WO2018213297A1 - Treatment of cancer with anti-gitr agonist antibodies - Google Patents

Treatment of cancer with anti-gitr agonist antibodies Download PDF

Info

Publication number
WO2018213297A1
WO2018213297A1 PCT/US2018/032750 US2018032750W WO2018213297A1 WO 2018213297 A1 WO2018213297 A1 WO 2018213297A1 US 2018032750 W US2018032750 W US 2018032750W WO 2018213297 A1 WO2018213297 A1 WO 2018213297A1
Authority
WO
WIPO (PCT)
Prior art keywords
cells
proliferating
memory
activated
dose
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/032750
Other languages
English (en)
French (fr)
Inventor
Suba KRISHNAN
Penny E. PHILLIPS
Zheng Yang
Haiqing Wang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bristol Myers Squibb Co
Original Assignee
Bristol Myers Squibb Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Bristol Myers Squibb Co filed Critical Bristol Myers Squibb Co
Priority to KR1020197036659A priority Critical patent/KR20200006115A/ko
Priority to US16/612,956 priority patent/US11685787B2/en
Priority to JP2019563411A priority patent/JP7274426B2/ja
Priority to EP18731561.9A priority patent/EP3625260A1/en
Priority to CN201880046058.6A priority patent/CN110869392A/zh
Publication of WO2018213297A1 publication Critical patent/WO2018213297A1/en
Anticipated expiration legal-status Critical
Priority to US18/133,822 priority patent/US20230416388A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • kits for treating diseases and conditions e.g., cancer, e.g., advanced solid tumors, by administering an anti-GITR agonist Ab in combination with an anti-PD-1 or anti-PD- Ll Ab.
  • Figure 1 shows the phase l/2a study of 28F3.IgGl + nivolumab in patients
  • DLT dose-limiting toxicity
  • HCC hepatocellular carcinoma
  • MAD maximum administered dose
  • MTD maximum tolerated dose
  • NSCLC non-small cell lung cancer
  • PD pharmacodynamics
  • PK pharmacokinetics
  • SCCHN squamous cell carcinoma of the head and neck
  • Q2W every 2 weeks.
  • Figure 2 shows that GITR Ab and nivolumab demonstrate a linear PK and low immunogenicity.
  • concentration of GITR Ab is shown as a function of time and
  • concentration of GITR Ab with or without nivolumab after administration of the first dose are 10 mg, 30 mg, 100 mg, 240 mg and 800 mg.
  • concentrations from bottom to top lines for the GITR Ab and nivolumab are 30 mg, 100 mg, 240 mg and 800 mg (administered with 240 mg of nivolumab).
  • Figure 3 shows that 28F3.IgGl + nivolumab increase proliferating (Ki67+) NK and CD8 cells in peripheral blood.
  • a Asterisk denotes outlier at 10.9.
  • b Asterisk denotes outlier at 7.8.
  • Figure 4 shows that GITR Ab + nivolumab increases proliferation and activation of CD8 memory cells.
  • the fold change over baseline of proliferation (measured with Ki67 marker) or activation (measured with HLA-DR marker) of effector memory CD8 cells is shown.
  • the time of administration of the GITR Ab and nivolumab is shown with arrows.
  • Figure 5 shows cross sections of tumors in a patient with cervical cancer, at baseline
  • Figure 6 shows cross sections of tumors in a patient with adenocarcinoma of the ampulla of Vater, at baseline (before treatment) and during treatment ("Dec 2017") with a combination of 240 mg 28F3.IgGl and 240 mg nivolumab. The changes in tumor size are shown with a circle.
  • Figure 7 shows cross sections of tumors in a patient with melanoma after progression on anti-PD-1 therapy, at baseline (before treatment) and during treatment ("Dec 2017") with a combination of 100 mg 28F3.IgGl and 240 mg nivolumab. The changes in tumor size are shown with a circle.
  • Figure 8 shows cross sections of tumors in a patient with nasopharyngeal cancer after progression on anti-PD-1 therapy, at baseline (before treatment) and during treatment ("Feb 2017") with a combination of 240 mg 28F3.IgGl and 240 mg nivolumab. The changes in tumor size are shown with a circle.
  • Figure 9 is a schematic of approaches for FIH safe starting dose selection for novel immunomodulatory protein therapeutic s .
  • Figure 10 is a schematic of the first- in-human dose selection strategy for 28F3.IgGl.
  • Figure 11 is a schematic of the data analysis method for first-in-human dose selection.
  • Figure 12 is a graph showing NK cell activation at the indicated concentrations of 28F3.IgGl.
  • Figure 13 is a schematic of the dosing schedule of DTAl-mIgG2a in the CT26 mouse tumor model.
  • Figure 14 is a graph showing the percentage of Ki67-positve cells among CD8+ T cells at day 12 after cell implantation at the indicated doses of DTAmIgG2a.
  • Figure 15 is a graph showing the CD8+T cell/Treg cell ratio in tumors of the CT26 mouse tumor model treated with the indicated doses of DTAmIgG2a.
  • Figure 16 is a graph showing a time course of tumor-free mice at the indicated doses of DTAmIgG2a.
  • Figure 17 is a graph showing projections of the human efficacious dose based on mouse efficacy data (tumor-free mice).
  • anti-GITR agonist agents e.g., antibodies
  • anti-PD-1 or anti-PD-Ll e.g., antibodies
  • PD-l/PD-Ll axis e.g., antibodies
  • GITR GITR ligand
  • GITR includes any variants or isoforms of GITR which are naturally expressed by cells. Accordingly, antibodies described herein may cross-react with GITR from species other than human (e.g., cynomolgus GITR). Alternatively, the antibodies may be specific for human GITR and may not exhibit any cross -reactivity with other species. GITR or any variants and isoforms thereof, may either be isolated from cells or tissues which naturally express them or be recombinantly produced using well-known techniques in the art and/or those described herein.
  • Variant 1 (Accession No. NP_004186; SEQ ID NO: 1) consists of 241 amino acids and represents the longest transcript. It contains an extra coding segment that leads to a frame shift, compared to variant 2. The resulting protein (isoform 1) contains a distinct and shorter C-terminus, as compared to isoform 2.
  • Variant 2 (Accession No. NP_683699; SEQ ID NO: 2) encodes the longest protein (isoform 2), consisting of 255 amino acids, and is soluble.
  • Variant 3 (Accession No.
  • NP_683700; SEQ ID NO: 3 contains an extra coding segment that leads to a frame shift, compared to variant 2.
  • the resulting protein (isoform 3) contains a distinct and shorter C-terminus, as compared to isoform 2, and consists of 234 amino acids.
  • Human GITR isoform 1 (Accession No. NP_004186; SEQ ID NO: 1; encoded by the nucleotide sequence having Accession No. NM_004195.2):
  • Human GITR isoform 2 (Accession No. NP_683699.1; SEQ ID NO: 2; encoded by the nucleotide sequence having Accession No. NM_148901.1):
  • Human GITR isoform 3 (Accession No. NP_683700.1; SEQ ID NO: 3; encoded by the nucleotide sequence having Accession No. NM_148902.1): MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRC CRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDC ASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAV AACVLLLTSAQLGLHIWQLRKTQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDL WV
  • the signal sequence of isoforms 1-3 corresponds to amino acids 1-25.
  • the mature isoforms 1, 2 and 3 consist of amino acids 26 to 241, 255 or 234, respectively.
  • the extracellular domain of mature GITR consists of amino acids 26-162 and has the amino acid sequence:
  • QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSE WDCMCVQPEFHCGD PCCTTCRHHPCPPGQGVQS QGKFSFGFQCIDC AS GTFS GGHEGHCKPWTDCTQFGFLTV FPGNKTHNAVCVPGSPPAEP (SEQ ID NO: 4)
  • Cynomolgus GITR protein sequence (SEQ ID NO: 5):
  • Human GITR-L protein sequence (Accession No. NP_005083.2; SEQ ID NO: 6):
  • antibody as used to herein includes whole antibodies and any antigen binding fragments (i.e., “antigen-binding portions") or single chains thereof.
  • An “antibody” refers, in one embodiment, to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof.
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V H ) and a heavy chain constant region.
  • V H heavy chain variable region
  • V L light chain variable region
  • the light chain constant region is comprised of one domain, CL.
  • CDR complementarity determining regions
  • FR framework regions
  • Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g. , effector cells) and the first component (Clq) of the classical complement system.
  • Antibodies typically bind specifically to their cognate antigen with high affinity, reflected by a dissociation constant (KD) of 10 "5 to 10 "11 M or less. Any KD greater than about 10 "4 M is generally considered to indicate nonspecific binding.
  • KD dissociation constant
  • an antibody that "binds specifically" to an antigen refers to an antibody that binds to the antigen and substantially identical antigens with high affinity, which means having a KD of 10 "7 M or less, preferably 10 s M or less, even more preferably 5 x 10 "9 M or less, and most preferably between 10 s M and 10 "10 M or less, but does not bind with high affinity to unrelated antigens.
  • an antigen is "substantially identical" to a given antigen if it exhibits a high degree of sequence identity to the given antigen, for example, if it exhibits at least 80%, at least 90%, preferably at least 95%, more preferably at least 97%, or even more preferably at least 99% sequence identity to the sequence of the given antigen.
  • an antibody that binds specifically to human GITR may also have cross-reactivity with GITR antigens from certain primate species (e.g., cynomolgus GITR), but may not cross-react with GITR antigens from other species or with an antigen other than GITR.
  • An immunoglobulin may be from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG and IgM.
  • the IgG isotype is divided in subclasses in certain species: IgGl, IgG2, IgG3 and IgG4 in humans, and IgGl, IgG2a, IgG2b and IgG3 in mice.
  • the anti-GITR antibodies described herein are of the IgGl or IgG2 subtype.
  • Immunoglobulins, e.g., IgGl exist in several allotypes, which differ from each other in at most a few amino acids.
  • Antibody includes, by way of example, both naturally occurring and non-naturally occurring antibodies; monoclonal and polyclonal antibodies;
  • an antibody can be part of an antibody multimer (or multimeric antibody), e.g., dimer, trimer, tetramer, pentamer and hexamer.
  • the term "monoclonal antibody,” as used herein, refers to an antibody that displays a single binding specificity and affinity for a particular epitope or a composition of antibodies in which all antibodies display a single binding specificity and affinity for a particular epitope. Accordingly, the term “human monoclonal antibody” refers to an antibody or antibody composition that display(s) a single binding specificity and which has variable and optional constant regions derived from human germline immunoglobulin sequences.
  • human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
  • Human antibody refers to an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
  • the antibodies described herein may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
  • the term “human antibody”, as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • the terms "human” antibodies and “fully human” antibodies are used synonymously.
  • a “humanized” antibody refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In one embodiment of a humanized form of an antibody, some, most or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a particular antigen.
  • a "humanized” antibody retains an antigenic specificity similar to that of the original antibody.
  • a “chimeric antibody” refers to an antibody in which the variable regions are derived from one species and the constant regions are derived from another species, such as an antibody in which the variable regions are derived from a mouse antibody and the constant regions are derived from a human antibody.
  • isotype refers to the antibody class (e.g. , IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE antibody) that is encoded by the heavy chain constant region genes.
  • antibody class e.g. , IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE antibody
  • Allotype refers to naturally occurring variants within a specific isotype group, which variants differ in a few amino acids (see, e.g., Jefferis et al. (2009) mAbs 1 : 1). Antibodies described herein may be of any allotype. As used herein, antibodies referred to as "IgGlf ' or "IgGl . If ' isotype are IgGl and effectorless IgGl .
  • an antibody recognizing an antigen and "an antibody specific for an antigen” are used interchangeably herein with the term “an antibody which binds specifically to an antigen.”
  • an "isolated antibody,” as used herein, is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g. , an isolated antibody that specifically binds to GITR is substantially free of antibodies that specifically bind antigens other than GITR).
  • An isolated antibody that specifically binds to an epitope of GITR may, however, have cross -reactivity to other GITR proteins from different species.
  • PD-1 Proteinous Death- 1
  • PD-1 refers to an immunoinhibitory receptor belonging to the
  • PD-1 is expressed predominantly on previously activated T cells in vivo, and binds to two ligands, PD-L1 and PD-L2.
  • the term "PD- 1 " as used herein includes human PD- 1 (hPD- 1), variants, isoforms, and species homologs of hPD-1, and analogs having at least one common epitope with hPD-1.
  • the complete hPD- 1 sequence can be found under GenBank Accession No. U64863.
  • P-L1 Programmed Death Ligand- 1
  • PD-L1 is one of two cell surface glycoprotein ligands for PD- 1 (the other being PD-L2) that down-regulate T cell activation and cytokine secretion upon binding to PD-1.
  • the term "PD-L1 " as used herein includes human PD-L1 (hPD-Ll), variants, isoforms, and species homologs of hPD-Ll, and analogs having at least one common epitope with hPD-Ll .
  • the complete hPD-Ll sequence can be found under GenBank Accession No. Q9NZQ7.
  • Fc region fragment crystallizable region
  • Fc domain fragment crystallizable region
  • Fc domain refers to the C- terminal region of the heavy chain of an antibody that mediates the binding of the
  • an Fc region comprises the constant region of an antibody excluding the first constant region immunoglobulin domain (e.g., CHI or CL).
  • the Fc region comprises two identical protein fragments, derived from the second (Cm) and third (Cm) constant domains of the antibody's two heavy chains; IgM and IgE Fc regions comprise three heavy chain constant domains (CH domains 2-4) in each polypeptide chain.
  • the Fc region comprises immunoglobulin domains Cy2 and Cy3 and the hinge between Cyl and Cy2.
  • the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position C226 or P230 (or amino acid between these two amino acids) to the carboxy-terminus of the heavy chain, wherein the numbering is according to the EU index as in Kabat.
  • the Cm domain of a human IgG Fc region extends from about amino acid 231 to about amino acid 340, whereas the Cm domain is positioned on C-terminal side of a Cm domain in an Fc region, i.e.
  • the Fc region may be a native sequence Fc, including any allotypic variant, or a variant Fc (e.g., a non-naturally occurring Fc). Fc may also refer to this region in isolation or in the context of an Fc-comprising protein polypeptide such as a "binding protein comprising an Fc region," also referred to as an "Fc fusion protein” (e.g., an antibody or immunoadhesin).
  • a “native sequence Fc region” or “native sequence Fc” comprises an amino acid sequence that is identical to the amino acid sequence of an Fc region found in nature.
  • Native sequence human Fc regions include a native sequence human IgGl Fc region; native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
  • Native sequence Fc include the various allotypes of Fes (see, e.g., Jefferis et al. (2009) mAbs 1 : 1).
  • a “hinge”, “hinge domain” or “hinge region” or “antibody hinge region” refers to the domain of a heavy chain constant region that joins the CHI domain to the CH2 domain and includes the upper, middle, and lower portions of the hinge (Roux et al. J. Immunol. 1998 161:4083).
  • the hinge provides varying levels of flexibility between the binding and effector regions of an antibody and also provides sites for intermolecular disulfide bonding between the two heavy chain constant regions.
  • a hinge starts at Glu216 and ends at Gly237 for all IgG isotypes (Roux et al., 1998 J Immunol 161:4083).
  • the sequences of wildtype IgGl, IgG2, IgG3 and IgG4 hinges are show in Tables 1 and 2. Table 1. Hinge region amino acid sequences
  • the term “hinge” includes wildtype hinges (such as those set forth in Table 1 or 2), as well as variants thereof (e.g., non-naturally-occurring hinges or modified hinges).
  • the term “IgG2 hinge” includes wildtype IgG2 hinge, as shown in Table 1 or 2, and variants having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
  • Exemplary IgG2 hinge variants include IgG2 hinges in which 1, 2, 3 or all 4 cysteines (C219, C220, C226 and C229) are changed to another amino acid.
  • an IgG2 comprises a C219S substitution.
  • a hinge is a hybrid hinge that comprises sequences from at least two isotypes.
  • a hinge may comprise the upper, middle or lower hinge from one isotype and the remainder of the hinge from one or more other isotypes.
  • a hinge can be an IgG2/IgGl hinge, and may comprise, e.g., the upper and middle hinges of IgG2 and the lower hinge of IgGl.
  • a hinge may have effector function or be deprived of effector function.
  • the lower hinge of wildtype IgGl provides effector function.
  • CHI domain refers to the heavy chain constant region linking the variable domain to the hinge in a heavy chain constant domain.
  • a CHI domain starts at Al 18 and ends at V215.
  • the term "CHI domain” includes wildtype CHI domains (such as having SEQ ID NO: 278 for IgGl and SEQ ID NO: 279 for IgG2; Table 2), as well as variants thereof (e.g., non-naturally-occurring CHI domains or modified CHI domains).
  • the term "CHI domain” includes wildtype CHI domains and variants having 1, 2, 3, 4, 5, 1-3, 1- 5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
  • Exemplary CHI domains include CHI domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC or half-life. Modifications to the CHI domain that affect a biological activity of an antibody are provided herein.
  • CH2 domain refers to the heavy chain constant region linking the hinge to the CH3 domain in a heavy chain constant domain. As used herein, a CH2 domain starts at P238 and ends at K340.
  • CH2 domain includes wildtype CH2 domains (such as having SEQ ID NO: 280 for IgGl and SEQ ID NO: 297 for IgG2; Table 2), as well as variants thereof (e.g., non-naturally-occurring CH2 domains or modified CH2 domains).
  • CH2 domain includes wildtype CH2 domains and variants having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
  • exemplary CH2 domains include CH2 domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC or half-life.
  • a CH2 domain comprises the substitutions A330S/P331S that reduce effector function.
  • Other modifications to the CH2 domain that affect a biological activity of an antibody are provided herein.
  • CH3 domain refers to the heavy chain constant region that is C-terminal to the CH2 domain in a heavy chain constant domain. As used herein, a CH3 domain starts at G341 and ends at K447.
  • the term "CH3 domain” includes wildtype CH3 domains (such as having SEQ ID NO: 282 for IgGl and SEQ ID NO: 298 for IgG2; Table 2), as well as variants thereof (e.g., non-naturally-occurring CH3 domains or modified CH3 domains).
  • the term "CH3 domain” includes wildtype CH3 domains and variants having 1, 2, 3, 4, 5, 1-3, 1- 5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
  • Exemplary CH3 domains include CH3 domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC or half-life. Modifications to the CH3 domain that affect a biological activity of an antibody are provided herein.
  • a “native sequence Fc region” or “native sequence Fc” comprises an amino acid sequence that is identical to the amino acid sequence of an Fc region found in nature.
  • Native sequence human Fc regions include a native sequence human IgGl Fc region; native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
  • Native sequence Fc includes the various allotypes of Fes (see, e.g., Jefferis et al. (2009) mAbs 1: 1).
  • epitopes refers to a site on an antigen (e.g., GITR) to which an immunoglobulin or antibody specifically binds.
  • Epitopes can be formed both from contiguous amino acids (usually a linear epitope) or noncontiguous amino acids juxtaposed by tertiary folding of a protein (usually a conformational epitope). Epitopes formed from contiguous amino acids are typically, but not always, retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation.
  • epitope mapping Methods for determining what epitopes are bound by a given antibody (i.e., epitope mapping) are well known in the art and include, for example, immunoblotting and immunoprecipitation assays, wherein overlapping or contiguous peptides from (e.g., from GITR) are tested for reactivity with a given antibody (e.g., anti-GITR antibody).
  • Methods of determining spatial conformation of epitopes include techniques in the art and those described herein, for example, x-ray crystallography, 2-dimensional nuclear magnetic resonance and HDX-MS (see, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996)).
  • epitopope mapping refers to the process of identification of the molecular determinants for antibody- antigen recognition.
  • the term "binds to the same epitope” with reference to two or more antibodies means that the antibodies bind to the same segment of amino acid residues, as determined by a given method.
  • Techniques for determining whether antibodies bind to the "same epitope on GITR" with the antibodies described herein include, for example, epitope mapping methods, such as, x- ray analyses of crystals of antigen: antibody complexes which provides atomic resolution of the epitope and hydrogen/deuterium exchange mass spectrometry (HDX-MS).
  • Other methods monitor the binding of the antibody to antigen fragments or mutated variations of the antigen where loss of binding due to a modification of an amino acid residue within the antigen sequence is often considered an indication of an epitope component.
  • Antibodies that "compete with another antibody for binding to a target” refer to antibodies that inhibit (partially or completely) the binding of the other antibody to the target. Whether two antibodies compete with each other for binding to a target, i.e., whether and to what extent one antibody inhibits the binding of the other antibody to a target, may be determined using known competition experiments. In certain embodiments, an antibody competes with, and inhibits binding of another antibody to a target by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%. The level of inhibition or competition may be different depending on which antibody is the "blocking antibody” (i.e., the cold antibody that is incubated first with the target).
  • blocking antibody i.e., the cold antibody that is incubated first with the target.
  • Competing antibodies bind to the same epitope, an overlapping epitope or to adjacent epitopes (e.g., as evidenced by steric hindrance).
  • RIA radioimmunoassay
  • EIA enzyme immunoassay
  • sandwich competition assay see Stahli et al., Methods in Enzymology 9:242 (1983)
  • solid phase direct biotin-avidin EIA see Kirkland et al., J. Immunol. 137:3614 (1986)
  • solid phase direct labeled assay solid phase direct labeled sandwich assay (see Harlow and Lane, Antibodies: A
  • telomere binding As used herein, the terms “specific binding,” “selective binding,” “selectively binds,” and “specifically binds,” refer to antibody binding to an epitope on a predetermined antigen.
  • the antibody (i) binds with an equilibrium dissociation constant (Kp j ) of
  • BIACORE 2000 instrument using the predetermined antigen, e.g., recombinant human GITR, as the analyte and the antibody as the ligand, or Scatchard analysis of binding of the antibody to antigen positive cells, and (ii) binds to the predetermined antigen with an affinity that is at least two-fold greater than its affinity for binding to a non-specific antigen ⁇ e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen.
  • a non-specific antigen e.g., BSA, casein
  • an antibody that "specifically binds to human GITR” refers to an antibody that binds to soluble or cell bound human GITR with a K D of 10 "7 M or less, such as approximately less than 10 8 M, 10 "9 M or 10 " 10 M or even lower.
  • An antibody that "cross-reacts with cynomolgus GITR” refers to an antibody that binds to cynomolgus GITR with a K D of 10 "7 M or less, such as approximately less than 10 8 M, 10 "9 M or 10 "10 M or even lower.
  • such antibodies that do not cross-react with GITR from a non-human species exhibit essentially undetectable binding against these proteins in standard binding assays.
  • naturally-occurring refers to the fact that an object can be found in nature.
  • a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally-occurring.
  • polypeptide refers to a chain comprising at least two consecutively linked amino acid residues, with no upper limit on the length of the chain.
  • One or more amino acid residues in the polypeptide may contain a modification such as, but not limited to, glycosylation,
  • a “protein” may comprise one or more
  • nucleic acid molecule is intended to include DNA molecules and RNA molecules.
  • a nucleic acid molecule may be single- stranded or double- stranded, and may be cDNA.
  • conservative sequence modifications of the sequences set forth herein, e.g., in Table 2, such as in SEQ ID NOs: 13-191, i.e., nucleotide and amino acid sequence modifications which do not abrogate the binding of the antibody encoded by the nucleotide sequence or containing the amino acid sequence, to the antigen.
  • conservative sequence modifications include conservative nucleotide and amino acid substitutions, as well as, nucleotide and amino acid additions and deletions.
  • modifications can be introduced into a sequence in Table 2, e.g., SEQ ID NOs: 13-191, by standard techniques known in the art, such as site-directed mutagenesis and PCR- mediated mutagenesis.
  • Conservative amino acid substitutions include ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g. , lysine, arginine, histidine), acidic side chains (e.g. , aspartic acid, glutamic acid), uncharged polar side chains (e.g. , glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g. , alanine, valine, leucine, isoleucine, proline,
  • basic side chains e.g. , lysine, arginine, histidine
  • acidic side chains e.g. , aspartic acid, glutamic acid
  • uncharged polar side chains e.g. , glycine, asparagine,
  • phenylalanine, methionine beta-branched side chains (e.g. , threonine, valine, isoleucine) and aromatic side chains (e.g. , tyrosine, phenylalanine, tryptophan, histidine).
  • a predicted nonessential amino acid residue in an anti-GITR antibody is preferably replaced with another amino acid residue from the same side chain family.
  • mutations can be introduced randomly along all or part of an anti-GITR antibody coding sequence, such as by saturation mutagenesis, and the resulting modified anti-GITR antibodies can be screened for binding activity.
  • polypeptides For polypeptides, the term "substantial homology" indicates that two polypeptides, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate amino acid insertions or deletions, in at least about 80% of the amino acids, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the amino acids.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
  • the percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4: 11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol. Biol.
  • nucleic acid and protein sequences described herein can further be used as a "query sequence" to perform a search against public databases to, for example, identify related sequences.
  • Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
  • Gapped BLAST can be utilized as described in Altschul et ah, (1997) Nucleic Acids Res. 25(17):3389-3402.
  • the default parameters of the respective programs ⁇ e.g., XBLAST and NBLAST
  • XBLAST and NBLAST can be used. See www.ncbi.nlm.nih.gov.
  • an "immune response” refers to a biological response within a vertebrate against foreign agents, which response protects the organism against these agents and diseases caused by them.
  • An immune response is mediated by the action of a cell of the immune system (for example, a T lymphocyte, B lymphocyte, natural killer (NK) cell, macrophage, eosinophil, mast cell, dendritic cell or neutrophil) and soluble macromolecules produced by any of these cells or the liver (including antibodies, cytokines, and complement) that results in selective targeting, binding to, damage to, destruction of, and/or elimination from the vertebrate's body of invading pathogens, cells or tissues infected with pathogens, cancerous or other abnormal cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
  • An immune reaction includes, e.g., activation or inhibition of a T cell, e.g., an effector T cell or a Th cell, such as a CD4+ or CD8
  • an “immunomodulator” or “immunoregulator” refers to an agent, e.g., a component of a signaling pathway, that may be involved in modulating, regulating, or modifying an immune response.
  • Modulating,” “regulating,” or “modifying” an immune response refers to any alteration in a cell of the immune system or in the activity of such cell (e.g., an effector T cell).
  • Such modulation includes stimulation or suppression of the immune system which may be manifested by an increase or decrease in the number of various cell types, an increase or decrease in the activity of these cells, or any other changes which can occur within the immune system.
  • Both inhibitory and stimulatory immunomodulators have been identified, some of which may have enhanced function in a tumor microenvironment.
  • the immunomodulator is located on the surface of a T cell.
  • An "immunomodulatory target” or “immunoregulatory target” is an immunomodulator that is targeted for binding by, and whose activity is altered by the binding of, a substance, agent, moiety, compound or molecule.
  • Immunomodulatory targets include, for example, receptors on the surface of a cell ("immunomodulatory receptors") and receptor ligands ("immunomodulatory ligands").
  • Immunotherapy refers to the treatment of a subject afflicted with, or at risk of contracting or suffering a recurrence of, a disease by a method comprising inducing, enhancing, suppressing or otherwise modifying an immune response.
  • Immuno stimulating therapy or “immunostimulatory therapy” refers to a therapy that results in increasing (inducing or enhancing) an immune response in a subject for, e.g., treating cancer.
  • Patentiating an endogenous immune response means increasing the effectiveness or potency of an existing immune response in a subject. This increase in effectiveness and potency may be achieved, for example, by overcoming mechanisms that suppress the
  • endogenous host immune response or by stimulating mechanisms that enhance the endogenous host immune response.
  • T effector (“T e ff”) cells refers to T cells (e.g., CD4+ and CD8+ T cells) with cytolytic activities as well as T helper (Th) cells, which secrete cytokines and activate and direct other immune cells, but does not include regulatory T cells (Treg cells).
  • T e ff T cells
  • Th T helper
  • Anti-GITR antibodies described herein activate T e ff cells, e.g., CD4+ and CD8+ T e ff cells.
  • An increased ability to stimulate an immune response or the immune system can result from an enhanced agonist activity of T cell costimulatory receptors and/or an enhanced antagonist activity of inhibitory receptors.
  • An increased ability to stimulate an immune response or the immune system may be reflected by a fold increase of the EC50 or maximal level of activity in an assay that measures an immune response, e.g., an assay that measures changes in cytokine or chemokine release, cytolytic activity (determined directly on target cells or indirectly via detecting CD 107a or granzymes) and proliferation.
  • the ability to stimulate an immune response or the immune system activity may be enhanced by at least 10%, 30%, 50%, 75%, 2 fold, 3 fold, 5 fold or more.
  • An agonist activity of an antibody can be determined, e.g., by measuring the level of IFN- ⁇ or IL-2 secretion from T cells that are contacted with the antibody.
  • the agonist activity of one agonist agent e.g., an antibody, may be higher by at least 10%, 30%, 50%, 75%, 2 fold, 3 fold, 5 fold or more relative to another agonist agent, as defined by increased cytokine release or increased proliferation in effector T cells; reduced T regulatory cell activity if engagement on Tregs reduces Treg function; or increased depletion of Tregs.
  • the amount of IFN- ⁇ or IL-2 secreted from T cells stimulated with a first agonist agent may be at least 10%, 30%, 50%, 75%, 2 fold, 3 fold, 5 fold or more higher than that of T cells simulated with the a second agonist agent, e.g., antibody.
  • An "agonist" of a ligand or receptor is an agent that mirrors the activity of the natural ligand/receptor interaction.
  • 28F3.IgGl is an exemplary GITR agonist antibody.
  • Nivolumab is an exemplary PD-1 antagonist antibody.
  • linkage refers to the association of two or more molecules.
  • the linkage can be covalent or non-covalent.
  • the linkage also can be genetic (i.e., recombinantly fused). Such linkages can be achieved using a wide variety of art recognized techniques, such as chemical conjugation and recombinant protein production.
  • administering refers to the physical introduction of a composition comprising a therapeutic agent to a subject, using any of the various methods and delivery systems known to those skilled in the art, e.g., intravenous.
  • Routes of administration for antibodies described herein include intravenous, intraperitoneal, intramuscular, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion.
  • parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intraperitoneal, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion, as well as in vivo electroporation.
  • an antibody described herein can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically. Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
  • T cell-mediated response refers to a response mediated by T cells, including effector T cells (e.g. , CD8 + cells) and helper T cells (e.g. , CD4 + cells). T cell mediated responses include, for example, T cell cytotoxicity and proliferation.
  • cytotoxic T lymphocyte (CTL) response refers to an immune response induced by cytotoxic T cells. CTL responses are mediated primarily by CD8 + T cells.
  • inhibits or “blocks” (e.g., referring to inhibition/blocking of binding of GITR-L to GITR on cells or PD-1 to PD-L1 or PD-L2 on cells) are used
  • the anti-GITR antibody inhibits binding of GITR-L to GITR by at least about 50%, for example, about 60%, 70%, 80%, 90%, 95%, 99%, or 100%, determined, e.g., as further described herein. In some embodiments, the anti-GITR antibody inhibits binding of GITR-L to GITR by no more than 50%, for example, by about 40%, 30%, 20%, 10%, 5% or 1%, determined, e.g., as further described herein.
  • the term "inhibits growth" of a tumor includes any measurable decrease in the growth of a tumor, e.g. , the inhibition of growth of a tumor by at least about 10%, for example, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 99%, or 100%.
  • cancer refers a broad group of diseases characterized by the uncontrolled growth of abnormal cells in the body. Unregulated cell division may result in the formation of malignant tumors or cells that invade neighboring tissues and may metastasize to distant parts of the body through the lymphatic system or bloodstream.
  • treat refers to any type of intervention or process performed on, or administering an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, or slowing down or preventing the progression, development, severity or recurrence of a symptom, complication, condition or biochemical indicia associated with a disease.
  • Treatment can be of a subject having a disease or a subject who does not have a disease (e.g., for prophylaxis).
  • a "hematological malignancy” includes a lymphoma, leukemia, myeloma or a lymphoid malignancy, as well as a cancer of the spleen and the lymph nodes.
  • Exemplary lymphomas include both B cell lymphomas (a B-cell hematological cancer) and T cell lymphomas.
  • B-cell lymphomas include both Hodgkin's lymphomas and most non-Hodgkin's lymphomas.
  • Non- limiting examples of B cell lymphomas include diffuse large B-cell lymphoma, follicular lymphoma, mucosa-associated lymphatic tissue lymphoma, small cell lymphocytic lymphoma (overlaps with chronic lymphocytic leukemia), mantle cell lymphoma (MCL), Burkitt's lymphoma, mediastinal large B cell lymphoma, Waldenstrom macroglobulinemia, nodal marginal zone B cell lymphoma, splenic marginal zone lymphoma, intravascular large B-cell lymphoma, primary effusion lymphoma, lymphomatoid granulomatosis.
  • T cell lymphomas include extranodal T cell lymphoma, cutaneous T cell lymphomas, anaplastic large cell lymphoma, and angioimmunoblastic T cell lymphoma.
  • Hematological malignancies also include leukemia, such as, but not limited to, secondary leukemia, chronic lymphocytic leukemia, acute myelogenous leukemia, chronic myelogenous leukemia, and acute lymphoblastic leukemia.
  • Hematological malignancies further include myelomas, such as, but not limited to, multiple myeloma and smoldering multiple myeloma.
  • Other hematological and/or B cell- or T-cell-associated cancers are encompassed by the term hematological malignancy.
  • an effective dose or “effective dosage” is defined as an amount sufficient to achieve or at least partially achieve a desired effect.
  • a “therapeutically effective amount” or “therapeutically effective dosage” of a drug or therapeutic agent is any amount of the drug that, when used alone or in combination with another therapeutic agent, promotes disease regression evidenced by a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
  • a therapeutically effective amount or dosage of a drug includes a "prophylactically effective amount” or a “prophylactically effective dosage”, which is any amount of the drug that, when administered alone or in combination with another therapeutic agent to a subject at risk of developing a disease or of suffering a recurrence of disease, inhibits the development or recurrence of the disease.
  • a therapeutic agent to promote disease regression or inhibit the development or recurrence of the disease can be evaluated using a variety of methods known to the skilled practitioner, such as in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or by assaying the activity of the agent in in vitro assays.
  • an anti-cancer agent is a drug that promotes cancer regression in a subject.
  • a therapeutically effective amount of the drug promotes cancer regression to the point of eliminating the cancer.
  • "Promoting cancer regression” means that administering an effective amount of the drug, alone or in combination with an anti- neoplastic agent, results in a reduction in tumor growth or size, necrosis of the tumor, a decrease in severity of at least one disease symptom, an increase in frequency and duration of disease symptom-free periods, a prevention of impairment or disability due to the disease affliction, or otherwise amelioration of disease symptoms in the patient.
  • the terms "effective” and “effectiveness” with regard to a treatment includes both pharmacological effectiveness and physiological safety.
  • Pharmacological effectiveness refers to the ability of the drug to promote cancer regression in the patient.
  • Physiological safety refers to the level of toxicity, or other adverse physiological effects at the cellular, organ and/or organism level (adverse effects) resulting from administration of the drug.
  • a therapeutically effective amount or dosage of the drug preferably inhibits cell growth or tumor growth by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects.
  • a therapeutically effective amount or dosage of the drug preferably inhibits cell growth or tumor growth by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects.
  • a therapeutically effective amount or dosage of the drug completely inhibits cell growth or tumor growth, i.e., preferably inhibits cell growth or tumor growth by 100%.
  • the ability of a compound to inhibit tumor growth can be evaluated using the assays described infra. Alternatively, this property of a composition can be evaluated by examining the ability of the compound to inhibit cell growth, such inhibition can be measured in vitro by assays known to the skilled practitioner. In other preferred embodiments described herein, tumor regression may be observed and continue for a period of at least about 20 days, more preferably at least about 40 days, or even more preferably at least about 60 days.
  • patient includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.
  • the term "subject” includes any human or non-human animal.
  • the methods and compositions described herein can be used to treat a subject having cancer.
  • “Therapeutic synergy” refers to a phenomenon where treatment of patients with a combination of therapeutic agents manifests a therapeutically superior outcome to the outcome achieved by each individual constituent of the combination used at its optimum dose (Corbett, T.H. et al., Cancer Treatment Reports, 66: 1187 (1982)).
  • a therapeutically superior outcome is one in which the patients either a) exhibit fewer incidences of adverse events while receiving a therapeutic benefit that is equal to or greater than that where individual constituents of the combination are each administered as monotherapy at the same dose as in the
  • An anti-GITR agonist agent such as an anti-GITR agonist Ab
  • the treatment may be administered in 8 week cycles, e.g., one 8 week cycle, two 8 week cycles, three 8 week cycles, four 8 week cycles, five 8 week cycles, six 8 week cycles, or more.
  • Once cycle may comprise 8, 7, 6, 5, 4, 3, 2 or 1 administration of the anti-GITR agonist agent, such as an antibody.
  • One cycle preferably comprises 4 administrations with one administration every two weeks.
  • the treatment may be a monotherapy or part of a combination therapy.
  • An anti-GITR agonist agent e.g., Ab
  • a subject having cancer e.g., an advanced solid tumor
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., Ab
  • an anti-GITR agonist agent e.g., Ab
  • an anti-GITR agonist agent e.g., an Ab, once every week, once every two weeks, once every 3 weeks, once every 4 weeks, once every 5 weeks, once every 6 weeks, once every 7 weeks or once every 8 weeks.
  • the treatment may be administered in 8 week cycles, e.g., one 8 week cycle, two 8 week cycles, three 8 week cycles, four 8 week cycles, five 8 week cycles, six 8 week cycles, or more.
  • the anti-PD-1 or anti-PD-Ll antagonist, e.g., antibody may be administered at a flat dose of, e.g., 100-500 mg, 200 mg-500 mg, 100-300 mg, such as, 200-300 mg, 220-260 mg, 230-250 mg, 120 mg, 240 mg or 480 mg.
  • An anti-GITR agonist agent e.g., Ab
  • a first therapy may be administered to a subject having cancer, e.g., an advanced solid tumor, for 1-6 cycles, followed by a rest period (a "follow-up period") and then retreatment with an anti-GITR agonist agent, e.g., Ab, as monotherapy or combination therapy (a "second therapy").
  • the first dose of the re-treatment i.e., second therapy
  • the first dose of the retreatment occurs within 12 months of the last dose of the first therapy.
  • Exemplary combination therapies comprise an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., an antagonist Ab.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-GITR agent e.g., Ab
  • an anti-GITR agent may be administered by infusion for a period of 30-60 minutes, followed by an infusion of an anti-PD-1 or anti-PD-Ll agent over a period of 30-60 minutes.
  • an anti-PD-1 or anti-PD-Ll agent is administered by infusion for a period of 30-60 minutes, followed by an infusion of an anti-GITR agonist agent, e.g., Ab, over a period of 30-60 minutes.
  • an anti-GITR agonist agent e.g., Ab
  • the two infusions are separated by a time period, e.g., 10 minutes, 30 minutes, 60 minutes, 2 hours, 3 hours, 6 hours, 12 hours, 24 hours, 10 minutes to 12 hours, 10 minutes to 6 hours, 10 minutes to 3 hours, or 20 minutes to 2 hours.
  • An anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., Ab
  • An exemplary combination therapy comprises administering an anti-GITR agonist agent, e.g., Ab, in combination with the anti-PD-1 Ab nivolumab.
  • an anti-GITR agonist agent e.g., Ab
  • Nivolumab may be administered at a flat dose of 240 mg every two weeks.
  • An anti-GITR agonist agent e.g., Ab
  • may be administered via infusion e.g., an infusion over a period of at least 30 minutes, e.g., 30-60 or 30-90 minutes.
  • an anti-GITR agonist agent, e.g., Ab may be administered by infusion over a period of 30 minutes or a period of 60 minutes.
  • An anti-GITR agent e.g., Ab, e.g., for administration by infusion, may be provided as a formulation of 1 mg/ml, 2 mg/ml, 3 mg/ml, 4 mg/ml, 5 mg/ml, 6 mg/ml, 7 mg/ml, 8 mg/ml, 9 mg/ml, 10 mg/ml, 20 mg/ml or more.
  • An exemplary treatment comprises administering to a subject having an advanced solid tumor a 1 mg flat dose of an anti-GITR agonist agent, e.g., Ab, administered as an IV infusion, e.g., over 60 minutes, every 2 weeks.
  • a treatment may comprise
  • a treatment may comprise administering to a subject having an advanced solid tumor a 3 mg flat dose of an anti-GITR agonist agent, e.g., Ab, administered as an IV infusion, e.g., over 60 minutes, every 2 weeks.
  • a treatment may comprise administering to a subject having an advanced solid tumor a 10 mg flat dose of an anti-GITR agonist agent, e.g., Ab, administered as an IV infusion, e.g., over 60 minutes, every 2 weeks.
  • a treatment may comprise administering to a subject having an advanced solid tumor a 30 mg flat dose of an anti-GITR agonist agent, e.g., Ab, administered as an IV infusion, e.g., over 60 minutes, every 2 weeks.
  • a treatment may comprise administering to a subject having an advanced solid tumor a 100 mg flat dose of an anti-GITR agonist agent, e.g., Ab, administered as an IV infusion, e.g., over 60 minutes, every 2 weeks.
  • a treatment may comprise administering to a subject having an advanced solid tumor a 240 mg flat dose of an anti-GITR agonist agent, e.g., Ab, administered as an IV infusion, e.g., over 800 minutes, every 2 weeks.
  • a treatment may comprise administering to a subject having an advanced solid tumor a 800 mg flat dose of an anti-GITR agonist agent, e.g., Ab, administered as an IV infusion, e.g., over 800 minutes, every 2 weeks.
  • An exemplary combination treatment comprises administering to a subject having an advanced solid tumor a 1 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 240 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 2 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 3 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 240 mg, both administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 2 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 10 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 240 mg, both administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 2 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 30 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 240 mg, both administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 2 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 100 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD- Ll antagonist agent, e.g., nivolumab, at a flat dose of 240 mg, both administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 2 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD- Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 240 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 240 mg, both administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 2 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 800 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 240 mg, both administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 2 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • An exemplary combination treatment comprises administering to a subject having an advanced solid tumor a 1 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 120 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every week.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 3 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 120 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every week.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 10 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 120 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every week.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 30 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti- PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 120 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every week.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti- PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 100 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 120 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every week.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 240 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 120 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every week.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 800 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti- PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 120 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every week.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti- PD-Ll antagonist agent e.g., nivolumab
  • combination treatment may exhibit a therapeutic synergy.
  • An exemplary combination treatment comprises administering to a subject having an advanced solid tumor a 1 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 360 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 3 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 3 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 360 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 3 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 30 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti- PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 360 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 3 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 100 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 360 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 3 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 240 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 360 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 3 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 360 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti- PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 360 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 3 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 460 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 360 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 3 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 600 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 360 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 3 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 800 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti- PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 360 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 3 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • An exemplary combination treatment comprises administering to a subject having an advanced solid tumor a 1 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 480 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 4 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 3 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 480 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 4 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 30 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti- PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 480 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 4 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 100 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 480 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 4 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 240 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 480 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 4 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 360 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti- PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 480 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 4 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 480 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 480 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 4 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 600 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 480 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 4 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a treatment may comprise administering to a subject having an advanced solid tumor a 800 mg flat dose of an anti-GITR agonist agent, e.g., Ab, and an anti- PD-1 or anti-PD-Ll antagonist agent, e.g., nivolumab, at a flat dose of 480 mg, administered together or separately, as one or two IV infusions, e.g., over 30-60 minutes each, every 4 weeks.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., nivolumab
  • a combination treatment may exhibit a therapeutic synergy.
  • An anti-GITR agonist agent e.g., Ab
  • lung cancer such as non-small cell lung cancer (NSCLC), e.g., NSCLC subjects with progressive or recurrent disease during or after prior platinum doublet-based chemotherapy, followed by recurrent or progressive disease (per RECIST vl. l) during or after subsequent anti-PD-1 or anti- PD-L1 therapy.
  • An anti-GITR agonist agent, e.g., Ab may be administered to patients who have cervical cancer, such as persistent, recurrent or metastatic cervical cancer.
  • An anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll agent e.g., nivolumab
  • an anti- PD-1 or anti-PD-Ll agent e.g., nivolumab
  • NSCLC subjects with progressive or recurrent disease during or after prior platinum doublet-based chemotherapy followed by progressive or recurrent disease (per RECIST vl .l) during or after subsequent anti-PD-1 or anti-PD-Ll therapy ii) NSCLC subjects with progressive or recurrent disease during or after platinum doublet-based chemotherapy with no prior anti-PD-1 or anti-PD- LI therapy, and (iii) persistent, recurrent or metastatic cervical cancer.
  • Treatment may consists of up to three, 8-week treatment cycles, wherein, e.g., each treatment cycle comprises 4 doses of an anti-GITR agonist agent, e.g., Ab administered every 2 weeks on Days 1, 15, 29, and 43 of the treatment cycle.
  • each treatment cycle may comprise 4 doses of an anti-GITR agonist agent, e.g., Ab, (administered on Days 1, 15, 29 and 43) in combination with 4 doses of an anti-PD-1 or anti-PD- Ll agent, e.g., nivolumab, administered on Days 1, 15, 29, and 43 of the treatment cycle.
  • the anti-PD-1 or an anti-PD-Ll agent may be given first followed by the anti-GITR agonist agent, e.g., Ab, at least 30 minutes (e.g., 30 minutes to 3, 4, or 5 hours) after completion of the infusion of the anti-PD-1 or an anti-PD-Ll agent.
  • Subjects completing approximately 24 weeks (e.g., 6 months) of treatment with ongoing disease control may receive an additional 3 cycles of monotherapy or combination therapy beyond the initial 24 weeks.
  • Cancer may be monitored by radiologic (e.g., tumor scans) and clinical tumor assessments, e.g., every 12 weeks or every six months.
  • Patients receiving an anti-GITR agonist agent, e.g., Ab, as monotherapy or as part of a combination therapy may have post-chemotherapy NSCLC or advanced/metastatic cervical cancer.
  • the decision to treat a subject with additional cycles of anti-GITR agonist agent, e.g., Ab, as monotherapy or combination therapy may be based on tumor assessment (e.g., evaluation performed between Days 49 and 56 of each cycle and completed before the first dose in the next cycle). Tumor progression or response endpoints may be assessed using RECIST vl.l criteria for solid tumors.
  • subjects having NSCLC are treated with an anti-GITR agonist agent, e.g., Ab, as monotherapy or combination therapy
  • an anti-GITR agonist agent e.g., Ab
  • the subjects with progressive or recurrent disease during or after platinum doublet-based chemotherapy have progressive or recurrent disease during or after platinum doublet-based chemotherapy;
  • the subjects with non- squamous histology have a known EGFR and ALK status;
  • the subjects with an activating EGFR mutation have received an EGFR tyrosine kinase inhibitor; and/or the subjects with an ALK translocation have received an ALK inhibitor.
  • subjects having a solid tumor e.g., advanced solid tumor, such as cervical cancer
  • an anti-GITR agonist agent e.g., Ab
  • the subjects have persistent, recurrent or metastatic cervical cancer with documented disease progression; the subject have squamous,
  • adenosquamous or adenocarcinoma histology the subjects have had one prior systemic chemotherapeutic regimen (e.g. paclitaxel/cisplatin, paclitaxel/cisplatin/bevacizumab) for persistent, recurrent, or metastatic disease; the subjects had chemotherapy administered concurrently with primary radiation (e.g. weekly cisplatin), adjuvant chemotherapy given following completion of radiation therapy or as concurrent chemotherapy and radiation therapy (e.g. paclitaxel and carboplatin for up to 4 cycles); the subjects are HPV positive or negative; the subjects have ECOG performance status of ⁇ 1; the subjects have at least one lesion with measurable disease as defined by RECIST vl.
  • paclitaxel/cisplatin paclitaxel/cisplatin/bevacizumab
  • primary radiation e.g. weekly cisplatin
  • adjuvant chemotherapy e.g. paclitaxel and carboplatin for up to 4 cycles
  • the subjects had prior exposure to therapy with any agent specifically targeting checkpoint pathway inhibition (such as anti-PD- 1, anti-PD-Ll, anti-PDL-2, anti-LAG-3, antiCTLA-4 antibody), preferably with a washout period of any time greater than 4 weeks from the last treatment; the subjects experienced prior Grade 1 to 2 checkpoint therapy-related immune-mediated adverse events, which subjects may or not have confirmed recovery from these events at the time of the beginning of the anti-GITR agonist agent, e.g., Ab, therapy, other than endocrinopathies treated with supplementation, as documented by resolution of all related clinical symptoms, abnormal findings on physical examination, and/or associated laboratory abnormalities; and/or subjects had prior > Grade 3 checkpoint therapy-related immune adverse events; the subjects had prior therapy with any agent specifically targeting T-cell co-stimulation pathways, such as anti- CD 137, anti-OX40 antibody, preferably with a washout period of any time greater than 4 weeks
  • a patient receiving a treatment described herein may be a patient having one or more of the inclusion criteria set forth in Example 1, or not having one or more of the exclusion criteria set forth in Example 1.
  • subjects having a solid tumor e.g., advanced solid tumor, such as cervical cancer
  • an anti-GITR agonist agent e.g., Ab
  • the subjects have no known or suspected central nervous system (CNS) metastases, untreated CNS metastases, or have the CNS as the only site of disease, except that the subject may have controlled brain metastases (i.e., no radiographic progression for at least 4 weeks following radiation and/or surgical treatment (or 4 weeks of observation if no intervention is clinically indicated), and off of steroids for at least 2 weeks, and no new or progressive neurological signs and symptoms; the subjects have no known carcinomatous meningitis.
  • CNS central nervous system
  • a method of treatment with an anti-GITR agonist Ab comprises administering the anti-GITR agonist agent, e.g., Ab, into one or more tumors, e.g., solid tumors, of the subject. Administration into a tumor can be via injection into the tumor.
  • the anti-GITR agent, e.g., Ab is administered both parenterally (e.g.,
  • an anti- GITR agent e.g., Ab
  • a subject is administered intratumorally in a single dose, or
  • every week, every 2 weeks, every 3 weeks, or once a month e.g., until tumor shrinkage.
  • 0.01 mg, 0.05 mg, 0.1 mg, 0.5 mg, 1 mg, 2 mg, 5 mg, 7 mg or 10 mg of an anti-GITR agent, e.g., Ab is administered intratumorally as a single dose, every week, every 2 weeks, every 3 weeks, or once a month, e.g., until tumor shrinkage.
  • lower amounts of the agent, e.g., Ab may be administered, e.g., 1 ⁇ g, 3 ⁇ g, 5 ⁇ g, 10 ⁇ g, 25 ⁇ g, 50 ⁇ g, or 100 ⁇ g.
  • An anti-PD-1 or PD-L1 antagonist Ab may be co-administered with an anti-GITR agonist agent, e.g., Ab, into one or more tumors in a subject.
  • the anti-PD-1 or PD-L1 Ab may be administered at the same time, before, or after administration of the anti-GITR agent, e.g., Ab.
  • the anti-PD-1 or PD-L1 Ab may be injected into a tumor at the same time as the anti-GITR agent, e.g., Ab, is injected into the tumor.
  • the two agents are co-formulated prior to administration into a tumor.
  • one agent is administered parenterally and one agent is administered directly into one or more tumors.
  • an anti-PD-1 agent, e.g., Ab, or PD-L1 agent, e.g., Ab is administered parenterally and an anti-GITR agent, e.g., Ab, is administered intratumorally.
  • Anti-tumor activity of an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or anti-PD-Ll antagonist agent e.g., Ab, e.g., nivolumab
  • an increase in overall survival e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 16, 24 months or more, relative to a subject treated with a placebo.
  • Efficacy of treatment may be determined by measurement of the objective response rate (ORR). ORR and corresponding 2-sided exact 95% exact confidence interval by the Clopper and Pearson method may be determined. Median duration of response and corresponding two-sided 95% confidence interval may be determined.
  • Duration of response may be analyzed using the Kaplan-Meier method.
  • Progression free survival rate PFSR
  • the probability of a subject remaining progression free or surviving to 24 weeks may be estimated by the Kaplan-Meier methodology.
  • the corresponding 90% confidence interval may be derived based on Greenwood formula.
  • Overall survival may be plotted using the Kaplan-Meier method.
  • a GITR agonist agent is an agent that enhances the activity that normally results from the interaction between GITR and GITRL.
  • a GITR agonist agent is an antibody or a variant thereof, such as a multimer thereof, or single chain or antigen binding fragment or bi- specific agent.
  • a GITR agonist agent is human GITRL or a variant thereof, such as a fragment thereof, a fusion protein (comprising full length or a GITR binding fragment of GITRL) or a multimer of the full length or a GITR binding fragment of GITRL).
  • Exemplary GITR agonist agents include the following antibodies or multimers thereof or GITRL based molecules:
  • Anti-GITR agonist Abs for use in the methods described herein may be monoclonal antibodies, in particular human monoclonal antibodies that specifically bind GITR and have desirable functional properties, e.g., high affinity binding to human GITR and the ability to stimulate antigen- specific T cell responses. Antigen binding fragments of such Abs may also be used.
  • anti-GITR agonist Abs or antigen binding portions thereof, which bind to
  • GITR may exhibit at least one of the following properties:
  • T cell activation e.g., antigen specific T cell activation
  • the anti-GITR agonist antibodies, or antigen binding portions thereof, described herein stimulate an anti-tumor immune response, for example, an antigen- specific T cell response.
  • the anti-GITR agonist antibodies, or antigen binding portions thereof increase cytokine production (e.g., IL-2 and/or IFN- ⁇ ) in GITR- expressing T cells and/or increase T cell proliferation.
  • the anti-GITR agonist antibodies, or antigen binding portions thereof do not bind to Fc receptors.
  • the anti-GITR agonist antibodies, or antigen binding portions thereof bind to one or more FcyRs, e.g., activating or inhibitory, FcyRs.
  • the anti-GITR agonist antibodies, or antigen binding portions thereof bind to soluble human GITR with a K D of 100 nM or less as measured by Biacore, bind to membrane bound human GITR with a K D of 10 nM or less as measured by Scatchard, bind to membrane bound human GITR with an EC50 of 1 nM or less as measured by FACS, bind to membrane bound cynomolgus GITR with an EC50 of 10 nM or less as measured by FACS, induce or enhance T cell, e.g, T e ff cell, activation without requiring multivalent cross-linking, inhibit the binding of GITR ligand to GITR with an EC50 of 1 ⁇ g/mL or less as measured by FACS, and/or bind within the regions PTGGPGCGPGRLLLGTGT (SEQ ID NO: 217) and CRDYPGEE (SEQ ID NO: 218) of mature human GITR (SEQ ID NO:
  • isolated anti-GITR agonist monoclonal antibodies which specifically bind to GITR and comprise the three variable heavy chain CDRs and the three variable light chain CDRs that are in the variable heavy chain and variable light chain pairs selected from:
  • heavy chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 62, 63, and 64, respectively, and/or light chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 68, 69, and 70, respectively;
  • heavy chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 106, 107, and 108, respectively, and/or light chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 112, 113, and 114, respectively;
  • heavy chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 122, 123, and 124, respectively, and/or light chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 125, 126, and 127, respectively;
  • heavy chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 138, 139, and 140, respectively, and/or light chain CDRl, CDR2, and CDR3 sequences comprising SEQ ID NOs: 144, 145, and 146, respectively; or
  • anti-GITR agonist antibodies e.g., monoclonal antibodies, or antigen binding portions thereof, which bind to GITR and comprise heavy and light chain variable region sequences at least 85% identical, for example, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical, to the amino acid sequences selected from the group consisting of:
  • anti-GITR agonist antibodies e.g., monoclonal antibodies, or antigen binding portions thereof, which bind to GITR and comprise heavy chain and light chain sequences at least 80%, 85%, 90%, 95%, 96%, 97%, 98% 99%, or 100% identical to the amino acid sequences selected from the group consisting of:
  • anti-GITR agonist antibodies comprising a VHCDR1, VHCDR2, VHCDR3, VLCDRl, VLCDR2, and/or VLCDR3 that differs from the corresponding CDR of 28F3, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, 19D3, 18E10, and/or 6G10, in 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, or 1-5 amino acid changes (i.e., amino acid substitutions, additions or deletions).
  • an anti-GITR antibody comprises 1-5 amino acid changes in each of 1, 2, 3, 4, 5 or 6 of the CDRs relative to the corresponding sequence in 28F3, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, 19D3, 18E10, and/or 6G10. In certain embodiments, an anti-GITR antibody comprises at total of 1-5 amino acid changes across all CDRs relative to the CDRs in 28F3, 3C3-1, 3C3-2, 2G6, 8A6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, 19D3, 18E10, and/or 6G10.
  • an anti-GITR antibody comprises VH and VL CDRs consisting of those of 28F3, wherein one or more of the amino acids in one or more CDRs are those of one of the other anti-GITR agonist antibodies disclosed herein.
  • an anti-GITR agonist antibody comprises a VHCDR1 comprising one or more amino acid modifications relative to SYGMH (SEQ ID NO: 20), and may comprise, e.g., one of the following degenerate sequences:
  • SYGXH (SEQ ID NO: 372), wherein X is any amino acid, e.g., M or F;
  • Xi is any amino acid, e.g., S,N or D; and X 2 is any amino acid, e.g.,
  • Xi is any amino acid, e.g., S,N or D
  • X 2 is any amino acid, e.g., M or F
  • X3 is any amino acid, e.g., H or Q.
  • an anti-GITR agonist antibody comprises a VHCDR2 comprising one or more amino acid modifications relative to VIWYEGSNKYYADSVKG (SEQ ID NO: 21), and may comprise one of the following degenerate sequences:
  • VIWYX1GSNKX2YADSVKG (SEQ ID NO: 373), wherein Xi is any amino acid, e.g., E or A; and X 2 is any amino acid, e.g., Y or F; and
  • VIWYX1GSNKX2YX3DSVKG (SEQ ID NO: 374), wherein Xi is any amino acid, e.g., E, A, G or D; X 2 is any amino acid, e.g., Y or F; and X3 is any amino acid, e.g., A or V.
  • an anti-GITR agonist antibody comprises a VHCDR3 comprising one or more amino acid modifications relative to GGSMVRGDYYYGMDV(SEQ ID NO: 22), and may comprise, e.g., one of the following degenerate sequences:
  • GGS X 1 VRGD Y Y YGMD V (SEQ ID NO: 375), wherein Xi is any amino acid, e.g., M or V, L, I or A.
  • GGS X 1 VRGX 2 YY YGMD V (SEQ ID NO: 376), wherein Xi is any amino acid, e.g., M or V, L, I or A; and X 2 is any amino acid, e.g., D or E.
  • Xi and X 2 are set forth in the Examples.
  • GG (6-7aa) MDVWYYXiMDVW (SEQ ID NO: 377), wherein Xi is any amino acid, e.g., G, S or V.
  • the 6-7 amino acids correspond to the amino acids at that position in a VHCDR3 sequence of an anti-GITR antibody disclosed herein.
  • an anti-GITR agonist antibody comprises a VLCDR1
  • RASQGISSALA SEQ ID NO: 23
  • RASQGISSALA SEQ ID NO: 23
  • RASQGISSXLA (SEQ ID NO: 378), wherein X is any amino acid, e.g., A or W (or A, W or Y); and
  • RASQG (2-3 aa) SXiLA (SEQ ID NO: 379), wherein Xi is any amino acid, e.g., W, Y or A and the 2-3 amino acids are any amino acids, e.g., GI, SVS or SVT.
  • an anti-GITR agonist antibody comprises a VLCDR2
  • DASSLES comprising one or more amino acid modifications relative to DASSLES (SEQ ID NO: 24), and may comprise, e.g., one of the following degenerate sequences:
  • DASSLXS (SEQ ID NO: 380), wherein X is any amino acid, e.g., E or Q; and
  • X1ASSX2X3X4 wherein Xi is any amino acid, e.g., A, D or G; X 4 is any amino acid, e.g., L or R; X3 is any amino acid, e.g., Q, E or A; and X 4 is any amino acid, e.g., S or T.
  • an anti-GITR agonist antibody comprises a VLCDR3
  • QQFNSYPYT SEQ ID NO: 25
  • SEQ ID NO: 25 may comprise, e.g., one of the following degenerate sequences:
  • QQXNSYPYT (SEQ ID NO: 381), wherein X is any amino acid, e.g., F or Y;
  • QQX1X2SX3PX4T (SEQ ID NO: 382), wherein Xi is any amino acid, e.g., F or Y; X 2 is any amino acid, e.g., N or G; X3 is any amino acid, e.g., Y or S; and X 4 is any amino acid, e.g., Y, W, I, P or Q.
  • the isolated monoclonal antibodies, or antigen binding portions thereof (a) bind to the same epitope on GITR as 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 9G7- 1, 9G7-2, 14E3, 19H8-1, 19H8-2 and/or 6G10, and/or (b) inhibit binding of 28F3, 19D3, 18E10, 3C3-1, 3C3-2, 2G6, 9G7-1, 9G7-2, 14E3, 19H8-1, 19H8-2, and/or 6G10 to GITR on activated T cells by at least 50%, 60%, 70%, 80% or 90% as measured by, e.g., FACS.
  • the anti-GITR agonist antibodies, or antigen binding portions thereof bind within the regions PTGGPGCGPGRLLLGTGT (SEQ ID NO: 217) and CRDYPGEE (SEQ ID NO: 218) of mature human GITR (SEQ ID NO: 4). In some embodiments, the anti-GITR agonist antibodies, or antigen binding portions thereof, described herein, bind to both human and cynomolgus GITR.
  • the anti-GITR agonist antibodies, or antigen-binding portions thereof are IgGl, IgG2, IgG3, or IgG4 antibodies, or variants thereof.
  • the anti-GITR agonist antibodies, or antigen-binding portions thereof comprise an effectorless IgGl Fc, for example, an effectorless IgGl Fc with the following mutations: L234A, L235E, G237A, A330S and P331S.
  • the anti-GITR agonist antibodies, or antigen-binding portions thereof comprise an Fc binding to, or having enhanced binding to, an activating FcyR, e.g., relative to a wild-type IgGl Fc.
  • methionine residues in the CDR regions of the anti-GITR agonist antibodies, or antigen-binding portions thereof are substituted for amino acid residues that do not undergo oxidation.
  • the anti-GITR agonist antibodies, or antigen-binding portions thereof are human or humanized antibodies.
  • Anti-GITR agonist antibodies, or antigen binding portions thereof may comprise a modified heavy chain constant region that comprises an IgG2 hinge and at least one of CHI, CH2 and CH3 that is not of an IgG2 isotype, wherein the anti-GITR agonist antibody has enhanced agonist activity relative to the same anti-GITR antibody but with a non-IgG2 hinge.
  • the modified heavy chain constant region comprises a heavy chain constant region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 223-226 and 283-290 or a heavy chain constant region that differs therefrom in at most 5 amino acids or is at least 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of SEQ ID NOs: 223-226 and 283-290.
  • the heavy chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 17, 18, 28, 30, 31, 41, 43, 44, 55, 58, 59, 73, 75, 76, 86, 88, 89, 100, 102, 103, 117, 119, 120, 131, 134, 135, 227-275, 337, 339, 340, 348-352, 361, and 362, or a heavy chain that differs therefrom in at most 10 amino acids or is at least 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of SEQ ID NOs: 15, 17, 18, 28, 30, 31, 41, 43, 44, 55, 58, 59, 73, 75, 76, 86, 88, 89, 100, 102, 103, 117, 119, 120, 131, 134, 135, 227- 275, 337, 339, 340, 348-352, 361, and 362.
  • the light chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 16, 19, 29, 32, 42, 45, 56, 57, 60, 61, 74, 87, 90, 101, 104, 105, 118, 121, 132, 133, 136, 137, 338, 341, and 371 or a light chain that differs therefrom in at most 10 amino acids or is at least 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of SEQ ID NOs: 16, 19, 29, 32, 42, 45, 56, 57, 60, 61, 74, 87, 90, 101, 104, 105, 118, 121, 132, 133, 136, 137, 338, 341, and 371.
  • amino acid substitutions may be conservative amino acid substitutions.
  • anti-GITR agonist antibodies that may be administered as described herein include antibodies comprising the CDR sequences, VH and VL chains or heavy and light chains of (i) TRX-518 or 6C8, as described, e.g., in WO2006/105021 and Schaer et al. Curr Opin Immunol. (2012) Apr; 24(2): 217-224; (ii) an anti-GITR antibody described in WO2011/028683, e.g., MK4166; an anti-GITR antibody described in JP2008278814; or an anti-GITR antibody described in WO2015/031667.
  • an anti-GITR agonist antibody is an antibody that cross-competes with TRX518, MK4166, MK-1248 or an anti-GITR antibody described in WO2015/031667.
  • an anti-GITR antibody for the present composition binds the same epitope as TRX518, MK4166 or an anti-GITR antibody described in WO2015/031667.
  • an anti-GITR agonist antibody comprises six CDRs of TRX518, MK4166, MK- 1248 or an anti-GITR antibody described in WO2015/031667.
  • the heavy chain of an anti-GITR Ab or other Ab described herein may or may not comprise the C-terminal lysine (K), as this amino acid is frequently cleaved off.
  • An anti-GITR agonist antibody may be administered with an anti-PDl antibody or an anti-
  • PD-Ll antibody is a key immune checkpoint receptor expressed by activated T and B cells and mediates immunosuppression.
  • PD-1 is a member of the CD28 family of receptors, which includes CD28, CTLA-4, ICOS, PD-1, and BTLA.
  • Two cell surface glycoprotein ligands for PD- 1 have been identified, Programmed Death Ligand-1 (PD-L1) and Programmed Death Ligand-2 (PD-L2), that are expressed on antigen-presenting cells as well as many human cancers and have been shown to down regulate T cell activation and cytokine secretion upon binding to PD-1. Inhibition of the PD-1/PD-L1 interaction mediates potent antitumor activity in preclinical models.
  • HuMAbs that bind specifically to PD-1 with high affinity have been disclosed in U.S. Patent Nos. 8,008,449 and 8,779,105.
  • Other anti-PD-1 mAbs have been described in, for example, U.S. Patent Nos. 6,808,710, 7,488,802, 8,168,757 and 8,354,509, and PCT Publication No. WO 2012/145493.
  • the anti-PD-1 Ab is nivolumab.
  • Nivolumab also known as "OPDIVO ® "; formerly designated 5C4, BMS-936558, MDX-1106, or ONO-4538
  • OPDIVO ® is a fully human IgG4 (S228P) PD-1 immune checkpoint inhibitor Ab that selectively prevents interaction with PD-1 ligands (PD-L1 and PD-L2), thereby blocking the down-regulation of antitumor T-cell functions
  • S228P PD-1 immune checkpoint inhibitor Ab that selectively prevents interaction with PD-1 ligands (PD-L1 and PD-L2), thereby blocking the down-regulation of antitumor T-cell functions
  • Nivolumab can also be referred to as BMS-936558, MDX-1106 ONO-4538, or by its CAS Registry No. 946414-94-4, and is disclosed as antibody 5C4 in WO 2006/121168, incorporated herein by reference in its entirety and for all purposes.
  • Nivolumab is a human monoclonal antibody that specifically binds to PD1 and comprises a light chain variable region provided as SEQ ID NO: 397, and a heavy chain variable region provided as SEQ ID NO: 395.
  • Nivolumab may also be described as an antibody comprising a light chain CDR1 having amino acids 24-34 of SEQ ID NO: 397, a light chain CDR2 having amino acids 50-56 of SEQ ID NO: 397, and a light chain CDR3 having amino acids 89-97 of SEQ ID NO: 397; and comprising a heavy chain CDR1 having amino acids 31-35 of SEQ ID NO: 395, a heavy chain CDR2 having amino acids 50-66 of SEQ ID NO: 395, and a heavy chain CDR3 having amino acids 99-102 of SEQ ID NO: 395.
  • compositions of BMS-936558 include all pharmaceutically acceptable compositions comprising BMS-936558 and one or more diluents, vehicles and/or excipients.
  • BMS-936558 may be administered by I.V.
  • Light chain variable region for Nivolumab :
  • EIVLTQS P ATLS LS PGERATLS CR AS QS VS S YLA W YQQKPGQ APRLLIYD AS NRATGIP A RFS GS GS GTDFTLTIS SLEPEDFA VY YCQQS SNWPRTFGQGTKVEIK (SEQ ID NO: 397)
  • the anti-PD-1 Ab is pembrolizumab.
  • Pembrolizumab also known as "KEYTRUDA ® ", lambrolizumab, and MK-3475
  • KEYTRUDA ® a humanized monoclonal IgG4 antibody directed against human cell surface receptor PD-1 (programmed death- 1 or programmed cell death-1).
  • Pembrolizumab has been approved by the FDA for the treatment of relapsed or refractory melanoma.
  • the anti-PD-1 Ab is MEDI0608 (formerly AMP-514), which is a monoclonal antibody.
  • the anti-PD-1 antibody is Pidilizumab (CT-011), which is a humanized monoclonal antibody.
  • CT-011 Pidilizumab
  • CT-011 a humanized monoclonal antibody.
  • Pidilizumab is described in US Pat. No. 8,686,119 B2 or WO 2013/014668 Al. The specificity of CT-011 for PD-1 binding has been questioned.
  • Anti-PD-1 Abs useful for the disclosed compositions also include isolated Abs that bind specifically to human PD-1 and compete or cross-compete for binding to human PD-1 with nivolumab ⁇ see, e.g., U.S. Patent Nos. 8,008,449 and 8,779,105; WO 2013/173223) or other anti- PD-1 Ab.
  • the ability of Abs to compete or cross-compete for binding to an antigen indicates that these Abs bind to the same or similar epitope region of the antigen and sterically hinder the binding of other competing or cross-competing Abs to that particular epitope region.
  • Competing or cross-competing Abs are expected to have functional properties very similar to those of the antibody that they compete with, e.g., nivolumab, by virtue of their binding to the same or similar epitope region of PD-1.
  • Competing or cross-competing Abs can be readily identified based on their ability to compete or cross-compete, respectively, with nivolumab (or other anti-PD-1 Ab) in standard PD-1 binding assays such as Biacore analysis, ELISA assays or flow cytometry (see, e.g., WO 2013/173223).
  • Cross -competing refers to competing in both directions.
  • the Abs that compete or cross-compete for binding to human PD- 1 with, or bind to the same or similar epitope region of human PD-1 as, e.g., nivolumab are mAbs.
  • these competing or cross-competing Abs can be chimeric Abs, or humanized or human Abs.
  • Such chimeric, humanized or human mAbs can be prepared and isolated by methods well known in the art.
  • Anti-PD-1 Abs useful for the compositions of the disclosed invention also include antigen- binding portions of the above Abs. It has been amply demonstrated that the antigen-binding function of an Ab can be performed by fragments of a full-length Ab. Examples of binding fragments encompassed within the term "antigen-binding portion" of an Ab include (i) a Fab fragment, a monovalent fragment consisting of the VL, V3 ⁇ 4 CL and Cm domains; (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V# and Cm domains; and (iv) a Fv fragment consisting of the V L and V# domains of a single arm of an Ab.
  • Fab fragment a monovalent fragment consisting of the VL, V3 ⁇ 4 CL and Cm domains
  • F(ab') 2 fragment a bivalent fragment comprising two Fab fragments
  • Anti-PD-1 Abs suitable for use in the disclosed compositions are Abs that bind to PD-1 with high specificity and affinity, block the binding of PD-L1 and or PD-L2, and inhibit the immunosuppressive effect of the PD-1 signaling pathway.
  • an anti-PD-1 "antibody” includes an antigen-binding portion or fragment that binds to the PD-1 receptor and exhibits the functional properties similar to those of whole Abs in inhibiting ligand binding and upregulating the immune system.
  • the anti- PD-1 Ab or antigen-binding portion thereof cross-competes with nivolumab for binding to human PD-1.
  • the anti-PD-1 Ab or antigen-binding portion thereof is a chimeric, humanized or human monoclonal Ab or a portion thereof.
  • the Ab is a humanized Ab.
  • the Ab is a human Ab. Abs of an IgGl, IgG2, IgG3 or IgG4 isotype can be used.
  • the anti-PD-1 Ab or antigen-binding portion thereof comprises a heavy chain constant region which is of a human IgGl or IgG4 isotype.
  • the sequence of the IgG4 heavy chain constant region of the anti-PD-1 Ab or antigen-binding portion thereof contains an S228P mutation which replaces a serine residue in the hinge region with the proline residue normally found at the corresponding position in IgGl isotype antibodies. This mutation, which is present in nivolumab, prevents Fab arm exchange with endogenous IgG4 antibodies, while retaining the low affinity for activating Fc receptors associated with wild-type IgG4 antibodies (Wang et al., 2014).
  • the Ab comprises a light chain constant region which is a human kappa or lambda constant region.
  • the anti-PD-1 Ab or antigen-binding portion thereof is a mAb or an antigen-binding portion thereof.
  • the anti-PD-1 Ab is nivolumab.
  • the anti-PD-1 Ab is pembrolizumab.
  • the anti-PD-1 Ab is chosen from the human antibodies 17D8, 2D3, 4H1, 4A11, 7D3 and 5F4 described in U.S. Patent No. 8,008,449.
  • the anti-PD-1 Ab is MEDI0608 (formerly AMP-514), AMP-224, or Pidilizumab (CT-011).
  • An exemplary anti-PD- 1 antibody is 5C4 comprising heavy and light chains having the sequences shown in SEQ ID NOs: 393 and 394, respectively, or antigen binding fragments and variants thereof.
  • the antibody comprises the heavy and light chain CDRs or variable regions of 5C4. Accordingly, in one embodiment, the antibody comprises the CDR1, CDR2, and CDR3 domains of the VH of 5C4 having the sequence set forth in SEQ ID NO: 395, and the CDR1, CDR2 and CDR3 domains of the VL of 5C4 having the sequences set forth in SEQ ID NO: 397.
  • the antibody comprises VH CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs: 399-401, respectively, and VL CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs: 402-404, respectively.
  • the antibody comprises VH and/or VL regions having the amino acid sequences set forth in SEQ ID NO: 395 and/or SEQ ID NO: 397, respectively.
  • the antibody comprises the heavy chain variable (VH) and/or light chain variable (VL) regions encoded by the nucleic acid sequences set forth in SEQ ID NO: 396 and/or SEQ ID NO: 398, respectively.
  • the antibody competes for binding with and/or binds to the same epitope on PD-1 as the above-mentioned antibodies.
  • the antibody has at least about 90% variable region amino acid sequence identity with the above- mentioned antibodies (e.g., at least about 90%, 95% or 99% variable region identity with SEQ ID NO: 395 or SEQ ID NO: 397).
  • the PD1 antibodies exhibit one or more desirable functional properties, such as high affinity binding to PD-1, e.g., binding to human PD-1 with a K D of 10 "7 M or less; lack of significant cross -reactivity to other CD28 family members, e.g., CD28, CTLA- 4 and ICOS; the ability to stimulate T cell proliferation in a mixed lymphocyte reaction (MLR) assay; the ability to increase IFN- ⁇ and/or IL-2 secretion in an MLR; the ability to inhibit binding of one or more PD-1 ligands (e.g., PD-Ll and/or PD-L2) to PD-1; the ability to stimulate antigen-specific memory responses; the ability to stimulate antibody responses and/or the ability to inhibit growth of tumor cells in vivo.
  • MLR mixed lymphocyte reaction
  • the antibody to be administered with an anti-GITR Ab is an anti-GITR Ab
  • the anti-PD-Ll antibody is BMS-936559 (formerly 12A4 or MDX-1105) (see, e.g., U.S. Patent No.
  • an anti-PD-Ll antibody is avelumab, durvalumab (MEDI4736 (also known as Anti-B7-Hl)), MPDL3280A (also known as RG7446, atezolizumab and TECENTRIQ), MSB0010718C (WO2013/79174), or rHigM12B7.
  • anti-PD-Ll antibodies Any of the anti-PD-Ll antibodies disclosed in WO2013/173223, WO2011/066389, WO2012/145493, U.S. Patent Nos. 7,635,757 and 8,217,149 and U.S. Publication No. 2009/145493 may also be used.
  • Anti-PD-Ll antibodies that compete with and/or bind to the same epitope as that of any of these antibodies may also be used in the treatments described herein.
  • An exemplary anti-PD-Ll antibody is 12A4 (WO 2007/005874 and US Patent No.
  • the antibody comprises the heavy and light chain CDRs or VRs of 12A4. Accordingly, in one embodiment, the antibody comprises the CDRl, CDR2, and CDR3 domains of the VH region of 12A4 having the sequence shown in SEQ ID NO: 383 and the CDRl, CDR2 and CDR3 domains of the VL region of 12A4 having the sequence shown in SEQ ID NO: 385. In one embodiment, the antibody comprises the heavy chain CDRl, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs: 387-389, respectively, and the light chain CDRl, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs: 390-392, respectively.
  • the antibody comprises VH and/or VL regions having the amino acid sequences set forth in SEQ ID NO: 383 and/or SEQ ID NO: 385, respectively.
  • the antibody comprises the heavy chain variable (VH) and/or light chain variable (VL) regions encoded by the nucleic acid sequences set forth in SEQ ID NO: 384 and/or SEQ ID NO: 386, respectively.
  • the antibody competes for binding with, and/or binds to the same epitope on PD-Ll as, the above-mentioned antibodies.
  • the antibody has at least about 90% variable region amino acid sequence identity with the above-mentioned antibodies (e.g., at least about 90% , 95% or 99% variable region identity with SEQ ID NO: 383 or SEQ ID NO: 385).
  • a PD- 1/PD-L1 antagonist agent that may be used in the methods described herein include nivolumab, pembrolizumab, atelozilumab, durvalumab, REGN2810, PDR001, AMP-514 (MEDI0608), AMP-224, BGB-A317 or a PD- 1 or PD-Ll antagonist described in any one of the following publications: WO 2009/014708, WO 03/099196, WO 2009/114335 and WO 2011/161699.
  • compositions e.g. , a pharmaceutical compositions, containing anti-
  • GITR agonist antibodies alone or in combination with antibodies to other targets, e.g., PD-1 or PD-Ll, formulated together with a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g. , by injection or infusion).
  • the pharmaceutical compounds described herein may include one or more
  • a "pharmaceutically acceptable salt” refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g. , Berge, S.M., et al. (1977) J. Pharm. Sci. 66: 1-19). Examples of such salts include acid addition salts and base addition salts.
  • Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
  • nontoxic inorganic acids such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like
  • nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
  • Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as ⁇ , ⁇ '- dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
  • a pharmaceutical composition described herein may also include a pharmaceutically acceptable anti-oxidant.
  • pharmaceutically acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
  • water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
  • oil-soluble antioxidants such as ascorbyl palmitate, butylated
  • aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
  • polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
  • vegetable oils such as olive oil
  • injectable organic esters such as ethyl oleate.
  • Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, supra, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
  • Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions described herein is contemplated.
  • composition may comprise a preservative or may be devoid of a preservative.
  • Supplementary active compounds can be incorporated into the compositions.
  • compositions typically must be sterile and stable under the conditions of manufacture and storage.
  • the composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated herein.
  • the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD-1 or PD-L1 antagonist agent e.g., Ab
  • An exemplary pharmaceutical composition comprises an anti-PD-1 antibody, e.g.
  • nivolumab e.g., OPDIVO
  • MK-3475 pembrolizumab; KEYTRUDA
  • other PD- 1/PD-L1 axis antagonist e.g., described herein
  • an anti-GITR agonist agent e.g., described herein
  • antibody having the CDRs, variable regions or heavy and light chain sequences of 28F3.IgGl or 28F3.IgGl . l or other anti-GITR Ab described herein (e.g.
  • the ratio of the amount (e.g., concentration (e.g., mg/ml) or weight) of the anti-PD- 1 agent, e.g., antibody, to the amount of the anti-GITR agent, e.g., antibody, (e.g., concentration (e.g., mg/ml) or weight, respectively) is from 1 : 1-20; 1 : 1- 10; 1 : 1-5; 1 :2-5; 1 :2-3; 1 :3-5; 1-20: 1 ; 1-10: 1 ; 1-5: 1 ; 2-5: 1 ; 2-3: 1 ; or 3-5: 1.
  • the combination may be administered weekly, biweekly, once every three weeks, monthly once every 5 weeks or once every 6 weeks.
  • a flat dose of 10- 1000 such as 100-400 mg, e.g., 200-300 mg or 240 mg or 250 mg of an anti-PD-1 agent, e.g., antibody, (e.g., nivolumab) or anti-PD-Ll antagonist agent, e.g., antibody
  • an anti-GITR agonist agent e.g., Ab (e.g., 28F3.IgGl, 28F3.IgGl .
  • cancer e.g., advanced solid tumors, e.g., as an intravenous infusion over, e.g. , 30, 30-60, 60 or 60-90 minutes every 1, 2, 3, 4, 5 or 6 weeks.
  • anti-PD- 1 agent e.g., antibody, e.g. , nivolumab
  • anti-GITR agent e.g., antibody, e.g., 28F3.IgGl, 28F3.IgGl . l, TRX518, MK4166, MK-1248 or an Ab described in WO2015/031667 or elsewhere herein, e.g., as an intravenous infusion over, e.g. , 30, 30-60, 60 or 60-90 minutes every 1, 2, 3, 4, 5 or 6 weeks.
  • 2 mg/kg anti-PD- 1 antibody e.g.
  • MK-3475 is administered together, e.g. , as a fixed dose combination, with 0.1- 10 mg/kg, 0.1- 5 mg/kg, 0.5- 10 mg/kg, 0.5-5 mg/kg, 0.5-2 mg/kg, 1-2 mg/kg or 2-5 mg/kg anti-GITR agent, e.g., antibody, e.g. , MK4166 or MK-1248, e.g. , as an intravenous infusion over, e.g. , 30, 30-60 or 60 minutes every 1, 2, 3 or 4 weeks.
  • the amount of antibodies in mg/kg can be calculated to determine the weight (mg) or the concentration (mg/ml) of the antibodies required for a fixed dosing ratio formulation.
  • an anti-PD-1 agent e.g., Ab
  • an anti-GITR agent e.g., Ab
  • a lyophilized composition can comprise, e.g. , 50 mg of an anti-PD-1 agent, e.g., Ab, e.g. , MK3475, and 5-250 mg, about 10-250, about 30- 100 mg, about 30-70 mg or about 50 mg of an anti-GITR agent, e.g., Ab, e.g. , 28F3.IgGl, 28F3.IgGl .
  • an anti- GITR agonist agent e.g., Ab, described herein, e.g., 28F3.IgGl or 28F3.IgGl . l, or antigen- binding portion thereof.
  • the antibody may be a human anti-GITR agent, e.g., Ab, (such as any of the human anti-human GITR antibodies described herein). Additionally or alternatively, the antibody can be a chimeric or humanized anti-GITR antibody, e.g., a chimeric or humanized anti-GITR antibody comprising sequences of 28F3 or other anti-GITR antibodies described herein.
  • Cancers whose growth may be inhibited using the antibodies of the invention include cancers typically responsive to immunotherapy and those that are not typically responsive to immunotherapy. Cancers may be cancers with solid tumors (e.g., advanced solid tumors) or blood malignancies (liquid tumors).
  • cancers for treatment include squamous cell carcinoma, small-cell lung cancer, non-small cell lung cancer, squamous non- small cell lung cancer (NSCLC), non-squamous NSCLC, glioma, gastrointestinal cancer, renal cancer (e.g. clear cell carcinoma), ovarian cancer, liver cancer, colorectal cancer, endometrial cancer, kidney cancer (e.g., renal cell carcinoma (RCC)), prostate cancer (e.g.
  • prostate adenocarcinoma thyroid cancer
  • neuroblastoma pancreatic cancer
  • glioblastoma glioblastoma multiforme
  • cervical cancer stomach cancer
  • bladder cancer hepatoma
  • breast cancer colon carcinoma
  • head and neck cancer gastric cancer
  • gastric cancer germ cell tumor
  • pediatric sarcoma sinonasal natural killer
  • melanoma e.g., metastatic malignant melanoma, such as cutaneous or intraocular malignant melanoma
  • bone cancer skin cancer, uterine cancer, cancer of the anal region, testicular cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra
  • lymphomas such as Hodgkin's lymphoma (HL), non-Hodgkin's lymphoma (NHL), B cell hematologic malignancy, e.g., B-cell lymphomas, T-cell lymphomas, lymphoplasmacytoid lymphoma, monocytoid B-cell lymphoma, mucosa-associated lymphoid tissue (MALT) lymphoma, anaplastic (e.g., Ki 1+) large-cell lymphoma, adult T-cell lymphoma/leukemia, mantle cell lymphoma, angio immunoblastic T-cell lymphoma, angiocentric lymphoma, intestinal T-cell lymphoma, primary mediastinal B-cell lymphoma, precursor T-lymphoblastic lymphoma, T- lymphoblastic; and lymphoma/leuk
  • lymphomas such as Hodgkin's lymphoma (HL), non-Hodgkin's lymphoma
  • the methods described herein may also be used for treatment of metastatic cancers, unresectable and/or refractory cancers (e.g., cancers refractory to previous immunotherapy, e.g., with a blocking CTLA-4 or PD-1 antibody), and recurrent cancers.
  • the methods of treatment described herein may also be used to treat a subject who has progressed on an immuno therapy (e.g., immuno stimulating therapy), e.g., an anti-PDl or anti- PD-L1 treatment.
  • an immuno therapy e.g., immuno stimulating therapy
  • an anti-GITR agent e.g., Ab
  • a prior treatment e.g., a prior treatment with an immuno-oncology drug
  • patients having a cancer that is refractory or resistant either intrinsically refractory or resistant (e.g., refractory to a PD-1 pathway antagonist), or a wherein the resistance or refractory state is acquired.
  • subjects who are not responsive or not sufficiently responsive to a first therapy or who see disease progression following treatment may be treated by administration of an anti-GITR agent, e.g., Ab, alone or in combination with another therapy (e.g., with an anti-PD-1 therapy).
  • an anti-GITR agent e.g., Ab
  • another therapy e.g., with an anti-PD-1 therapy
  • an anti-GITR agent e.g., Ab
  • an immuno-oncology agent e.g., a PD-1 pathway antagonist (PD-l/PD-Ll axis antagonist or PD-l/PD-Ll antagonist).
  • An anti-GITR agent e.g., Ab
  • a PD-l/PD-Ll antagonist may be administered with a standard of care treatment.
  • An anti-GITR agent, e.g., Ab, and/or PD-l/PD-Ll antagonist may be administered as a maintenance therapy, e.g., a therapy that is intended to prevent the occurrence or recurrence of tumors.
  • An anti-GITR agent e.g., Ab
  • a PD-l/PD-Ll antagonist may be administered with another treatment, e.g., radiation, surgery, or chemotherapy.
  • An anti-GITR agent, e.g., Ab, a PD-l/PD-Ll antagonist adjunctive therapy may be administered when there is a risk that micrometastases may be present and/or in order to reduce the risk of a relapse.
  • GITR agonist and a PD- l/PD-Ll axis antagonist have an increased peripheral blood level (or number) of (1) proliferating CD8+ cells; (2) proliferating and activated CD4+ and CD8+ effector memory and central memory T cells and (3) proliferating NK cells 8 days after administration of a dose of the GITR agonist and the PD-l/PD-Ll axis antagonist, provided herein are methods for treating subjects having cancer with an immunostimulating therapy (e.g., GITR agonist and PD-l/PD-Ll antagonist), wherein the treatment increases the level or number of one or more of these populations of cells.
  • an immunostimulating therapy e.g., GITR agonist and PD-l/PD-Ll antagonist
  • immunostimulating agent induces an elevation of the level of one or more of these cell populations by at least 1.5, 2, 3, 4 or 5 fold relative to their base level, e.g., level immediately prior to (e.g., less than 10, 5, 4, 3, 2, or 1 hour prior to) administration of the first dose of the therapy.
  • level immediately prior to e.g., less than 10, 5, 4, 3, 2, or 1 hour prior to
  • Measurement of the level of these cell types in the peripheral blood of a subject can be done as described in the Examples.
  • an immunostimulating therapy e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent
  • administering comprising administering to the subject a first dose of the immunostimulating therapy, wherein at about 5-12 days (e.g., 8 days) following the
  • the level (or number) of (1) proliferating CD8+ cells; (2) proliferating and activated CD4+ and CD8+ effector memory and central memory T cells and/or (3) proliferating NK cells is higher by, e.g., 1.5 fold, 2, 3, 4 or 5 fold relative the level of the cell population before the administration.
  • methods of treating a subject having cancer with an immunostimulating therapy comprising administering to the subject a first dose of the immunostimulating therapy, wherein at about 5-12 days (e.g., 8 days) following the administration, the level (or number) of (1) proliferating CD8+ cells; (2) proliferating and activated CD4+ and CD8+ effector memory and central memory T cells and (3) proliferating NK cells is higher by, e.g., 1.5 fold, 2, 3, 4 or 5 fold relative the level of the cell population before the administration.
  • a method may comprise treating a subject having cancer with an immunostimulating therapy (e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis antagonist alone, or together with
  • immunostimulating agents e.g., a GITR agonist agent
  • administering to the subject a first dose of the immunostimulating therapy, wherein at about 5-12 days (e.g., 8 days) following the administration, the level (or number) of (i) proliferating CD8+ effector memory cells; (ii) activated CD8+ effector memory cells; (iii) proliferating CD8+ central memory cells; and (iv) activated CD8+ central memory cells is higher by, e.g., 1.5 fold, 2, 3, 4 or 5 fold relative the level of the cell population before the administration.
  • a method may comprise treating a subject having cancer with an immunostimulating therapy (e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent), comprising administering to the subject a first dose of the immunostimulating therapy, wherein at about 5-12 days (e.g., 8 days) following the
  • an immunostimulating therapy e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent
  • a method may comprise treating a subject having cancer with an immunostimulating therapy (e.g., an immuno-oncology drug, e.g., an PD- 1/PD-Ll axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent), comprising administering to the subject a first dose of the immunostimulating therapy (e.g., an immuno-oncology drug, e.g., an PD- 1/PD-Ll axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent), comprising administering to the subject a first dose of the immunostimulating therapy (e.g., an immuno-oncology drug, e.g., an PD- 1/PD-Ll axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent), comprising administering to the subject a first dose of
  • immunostimulating therapy wherein at about 5-12 days (e.g., 8 days) following the
  • a method may comprise treating a subject having cancer with an immunostimulating therapy (e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent), comprising
  • an immunostimulating therapy e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent
  • the level (or number) of any one of (i) proliferating CD4+ central memory cells; (ii) proliferating CD8+ central memory cells; (iii) activated CD4+ central memory cells and (iv) activated CD8+ central memory cells, is higher by, e.g., 1.5 fold, 2, 3, 4 or 5 fold relative the level of the cell population before the
  • a method may comprise treating a subject having cancer with an immunostimulating therapy (e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent), comprising
  • an immunostimulating therapy e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent
  • the level (or number) of (i) proliferating CD4+ central memory cells; (ii) proliferating CD8+ central memory cells; (iii) activated CD4+ central memory cells and (iv) activated CD8+ central memory cells, is higher by, e.g., 1.5 fold, 2, 3, 4 or 5 fold relative the level of the cell population before the administration.
  • a method may comprise treating a subject having cancer with an immunostimulating therapy (e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent), comprising administering to the subject a first dose of the immuno stimulating therapy, wherein at about 5-12 days (e.g., 8 days) following the administration, the level (or number) of any one of (i) proliferating CD4+ effector memory cells; (ii) proliferating CD8+ effector memory cells; (iii) activated CD4+ effector memory cells and (iv) activated CD8+ effector memory cells, is higher by, e.g., 1.5 fold, 2, 3, 4 or 5 fold relative the level of the cell population before the
  • an immunostimulating therapy e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis
  • a method may comprise treating a subject having cancer with an immunostimulating therapy (e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent), comprising
  • an immunostimulating therapy e.g., an immuno-oncology drug, e.g., an PD-1/PD-L1 axis antagonist alone, or together with one or more immunostimulating agents, e.g., a GITR agonist agent
  • the level (or number) of (i) proliferating CD4+ effector memory cells; (ii) proliferating CD8+ effector memory cells; (iii) activated CD4+ effector memory cells and (iv) activated CD8+ effector memory cells is higher by, e.g., 1.5 fold, 2, 3, 4 or 5 fold relative the level of the cell population before the administration.
  • proliferating CD4 effector memory cells are provided.
  • CD45+CD3+CD4+CD8-CD197-CD45RA-Ki67+ T cells CD 197 is CCR7; activated CD4 effector memory cells are CD45+CD3+CD4+CD8-CD197-CD45RA-HLA-DR+; proliferating CD4 central memory cells are CD45+CD3+CD4+CD8-CD197+CD45RA-Ki67+; and activated CD4 central memory cells are CD45+CD3+CD4+CD8-CD197+CD45RA-HLA-DR+;
  • proliferating CD8 effector memory cells are CD45+CD3+CD4-CD8+CD197-CD45RA-Ki67+ cells; activated CD8 effector memory cells are CD45+CD3+CD4-CD8+CD197-CD45RA-HLA- DR+; proliferating CD8 central memory cells are CD45+CD3+CD4-CD8+CD197+CD45RA- Ki67+; and activated CD8 central memory cells are CD45+CD3+CD4-CD8+CD197+CD45RA- HLA-DR+, and the level of these cells is determined by flow cytometry, as described, e.g., in the Examples.
  • a dose, e.g., a first dose, of the immunostimulating therapy is administered to a subject having cancer, resulting in an elevation of the number of one or more populations of cells selected from (1) proliferating CD8+ cells; (2) proliferating and activated CD4+ and CD8+ effector memory and central memory T cells and (3) proliferating NK cells; and a second dose of the immuno stimulating therapy is administered at a time when the proliferation or activation of one or more of these populations of cells, e.g., peripheral effector memory T cells and/or central memory T cells, are at or close to their respective baseline level that was present in the subject immediately prior to administration of the dose, e.g., first dose, of the immunostimulating therapy.
  • the immunostimulating therapy e.g., GITR agonist agent and PD-1/PD-L1 antagonist agent
  • a dose e.g., a first dose, of an immunostimulating therapy (e.g., GITR agonist agent and PD-1/PD-L1 antagonist agent) is administered to a subject having cancer, resulting in an elevation of the level (or number) of (i) proliferating CD8+ effector memory cells; (ii) activated CD8+ effector memory cells; (iii) activated CD8+ effector memory cells; and/or (iv) activated CD8+ effector memory cells is higher by, e.g., 1.5 fold, 2, 3, 4 or 5 fold relative the level of the cell population before the administration; and a second dose of the immunostimulating therapy is administered at a time when the level (or number) of (i) proliferating CD8+ effector memory cells; (ii) activated CD8+ effector memory cells; (iii) proliferating CD8+ central memory cells; and/or (iv) activated CD8+ central memory cells are at or close (e.
  • a dose e.g., a first dose, of an immunostimulating therapy (e.g., GITR agonist agent and PD-1/PD-L1 antagonist agent) is administered to a subject having cancer, resulting in an elevation of the level (or number) of (i) proliferating CD4+ effector memory cells; (ii) activated CD4+ effector memory cells; (iii) proliferating CD4+ central memory cells; and/or (iv) activated CD4+ central memory cells is higher by, e.g., 1.5 fold, 2, 3, 4 or 5 fold relative the level of the cell population before the administration; and a second dose of the immunostimulating therapy is administered at a time when the level (or number) of (i) proliferating CD4+ effector memory cells; (ii) activated CD4+ effector memory cells; (iii) prolferating CD4+ central memory cells; and/or (iv) activated CD4+ central memory cells are at or close to (e
  • a dose e.g., a first dose, of an immunostimulating therapy (e.g., GITR agonist agent and PD-1/PD-L1 antagonist agent) is administered to a subject having cancer, resulting in an elevation of the level (or number) of (i) proliferating CD8+ effector memory cells; (ii) activated CD8+ effector memory cells; (iii) proliferating CD8+ central memory cells; (iv) activated CD8+ central memory cells; (v) proliferating CD4+ effector memory cells; (vi) activated CD4+ effector memory cells; (vii) proliferating CD4+ central memory cells; and/or (viii) activated CD4+ central memory cells is higher by, e.g., 1.5 fold, 2, 3, 4 or 5 fold relative the level of the cell population before the administration; and a second dose of the immunostimulating therapy is administered at a time when the level (or number) of (i) proliferating CD8+ effector
  • proliferating CD4 effector memory cells are CD45+CD3+CD4+CD8-CD197-CD45RA-Ki67+ T cells (CD 197 is CCR7); activated CD4 effector memory cells are CD45+CD3+CD4+CD8-CD 197-CD45RA-HLA-DR+; proliferating CD4 central memory cells are CD45+CD3+CD4+CD8-CD197+CD45RA-Ki67+; and activated CD4 central memory cells are CD45+CD3+CD4+CD8-CD197+CD45RA-HLA- DR+; proliferating CD8 effector memory cells are CD45+CD3+CD4-CD8+CD197-CD45RA- Ki67+ cells; activated CD8 effector memory cells are CD45+CD3+CD4-CD8+CD197- CD45RA- Ki67+ cells; activated CD8 effector memory cells are CD45+CD3+CD4-CD8+CD197- CD45RA-HLA-DR+; prolifer
  • CD8+CD197+CD45RA-Ki67+; and activated CD8 central memory cells are CD45+CD3+CD4- CD8+CD197+CD45RA-HLA-DR+, and the level of these cells is determined by flow cytometry, as described, e.g., in the Examples.
  • a method comprises administering to a subject a dose of
  • immunostimulating therapy e.g., a GITR agonist agent and a PD-1/PD-L1 axis antagonist
  • determining about 3-12 days later the level of one or one or more populations of cells selected from (1) proliferating CD8+ cells; (2) proliferating and activated CD4+ and CD8+ effector memory and central memory T cells and (3) proliferating NK cells, wherein an increase (by, 1.5, 2, 3, 4, or 5 or more fold) in one or more of these populations of cells relative to their respective level before administration of the therapy, indicates that the subject is likely to respond to the therapy, whereas the lack of increase in one or more of these cell populations indicates that the subject is not likely to respond to the treatment.
  • a method may comprise administering to a subject a dose of immuno stimulating therapy (e.g., a GITR agonist agent and a PD-1/PD-L1 axis antagonist), and determining about 3-12 days later the level of (i) proliferating CD8+ effector memory cells; (ii) activated CD8+ effector memory cells; (iii) proliferating CD8+ central memory cells; and/or (iv) activated CD8+ central memory cells, wherein an increase (by, 1.5, 2,
  • a dose of immuno stimulating therapy e.g., a GITR agonist agent and a PD-1/PD-L1 axis antagonist
  • a method may comprise administering to a subject a dose of immuno stimulating therapy (e.g., a GITR agonist agent and a PD-1/PD-L1 axis antagonist), and determining about 3-12 days later the level of (i) proliferating CD4+ effector memory cells; (ii) activated CD4+ effector memory cells; (iii) proliferating CD4+ central memory cells; (iv) activated CD4+ central memory cells, wherein an increase (by, 1.5, 2, 3, 4, or 5 or more fold) in one or more (e.g., all) of these populations of cells relative to their respective level before administration of the therapy, indicates that the subject is likely to respond to the therapy, whereas the lack of increase in one or more (or all) of these cell populations indicates that the subject is not likely to respond to the treatment.
  • immuno stimulating therapy e.g., a GITR agonist agent and a PD-1/PD-L1 axis antagonist
  • a method may comprise administering to a subject a dose of immuno stimulating therapy (e.g., a GITR agonist agent and a PD-1/PD-L1 axis antagonist), and determining about 3-12 days later the level of (i) proliferating CD8+ effector memory cells; (ii) activated CD8+ effector memory cells; (iii) proliferating CD8+ central memory cells; (iv) activated CD8+ central memory cells; (v) proliferating CD4+ effector memory cells; (vi) activated CD4+ effector memory cells; (vii) proliferating CD4+ central memory cells; and (viii) activated CD4+ central memory cells, wherein an increase (by, 1.5, 2, 3, 4, or 5 or more fold) in one or more (e.g., all) of these populations of cells relative to their respective level before administration of the therapy, indicates that the subject is likely to respond to the therapy, whereas the lack of increase in one or more (or all) of these cell populations indicates that the subject is not
  • proliferating CD4 effector memory cells are CD45+CD3+CD4+CD8-CD197-CD45RA-Ki67+ T cells (CD 197 is CCR7); activated CD4 effector memory cells are CD45+CD3+CD4+CD8-CD197-CD45RA-HLA-DR+; proliferating CD4 central memory cells are CD45+CD3+CD4+CD8-CD197+CD45RA-Ki67+; and activated CD4 central memory cells are CD45+CD3+CD4+CD8-CD197+CD45RA-HLA-DR+;
  • proliferating CD8 effector memory cells are CD45+CD3+CD4-CD8+CD197-CD45RA-Ki67+ cells; activated CD8 effector memory cells are CD45+CD3+CD4-CD8+CD197-CD45RA-HLA- DR+; proliferating CD8 central memory cells are CD45+CD3+CD4-CD8+CD197+CD45RA- Ki67+; and activated CD8 central memory cells are CD45+CD3+CD4-CD8+CD197+CD45RA- HLA-DR+, and the level of these cells is determined by flow cytometry, as described, e.g., in the Examples.
  • kits comprising an anti-GITR agonist agent, e.g., Ab, and optionally an anti-PD-1 or anti-PD-Ll antagonist agent, e.g., Ab, compositions and instructions for therapeutic uses.
  • Kits typically include a label indicating the intended use of the contents of the kit and instructions for use.
  • label includes any writing, or recorded material supplied on or with the kit, or which otherwise accompanies the kit.
  • kits comprising: (a) an appropriate dosage of one or more compositions disclosed herein (e.g., an anti-GITR agonist agent, e.g., Ab, composition alone or with an anti-PD- 1 or anti-PD-Ll antagonist composition or a composition comprising the two Abs) and (b) instructions for using the composition(s) in any of the methods disclosed herein.
  • an anti-GITR agonist agent e.g., Ab
  • an anti-PD- 1 or anti-PD-Ll antagonist composition e.g., a composition comprising the two Abs
  • a method of treating a subject having cancer comprising administering to a subject
  • an anti-GITR agonist antibody (Ab) at a flat dose ranging from 1-800 mg once every 2-4 weeks.
  • the method of any one of embodiments 1-8, wherein the cancer is a solid tumor cancer.
  • the method of any one of embodiments 1-8, wherein the cancer is an advanced cancer.
  • the method of embodiment 9, wherein the cancer is an advanced solid tumor cancer.
  • the method of any one of embodiments 1-8, wherein the cancer is a hematopoietic cancer.
  • an immuno-oncology agent other than the anti-GITR agonist Ab comprising administering an immuno-oncology agent other than the anti-GITR agonist Ab.
  • the immuno-oncology agent is an anti-PD 1 or anti-PD-Ll antagonist agent.
  • the anti-GITR agonist Ab comprises the VH CDR1, CDR2, CDR3 and VL CDR1, CDR2, CDR3 of 28F3.IgGl.
  • the anti-GITR agonist Ab comprises a VH and VL chain that is at least 95%, 96%, 97%, 98% 99% or 100% identical to the VH and VL sequences of 28F3.IgGl, respectively.
  • the anti-GITR agonist Ab comprises a heavy chain (optionally without the C-terminal lysine of the heavy chain) and a light chain that are at least 95%, 96%, 97%, 98% 99% or 100% identical to the heavy and light chain sequences of 28F3.IgGl, respectively.
  • the anti-PD-1 Ab comprises a VH and VL chain that is at least 95%, 96%, 97%, 98% 99% or 100% identical to the VH and VL sequences of nivolumab, respectively.
  • the anti-PD-1 Ab comprises a heavy chain (optionally without the C-terminal lysine of the heavy chain) and a light chain that are at least 95%, 96%, 97%, 98% 99% or 100% identical to the heavy and light chain sequences of nivolumab, respectively.
  • anti- PD-L1 Ab comprises a VH and VL chain that is at least 95%, 96%, 97%, 98% 99% or 100% identical to the VH and VL sequences of 12A4, respectively.
  • the anti- PD-L1 Ab comprises a heavy chain (optionally without the C-terminal lysine of the heavy chain) and a light chain that are at least 95%, 96%, 97%, 98% 99% or 100% identical to the heavy and light chain sequences of 12A4, respectively.
  • the constant region is GLYSLSSWTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVEC underlined PPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEV
  • the constant region is DYEKHKVYACEVTHQGLSSPVTKSFNRGEC
  • the constant region is QGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLV underlined KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
  • the constant region is VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN underlined ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK
  • the constant region is QGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLV underlined KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
  • VVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVE CPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRV VSVLTVVHQDWLNGKEYKCKVSNKGLPAP IEKTI SKTK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • the constant region is VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN underlined ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK
  • VL2 EIVLTQSPATLSLSPGERATLSCRASQGVSSYLAWYQQ
  • the constant region is VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE underlined PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
  • the constant region is VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN underlined ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK
  • the constant region is FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA underlined LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV
  • the constant region is GQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCL underlined VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS SVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCV
  • the constant region is VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN underlined ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK
  • the constant region is GQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCL underlined VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
  • the constant region is VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN underlined ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK
  • the constant region is WGQGTSVTVSSASTKGPSVFPLAPCSRSTSESTAALGC underlined LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
  • the constant region is VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE underlined PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
  • SSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPP CPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAP IEKTI SKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSPGK
  • the constant region is VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN underlined ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK
  • the constant region is GQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCL underlined VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
  • 28F3 full length wild-type GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAG light chain
  • 19D3 (VH) nucleotide CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCA sequence ACCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTG
  • 19D3 full length wild-type CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCA heavy chain nucleotide ACCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTG sequence GATTCACCTTCAGTAGCTATGGCTTCCACTGGGTCCGC
  • 161 18E10 full length wild-type GACATCCAGATGACCCAGTCTCCATCCTCACTGTCTGC light chain nucleotide ATCTGTAGGAGACAGAGTCACCATCACTTGTCGGGCGA sequence GTCAGGGTATTAGCAGCTGGTTAGCCTGGTATCAGCAG
  • VL1 163 3C3 (VL1) nucleotide GACATCCAGATGACCCAGTCTCCATCCTCACTGTCTGC sequence ATCTGTAGGAGACAGAGTCACCATCACTTGTCGGGCGA
  • VL2 3C3 nucleotide GAAATTGTGTTGACACAGTCTCCAGCCACCCTGTCTTT sequence GTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCA
  • sequence encoding the CAATCATAGTGGAAACACCAACTACAACCCGTCCCTCA constant region is underlined AGAGTCGAGTCACCATATCAGTAGACACGTCCAAGAAC
  • 3C3 LI full length wild-type GACATCCAGATGACCCAGTCTCCATCCTCACTGTCTGC light chain nucleotide ATCTGTAGGAGACAGAGTCACCATCACTTGTCGGGCGA sequence GTCAGGGTATTAGCAGCTGGTTAGCCTGGTATCAGCAG
  • I 2G6 full length wild-type GACATCCAGATGACCCAGTCTCCATCCTCACTGTCTGC light chain nucleotide ATCTGTAGGAGACAGAGTCACCATCACT TGTCGGGCGA sequence GTCAGGGTAT TAGCAGCTGGT TAGCCTGGTATCAGCAG
  • GATTCACTTTCAGTACCGTCTGGATGAGCTGGGTCCGC CAGGCTCCAGGGAAGGGGCTGGAGTGGGTTGGCCGTAT TAAAAGCAAAACTGATGGTGGGACAACAGACTACGCTG CACCCGTGAAAGGCAGATTCACCATCTCAAGAGATGAT TCAAAAAACACGCTGTATCTGCAAATGAACAGCCTGCA CACCGAGGACACAGCCGTGTATTACTGTACCACAGGGC AGCTGATCCCTTACTCCTACTACTACGGTATGGACGTC TGGGGCCAAGGGACCTCGGT CACCGTCTCCTCA

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2018/032750 2017-05-16 2018-05-15 Treatment of cancer with anti-gitr agonist antibodies Ceased WO2018213297A1 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
KR1020197036659A KR20200006115A (ko) 2017-05-16 2018-05-15 항-gitr 효능제 항체에 의한 암의 치료
US16/612,956 US11685787B2 (en) 2017-05-16 2018-05-15 Treatment of cancer with anti-GITR agonist antibodies
JP2019563411A JP7274426B2 (ja) 2017-05-16 2018-05-15 抗gitrアゴニスト抗体での癌の処置
EP18731561.9A EP3625260A1 (en) 2017-05-16 2018-05-15 Treatment of cancer with anti-gitr agonist antibodies
CN201880046058.6A CN110869392A (zh) 2017-05-16 2018-05-15 用抗gitr激动性抗体治疗癌症
US18/133,822 US20230416388A1 (en) 2017-05-16 2023-04-12 Treatment of cancer with anti-gitr agonist antibodies

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US201762507071P 2017-05-16 2017-05-16
US62/507,071 2017-05-16
US201762514312P 2017-06-02 2017-06-02
US201762514245P 2017-06-02 2017-06-02
US62/514,312 2017-06-02
US62/514,245 2017-06-02
US201762573494P 2017-10-17 2017-10-17
US62/573,494 2017-10-17

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/612,956 A-371-Of-International US11685787B2 (en) 2017-05-16 2018-05-15 Treatment of cancer with anti-GITR agonist antibodies
US18/133,822 Continuation US20230416388A1 (en) 2017-05-16 2023-04-12 Treatment of cancer with anti-gitr agonist antibodies

Publications (1)

Publication Number Publication Date
WO2018213297A1 true WO2018213297A1 (en) 2018-11-22

Family

ID=62620935

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/032750 Ceased WO2018213297A1 (en) 2017-05-16 2018-05-15 Treatment of cancer with anti-gitr agonist antibodies

Country Status (6)

Country Link
US (1) US11685787B2 (https=)
EP (1) EP3625260A1 (https=)
JP (1) JP7274426B2 (https=)
KR (1) KR20200006115A (https=)
CN (1) CN110869392A (https=)
WO (1) WO2018213297A1 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11084881B2 (en) 2014-06-06 2021-08-10 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (GITR) and uses thereof
WO2021225159A1 (ja) * 2020-05-08 2021-11-11 国立大学法人三重大学 Gitr結合性分子
CN114787188A (zh) * 2019-11-05 2022-07-22 震动疗法股份有限公司 用抗pd-1抗体治疗癌症的方法
US11685787B2 (en) 2017-05-16 2023-06-27 Bristol-Myers Squibb Company Treatment of cancer with anti-GITR agonist antibodies
WO2024097328A1 (en) * 2022-11-03 2024-05-10 Incyte Corporation Combination therapies comprising an anti-gitr antibody for treating cancers
EP4085074A4 (en) * 2020-01-02 2024-05-15 Nanjing GenScript Biotech Co., Ltd. ANTI-GITR ANTIBODIES AND THEIR USES
WO2025145207A1 (en) 2023-12-29 2025-07-03 Bristol-Myers Squibb Company Combination therapy of kras inhibitor and treg-depleting agent

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX2017015260A (es) 2015-06-03 2018-02-19 Squibb Bristol Myers Co Anticuerpos anti receptor de factor de necrosis tumoral inducible por glucocorticoide (gitr) para diagnostico del cancer.
JP7274454B2 (ja) * 2017-07-28 2023-05-16 ブリストル-マイヤーズ スクイブ カンパニー チェックポイント阻害薬のための予測末梢血バイオマーカー
EP4210702A1 (en) * 2020-09-14 2023-07-19 JANSSEN Pharmaceutica NV Fgfr inhibitor combination therapies
EP4339209A4 (en) * 2021-05-10 2025-05-28 MediMabbio Inc. ANTI-GITR ANTIBODIES AND THEIR USES

Citations (45)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003099196A2 (en) 2002-05-23 2003-12-04 Cure Tech Ltd. Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency
US6808710B1 (en) 1999-08-23 2004-10-26 Genetics Institute, Inc. Downmodulating an immune response with multivalent antibodies to PD-1
WO2006105021A2 (en) 2005-03-25 2006-10-05 Tolerrx, Inc. Gitr binding molecules and uses therefor
WO2006121168A1 (en) 2005-05-09 2006-11-16 Ono Pharmaceutical Co., Ltd. Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics
WO2007005874A2 (en) 2005-07-01 2007-01-11 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (pd-l1)
JP2008278814A (ja) 2007-05-11 2008-11-20 Igaku Seibutsugaku Kenkyusho:Kk アゴニスティック抗ヒトgitr抗体による免疫制御の解除とその応用
WO2009014708A2 (en) 2007-07-23 2009-01-29 Cell Genesys, Inc. Pd-1 antibodies in combination with a cytokine-secreting cell and methods of use thereof
US7488802B2 (en) 2002-12-23 2009-02-10 Wyeth Antibodies against PD-1
WO2009045957A1 (en) 2007-10-01 2009-04-09 Medarex, Inc. Human antibodies that bind mesothelin, and uses thereof
WO2009054863A2 (en) 2006-12-13 2009-04-30 Medarex, Inc. Human antibodies that bind cd19 and uses thereof
WO2009073533A2 (en) 2007-11-30 2009-06-11 Medarex, Inc. Anti-b7h4 monoclonal antibody-drug conjugate and methods of use
WO2009073546A2 (en) 2007-11-30 2009-06-11 Medarex, Inc. Monoclonal antibody partner molecule conjugates directed to protein tyrosine kinase 7 (ptk7)
US20090145493A1 (en) 2004-11-23 2009-06-11 Pip Co., Ltd. Built-in wall water service box
WO2009114335A2 (en) 2008-03-12 2009-09-17 Merck & Co., Inc. Pd-1 binding proteins
US7635757B2 (en) 1999-08-23 2009-12-22 Dana-Farber Cancer Institute, Inc. B7-4 Antibodies and uses therefor
WO2011028683A1 (en) 2009-09-03 2011-03-10 Schering Corporation Anti-gitr antibodies
WO2011066389A1 (en) 2009-11-24 2011-06-03 Medimmmune, Limited Targeted binding agents against b7-h1
US20110150892A1 (en) 2008-08-11 2011-06-23 Medarex, Inc. Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof
WO2011161699A2 (en) 2010-06-25 2011-12-29 Aurigene Discovery Technologies Limited Immunosuppression modulating compounds
US8217149B2 (en) 2008-12-09 2012-07-10 Genentech, Inc. Anti-PD-L1 antibodies, compositions and articles of manufacture
WO2012145493A1 (en) 2011-04-20 2012-10-26 Amplimmune, Inc. Antibodies and other molecules that bind b7-h1 and pd-1
US8354509B2 (en) 2007-06-18 2013-01-15 Msd Oss B.V. Antibodies to human programmed death receptor PD-1
WO2013014668A1 (en) 2011-07-24 2013-01-31 Curetech Ltd. Variants of humanized immunomodulatory monoclonal antibodies
WO2013079174A1 (en) 2011-11-28 2013-06-06 Merck Patent Gmbh Anti-pd-l1 antibodies and uses thereof
WO2013119202A1 (en) * 2012-02-06 2013-08-15 Providence Health & Services - Oregon Cancer treatment and monitoring methods using ox40 agonists
WO2013173223A1 (en) 2012-05-15 2013-11-21 Bristol-Myers Squibb Company Cancer immunotherapy by disrupting pd-1/pd-l1 signaling
US8609089B2 (en) 2008-08-25 2013-12-17 Amplimmune, Inc. Compositions of PD-1 antagonists and methods of use
US20140065152A1 (en) 2012-06-08 2014-03-06 National Cancer Center Novel epitope for switching to th1 cell and use thereof
WO2015026684A1 (en) * 2013-08-20 2015-02-26 Merck Sharp & Dohme Corp. Modulation of tumor immunity
WO2015031667A2 (en) 2013-08-30 2015-03-05 Amgen Inc. Gitr antigen binding proteins
WO2015116178A1 (en) 2014-01-31 2015-08-06 Thomas Jefferson University Fusion proteins for modulating regulatory and effector t cells
WO2015184099A1 (en) 2014-05-28 2015-12-03 4-Antibody Ag Anti-gitr antibodies and methods of use thereof
WO2015187835A2 (en) 2014-06-06 2015-12-10 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
WO2016054638A1 (en) 2014-10-03 2016-04-07 Dana-Farber Cancer Institute, Inc. Glucocorticoid-induced tumor necrosis factor receptor (gitr) antibodies and methods of use thereof
WO2016057846A1 (en) 2014-10-08 2016-04-14 Novartis Ag Compositions and methods of use for augmented immune response and cancer therapy
WO2016081746A2 (en) 2014-11-21 2016-05-26 Bristol-Myers Squibb Company Antibodies comprising modified heavy constant regions
CN105669867A (zh) 2014-11-21 2016-06-15 上海中信国健药业股份有限公司 抗gitr/ctla-4双特异性抗体及其制备方法和用途
WO2016126781A1 (en) 2015-02-03 2016-08-11 Oncomed Pharmaceuticals, Inc. Tnfrsf-binding agents and uses thereof
WO2016168716A1 (en) 2015-04-17 2016-10-20 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-pd-1 antibody and another antibody
WO2016196792A1 (en) 2015-06-03 2016-12-08 Bristol-Myers Squibb Company Anti-gitr antibodies for cancer diagnostics
WO2017015623A2 (en) 2015-07-23 2017-01-26 Inhibrx Lp Multivalent and multispecific gitr-binding fusion proteins
WO2017025610A1 (en) 2015-08-12 2017-02-16 Medimmune Limited Gitrl fusion proteins and uses thereof
WO2017068186A1 (en) 2015-10-22 2017-04-27 Ablynx Nv Gitr agonists
WO2017068185A1 (en) 2015-10-23 2017-04-27 Apogenix Ag Single-chain gitr-receptor agonist proteins
WO2017087678A2 (en) 2015-11-19 2017-05-26 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof

Family Cites Families (63)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP3101690B2 (ja) 1987-03-18 2000-10-23 エス・ビィ・2・インコーポレイテッド 変性抗体の、または変性抗体に関する改良
US7247302B1 (en) 1996-08-02 2007-07-24 Bristol-Myers Squibb Company Method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis
ES2308787T3 (es) 1996-08-16 2008-12-01 Schering Corporation Antigenos de superficie de celular de mamiferos; reactivos relacionados.
US6111090A (en) 1996-08-16 2000-08-29 Schering Corporation Mammalian cell surface antigens; related reagents
WO2001040464A1 (en) 1999-11-30 2001-06-07 Genentech, Inc. Interleukin-1-receptor associated kinase-3 (irak3) and its use in promotion or inhibition of angiogenesis and cardiovascularization
GB9625074D0 (en) 1996-12-02 1997-01-22 Pharmacia & Upjohn Spa Receptor belonging to the TNF/NGF receptor family
WO2000032778A2 (en) 1998-12-01 2000-06-08 Genentech, Inc. Methods and compositions for inhibiting neoplastic cell growth
JP2001520039A (ja) 1997-10-21 2001-10-30 ヒューマン ジノーム サイエンシーズ, インコーポレイテッド ヒト腫瘍壊死因子レセプター様タンパク質、tr11,tr11sv1およびtr11sv2
WO1999025834A1 (en) 1997-11-18 1999-05-27 Genentech, Inc. Dna19355 polypeptide, a tumor necrosis factor homolog
AU2591599A (en) 1998-02-09 1999-08-23 Genentech Inc. Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same
EP1095142A2 (en) 1998-07-22 2001-05-02 Incyte Pharmaceuticals, Inc. Molecules associated with cell proliferation
JP3695642B2 (ja) 1998-12-01 2005-09-14 ジェネンテック・インコーポレーテッド 血管形成及び心臓血管新生の促進又は阻害
WO2000050459A1 (en) 1999-02-24 2000-08-31 Human Genome Sciences, Inc. Human tumor necrosis factor receptor-like proteins tr11, tr11sv1, and tr11sv2
WO2001003720A2 (en) 1999-07-12 2001-01-18 Genentech, Inc. Promotion or inhibition of angiogenesis and cardiovascularization by tumor necrosis factor ligand/receptor homologs
AU783473B2 (en) 1999-12-23 2005-10-27 Zymogenetics Inc. Soluble interleukin-20 receptor
EP1244708B8 (en) 1999-12-23 2007-03-07 ZymoGenetics, Inc. Method for treating inflammation
WO2001075166A2 (en) 2000-03-31 2001-10-11 Genentech, Inc. Compositions and methods for detecting and quantifying gene expression
AU2001274888A1 (en) 2000-05-19 2001-12-03 Human Genome Sciences, Inc. Nucleic acids, proteins, and antibodies
ATE333888T1 (de) 2000-09-15 2006-08-15 Zymogenetics Inc Verwendung eines polypeptids, welches die extrazelluläre domäne von il-20ra und il-20rb enthält, zur behandlung von entzündungen
EP1399472B1 (en) 2001-03-09 2009-06-03 ZymoGenetics, Inc. Soluble heterodimeric cytokine receptor
WO2003006058A1 (en) 2001-07-12 2003-01-23 Wyeth Cd25+ differential markers and uses thereof
AUPS054702A0 (en) 2002-02-14 2002-03-07 Immunaid Pty Ltd Cancer therapy
US20060281146A1 (en) 2002-09-11 2006-12-14 Genetech, Inc. Novel compositions and methods for the treatment of immune related diseases
EP2322200A3 (en) 2002-10-29 2011-07-27 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
JP2011516026A (ja) 2002-11-26 2011-05-26 ジェネンテック・インコーポレーテッド 免疫関連疾患の治療のための組成物と方法
US7618632B2 (en) 2003-05-23 2009-11-17 Wyeth Method of treating or ameliorating an immune cell associated pathology using GITR ligand antibodies
WO2005007190A1 (en) 2003-07-11 2005-01-27 Schering Corporation Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer
GB0407315D0 (en) 2003-07-15 2004-05-05 Cambridge Antibody Tech Human antibody molecules
WO2005019258A2 (en) 2003-08-11 2005-03-03 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
WO2005052001A2 (en) 2003-11-21 2005-06-09 Zymogenetics, Inc. Anti-il-20 receptor antibodies and binding partners and methods of using in inflammation
PT1737891E (pt) 2004-04-13 2013-04-16 Hoffmann La Roche Anticorpos anti p-selectina
CA2585776A1 (en) 2004-10-29 2006-05-11 University Of Southern California Combination cancer immunotherapy with co-stimulatory molecules
US20060099171A1 (en) 2004-11-05 2006-05-11 Masahide Tone Mouse glucocorticoid-induced TNF receptor ligand is costimulatory for T cells
AU2006206343A1 (en) 2005-01-19 2006-07-27 Genzyme Corporation GITR antibodies for the diagnosis of NSCLC
WO2006124269A2 (en) 2005-05-16 2006-11-23 Amgen Fremont Inc. Human monoclonal antibodies that bind to very late antigen-1 for the treatment of inflammation and other disorders
JP4984160B2 (ja) 2005-06-07 2012-07-25 国立大学法人 東京大学 抗体の作製方法
CA2611814A1 (en) 2005-06-20 2007-01-04 Medarex, Inc. Cd19 antibodies and their uses
EP2441846A3 (en) 2006-01-09 2012-07-25 The Regents Of the University of California Immunostimulatory combinations of TNFRSF, TLR, NLR, RHR, purinergic receptor, and cytokine receptor agoinsts for vaccines and tumor immunotherapy
WO2007133822A1 (en) 2006-01-19 2007-11-22 Genzyme Corporation Gitr antibodies for the treatment of cancer
PT2099823E (pt) 2006-12-01 2014-12-22 Seattle Genetics Inc Agentes de ligação ao alvo variantes e suas utilizações
KR20080105674A (ko) 2007-05-31 2008-12-04 울산대학교 산학협력단 항-마우스 gitrl 단일클론 항체 또는 항-인간aitrl 단일클론 항체 및 이를 유효성분으로 함유하는염증성 장질환의 예방 및 치료용 조성물
US8591886B2 (en) 2007-07-12 2013-11-26 Gitr, Inc. Combination therapies employing GITR binding molecules
KR20160070165A (ko) 2008-02-08 2016-06-17 메디뮨 엘엘씨 Fc 리간드 친화성이 감소된 항-IFNAR1 항체
EP2604279A1 (en) 2008-03-27 2013-06-19 ZymoGenetics, Inc. Compositions and methods for inhibiting PDGFRBETA and VEGF-A
US10150808B2 (en) 2009-09-24 2018-12-11 Chugai Seiyaku Kabushiki Kaisha Modified antibody constant regions
CA3253628A1 (en) 2010-03-05 2025-11-29 The Johns Hopkins University Compositions and methods for targeted immunomodulatory antibodies and fusion proteins
JP2013528357A (ja) 2010-03-29 2013-07-11 ザイムワークス,インコーポレイテッド 強化又は抑制されたエフェクター機能を有する抗体
AU2011283694B2 (en) 2010-07-29 2017-04-13 Xencor, Inc. Antibodies with modified isoelectric points
WO2012087928A2 (en) 2010-12-20 2012-06-28 The Rockefeller University Modulating agonistic tnfr antibodies
WO2012098113A1 (en) 2011-01-17 2012-07-26 Novo Nordisk A/S Il-21 ligands
PT2691112T (pt) * 2011-03-31 2018-07-10 Merck Sharp & Dohme Formulações estáveis de anticorpos para o recetor pd-1 humano de morte programada e tratamentos relacionados
US9574002B2 (en) 2011-06-06 2017-02-21 Amgen Inc. Human antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor
MX368257B (es) 2011-08-01 2019-09-26 Genentech Inc Antagonistas de unión al eje pd-1e inhibidores de mek y sus usos en el tratamiento de cáncer.
WO2013039954A1 (en) 2011-09-14 2013-03-21 Sanofi Anti-gitr antibodies
WO2013043569A1 (en) 2011-09-20 2013-03-28 Vical Incorporated Synergistic anti-tumor efficacy using alloantigen combination immunotherapy
US20150073043A1 (en) 2012-01-19 2015-03-12 Institut Pasteur Of Shanghai, Chinese Academy Of Sciences Use of phosphorylation pathway-related factor in regulating function of regulatory t cell
US8945553B2 (en) 2012-05-22 2015-02-03 Bristol-Myers Squibb Company Bispecific antibodies to IL-23 and IL-17A/F
EP3508215A3 (en) 2012-12-03 2019-10-02 Bristol-Myers Squibb Company Enhancing anti-cancer activity of immunomodulatory fc fusion proteins
JP6595458B2 (ja) 2013-09-20 2019-10-23 ブリストル−マイヤーズ スクイブ カンパニー 腫瘍を処置するための抗lag−3抗体と抗pd−1抗体との組合せ
PE20170255A1 (es) * 2014-01-24 2017-03-22 Dana Farber Cancer Inst Inc Moleculas de anticuerpo que se unen a pd-1 y usos de las mismas
CN105175545B (zh) * 2015-10-20 2019-01-25 安徽瀚海博兴生物技术有限公司 一种抗vegf-抗pd-1双功能抗体及其应用
EP3496707A4 (en) * 2016-08-09 2020-03-25 Angimmune, LLC Treatment of cancer using a combination of immunomodulation and check point inhibitors
CN110869392A (zh) 2017-05-16 2020-03-06 百时美施贵宝公司 用抗gitr激动性抗体治疗癌症

Patent Citations (55)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7635757B2 (en) 1999-08-23 2009-12-22 Dana-Farber Cancer Institute, Inc. B7-4 Antibodies and uses therefor
US6808710B1 (en) 1999-08-23 2004-10-26 Genetics Institute, Inc. Downmodulating an immune response with multivalent antibodies to PD-1
WO2003099196A2 (en) 2002-05-23 2003-12-04 Cure Tech Ltd. Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency
US7488802B2 (en) 2002-12-23 2009-02-10 Wyeth Antibodies against PD-1
US20090145493A1 (en) 2004-11-23 2009-06-11 Pip Co., Ltd. Built-in wall water service box
WO2006105021A2 (en) 2005-03-25 2006-10-05 Tolerrx, Inc. Gitr binding molecules and uses therefor
US8779105B2 (en) 2005-05-09 2014-07-15 Medarex, L.L.C. Monoclonal antibodies to programmed death 1 (PD-1)
US8008449B2 (en) 2005-05-09 2011-08-30 Medarex, Inc. Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
WO2006121168A1 (en) 2005-05-09 2006-11-16 Ono Pharmaceutical Co., Ltd. Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics
WO2007005874A2 (en) 2005-07-01 2007-01-11 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (pd-l1)
US7943743B2 (en) 2005-07-01 2011-05-17 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
WO2009054863A2 (en) 2006-12-13 2009-04-30 Medarex, Inc. Human antibodies that bind cd19 and uses thereof
JP2008278814A (ja) 2007-05-11 2008-11-20 Igaku Seibutsugaku Kenkyusho:Kk アゴニスティック抗ヒトgitr抗体による免疫制御の解除とその応用
US8900587B2 (en) 2007-06-18 2014-12-02 Merck Sharp & Dohme Corp. Antibodies to human programmed death receptor PD-1
US8354509B2 (en) 2007-06-18 2013-01-15 Msd Oss B.V. Antibodies to human programmed death receptor PD-1
WO2009014708A2 (en) 2007-07-23 2009-01-29 Cell Genesys, Inc. Pd-1 antibodies in combination with a cytokine-secreting cell and methods of use thereof
WO2009045957A1 (en) 2007-10-01 2009-04-09 Medarex, Inc. Human antibodies that bind mesothelin, and uses thereof
WO2009073533A2 (en) 2007-11-30 2009-06-11 Medarex, Inc. Anti-b7h4 monoclonal antibody-drug conjugate and methods of use
WO2009073546A2 (en) 2007-11-30 2009-06-11 Medarex, Inc. Monoclonal antibody partner molecule conjugates directed to protein tyrosine kinase 7 (ptk7)
US8168757B2 (en) 2008-03-12 2012-05-01 Merck Sharp & Dohme Corp. PD-1 binding proteins
WO2009114335A2 (en) 2008-03-12 2009-09-17 Merck & Co., Inc. Pd-1 binding proteins
US20110150892A1 (en) 2008-08-11 2011-06-23 Medarex, Inc. Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof
US8609089B2 (en) 2008-08-25 2013-12-17 Amplimmune, Inc. Compositions of PD-1 antagonists and methods of use
US8217149B2 (en) 2008-12-09 2012-07-10 Genentech, Inc. Anti-PD-L1 antibodies, compositions and articles of manufacture
WO2011028683A1 (en) 2009-09-03 2011-03-10 Schering Corporation Anti-gitr antibodies
WO2011066389A1 (en) 2009-11-24 2011-06-03 Medimmmune, Limited Targeted binding agents against b7-h1
WO2011161699A2 (en) 2010-06-25 2011-12-29 Aurigene Discovery Technologies Limited Immunosuppression modulating compounds
WO2012145493A1 (en) 2011-04-20 2012-10-26 Amplimmune, Inc. Antibodies and other molecules that bind b7-h1 and pd-1
WO2013014668A1 (en) 2011-07-24 2013-01-31 Curetech Ltd. Variants of humanized immunomodulatory monoclonal antibodies
US8686119B2 (en) 2011-07-24 2014-04-01 Curetech Ltd. Variants of humanized immunomodulatory monoclonal antibodies
WO2013079174A1 (en) 2011-11-28 2013-06-06 Merck Patent Gmbh Anti-pd-l1 antibodies and uses thereof
WO2013119202A1 (en) * 2012-02-06 2013-08-15 Providence Health & Services - Oregon Cancer treatment and monitoring methods using ox40 agonists
WO2013173223A1 (en) 2012-05-15 2013-11-21 Bristol-Myers Squibb Company Cancer immunotherapy by disrupting pd-1/pd-l1 signaling
US20140072565A1 (en) 2012-06-08 2014-03-13 National Cancer Center Novel epitope for switching to th17 cell and use thereof
US20140072566A1 (en) 2012-06-08 2014-03-13 National Cancer Center Novel epitope for switching to th2 cell and use thereof
US20140065152A1 (en) 2012-06-08 2014-03-06 National Cancer Center Novel epitope for switching to th1 cell and use thereof
WO2015026684A1 (en) * 2013-08-20 2015-02-26 Merck Sharp & Dohme Corp. Modulation of tumor immunity
WO2015031667A2 (en) 2013-08-30 2015-03-05 Amgen Inc. Gitr antigen binding proteins
WO2015116178A1 (en) 2014-01-31 2015-08-06 Thomas Jefferson University Fusion proteins for modulating regulatory and effector t cells
WO2015184099A1 (en) 2014-05-28 2015-12-03 4-Antibody Ag Anti-gitr antibodies and methods of use thereof
WO2015187835A2 (en) 2014-06-06 2015-12-10 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
US9228016B2 (en) 2014-06-06 2016-01-05 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (GITR) and uses thereof
WO2016054638A1 (en) 2014-10-03 2016-04-07 Dana-Farber Cancer Institute, Inc. Glucocorticoid-induced tumor necrosis factor receptor (gitr) antibodies and methods of use thereof
WO2016057846A1 (en) 2014-10-08 2016-04-14 Novartis Ag Compositions and methods of use for augmented immune response and cancer therapy
WO2016057841A1 (en) 2014-10-08 2016-04-14 Novartis Ag Compositions and methods of use for augmented immune response and cancer therapy
WO2016081746A2 (en) 2014-11-21 2016-05-26 Bristol-Myers Squibb Company Antibodies comprising modified heavy constant regions
CN105669867A (zh) 2014-11-21 2016-06-15 上海中信国健药业股份有限公司 抗gitr/ctla-4双特异性抗体及其制备方法和用途
WO2016126781A1 (en) 2015-02-03 2016-08-11 Oncomed Pharmaceuticals, Inc. Tnfrsf-binding agents and uses thereof
WO2016168716A1 (en) 2015-04-17 2016-10-20 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-pd-1 antibody and another antibody
WO2016196792A1 (en) 2015-06-03 2016-12-08 Bristol-Myers Squibb Company Anti-gitr antibodies for cancer diagnostics
WO2017015623A2 (en) 2015-07-23 2017-01-26 Inhibrx Lp Multivalent and multispecific gitr-binding fusion proteins
WO2017025610A1 (en) 2015-08-12 2017-02-16 Medimmune Limited Gitrl fusion proteins and uses thereof
WO2017068186A1 (en) 2015-10-22 2017-04-27 Ablynx Nv Gitr agonists
WO2017068185A1 (en) 2015-10-23 2017-04-27 Apogenix Ag Single-chain gitr-receptor agonist proteins
WO2017087678A2 (en) 2015-11-19 2017-05-26 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof

Non-Patent Citations (41)

* Cited by examiner, † Cited by third party
Title
"An Investigational Immuno-therapy Study of Experimental Medication BMS-986156, Given by Itself or in Combination With Nivolumab in Patients With Solid Cancers or Cancers That Have Spread.", 6 November 2015 (2015-11-06), XP002783802, Retrieved from the Internet <URL:https://clinicaltrials.gov/ct2/show/NCT02598960> [retrieved on 20180810] *
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10
ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, no. 17, 1997, pages 3389 - 3402
BERGE, S.M. ET AL., J. PHARM. SCI., vol. 66, 1977, pages 1 - 19
BRAHMER J ET AL., NEW ENGL J MED., vol. 373, 2015, pages 123 - 135
BRUMMELL ET AL., BIOCHEM., vol. 32, 1993, pages 1180 - 1187
BURKS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 412 - 417
CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546
CORBETT, T.H. ET AL., CANCER TREATMENT REPORTS, vol. 66, 1982, pages 1187
DANNY N. KHALIL ET AL: "The future of cancer treatment: immunomodulation, CARs and combination immunotherapy", NATURE REVIEWS CLINICAL ONCOLOGY, vol. 13, no. 5, 15 March 2016 (2016-03-15), NY, US, pages 273 - 290, XP055290129, ISSN: 1759-4774, DOI: 10.1038/nrclinonc.2016.25 *
E. MEYERS; W. MILLER, CABIOS, vol. 4, 1989, pages 11 - 17
ED HARLOW; DAVID LANE, COLD SPRING HARB PROTOC, 2006
ED HARLOW; DAVID LANE: "Using Antibodies", 1999, COLD SPRING HARBOR LABORATORY PRESS, article "Chapter 11"
FERNS RL ET AL., NEW ENGL J MED, vol. 375, 2016, pages 1856 - 1867
G. E. MORRIS: "Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996
HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS
JEFFERIS ET AL., MABS, vol. 1, 2009, pages 1
KHALIL DANNY N ET AL: "The New Era of Cancer Immunotherapy: Manipulating T-Cell Activity to Overcome Malignancy", IMMUNOTHERAPY OF CANCER IN: ADVANCES IN CANCER RESEARCH; ISSN 0065-230X; VOL. 128; [ADVANCES IN CANCER RESEARCH; ISSN 0065-230X; VOL], ACADEMIC PRESS, US, vol. 128, 1 January 2015 (2015-01-01), pages 1 - 68, XP009190991, ISSN: 0065-230X, DOI: 10.1016/BS.ACR.2015.04.010 *
KIM EILEEN S ET AL: "Immune Checkpoint Modulators: An Emerging Antiglioma Armamentarium", JOURNAL OFR IMMUNOLOGY RESEARCH, 2016, XP002783804 *
KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614
KNEE DEBORAH A ET AL: "Rationale for anti-GITR cancer immunotherapy", EUROPEAN JOURNAL OF CANCER, ELSEVIER, AMSTERDAM, NL, vol. 67, 31 August 2016 (2016-08-31), pages 1 - 10, XP029758970, ISSN: 0959-8049, DOI: 10.1016/J.EJCA.2016.06.028 *
KOBAYASHI ET AL., PROTEIN ENG., vol. 12, no. 10, 1999, pages 879 - 884
LEI LU ET AL: "Combined PD-1 blockade and GITR triggering induce a potent antitumor immunity in murine cancer models and synergizes with chemotherapeutic drugs", JOURNAL OF TRANSLATIONAL MEDICINE, BIOMED CENTRAL, vol. 12, no. 1, 7 February 2014 (2014-02-07), pages 36, XP021176018, ISSN: 1479-5876, DOI: 10.1186/1479-5876-12-36 *
LOHMUELLER JASON ET AL: "Current modalities in cancer immunotherapy: Immunomodulatory antibodies, CARs and vaccines", PHARMACOLOGY AND THERAPEUTICS, vol. 178, 16 March 2017 (2017-03-16), pages 31 - 47, XP085202011, ISSN: 0163-7258, DOI: 10.1016/J.PHARMTHERA.2017.03.008 *
MARTIN-LIBERAL JUAN ET AL: "The expanding role of immunotherapy", CANCER TREATMENT REVIEWS, ELSEVIER, AMSTERDAM, NL, vol. 54, 11 February 2017 (2017-02-11), pages 74 - 86, XP029937029, ISSN: 0305-7372, DOI: 10.1016/J.CTRV.2017.01.008 *
MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77
MOREL ET AL., MOL. IMMUNOL., vol. 25, no. 1, 1988, pages 7
MOTZER RJ ET AL., NEW ENGL J MED, vol. 373, 2015, pages 1803 - 1813
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453
NENGWANG YU ET AL: "Synergistic antitumor responses by combined GITR activation and sunitinib in metastatic renal cell carcinoma", INTERNATIONAL JOURNAL OF CANCER, vol. 138, no. 2, 18 August 2015 (2015-08-18), US, pages 451 - 462, XP055364303, ISSN: 0020-7136, DOI: 10.1002/ijc.29713 *
NIH U.S. NATIONAL LIBRARY OF MEDICINE: "Phase 1/2 Study Exploring the Safety, Tolerability, and Efficacy of INCAGN01876 Combined With Immune Therapies in Advanced or Metastatic Malignancies", 24 April 2017 (2017-04-24), XP002783803, Retrieved from the Internet <URL:https://clinicaltrials.gov/ct2/show/NCT03126110> [retrieved on 20180809] *
PADOVANI CTJ ET AL., REV SOC BRAS MED TROP, vol. 46, 2013, pages 288 - 292
ROUX ET AL., J IMMUNOL, vol. 161, 1998, pages 4083
ROUX ET AL., J. IMMUNOL., vol. 161, 1998, pages 4083
SANTONI MATTEO ET AL: "Triple negative breast cancer: Key role of Tumor-Associated Macrophages in regulating the activity of anti-PD-1/PD-L1 agents", BBA - REVIEWS ON CANCER, ELSEVIER SCIENCE BV, AMSTERDAM, NL, vol. 1869, no. 1, 7 November 2017 (2017-11-07), pages 78 - 84, XP085338105, ISSN: 0304-419X, DOI: 10.1016/J.BBCAN.2017.10.007 *
SCHAER ET AL., CURR OPIN IMMUNOL, vol. 24, no. 2, pages 217 - 224
SHARMA PADMANEE ET AL: "Primary, Adaptive, and Acquired Resistance to Cancer Immunotherapy", CELL, CELL PRESS, AMSTERDAM, NL, vol. 168, no. 4, 9 February 2017 (2017-02-09), pages 707 - 723, XP029935389, ISSN: 0092-8674, DOI: 10.1016/J.CELL.2017.01.017 *
STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242
TAN WAN-LING ET AL: "Novel therapeutic targets on the horizon for lung cancer", THE LANCET ONCOLOGY, ELSEVIER, AMSTERDAM, NL, vol. 17, no. 8, 26 July 2016 (2016-07-26), XP029663507, ISSN: 1470-2045, DOI: 10.1016/S1470-2045(16)30123-1 *
VISSER J ET AL., CLIN EXP IMMUNOL., vol. 150, 2007, pages 199 - 209
WANG ET AL., CANCER IMMUNOL RES, vol. 2, no. 9, 2014, pages 846 - 56

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11084881B2 (en) 2014-06-06 2021-08-10 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (GITR) and uses thereof
US11802162B2 (en) 2014-06-06 2023-10-31 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (GITR) and uses thereof
US11685787B2 (en) 2017-05-16 2023-06-27 Bristol-Myers Squibb Company Treatment of cancer with anti-GITR agonist antibodies
CN114787188A (zh) * 2019-11-05 2022-07-22 震动疗法股份有限公司 用抗pd-1抗体治疗癌症的方法
EP4085074A4 (en) * 2020-01-02 2024-05-15 Nanjing GenScript Biotech Co., Ltd. ANTI-GITR ANTIBODIES AND THEIR USES
WO2021225159A1 (ja) * 2020-05-08 2021-11-11 国立大学法人三重大学 Gitr結合性分子
WO2024097328A1 (en) * 2022-11-03 2024-05-10 Incyte Corporation Combination therapies comprising an anti-gitr antibody for treating cancers
WO2025145207A1 (en) 2023-12-29 2025-07-03 Bristol-Myers Squibb Company Combination therapy of kras inhibitor and treg-depleting agent

Also Published As

Publication number Publication date
JP7274426B2 (ja) 2023-05-16
CN110869392A (zh) 2020-03-06
US11685787B2 (en) 2023-06-27
KR20200006115A (ko) 2020-01-17
US20200291122A1 (en) 2020-09-17
EP3625260A1 (en) 2020-03-25
JP2020520912A (ja) 2020-07-16

Similar Documents

Publication Publication Date Title
US11685787B2 (en) Treatment of cancer with anti-GITR agonist antibodies
US20240158524A1 (en) Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
KR102114562B1 (ko) 암의 치료에 사용하기 위한 5-브로모-2,6-디-(1h-피라졸-1-일)피리미딘-4-아민
AU2018250301B2 (en) Anti-ICOS agonist antibodies and uses thereof
US20220175921A1 (en) Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
KR102493282B1 (ko) Tim3에 대한 항체 및 그의 용도
CN107922496B (zh) IL2Rβ/通用γ链抗体
AU2018295119B2 (en) Multi-specific antibodies and methods of making and using thereof
JP2022028666A (ja) Cd40に対する抗体
KR20200044899A (ko) 암의 치료 및 진단을 위한 tim-3 길항제
KR20200108870A (ko) Tim3에 대한 항체 및 그의 용도
KR20200109339A (ko) Tim3에 대한 항체를 사용하여 암을 치료하는 방법
US20240010729A1 (en) Combination therapy of a pd-1 antagonist and lag3 antagonist and lenvatinib or a pharmaceutically acceptable salt thereof for treating patients with cancer
TWI879267B (zh) 抗人類pd-l1抗體及其用途
US20230416388A1 (en) Treatment of cancer with anti-gitr agonist antibodies
US20230140384A1 (en) Antibodies to cd40 with enhanced agonist activity
KR102226100B1 (ko) 암의 치료에 사용하기 위한 5-브로모-2,6-디-(1h-피라졸-1-일)피리미딘-4-아민
RU2811477C2 (ru) Мультиспецифические антитела и способы их получения и применения
HK40128870A (zh) 抗人类pd-l1抗体及其用途
HK40089230A (zh) 药物组合物及用途
NZ789986A (en) Antibodies against tim3 and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18731561

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2019563411

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20197036659

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018731561

Country of ref document: EP

Effective date: 20191216