1358. At this temperature showed a beginning significant decrease in the weight of the powder coating material.
  • coated sheets according to the invention were much more homogeneous in terms of their appearance and feel. SEM images of the surfaces show the formation of larger uniform areas of the coating, while the
  • the aluminum particles according to Examples 7-2 and 9-1 were applied to steel plates by means of a flame spraying system from CASTOLIN in an acetylene / oxygen flame. Subsequently, the obtained sheets were analyzed by SEM. This showed a uniform coating, with small Cavities and only minor amounts of oxidation were observed. The coatings macroscopically showed good adhesion to the steel sheets.
  • Coating aid did not allow a coating according to the invention. Here only small amounts of strongly isolated were very coarsely particulate
  • the application of the pulverulent coating material was carried out by means of a Plasmatron system from Inocon Attnang-Puchheim, Austria.
  • the ionizable gases used were argon and nitrogen. Here were
  • Examples 9-2 to 9-5 were applied to aluminum sheets, steel sheets and wafers. This showed a very uniform application of the powder, a low overspray, a good adhesion of the layer to the surface and a color of the coating, based on a small amount of oxidation
  • Copper grit according to Example 9-2 can be found in Figures 1 and 2.
  • Figure 1 shows, for example, the excellent connection to the surface.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Mechanical Engineering (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Materials Engineering (AREA)
  • Metallurgy (AREA)
  • Organic Chemistry (AREA)
  • Plasma & Fusion (AREA)
  • Physics & Mathematics (AREA)
  • Paints Or Removers (AREA)
  • Coating By Spraying Or Casting (AREA)
  • Pigments, Carbon Blacks, Or Wood Stains (AREA)
  • Application Of Or Painting With Fluid Materials (AREA)
EP12746062.4A 2011-07-25 2012-07-25 Verwendung speziell belegter, pulverförmiger beschichtungsmaterialien und beschichtungsverfahren unter einsatz derartiger beschichtungsmaterialien Withdrawn EP2737102A2 (de)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DE102011052120A DE102011052120A1 (de) 2011-07-25 2011-07-25 Verwendung speziell belegter, pulverförmiger Beschichtungsmaterialien und Beschichtungsverfahren unter Einsatz derartiger Beschichtungsmaterialien
PCT/EP2012/064636 WO2013014211A2 (de) 2011-07-25 2012-07-25 Verwendung speziell belegter, pulverförmiger beschichtungsmaterialien und beschichtungsverfahren unter einsatz derartiger beschichtungsmaterialien

Publications (1)

Publication Number Publication Date
EP2737102A2 true EP2737102A2 (de) 2014-06-04

Family

ID=46650518

Family Applications (1)

Application Number Title Priority Date Filing Date
EP12746062.4A Withdrawn EP2737102A2 (de) 2011-07-25 2012-07-25 Verwendung speziell belegter, pulverförmiger beschichtungsmaterialien und beschichtungsverfahren unter einsatz derartiger beschichtungsmaterialien

Country Status (7)

Country Link
US (1) US20140342094A1 (cg-RX-API-DMAC7.html)
EP (1) EP2737102A2 (cg-RX-API-DMAC7.html)
JP (1) JP2014522913A (cg-RX-API-DMAC7.html)
KR (1) KR20140068032A (cg-RX-API-DMAC7.html)
CN (1) CN103827345B (cg-RX-API-DMAC7.html)
DE (1) DE102011052120A1 (cg-RX-API-DMAC7.html)
WO (1) WO2013014211A2 (cg-RX-API-DMAC7.html)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11662300B2 (en) 2019-09-19 2023-05-30 Westinghouse Electric Company Llc Apparatus for performing in-situ adhesion test of cold spray deposits and method of employing
US11898986B2 (en) 2012-10-10 2024-02-13 Westinghouse Electric Company Llc Systems and methods for steam generator tube analysis for detection of tube degradation
US11935662B2 (en) 2019-07-02 2024-03-19 Westinghouse Electric Company Llc Elongate SiC fuel elements

Families Citing this family (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102011052121A1 (de) * 2011-07-25 2013-01-31 Eckart Gmbh Beschichtungsverfahren nutzend spezielle pulverförmige Beschichtungsmaterialien und Verwendung derartiger Beschichtungsmaterialien
DE102011052118A1 (de) * 2011-07-25 2013-01-31 Eckart Gmbh Verfahren zum Aufbringen einer Beschichtung auf einem Substrat, Beschichtung und Verwendung von Partikeln
KR101555753B1 (ko) * 2013-11-18 2015-09-30 서울대학교산학협력단 단일 공정의 부식 방지된 구리 페이스트 제조와 다이폴 태그 안테나로의 응용
DE102014103025A1 (de) * 2014-03-07 2015-09-10 Ernst-Moritz-Arndt-Universität Greifswald Verfahren zur Beschichtung eines Substrates, Verwendung des Substrats und Vorrichtung zur Beschichtung
EP2998048A1 (de) * 2014-09-17 2016-03-23 Heraeus Deutschland GmbH & Co. KG Metallsinterzubereitung und deren Verwendung zum Verbinden von Bauelementen
JP6630047B2 (ja) * 2015-02-27 2020-01-15 日立造船株式会社 溶射材料の製造方法、および、溶射方法
EP3078437B1 (de) 2015-04-09 2022-01-05 Eckart GmbH Verfahren zur herstellung von plastisch verformten metallpartikeln
CN104894449A (zh) * 2015-06-10 2015-09-09 深圳市威勒达科技开发有限公司 一种钒钼合金靶材及其制备方法
CN104946950A (zh) * 2015-06-10 2015-09-30 深圳市威勒达科技开发有限公司 一种钒钨合金靶材及其制备方法
WO2017207025A1 (de) 2016-05-31 2017-12-07 Eckart Gmbh Verfahren zur herstellung von plastisch verformten metallpartikeln
DE102016122394A1 (de) * 2016-11-21 2018-05-24 Woco Industrietechnik Gmbh Bauteil umfassend zumindest ein Kunststoffmaterial, Komponenten mit einem solchen Bauteil und Verfahren zur Verbesserung der Widerstandsfähigkeit eines solchen Bauteils
EP3327166A1 (en) * 2016-11-24 2018-05-30 Valeo Iluminacion Method for creating a conductive track
KR20190070735A (ko) * 2017-12-13 2019-06-21 엘티메탈 주식회사 용사법을 이용한 전기 접점재료의 제조방법 및 이로부터 제조된 전기 접점재료
CN110317938B (zh) * 2018-03-29 2021-02-19 宝山钢铁股份有限公司 一种高硅晶粒取向电工钢板的制造方法
FR3101635B1 (fr) * 2019-10-08 2022-03-11 Arkema France Composition de polymère thermoplastique pour construction d’articles 3D
CN113002022B (zh) * 2021-03-25 2022-03-08 南京工程学院 一种纤维增强树脂基复合材料修复方法
CN114032490B (zh) * 2021-09-30 2023-11-24 福建省宁德恒茂节能科技有限公司 一种aod炉汽化冷却锅炉高温防腐抗磨电弧喷涂粉芯丝材
CN116288121B (zh) * 2023-02-09 2024-09-10 佛山市骏昌隆新材料有限公司 热电偶表面防腐工艺
US20250313931A1 (en) * 2024-04-05 2025-10-09 Rtx Corporation Encapsulated particles for maintaining particle chemistry during plasma spray applications

Family Cites Families (69)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2071251A (en) 1931-07-03 1937-02-16 Du Pont Fiber and method of producing it
US2071250A (en) 1931-07-03 1937-02-16 Du Pont Linear condensation polymers
US2130523A (en) 1935-01-02 1938-09-20 Du Pont Linear polyamides and their production
US2130948A (en) 1937-04-09 1938-09-20 Du Pont Synthetic fiber
US2241322A (en) 1938-09-30 1941-05-06 Du Pont Process for preparing polyamides from cyclic amides
US2312966A (en) 1940-04-01 1943-03-02 Du Pont Polymeric material
US2512606A (en) 1945-09-12 1950-06-27 Du Pont Polyamides and method for obtaining same
BE561190A (cg-RX-API-DMAC7.html) 1956-09-28
DE1300266B (de) 1960-06-10 1969-07-31 Bayer Ag Verfahren zur Herstellung hochmolekularer, linearer Polycarbonate
DE1495730B2 (de) 1963-07-24 1971-03-18 Farbenfabriken Bayer AG, 5090 Le verkusen Verfahren zum herstellen thermoplastischer polykondensations produkte
IL24111A (en) 1964-08-24 1969-02-27 Du Pont Linear polyamides
US3471310A (en) * 1965-05-24 1969-10-07 Eutectic Welding Alloys Welding process and product
US3991240A (en) * 1975-02-18 1976-11-09 Metco, Inc. Composite iron molybdenum boron flame spray powder
DE2826925A1 (de) 1978-06-20 1980-01-17 Basf Ag Witterungsbestaendige, schlagzaehe thermoplastische massen mit guter einfaerbbarkeit
DE3227555A1 (de) 1982-07-23 1984-01-26 Basf Ag, 6700 Ludwigshafen Thermoplastische formmasse
CA1246295A (en) 1982-12-23 1988-12-06 Robert A. Clendinning Aromatic amorphous thermoplastic terpolymers
DE3330154A1 (de) 1983-08-20 1985-03-07 Basf Ag, 6700 Ludwigshafen Verfahren zur herstellung von polyethern
US4645716A (en) * 1985-04-09 1987-02-24 The Perkin-Elmer Corporation Flame spray material
CA1327769C (en) 1986-06-20 1994-03-15 Shoji Ikeda Powder treating method and apparatus used therefor
DE3726283A1 (de) 1987-08-07 1989-02-16 Basf Ag Thermoplastische formmassen
DE3816585A1 (de) 1988-05-16 1989-11-23 Thyssen Guss Ag Vorrichtung zum plasmaspritzen
US4872904A (en) 1988-06-02 1989-10-10 The Perkin-Elmer Corporation Tungsten carbide powder and method of making for flame spraying
DE8908954U1 (de) 1989-06-03 1990-09-27 Castolin S.A., Lausanne-St. Sulpice, Waadt/Vaud Autogenes Flammspritzgerät zum Flammspritzen von pulverförmigen Werkstoffen bzw. Spritzpulver
US5126205A (en) * 1990-05-09 1992-06-30 The Perkin-Elmer Corporation Powder of plastic and treated mineral
DE4041623A1 (de) 1990-12-22 1992-06-25 Osu Maschinenbau Gmbh Duese fuer eine vorrichtung und ein verfahren zum hochgeschwindigkeitsflammenspritzen
DE4134144C2 (de) * 1991-10-16 1994-04-21 Fraunhofer Ges Forschung Karbidisches Spritzpulver
US5233153A (en) * 1992-01-10 1993-08-03 Edo Corporation Method of plasma spraying of polymer compositions onto a target surface
US5385789A (en) * 1993-09-15 1995-01-31 Sulzer Plasma Technik, Inc. Composite powders for thermal spray coating
US5426003A (en) * 1994-02-14 1995-06-20 Westinghouse Electric Corporation Method of forming a plasma sprayed interconnection layer on an electrode of an electrochemical cell
DE19532412C2 (de) 1995-09-01 1999-09-30 Agrodyn Hochspannungstechnik G Vorrichtung zur Oberflächen-Vorbehandlung von Werkstücken
US5716422A (en) 1996-03-25 1998-02-10 Wilson Greatbatch Ltd. Thermal spray deposited electrode component and method of manufacture
JPH1060617A (ja) 1996-08-22 1998-03-03 Suruzaa Meteko Japan Kk 高速フレーム溶射方法
DE19728629A1 (de) 1997-07-04 1999-01-07 Basf Ag Thermoplastische Formmassen mit geringer Eigenfarbe
DE19747386A1 (de) 1997-10-27 1999-04-29 Linde Ag Verfahren zum thermischen Beschichten von Substratwerkstoffen
DE19807086A1 (de) 1998-02-20 1999-08-26 Fraunhofer Ges Forschung Verfahren zum Beschichten von Oberflächen eines Substrates, Vorrichtung zur Durchführung des Verfahrens, Schichtsystem sowie beschichtetes Substrat
EP0939142A1 (en) * 1998-02-27 1999-09-01 Ticona GmbH Thermal spray powder incorporating an oxidised polyarylene sulfide
DE19856307C1 (de) 1998-12-07 2000-01-13 Bosch Gmbh Robert Vorrichtung zur Erzeugung eines freien kalten Plasmastrahles
US6089825A (en) * 1998-12-18 2000-07-18 United Technologies Corporation Abradable seal having improved properties and method of producing seal
EP1024222A3 (de) 1999-01-27 2000-09-13 eybl International AG Verfahren zur Ausrüstung von textilen Substraten
DE29919142U1 (de) * 1999-10-30 2001-03-08 Agrodyn Hochspannungstechnik GmbH, 33803 Steinhagen Plasmadüse
DE19955880A1 (de) 1999-11-20 2001-05-23 Henkel Kgaa Plasmabeschichtung von Metallen bei Atmosphärendruck
DE10046956C2 (de) * 2000-09-21 2002-07-25 Federal Mogul Burscheid Gmbh Thermisch aufgetragene Beschichtung für Kolbenringe aus mechanisch legierten Pulvern
JP3952252B2 (ja) * 2001-01-25 2007-08-01 株式会社フジミインコーポレーテッド 溶射用粉末およびそれを用いた高速フレーム溶射方法
DE10109087A1 (de) 2001-02-24 2002-10-24 Leoni Bordnetz Sys Gmbh & Co Verfahren zum Herstellen eines Formbauteils mit einer integrierten Leiterbahn
JP2006037238A (ja) * 2001-03-08 2006-02-09 Shin Etsu Chem Co Ltd 溶射用球状粒子の製造方法
DE10116502B4 (de) 2001-04-03 2004-02-19 Viöl, Wolfgang, Prof. Dr. Verfahren und Vorrichtung zur Ausbildung eines Plasmastrahls
JP3543149B2 (ja) 2001-09-03 2004-07-14 島津工業有限会社 プラズマ溶射用のトーチヘッド
US7455891B2 (en) 2002-01-29 2008-11-25 Ciba Specialty Chemicals Corporation Process for the production of strongly adherent coatings
CA2482085C (en) 2002-04-12 2010-09-28 Sulzer Metco Ag A plasma spraying method
US7179526B2 (en) 2002-08-02 2007-02-20 3M Innovative Properties Company Plasma spraying
DE10320379A1 (de) 2003-05-06 2004-12-02 Leoni Ag Elektrisch beheizbares Element und Verfahren zum Herstellen eines elektrisch beheizbaren Elements
CH696811A5 (de) 2003-09-26 2007-12-14 Michael Dvorak Dr Ing Dipl Phy Verfahren zur Beschichtung einer Substratoberfläche unter Verwendung eines Plasmastrahles.
EP1707650A1 (de) * 2005-03-31 2006-10-04 Siemens Aktiengesellschaft Matrix und Schichtsystem
US7799111B2 (en) * 2005-03-28 2010-09-21 Sulzer Metco Venture Llc Thermal spray feedstock composition
JP4719877B2 (ja) * 2005-06-21 2011-07-06 国立大学法人豊橋技術科学大学 マイクロ波プラズマトーチ及びマイクロ波プラズマ溶射装置
DE102005047688C5 (de) * 2005-09-23 2008-09-18 Siemens Ag Kaltgasspritzverfahren
EP1806183A1 (de) 2006-01-10 2007-07-11 Siemens Aktiengesellschaft Düsenanordnung und Verfahren zum Kaltgasspritzen
DE102006005775A1 (de) * 2006-02-07 2007-08-09 Forschungszentrum Jülich GmbH Thermisches Spritzverfahren mit kolloidaler Suspension
DE102006047103A1 (de) * 2006-09-28 2008-04-03 Siemens Ag Pulver für Kaltgasspritzverfahren
DE102006061435A1 (de) 2006-12-23 2008-06-26 Leoni Ag Verfahren und Vorrichtung zum Aufspritzen insbesondere einer Leiterbahn, elektrisches Bauteil mit einer Leiterbahn sowie Dosiervorrichtung
US7928338B2 (en) 2007-02-02 2011-04-19 Plasma Surgical Investments Ltd. Plasma spraying device and method
DE102007006820A1 (de) * 2007-02-07 2008-08-14 Eckart Gmbh & Co.Kg Chemikalienbeständige Metalleffektpigmente, Verfahren zu deren Herstellung und Verwendung derselben
JP2009235558A (ja) * 2007-12-28 2009-10-15 Tosoh Corp 窒化アルミニウム溶射部材及びその製造方法
DE102008031843A1 (de) 2008-07-05 2010-01-07 Mtu Aero Engines Gmbh Verfahren und Vorrichtung zum Kaltgasspritzen
DE102008050184B4 (de) 2008-10-01 2011-04-21 Technische Universität Chemnitz Verfahren und Vorrichtung zum Hochgeschwindigkeitsflammspritzen
JP2010133021A (ja) * 2008-10-31 2010-06-17 Topy Ind Ltd 溶射用粒子
JP5146402B2 (ja) * 2009-05-19 2013-02-20 トヨタ自動車株式会社 炭素粒子含有被膜の成膜方法、伝熱部材、パワーモジュール、及び車両用インバータ
DE102009037846A1 (de) * 2009-08-18 2011-02-24 Siemens Aktiengesellschaft Partikelgefüllte Beschichtungen, Verfahren zur Herstellung und Verwendungen dazu
EP2686460A1 (de) * 2011-03-16 2014-01-22 Reinhausen Plasma GmbH Beschichtung sowie verfahren und vorrichtung zum beschichten

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
None *
See also references of WO2013014211A2 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11898986B2 (en) 2012-10-10 2024-02-13 Westinghouse Electric Company Llc Systems and methods for steam generator tube analysis for detection of tube degradation
US11935662B2 (en) 2019-07-02 2024-03-19 Westinghouse Electric Company Llc Elongate SiC fuel elements
US11662300B2 (en) 2019-09-19 2023-05-30 Westinghouse Electric Company Llc Apparatus for performing in-situ adhesion test of cold spray deposits and method of employing

Also Published As

Publication number Publication date
DE102011052120A1 (de) 2013-01-31
JP2014522913A (ja) 2014-09-08
KR20140068032A (ko) 2014-06-05
WO2013014211A3 (de) 2013-06-13
US20140342094A1 (en) 2014-11-20
WO2013014211A2 (de) 2013-01-31
CN103827345A (zh) 2014-05-28
CN103827345B (zh) 2018-10-26

Similar Documents

Publication Publication Date Title
EP2737102A2 (de) Verwendung speziell belegter, pulverförmiger beschichtungsmaterialien und beschichtungsverfahren unter einsatz derartiger beschichtungsmaterialien
EP2737100B1 (de) Verfahren zur substratbeschichtung und verwendung additivversehener, pulverförmiger beschichtungsmaterialien in derartigen verfahren
WO2013014214A2 (de) Beschichtungsverfahren nutzend spezielle pulverförmige beschichtungsmaterialien und verwendung derartiger beschichtungsmaterialien
WO2013014212A2 (de) Verfahren zum aufbringen einer beschichtung auf einem substrat, beschichtung und verwendung von partikeln
EP3508534A1 (en) Resin composition, filament and resin powder for three-dimensional printer, and shaped object and production rpocess therefor
EP1926841B1 (de) Kaltgasspritzverfahren
WO2022093554A2 (en) Chemically functionalized graphene oxide nanoparticle composites, coatings and methods of use thereof
CN106336630B (zh) 一种导电材料及其制备方法和用途
DE68911733T2 (de) Verfahren zum Beschichten eines festen Substrates mit einem Polymermaterial.
DE102011052119A1 (de) Verfahren zur Substratbeschichtung und Verwendung additivversehener, pulverförmiger Beschichtungsmaterialien in derartigen Verfahren
DE102007039645A1 (de) Verfahren und Vorrichtungen zur Beschichtung und/oder Modifizierung von Drähten, Fasern oder deren Verbunden
RU2511146C1 (ru) Способ нанесения теплозащитного электропроводящего покрытия на углеродные волокна и ткани
DE2109133A1 (de) Verfahren zum Flammspritzen von bei hohen Temperaturen beständigen KunststofFpulvern
CN113956605A (zh) 一种氧化物在制备可激光活化选择性金属化的树脂组合物中的应用
WO2014048887A1 (de) Beschichtete ferromagnetische metallpigmente, verfahren zu deren herstellung und deren verwendung
DE102014208249A1 (de) Verfahren zur Herstellung von Polymerfolien oder plattenförmigen Elementen aus Polymer
Ellingsen et al. Application of supersonic cold spray for solid-state battery manufacturing
US20240428963A1 (en) Conductive composition and method of producing same, method of recording conductive image, and conductive image
WO2006114431A1 (de) Verfahren zur herstellung metallisierter, extrudierter kunststoff-gegenstände
JP2001234323A (ja) 溶射粉末材、およびそれを使用した溶射方法並びに溶射皮膜
WO2007039323A1 (de) Kunststoffgegenstände zur metallisierung mit verbesserten formgebungseigenschaften
WO2012065704A1 (de) Verfahren zur herstellung von beschichtungen aus feinkörnigen pulvern
EP3160671A1 (de) Verfahren zur herstellung eines partikelhaltigen aerosols
JPS61238852A (ja) 金属粉含有重合体組成物
Agarwal et al. Experimental Analysis of Impact Behavior of Ultra-High Molecular Weight Polyethylene-Nano Ceramics Composite Particles by Isolated Particle Deposition Method Using Downstream Injection Cold Spray Technique

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20140219

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

DAX Request for extension of the european patent (deleted)
17Q First examination report despatched

Effective date: 20170719

GRAP Despatch of communication of intention to grant a patent

Free format text: ORIGINAL CODE: EPIDOSNIGR1

INTG Intention to grant announced

Effective date: 20180720

GRAJ Information related to disapproval of communication of intention to grant by the applicant or resumption of examination proceedings by the epo deleted

Free format text: ORIGINAL CODE: EPIDOSDIGR1

GRAP Despatch of communication of intention to grant a patent

Free format text: ORIGINAL CODE: EPIDOSNIGR1

INTC Intention to grant announced (deleted)
INTG Intention to grant announced

Effective date: 20181126

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20190409