DE1099243B - Vorrichtung zur punktweisen Aufzeichnung von Schriftzeichen in Unterabschnitten eines Druck-Maschinenspieles - Google Patents
Vorrichtung zur punktweisen Aufzeichnung von Schriftzeichen in Unterabschnitten eines Druck-MaschinenspielesInfo
- Publication number
- DE1099243B DE1099243B DEI13272A DEI0013272A DE1099243B DE 1099243 B DE1099243 B DE 1099243B DE I13272 A DEI13272 A DE I13272A DE I0013272 A DEI0013272 A DE I0013272A DE 1099243 B DE1099243 B DE 1099243B
- Authority
- DE
- Germany
- Prior art keywords
- printing
- control
- control hole
- line
- machine game
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000007639 printing Methods 0.000 title claims description 185
- 238000000034 method Methods 0.000 claims description 44
- 230000008569 process Effects 0.000 claims description 42
- 239000000758 substrate Substances 0.000 claims description 20
- 239000000463 material Substances 0.000 claims description 11
- 230000003287 optical effect Effects 0.000 claims description 7
- 230000003111 delayed effect Effects 0.000 claims description 6
- 230000000977 initiatory effect Effects 0.000 claims description 5
- 238000005286 illumination Methods 0.000 claims description 2
- 230000032258 transport Effects 0.000 description 29
- 230000005284 excitation Effects 0.000 description 24
- 230000000694 effects Effects 0.000 description 9
- 230000001276 controlling effect Effects 0.000 description 8
- 230000008878 coupling Effects 0.000 description 7
- 238000010168 coupling process Methods 0.000 description 7
- 238000005859 coupling reaction Methods 0.000 description 7
- 238000010586 diagram Methods 0.000 description 7
- 238000003860 storage Methods 0.000 description 7
- 230000007704 transition Effects 0.000 description 7
- 230000005540 biological transmission Effects 0.000 description 6
- 238000006073 displacement reaction Methods 0.000 description 6
- 230000002441 reversible effect Effects 0.000 description 6
- 238000012546 transfer Methods 0.000 description 6
- 230000001629 suppression Effects 0.000 description 5
- 230000006870 function Effects 0.000 description 3
- 230000009191 jumping Effects 0.000 description 3
- 238000004804 winding Methods 0.000 description 3
- 230000004913 activation Effects 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 230000001360 synchronised effect Effects 0.000 description 2
- 230000001960 triggered effect Effects 0.000 description 2
- 230000009471 action Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 102220418944 c.46C>A Human genes 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 230000004886 head movement Effects 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 239000003471 mutagenic agent Substances 0.000 description 1
- 230000010355 oscillation Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 238000004080 punching Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 230000033764 rhythmic process Effects 0.000 description 1
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B41—PRINTING; LINING MACHINES; TYPEWRITERS; STAMPS
- B41J—TYPEWRITERS; SELECTIVE PRINTING MECHANISMS, i.e. MECHANISMS PRINTING OTHERWISE THAN FROM A FORME; CORRECTION OF TYPOGRAPHICAL ERRORS
- B41J2/00—Typewriters or selective printing mechanisms characterised by the printing or marking process for which they are designed
- B41J2/22—Typewriters or selective printing mechanisms characterised by the printing or marking process for which they are designed characterised by selective application of impact or pressure on a printing material or impression-transfer material
- B41J2/23—Typewriters or selective printing mechanisms characterised by the printing or marking process for which they are designed characterised by selective application of impact or pressure on a printing material or impression-transfer material using print wires
- B41J2/30—Control circuits for actuators
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B41—PRINTING; LINING MACHINES; TYPEWRITERS; STAMPS
- B41J—TYPEWRITERS; SELECTIVE PRINTING MECHANISMS, i.e. MECHANISMS PRINTING OTHERWISE THAN FROM A FORME; CORRECTION OF TYPOGRAPHICAL ERRORS
- B41J11/00—Devices or arrangements of selective printing mechanisms, e.g. ink-jet printers or thermal printers, for supporting or handling copy material in sheet or web form
- B41J11/36—Blanking or long feeds; Feeding to a particular line, e.g. by rotation of platen or feed roller
- B41J11/42—Controlling printing material conveyance for accurate alignment of the printing material with the printhead; Print registering
Landscapes
- Credit Cards Or The Like (AREA)
- Character Spaces And Line Spaces In Printers (AREA)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US586408A US2863549A (en) | 1956-05-22 | 1956-05-22 | Subcycle control for serial-parallel printer |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| DE1099243B true DE1099243B (de) | 1961-02-09 |
Family
ID=24345589
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DEI13272A Pending DE1099243B (de) | 1956-05-22 | 1957-05-21 | Vorrichtung zur punktweisen Aufzeichnung von Schriftzeichen in Unterabschnitten eines Druck-Maschinenspieles |
Country Status (3)
| Country | Link |
|---|---|
| US (1) | US2863549A (OSRAM) |
| DE (1) | DE1099243B (OSRAM) |
| FR (1) | FR72107E (OSRAM) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE1941981A1 (de) * | 1968-12-18 | 1970-07-09 | Burroughs Corp | Zweifachgeschwindigkeitspapiervorschub mit Sprung zum Formatkopf |
| DE2452867A1 (de) * | 1973-11-12 | 1975-07-24 | Centronics Data Computer | Punktmatrix-drucker sowie steuereinrichtung hierzu |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NL262423A (OSRAM) * | 1960-03-16 | |||
| DE1214706B (de) * | 1960-07-05 | 1966-04-21 | Ibm | Zweidimensionale Schriftbild-Steuerungs-vorrichtung fuer Typendruckwerke |
| US3094261A (en) * | 1961-01-09 | 1963-06-18 | Ibm | Tape carriage control |
| US3131627A (en) * | 1961-03-30 | 1964-05-05 | Scm Corp | High speed serial printer |
| US3573562A (en) * | 1967-09-08 | 1971-04-06 | Ibm | Magnet driver circuit |
| US3498514A (en) * | 1968-09-23 | 1970-03-03 | Standard Register Co | High speed web feed apparatus |
| US3708050A (en) * | 1970-10-26 | 1973-01-02 | Ibm | Printer control with monodirectional and bidirectional printing compatibility |
| US3858704A (en) * | 1972-05-23 | 1975-01-07 | Kurosawa Telecommunications | Tape controlled line spacing and form feed mechanism |
| US3970183A (en) * | 1974-06-05 | 1976-07-20 | Centronics Data Computer Corporation | Random access line printer |
| JPS5357924A (en) * | 1976-11-05 | 1978-05-25 | Hitachi Ltd | Printer |
| US4279199A (en) * | 1979-10-19 | 1981-07-21 | International Business Machines Corporation | Print head image generator for printer subsystem |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2531885A (en) * | 1945-08-09 | 1950-11-28 | Ibm | Paper feeding device |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2654580A (en) * | 1950-06-22 | 1953-10-06 | A V Roe Canada Ltd | Temperature control of air supply systems |
| FR1065493A (OSRAM) * | 1951-06-06 | 1954-05-26 | ||
| US2747717A (en) * | 1954-12-23 | 1956-05-29 | Ibm | Paper feeding device |
-
0
- FR FR72107D patent/FR72107E/fr not_active Expired
-
1956
- 1956-05-22 US US586408A patent/US2863549A/en not_active Expired - Lifetime
-
1957
- 1957-05-21 DE DEI13272A patent/DE1099243B/de active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2531885A (en) * | 1945-08-09 | 1950-11-28 | Ibm | Paper feeding device |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE1941981A1 (de) * | 1968-12-18 | 1970-07-09 | Burroughs Corp | Zweifachgeschwindigkeitspapiervorschub mit Sprung zum Formatkopf |
| DE2452867A1 (de) * | 1973-11-12 | 1975-07-24 | Centronics Data Computer | Punktmatrix-drucker sowie steuereinrichtung hierzu |
Also Published As
| Publication number | Publication date |
|---|---|
| US2863549A (en) | 1958-12-09 |
| FR72107E (OSRAM) | 1960-03-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE971621C (de) | Anordnung zum UEbersetzen von Kennzeichnungen aus einem Aufzeichnungstraeger auf einen zweiten | |
| DE1081701B (de) | Schnellarbeitende Druckmaschine | |
| DE1274829B (de) | Druckeinrichtung fuer datenverarbeitende Recheneinheiten | |
| DE1099243B (de) | Vorrichtung zur punktweisen Aufzeichnung von Schriftzeichen in Unterabschnitten eines Druck-Maschinenspieles | |
| DE2317493B2 (de) | Schnelldrucker | |
| DE2605821A1 (de) | Schnelldrucker | |
| DE2439850B2 (de) | Einrichtung zum vorzeigen des textes in einem datendrucker | |
| DE2258247C3 (de) | Punktmatrixdrucker | |
| DE1203289B (de) | Impulsbetaetigte elektronische Steuereinrichtung fuer den Vorschub zusammenhaengender Formulare fuer Druck-Rechen-Buchungsmaschinen u. dgl. | |
| DE742224C (de) | Maschine zum Lochen von Karten nach einem Kombinationssystem | |
| DE1817804C3 (OSRAM) | ||
| DE2400444A1 (de) | Steuerung fuer druckeinrichtungen | |
| DE1817804B2 (de) | Druckvorrichtung | |
| DE2901167A1 (de) | Druckvorrichtung zum drucken von zeichen in punktmatrixform | |
| DE2132263C3 (de) | Schaltungsanordnung zur Prüfung einer Folge von Impulsgruppen auf korrekte Impulszahl | |
| DE2044409C3 (de) | Zeilenschlagdrucker | |
| DE940497C (de) | Vorschub- und Vorsteckeinrichtung fuer druckende Geschaeftsmaschinen, insbesondere fuer durch Aufzeichnungstraeger gesteuerte Tabelliermaschinen | |
| DE1561050B2 (de) | Rotationsdruckmaschine zum serienweisen drucken von erzeugnissen mit wechselndem aufdruck wie schecks | |
| DE2940019A1 (de) | Matrix-zeichendrucker | |
| DE1940703A1 (de) | Einrichtung zum steuerbaren Vorschub einer Papierbahn in einem Drucker | |
| DE973975C (de) | Einrichtung zur druckschriftlichen Wiedergabe der Angaben von Aufzeichnungstraegern | |
| DE1105217B (de) | Vorrichtung zur punktweisen Aufzeichnung von Schriftzeichen | |
| DE1222295B (de) | Verfahren zum Anpassen der Druckzykluslaenge fuer eine Druckzeile an die Anzahl der in einer Zeile zu druckenden Zeichen bei Schnelldruckern datenverarbeitender Systeme | |
| DE929335C (de) | Anordnung zur Zeilenauswahl bei der Formularbeschriftung in Geschaeftsmaschinen | |
| DE2326798C3 (de) | Steuereinrichtung für einen Seriendrucker |