WO2017214207A2 - Methods for the treatment of b cell malignancies using adoptive cell therapy - Google Patents

Methods for the treatment of b cell malignancies using adoptive cell therapy Download PDF

Info

Publication number
WO2017214207A2
WO2017214207A2 PCT/US2017/036231 US2017036231W WO2017214207A2 WO 2017214207 A2 WO2017214207 A2 WO 2017214207A2 US 2017036231 W US2017036231 W US 2017036231W WO 2017214207 A2 WO2017214207 A2 WO 2017214207A2
Authority
WO
WIPO (PCT)
Prior art keywords
cells
subject
optionally
car
dose
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/036231
Other languages
English (en)
French (fr)
Other versions
WO2017214207A3 (en
WO2017214207A8 (en
Inventor
Cameron J. Turtle
David Maloney
Stanley RIDDELL
Mark Gilbert
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Juno Therapeutics Inc
Fred Hutchinson Cancer Center
Original Assignee
Juno Therapeutics Inc
Fred Hutchinson Cancer Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020237018556A priority Critical patent/KR102644950B1/ko
Priority to AU2017277396A priority patent/AU2017277396B2/en
Priority to JP2019516103A priority patent/JP7139318B2/ja
Priority to CA3024725A priority patent/CA3024725A1/en
Priority to EP17733663.3A priority patent/EP3463437A2/en
Priority to BR112018074406-9A priority patent/BR112018074406A2/pt
Priority to US16/307,462 priority patent/US20200016199A1/en
Priority to KR1020247007298A priority patent/KR20240036704A/ko
Priority to MX2018014911A priority patent/MX2018014911A/es
Priority to KR1020197000351A priority patent/KR102540751B1/ko
Application filed by Juno Therapeutics Inc, Fred Hutchinson Cancer Center filed Critical Juno Therapeutics Inc
Priority to CN201780046873.8A priority patent/CN109562151A/zh
Publication of WO2017214207A2 publication Critical patent/WO2017214207A2/en
Publication of WO2017214207A3 publication Critical patent/WO2017214207A3/en
Publication of WO2017214207A8 publication Critical patent/WO2017214207A8/en
Anticipated expiration legal-status Critical
Priority to JP2021199037A priority patent/JP2022033929A/ja
Priority to JP2023189795A priority patent/JP2023184646A/ja
Priority to US19/031,042 priority patent/US20250197471A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/66Phosphorus compounds
    • A61K31/664Amides of phosphorus acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/66Phosphorus compounds
    • A61K31/675Phosphorus compounds having nitrogen as a ring hetero atom, e.g. pyridoxal phosphate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7076Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4212CD22, BL-CAM, siglec-2 or sialic acid binding Ig-related lectin 2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4214Receptors for cytokines
    • A61K40/4215Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR], CD30
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4221CD20
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4224Molecules with a "CD" designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70575NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6869Methods for sequencing
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment

Definitions

  • the present disclosure relates to adoptive cell therapy involving the administration of doses of cells for treating B cell malignancies.
  • the cells generally express recombinant receptors such as chimeric antigen receptors (CARs).
  • CARs chimeric antigen receptors
  • the methods are for treating subjects with chronic lymphocytic leukemia (CLL).
  • CLL chronic lymphocytic leukemia
  • NHL non-Hodgkin lymphoma
  • the methods involve prior administration of a lymphodepleting therapy, such as prior administration of fludarabine and/or another lymphodepleting chemotherapeutic agent, for example
  • features of the methods include an increase in complete remission, overall survival and/or progression free survival of subjects treated in accord with the provided methods.
  • adoptive cell therapies including those involving the administration of cells expressing chimeric receptors specific for a disease or disorder of interest, such as chimeric antigen receptors (CARs) and/or other recombinant antigen receptors, as well as other adoptive immune cell and adoptive T cell therapies
  • CARs chimeric antigen receptors
  • adoptive immune cell and adoptive T cell therapies can be effective in the treatment of cancer and other diseases and disorders.
  • Improved methods are needed, for example, to increase efficacy of such methods. Provided are methods and uses that meet such needs.
  • engineered cells e.g., T cells
  • compositions thereof for the treatment of subjects having a disease or condition, which generally is or includes a leukemia or lymphoma, most particularly a chronic lymphocytic leukemia (CLL) and/or a non-Hodgkin lymphoma (NHL).
  • CLL chronic lymphocytic leukemia
  • NHS non-Hodgkin lymphoma
  • the methods and uses provide for or achieve improved or more durable responses or efficacy and/or a reduced risk of toxicity or other side effects, as compared to certain alternative methods, such as in particular groups of subjects treated.
  • the methods are advantageous by virtue of the administration of specified numbers or relative numbers of the engineered cells, the
  • the methods and uses include administering to the subject cells expressing genetically engineered (recombinant) cell surface receptors in adoptive cell therapy, which generally are chimeric receptors such as chimeric antigen receptors (CARs), recognizing an antigen expressed by, associated with and/or specific to the leukemia or lymphoma and/or cell type from which it is derived.
  • the cells are generally administered in a composition formulated for administration; the methods generally involve administering one or more doses of the cells to the subject, which dose(s) may include a particular number or relative number of cells or of the engineered cells, and/or a defined ratio of two or more sub-types within the composition, such as CD4 vs CD8 T cells.
  • the subject generally has been preconditioned with a lymphodepleting therapy, which in some aspects increases the persistence and/or efficacy of the cells following administration, as compared to methods in which the preconditioning is not carried out or is carried out using a different lymphodepleting therapy.
  • the lymphodepleting therapy generally includes the administration of fludarabine, typically in combination with another chemotherapy or other agent, such as cyclophosphamide, which may be administered sequentially or simultaneously in either order.
  • the methods involve treating a subject having or suspected of having a chronic lymphocytic leukemia (CLL).
  • the methods include administering to the subject a dose of cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen expressed by the CLL.
  • CLL chronic lymphocytic leukemia
  • the dose contains (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg, (c) no more than at or about 2 x 10 6 of the cells/kg, (d) no more than at or about 2 x 10 5 of the cells/kg and/or (e) between at or about 2 x 10 5 of the cells/kg and at or about 2 x 10 6 of the cells/kg.
  • the subject prior to the administration, has been preconditioned with a lymphodepleting therapy that includes the administration of fludarabine.
  • a method of treating a subject having or suspected of having a chronic lymphocytic leukemia including administering to the subject a dose of cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen expressed by the CLL, said dose contianing (a) at or about 1 x 10 total cells or total CAR- expressing cells; (b) at or about 1.5 x 10 total cells or total CAR-expressing cells, (c) no more than at or about 1 x 10 total cells or total CAR-expressing cells, (d) no more than at or about 1.5 x 10 8 total cells or total CAR-expressing cells and/or (e) between at or about 1 x 107 total cells or total CAR-expressing cells and at or about 1.5 x 10 total cells or total CAR-expressing cells, wherein, prior to the administration, the subject has been preconditioned with a lymphodepleting therapy comprising the administration of fludarabine.
  • CAR chimeric antigen receptor
  • the methods involve treating a subject having a non-Hodgkin lymphoma (NHL), such as an aggressive NHL and/or an NHL of a particular sub-type such as a diffuse large B cell lymphoma (DLBCL), a primary mediastinal large B cell lymphoma (PMBCL), a T cell/histocyte-rich large B cell lymphoma (TCHRBCL), a Burkitt's lymphoma, and/or other aggressive NHL, a mantle cell lymphoma (MCL), and/or follicular lymphoma (FL).
  • NHL non-Hodgkin lymphoma
  • the methods include administering to the subject a dose of cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen expressed by the NHL.
  • the dose contains (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg, (c) no more than at or about 2 x 10 6 of the cells/kg, (d) no more than at or about 2 x 10 5 of the cells/kg and/or (e) between at or about 2 x 10 5 of the cells/kg and at or about 2 x 10 6 of the cells/kg.
  • the dose typically further contains a defined ratio of particular subtypes of cells, such as CD4 + cells expressing the CAR to CD8 + cells expressing the CAR and/or of CD4 + cells to CD8 + cells.
  • the subject prior to the administration, has been preconditioned with a lymphodepleting therapy that includes the administration of fludarabine.
  • the dose of cells administered includes a defined or pre-determined or engineered ratio of particular sub-types of cells.
  • the ratio may include a ratio of CD4 + cells expressing the CAR to CD8 + cells expressing the CAR and/or of CD4 + cells to CD8 + cells.
  • the CD4+ or CD8+ cells are enriched for a particular subtype, such as central-memory cells or are derived from such an enriched population, such as cells derived from CD8+ central memory cells, and/or those exhibiting increased expression of CD62L and/or CD45RO and/or CCR7 as compared to bulk T cells or bulk CD8+ T cells, or cells derived from bulk T cells or bulk CD8+ T cells.
  • the ratio is or is approximately 1: 1. In some aspects, it is between at or approximately 1:3 and at or
  • the subject is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk NHL; the subject is or has been identified as having high-risk NHL; and/or the NHL is selected from the group consisting of aggressive NHL, diffuse large B cell lymphoma (DLBCL), primary mediastinal large B cell lymphoma (PMBCL), T cell/histocyte- rich large B cell lymphoma (TCHRBCL), Burkitt's lymphoma, mantle cell lymphoma (MCL), and/or follicular lymphoma (FL).
  • DLBCL diffuse large B cell lymphoma
  • PMBCL primary mediastinal large B cell lymphoma
  • TCHRBCL T cell/histocyte- rich large B cell lymphoma
  • MCL mantle cell lymphoma
  • FL follicular lymphoma
  • the subject is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • the lymphodepleting therapy further includes administering another chemotherapeutic agent other than the fludarabine, such as cyclophosphamide.
  • the preconditioning e.g., via the lymphodepleting therapy such as fludarabine and/or
  • cyclohphosphamide is initiated at a time that is at least at or about 24 or at least at or about 48 hours prior to, or is between at or about 48 and at or about 96 hours prior to, the administration of the cells.
  • the lymphodepleting therapy includes the administration of cyclophosphamide at at or about 30-60 mg/kg of the subject (such as once daily for one, two or three days), and/or the fludarabine, such as at 25 mg/m (e.g., daily for 2, 3, 4, or 5 or more days, such as for 3-5 days).
  • the administration of the cell dose and/or the lymphodepleting therapy is carried out via outpatient delivery.
  • the subject is or has been identified as having one or more cytogenetic abnormalities and/or other risk factors.
  • the abnormalities or factor(s) are associated with high-risk or very- high risk disease, such as high-risk or very high risk CLL and/or NHL.
  • Such factors may be those detected or detectable by FISH and/or those not detectable by FISH.
  • the abnormalities may include complex karyotype (CK), translocations, deletion of the long arm of chromosome 13 (del 13q), del 11, trisomy 12, del 17p, del 6q, and del 13q. l4, optionally as detected by FISH.
  • the abnormalities include CK and/or dell7p.
  • the subject treated by the methods and uses is or has been identified as having high-risk CLL or very high-risk CLL and optionally is selected for the treatment based on such classification and/or a particular abnormality.
  • the subject is or has been identified as, and/or is selected for, having metastatic, aggressive, advanced, and/or extramedullary form of the disease or condition; and/or the subject is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • the subject prior to the administration of the dose of cells, the subject has been treated with two or more, optionally 3, 4, 5, 6, 7, 8, or 9 more, therapies for the leukemia or lymphoma, such as the NHL and/or the CLL and/or with two or more, optionally 3, 4, 5, 6, 7, 8, or 9 more, therapies other than the lymphodepleting therapy and/or other than another dose of cells expressing the CAR.
  • the subject prior to the administration of the dose of cells, has been treated for the CLL with a kinase inhibitor, optionally an inhibitor of Btk, optionally ibrutinib, and/or a biologic and/or immunotherapy, such as monoclonal antibody.
  • the subject prior to the administration of the dose of cells, the subject has been treated with two or more, optionally 2, 3, or 4 more, therapies for the leukemia or lymphoma, which generally are therapies other than the lymphodepleting therapy and/or the cells or another dose of cells expressing the CAR, optionally other than cells expressing a different CAR.
  • therapies for the leukemia or lymphoma which generally are therapies other than the lymphodepleting therapy and/or the cells or another dose of cells expressing the CAR, optionally other than cells expressing a different CAR.
  • the subject has relapsed following remission after treatment with, or become refractory to, such one or more prior therapies.
  • the subject prior to the administration of the dose of cells, the subject has been treated for the leukemia or lymohoma (such as the CLL or NHL) with a monoclonal antibody such as one that specifically binds to an antigen expressed by, or previously expressed by, cells of the CLL or the NHL.
  • a monoclonal antibody such as one that specifically binds to an antigen expressed by, or previously expressed by, cells of the CLL or the NHL.
  • the subject at or immediately prior to the time of the administration of the dose of cells, the subject has relapsed following remission after treatment with, or become refractory to, one or more prior therapies for the CLL.
  • the method further includes, prior to the administration of the cell dose, administering the lymphodepleting therapy to the subject.
  • the dose of cells contains a defined ratio of CD4+ cells expressing the CAR to CD8+ cells expressing the CAR and/or of CD4+ cells to CD8+ cells, which optionally is approximately 1: 1 or is between approximately 1:3 and approximately 3: 1.
  • the dose of cells is administered parenterally, optionally intravenously.
  • At least 50% of subjects treated according to the method achieve complete remission (CR) and/or objective response (OR); and/or the subject exhibits CR, OR, lymph nodes of less than at or about 20 mm in size, within 1 month of the administration of the dose of cells; and/or a malignant immunoglobulin heavy chain (IGH) locus and/or an index clone of the disease or condition such as the CLL or NHL is not detected in the bone marrow of the subject (or in the bone marrow of greater than 50% of subjects treated according to the methods), optionally as assessed by IGH deep sequencing, optionally at a time that is at or about or at least at or about 1, 2, 3, 4, 5, 6, 12, 18, or 24 months following the administration of the cell dose.
  • IGH immunoglobulin heavy chain
  • PFS progression-free survival
  • OS overall survival
  • the antigen is a B cell antigen. In some aspects, the antigen is CD19. In some aspects, the antigen is or includes CD20, CD22, CD30, CD33, CD38, ROR1, or other marker associated with B cells or B cell cancer.
  • the CAR contains a binding domain, which typically is or comprises an scFv specific for the antigen, a transmembrane domain, and one or more cytoplasmic signaling domains or regions, which may be derived from natural or endogenous signaling molecules or functional variants thereof.
  • the signaling region includes domains capable of delivering primary and secondary signals to a T cell or other immune cell.
  • the domains may include those derived from a costimulatory molecule, such as from a 4-1BB, e.g., a human 4-1BB, and/or a CD28 molecule, such as a human CD28.
  • the domains may further include a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, such as a CD3zeta, e.g., human CD3zeta.
  • a primary signaling ITAM-containing molecule such as a CD3zeta, e.g., human CD3zeta.
  • the CAR contains a spacer and/or hinge region, which may in some aspects be derived from a human IgG.
  • At least at or about 50%, at least at or about 60%, at least at or about 70%, at least at or about 80%, or at least at or about 90%, of subjects treated according to the method achieve complete remission (CR), such as measured by RECIST criteria and/or Lugano criteria, and/or any of a number of known criteria for assessing response.
  • at least at or about 50%, at least at or about 60%, at least at or about 70%, at least at or about 80%, or at least at or about 90%, of subjects treated according to the method achieve objective response (OR), such as measured by RECIST criteria and/or Lugano criteria, and/or any of a number of known criteria for assessing response.
  • the subject or at least at or about 50%, at least at or about 60%, at least at or about 70%, at least at or about 80%, or at least at or about 90%, of subjects that are treated according to the method, and that achieve complete remission (CR), exhibit progression-free survival (PFS) and/or overall survival (OS) of greater than 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or more months, e.g., on average, and/or greater than 6, 12, or 18 months.
  • PFS progression-free survival
  • OS overall survival
  • the subject or at least at or about 50%, at least at or about 60%, at least at or about 70%, at least at or about 80%, or at least at or about 90%, of subjects treated according to the method, exhibit(s) a median PFS or OS of greater than at or about 6 months, 12 months, or 18 months; and/or exhibits PFS or OS following therapy for at least at or about 6, 12, 18, or 24, or more months.
  • the subject does not exhibit grade 3 or higher neurotoxicity and/or does not exhibit severe CRS, or does not do so within a certain period of time following the treatment, such as within a week, two weeks, or one month of the administration of the cells.
  • a method of treating a subject having a non-Hodgkin lymphoma including administering to the subject a dose of cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen expressed by the NHL, wherein said dose (i) contains (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg, (c) no more than at or about 2 x 10 6 of the cells/kg, (d) no more than at or about 2 x 10 5 of the cells/kg and/or (e) between at or about 2 x 10 5 of the cells/kg and at or about 2 x 10 6 of the cells/kg, and (ii) contains a defined ratio of CD4 + cells expressing the CAR to CD8 + cells expressing the CAR and/or of CD4 + cells to CD8 + cells, which ratio optionally is approximately 1: 1 or is between
  • a method of treating a subject having a non-Hodgkin lymphoma including administering to the subject a dose of cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen expressed by the NHL, wherein said dose (i) contains (a) at or about 1 x 10 total cells or total CAR-expressing cells; (b) at or about 1.5 x 10 total cells or total CAR-expressing cells, (c) no more than at or about 1 x 10 7 total cells or total CAR-expressing cells, (d) no more than at or about 1.5 x 108 total cells or total CAR-expressing cells and/or (e) between at or about 1 x 10 total cells or total CAR- expressing cells and at or about 1.5 x 10 total cells or total CAR-expressing cells, and (ii) contains a defined ratio of CD4 + cells expressing the CAR to CD8 + cells expressing the CAR and/or of CD4 + cells to CD8 + cells
  • the subject is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk NHL; the subject is or has been identified as having high-risk NHL; and/or the NHL is selected from the group consisting of aggressive NHL, diffuse large B cell lymphoma (DLBCL), primary mediastinal large B cell lymphoma (PMBCL), T cell/histocyte- rich large B cell lymphoma (TCHRBCL), Burkitt's lymphoma, mantle cell lymphoma (MCL), and/or follicular lymphoma (FL); and/or the subject is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • DLBCL diffuse large B cell lymphoma
  • PMBCL primary mediastinal large B cell lymphoma
  • TCHRBCL T cell/histocyte- rich large B cell lymphoma
  • MCL mantle cell lymphoma
  • FL follicular lymphoma
  • the subject has been treated with two or more, optionally 2, 3, or 4 or more, therapies for the NHL other than the lymphodepleting therapy and/or other than another dose of cells expressing the CAR.
  • the subject at or immediately prior to the time of the administration of the dose of cells, the subject has relapsed following remission after treatment with, or become refractory to, one or more prior therapies for the NHL.
  • the method further includes prior to the administration of the cell dose, administering the lymphodepleting therapy to the subject.
  • the lymphodepleting therapy (i) further includes administering another chemotherapeutic agent other than the fludarabine, which optionally is cyclophosphamide; (ii) is initiated at a time that is at least at or about 48 hours prior to or is between at or about 48 and at or about 96 hours prior to the administration of the cells; and (iii) includes the administration of cyclophosphamide at about 30-60 mg/kg, optionally once daily for one or two days, and/or the fludarabine at about 25 mg/m , daily for 3-5 days.
  • the administration of the cell dose and/or the lymphodepleting therapy is carried out via outpatient delivery.
  • the defined ratio is a defined ratio of CD4+ cells expressing the CAR to CD8+ cells expressing the CAR of at or about 1: 1 and/or is a defined ratio of CD4+ cells to CD8+ cells, which is at or about 1: 1.
  • the dose of cells is administered parenterally, optionally intravenously.
  • At least 50% of subjects treated according to the method achieve complete remission (CR) and/or objective response (OR).
  • CR complete remission
  • OR objective response
  • PFS progression-free survival
  • OS overall survival
  • the antigen is a B cell antigen, which optionally is CD19.
  • the CAR contains an scFv specific for the antigen, a
  • the transmembrane domain a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta.
  • the CAR contains a spacer and/or hinge region, each optionally derived from a human IgG.
  • the CAR contains, in order, an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is or includes a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta signaling domain; or the CAR contains, in order, an scFv specific for the antigen, a spacer, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is or includes a CD3zeta signaling domain; and wherein the spacer is optionally a polypeptide spacer that (a) contains or consists of all or
  • VIWGS ETT Y YNS ALKS (SEQ ID NO: 39), and/or a CDRH3 sequence of YAMDYWG (SEQ ID NO: 40) or wherein the scFv includes a variable heavy chain region of FMC63 and a variable light chain region of FMC63 and/or a CDRL1 sequence of FMC63, a CDRL2 sequence of FMC63, a CDRL3 sequence of FMC63, a CDRH1 sequence of FMC63, a CDRH2 sequence of FMC63, and a CDRH3 sequence of FMC63 or binds to the same epitope as or competes for binding with any of the foregoing, and optionally wherein the scFv contains, in order, a VH, a linker, optionally comprising SEQ ID NO: 24, and a VL, and/or the scFv contains a flexible linker and/or includes the amino acid sequence set forth as SEQ ID NO: 24.
  • a method of prognosis or staging including detecting the presence or absence of a malignant immunoglobulin heavy chain locus (IGH) sequence in a sample from a subject having a B cell malignancy, said subject having previously received administration of a cell therapy comprising a dose or composition of genetically engineered cells expressing a recombinant receptor for treating the B cell malignancy, wherein detecting the presence or absence of the malignant IGH sequence determines the prognosis of the subject in response to the cell therapy.
  • the detecting the presence or absence of the malignant IGH sequence is carried out within or within about or about 3 to 6 weeks after initiation of the cell therapy, optionally within or within about 4 weeks of initiation of administration of the cell therapy.
  • the subject if the malignant IGH sequence is detected, the subject is identified as not responding or not exhibiting a complete response (CR) or an overall response (OR) to the cell therapy or as likely to relapse to the cell therapy.
  • CR complete response
  • OR overall response
  • the malignant IGH sequence is detected identifying the subject as a candidate for further treatment and/or for receiving an altered or alternative treatment.
  • the malignant IGH sequence is detected discontinuing administration of the cell therapy, administering to the subject a further dose of the cell therapy, administering to the subject a higher dose of the cell therapy, administering o the subject a different cell therapy, optionally a cell therapy expressing a different recombinant receptor, and/or administering to the subject an alternative therapeutic agent for treating the B cell malignancy.
  • the subject if the malignant IGH sequence is not detected, the subject is identified as responding to the cell therapy and/or as exhibiting a complete response (CR) or overall response (OR) to the cell therapy or as likely not to relapse to the cell therapy. In some embodiments, if the malignant IGH sequence is not detected, the subject is identified as a candidate for no further treatment and/or is not further treated, optionally is not further treated with the cell therapy and/or is not further treated with an alternative therapy for the B cell malignancy.
  • a method of predicting durability of response to a cell therapy including detecting the presence or absence of a malignant immunoglobulin heavy chain locus (IGH) sequence in a sample from a subject having a B cell malignancy, said subject having previously received administration of a cell therapy including a dose or composition of genetically engineered cells expressing a recombinant receptor for treating the B cell malignancy, wherein the presence or absence of the malignant IGH sequence predicts the durability of response to the cell therapy.
  • the detecting the presence or absence of the malignant IGH sequence is carried out within or within about or about 4 weeks, 6 weeks, 8 weeks, 12 weeks or 16 weeks after initiation of the cell therapy.
  • the subject if the malignant IGH sequence is not detected, the subject is predicted to exhibit or likely to exhibit a durable response to the cell therapy and/or to be at a low or relatively low risk of relapse within a certain period of time and/or to have a high likelihood of exhibiting progression free survival for at least a certain period of time.
  • the subject is predicted to exhibit survival without progression for greater than or about 3 months, greater than about 6 months, greater than about 9 months or greater than about 12 months after initiation of the cell therapy; and/or to remain surviving for greater than or greater than about 3 months, greater than or greater than about 6 months, greater than or greater than about about 9 months or greater than about 12 months after initiation of the cell therapy; and/or to exhibit durable CR or OR for greater than or greater than about 3 months, greater than or greater than about 6 months or greater than or greater than about 9 months after initiation of the cell therapy; and/or not likely to relapse following initiation of administration of the cell therapy, optionally not likely to relapse within 3 months, 6 months or 9 months after initiation of administration of the cell therapy.
  • the subject if the malignant IGH sequence is detected, the subject is predicted to exhibit or likely to exhibit a response to the cell therapy that is not durable and/or to be at a high or relatively high risk of relapse within a certain period of time and/or to have a low likelihood of exhibiting progression free survival for at least a certain period of time.
  • the subject is s predicted not to exhibit survival without progression for greater than or about 3 months, greater than about 6 months, greater than about 9 months or greater than about 12 months after initiation of the cell therapy; and/or not to remain surviving for greater than or greater than about 3 months, greater than or greater than about 6 months, greater than or greater than about about 9 months or greater than about 12 months after initiation of the cell therapy; and/or not to exhibit durable CR or OR for greater than or greater than about 3 months, greater than or greater than about 6 months or greater than or greater than about 9 months after initiation of the cell therapy.
  • the malignant IGH sequence is detected administering to the subject a further dose of the cell therapy, administering to the subject a higher dose of the cell therapy, administering o the subject a different cell therapy, optionally a cell therapy expressing a different recombinant receptor, and/or administering to the subject an alternative therapeutic agent for treating the B cell malignancy.
  • the presence or absence of the malignant IGH sequence is determined by IGH sequencing, optionally comprising PCR amplification of IGH target DNA.
  • the sample contians B cells. In some of any such embodiments, the sample contians B cells.
  • the sample contains a blood or bone marrow sample.
  • the sample has been obtained from the subject.
  • the method is carried out ex vivo.
  • the B cell malignancy is a cancer. In some cases, the B cell malignancy is or includes a leukemia. In some examples, the B cell malignancy is an antigen or is associated with an antigen selected from CD19, CD20, CD22, CD30, CD33 or CD38, ROR1. In some embodiments, the B cell malignancy is selected from and/or is acute lymphoblastic leukemia (ALL), adult ALL, chronic lymphoblastic leukemia (CLL), non- Hodgkin lymphoma (NHL), and Diffuse Large B-Cell Lymphoma (DLBCL).
  • ALL acute lymphoblastic leukemia
  • CLL chronic lymphoblastic leukemia
  • NHL non- Hodgkin lymphoma
  • the B cell malignancy is or includes chronic lymphoblastic leukemia (CLL) or high- risk CLL.
  • the B cell malignancy is or includes non-Hodgkin lymphoma (NHL).
  • the NHL is selected from the group consisting of aggressive NHL, diffuse large B cell lymphoma (DLBCL), NOS (de novo and transformed from indolent), primary mediastinal large B cell lymphoma (PMBCL), T cell/histocyte-rich large B cell lymphoma (TCHRBCL), Burkitt's lymphoma, mantle cell lymphoma (MCL), and/or follicular lymphoma (FL), optionally, follicular lymphoma Grade 3B (FL3B).
  • DLBCL diffuse large B cell lymphoma
  • NOS de novo and transformed from indolent
  • PMBCL primary mediastinal large B cell lymphoma
  • TCHRBCL T cell/histocyte-rich large B cell lymphoma
  • the recombinant receptor specifically binds to an antigen associated with the disease or condition or expressed in cells of the environment of a lesion associated with the B cell malignancy.
  • the recombinant receptor is a T cell receptor or a functional non-T cell receptor.
  • the recombinant receptor is a chimeric antigen receptor (CAR).
  • the CAR contains an extracellular antigen-recognition domain that specifically binds to the antigen and an intracellular signaling domain comprising an IT AM, wherein optionally, the intracellular signaling domain includes an intracellular domain of a CD3-zeta ⁇ 3 ⁇ ) chain; and/or wherein the CAR further includes a costimulatory signaling region, which optionally includes a signaling domain of CD28 or 4- 1BB.
  • the CAR contains an scFv specific for the antigen, a
  • the CAR contains a spacer and/or hinge region, each optionally derived from a human IgG.
  • the CAR contains, in order, an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is or includes a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta signaling domain; or the CAR contains, in order, an scFv specific for the antigen, a spacer, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB signaling domain, and a
  • cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is or includes a CD3zeta signaling domain; and wherein the spacer is optionally a polypeptide spacer that (a) contains or consists of all or a portion of an
  • VrWGS ETT Y YNS ALKS (SEQ ID NO: 39), and/or a CDRH3 sequence of YAMDYWG (SEQ ID NO: 40) or wherein the scFv includes a variable heavy chain region of FMC63 and a variable light chain region of FMC63 and/or a CDRL1 sequence of FMC63, a CDRL2 sequence of FMC63, a CDRL3 sequence of FMC63, a CDRH1 sequence of FMC63, a CDRH2 sequence of FMC63, and a CDRH3 sequence of FMC63 or binds to the same epitope as or competes for binding with any of the foregoing, and optionally wherein the scFv includes, in order, a VH, a linker, optionally comprising SEQ ID NO: 24, and a VL, and/or the scFv includes a flexible linker and/or includes the amino acid sequence set forth as SEQ ID NO: 24.
  • the engineered cells contains T cells, optionally CD4+ and/or CD8+.
  • the T cells are primary T cells obtained from a subject.
  • the engineered cells are autologous to the subject.
  • the engineered cells are allogeneic to the subject.
  • an article of manufacture containing one or more dose of a cell therapy, each dose comprising cells expressing a chimeric antigen receptor (CAR), and instructions for administering the cell therapy, wherein the instructions specify the dose of cells is to be administered to a subject having a chronic lymphocytic leukemia (CLL); and the instructions specify administration of a number of CAR-expressing or a number of cells, or specify administration of an amount or volume of one or more formulations corresponding to or containing said specified number of cells, wherein the specified number of cells to be administered contains a number to administer a dose of cells comprising (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg, (c) no more than at or about 2 x 10 6 of the cells/kg, (d) no more than at or about 2 x 10 5 of the cells/kg and/or (e) between at or about 2 x 10 5 of the cells
  • an article of manufacture comprising one or more dose of a cell therapy, each dose containing cells expressing a chimeric antigen receptor (CAR), and instructions for administering the cell therapy, wherein the instructions specify the dose of cells is to be administered to a subject having a chronic lymphocytic leukemia (CLL); and the instructions specify administration of a number of CAR-expressing or a number of cells, or specify administration of an amount or volume of one or more formulations corresponding to or containing said specified number of cells, wherein the specified number of cells to be administered contains a number to administer a dose of cells comprising (a) at or about 1 x 10 total cells or total CAR-expressing cells; (b) at or about 1.5 x 10 total cells or total CAR- expressing cells, (c) no more than at or about 1 x 10 total cells or total CAR-expressing cells, (d) no more than at or about 1.5 x 10 total cells or total CAR-expressing cells and/or (e) between at or about 1 x 10 7
  • the instructions specify that the cell therapy is to be administer to a subject that is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk CLL, optionally selected from among:
  • telomere complex karyotype deletion of the long arm of chromosome 13 (del 13q), del 11, trisomy 12, del 17p, del 6q, and del 13q. l4, optionally as detected by FISH; is or has been identified as having high-risk CLL; and/or is or has been identified as having extrameduUary disease; and/or is or has been identified as having central nervous system (CNS) disease; and/or is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • CNS central nervous system
  • the instructions specify that the cell therapy is to be administered to a subject that has been treated with two or more, optionally 3, 4, 5, 6, 7, 8, or 9 or more, therapies for the CLL, other than the lymphodepleting therapy and/or other than another dose of cells expressing the CAR; and/or has been treated for the CLL with a kinase inhibitor, optionally an inhibitor of Btk, optionally ibrutinib; and/or has been treated for the CLL with a monoclonal antibody that specifically binds to an antigen expressed by, or previously expressed by, cells of the CLL; and/or has been treated for the CLL with venetoclax, a combination therapy comprising fludarabine and rituximab, radiation therapy and/or
  • HSCT hematopoietic stem cell transplantation
  • the instructions specify that the cell therapy is to be administered to a subject that has relapsed following remission after treatment with, or become refractory to, one or more prior therapies for the CLL.
  • an article of manufacture containing one or more dose of a cell therapy, each dose containing cells expressing a chimeric antigen receptor (CAR), and instructions for administering the cell therapy, wherein the instructions specify the dose of cells is to be administered to a subject having a a non-Hodgkin lymphoma (NHL); and the instructions specify administration of a number of CAR-expressing or a number of cells, or specify administration of an amount or volume of one or more formulations corresponding to or containing said specified number of cells, wherein the specified number of cells to be administered contains a number to administer a dose of cells containing (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg, (c) no more than at or about 2 x 10 6 of the cells/kg, (d) no more than at or about 2 x 10 5 of the cells/kg and/or (e) between at or about 2 x 10 5
  • the instructions specify the
  • an article of manufacture containing one or more dose of a cell therapy, each dose comprising cells expressing a chimeric antigen receptor (CAR), and instructions for administering the cell therapy, wherein the instructions specify the dose of cells is to be administered to a subject having a a non-Hodgkin lymphoma (NHL); and the instructions specify administration of a number of CAR-expressing or a number of cells, or specify administration of an amount or volume of one or more formulations corresponding to or containing said specified number of cells, wherein the specified number of cells to be administered contains a number to administer a dose of cells containing (a) at or about 1 x 10 total cells or total CAR-expressing cells; (b) at or about 1.5 x 10 total cells or total CAR- expressing cells, (c) no more than at or about 1 x 10 total cells or total CAR-expressing cells, (d) no more than at or about 1.5 x 10 total cells or total CAR-expressing cells and/or (e) between at or about 1 x 10 total cells or total
  • the instructions specify that the cell therapy is to be administer to a subject that is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk NHL; is or has been identified as having high-risk NHL; and/or is selected from the group consisting of aggressive NHL, diffuse large B cell lymphoma (DLBCL), primary mediastinal large B cell lymphoma (PMBCL), T
  • TCHRBCL cell/histocyte-rich large B cell lymphoma
  • MCL mantle cell lymphoma
  • FL follicular lymphoma
  • the instructions specify that the cell therapy is to be administered to a subject that has been treated with two or more, optionally 2, 3 or 4 or more, therapies for the NHL, other than the lymphodepleting therapy and/or other than another dose of cells expressing the CAR.
  • the instructions specify that the cell therapy is to be administered to a subject that has relapsed following remission after treatment with, or become refractory to, one or more prior therapies for the NHL.
  • the lymphodepleting therapy (i) further includes administering another chemotherapeutic agent other than the fludarabine, which optionally is cyclophosphamide; and/or (ii) includes the administration of cyclophosphamide at about 30-60 mg/kg, optionally once daily for one or two days, and/or the fludarabine at about 25 mg/m , daily for 3-5 days.
  • the instructions specify that the lympodepleting therapy is initiated at a time that is at least at or about 48 hours prior to or is between at or about 48 and at or about 96 hours prior to the administration of the cell therapy.
  • the instructions specify administering the cell therapy at a defined ratio of CD4 + cells expressing the CAR to CD8 + cells, or specify administering amounts of volumes of the formulation(s) corresponding to such defined ratio, or includes a formulation having the cells at such ratio or contains the cells at such ratio expressing the CAR and/or of CD4 + cells to CD8 + cells, which ratio optionally is approximately 1: 1 or is between approximately 1:3 and approximately 3: 1.
  • the instructions further specify the cell therapy is for parenteral administration, optionally intravenous administration.
  • the instructions further specify the administration of the cell therapy is to be or may be administered to the subject on an outpatient setting and/or without admission of the subject to the hospital overnight or for one or more consecutive days and/or is without admission of the subject to the hospital for one or more days.
  • the cell therapy contains primary T cells obtained from a subject.
  • the T cells are autologous to the subject.
  • the T cells are allogeneic to the subject.
  • the CAR contains an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta.
  • the CAR contains a spacer and/or hinge region, each optionally derived from a human IgG.
  • the antigen is a B cell antigen, which optionally is CD19.
  • the CAR contains, in order, an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is or contains a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta signaling domain; or the CAR contains, in order, an scFv specific for the antigen, a spacer, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is or includes a CD3zeta signaling domain; and wherein the spacer is optionally a polypeptide spacer that (a) includes or consists of all or
  • immunoglobulin hinge or a modified version thereof or includes about 15 amino acids or less, and does not include a CD28 extracellular region or a CD8 extracellular region
  • (b) contains or consists of all or a portion of an immunoglobulin hinge, optionally an IgG4 hinge, or a modified version thereof and/or contains about 15 amino acids or less, and does not include a CD28 extracellular region or a CD8 extracellular region
  • (c) is at or about 12 amino acids in length and/or contains or consists of all or a portion of an immunoglobulin hinge, optionally an IgG4, or a modified version thereof; or (d) has or consists of the sequence of SEQ ID NO: 1, a sequence encoded by SEQ ID NO: 2, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID 0:N 34, or a variant of any of the foregoing having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%
  • VrWGS ETT Y YNS ALKS (SEQ ID NO: 39), and/or a CDRH3 sequence of YAMDYWG (SEQ ID NO: 40) or wherein the scFv includes a variable heavy chain region of FMC63 and a variable light chain region of FMC63 and/or a CDRL1 sequence of FMC63, a CDRL2 sequence of FMC63, a CDRL3 sequence of FMC63, a CDRH1 sequence of FMC63, a CDRH2 sequence of FMC63, and a CDRH3 sequence of FMC63 or binds to the same epitope as or competes for binding with any of the foregoing, and optionally wherein the scFv includes, in order, a VH, a linker, optionally comprising SEQ ID NO: 24, and a VL, and/or the scFv includes a flexible linker and/or includes the amino acid sequence set forth as SEQ ID NO: 24.
  • CAR chimeric antigen receptor
  • CAR chimeric anti
  • the composition is for use in treating a subject in which, at or prior to the administration of the dose of cells: the subject is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk CLL, optionally selected from among: complex karyotype, deletion of the long arm of chromosome 13 (del 13q), del 11, trisomy 12, del 17p, del 6q, and del 13q.
  • the subject is or has been identified as having high-risk CLL; and/or the subject is or has been identified as having extrameduUary disease; and/or the subject is or has been identified as having central nervous system (CNS) disease; and/or the subject is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • CNS central nervous system
  • the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated with two or more, optionally 3, 4, 5, 6, 7, 8, or 9 or more, therapies for the CLL, other than the
  • the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated with two or more, optionally 3, 4, 5, 6, 7, 8, or 9 or more, therapies for the CLL, other than another dose of cells expressing the CAR or other than another dose of cells expressing the CAR and the preconditioning therapy.
  • the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated for the CLL with a kinase inhibitor, optionally an inhibitor of Btk, optionally ibrutinib.
  • a kinase inhibitor optionally an inhibitor of Btk, optionally ibrutinib.
  • the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated for the CLL with a monoclonal antibody that specifically binds to an antigen expressed by, or previously expressed by, cells of the CLL.
  • the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated for the CLL with venetoclax, a combination therapy comprising fludarabine and rituximab, radiation therapy and/or hematopoietic stem cell transplantation (HSCT).
  • a combination therapy comprising fludarabine and rituximab, radiation therapy and/or hematopoietic stem cell transplantation (HSCT).
  • HSCT hematopoietic stem cell transplantation
  • composition containing cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen of a non-Hodgkin lymphoma (NHL) for use in treating a subject having or suspected of having NHL, wherein the treating includes
  • a dose of cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen expressed by the NHL wherein the treating includes administering to the subject a dose of cells expressing the CAR, said dose (i) contains (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg, (c) no more than at or about 2 x 10 6 of the cells/kg, (d) no more than at or about 2 x 10 5 of the cells/kg and/or (e) between at or about 2 x 10 5 of the cells/kg and at or about 2 x 10 6 of the cells/kg, and (ii) contains a defined ratio of CD4 + cells expressing the CAR to CD8 + cells expressing the CAR and/or of CD4 + cells to CD8 + cells, which ratio optionally is approximately 1: 1 or is between approximately 1:3 and approximately 3: 1, wherein, prior to
  • composition containing cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen of a non-Hodgkin lymphoma (NHL) for use in treating a subject having or suspected of having NHL, wherein the treating includes
  • said dose contains (a) at or about 1 x 10 7 total cells or total CAR-expressing cells; (b) at or about 1.5 x 108 total cells or total CAR-expressing cells, (c) no more than at or about 1 x 10 total cells or total CAR-expressing cells, (d) no more than at or about 1.5 x 10 total cells or total CAR-expressing cells and/or (e) between at or about 1 x 10 7 total cells or total CAR-expressing cells and at or about 1.5 x 108 total cells or total CAR-expressing cells, and (ii) contains a defined ratio of CD4 + cells expressing the CAR to CD8 + cells expressing the CAR and/or of CD4 + cells to CD8 + cells, which ratio optionally is approximately 1: 1 or is between approximately 1:3 and approximately 3: 1, wherein, prior to the administration, the subject has been preconditioned with a
  • lymphodepleting therapy comprising the administration of fludarabine.
  • the composition is for use in treating a subject in which, at or prior to the administration of the dose of cells, the subject is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk NHL; the subject is or has been identified as having high-risk NHL; and/or the NHL is selected from the group consisting of aggressive NHL, diffuse large B cell lymphoma (DLBCL), primary mediastinal large B cell lymphoma (PMBCL), T cell/histocyte-rich large B cell lymphoma (TCHRBCL), Burkitt's lymphoma, mantle cell lymphoma (MCL), and/or follicular lymphoma (FL); and/or the subject is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • DLBCL diffuse large B cell lymphoma
  • PMBCL primary mediastinal large B cell lymphoma
  • TCHRBCL T cell/histocyte-rich large B cell lymphoma
  • the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated with two or more, optionally 2, 3, or 4 or more, therapies for the NHL other than the lymphodepleting therapy and/or other than another dose of cells expressing the CAR.
  • the composition is for use in treating a subject in which, at or immediately prior to the time of the administration of the dose of cells, the subject has relapsed following remission after treatment with, or become refractory to, one or more prior therapies for the NHL.
  • the lymphodepleting therapy (i) further includes administration of another chemotherapeutic agent other than the fludarabine, which optionally is cyclophosphamide; (ii) is initiated at a time that is at least at or about 48 hours prior to or is between at or about 48 and at or about 96 hours prior to the administration of the cells; and (iii) includes the administration of cyclophosphamide at about 30-60 mg/kg, optionally once daily for one or two days, and/or the fludarabine at about 25 mg/m , daily for 3-5 days.
  • the treating includes administration of the cell dose and/or the lymphodepleting therapy via outpatient delivery.
  • the composition and/or the dose of cells contains a defined ratio of CD4+ cells expressing the CAR to CD8+ cells expressing the CAR and/or of CD4+ cells to CD8+ cells, which optionally is approximately 1: 1 or is between approximately 1:3 and approximately 3: 1.
  • the composition and/or dose of cells is formulated for parenteral administration, optionally intravenous administration.
  • the antigen is a B cell antigen, which optionally is CD19.
  • the CAR contains an scFv specific for the antigen, a
  • the transmembrane domain a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta.
  • the CAR contains a spacer and/or hinge region, each optionally derived from a human IgG.
  • the CAR contains, in order, an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is or includes a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta signaling domain; or the CAR contains, in order, an scFv specific for the antigen, a spacer, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB signaling domain, and a
  • cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is or includes a CD3zeta signaling domain; and wherein the spacer is optionally a polypeptide spacer that (a) contains or consists of all or a portion of an
  • VIWGS ETT Y YNS ALKS (SEQ ID NO: 39), and/or a CDRH3 sequence of YAMDYWG (SEQ ID NO: 40) or wherein the scFv contains a variable heavy chain region of FMC63 and a variable light chain region of FMC63 and/or a CDRLl sequence of FMC63, a CDRL2 sequence of FMC63, a CDRL3 sequence of FMC63, a CDRH1 sequence of FMC63, a CDRH2 sequence of FMC63, and a CDRH3 sequence of FMC63 or binds to the same epitope as or competes for binding with any of the foregoing, and optionally wherein the scFv contains, in order, a VH, a linker, optionally comprising SEQ ID NO: 24, and a VL, and/or the scFv contains a flexible linker and/or contains the amino acid sequence set forth as SEQ ID NO: 24.
  • Figure 1A shows percent progression-free survival (PFS) curves for relapsed or refractory (R/R) CD19 + chronic lymphocytic leukemia (CLL) subjects treated with a single infusion of 2 x 10 5 , 2 x 10 6 or 2 x 10 7 CAR-expressing T cells per kilogram (kg) weight of the subject. Separate curves are shown for subjects who achieved complete remission (CR) and for subjects that did not (non CR). Prior to the infusion, subjects were pre-conditioned with 60 mg/kg cyclophosphamide and 25 mg/m fludarabine (Flu) daily for 3-5 days.
  • PFS percent progression-free survival
  • FIG. IB shows percent overall survival (OS) curves for relapsed or refractory (R/R) CD19 + chronic lymphocytic leukemia (CLL) subjects treated with a single infusion of 2 x 10 5 , 2 x 10 6 or 2 x 10 7 CAR-expressing T cells per kilogram (kg) weight of the subject. Separate curves are shown for subjects who achieved complete remission (CR) and for subjects that did not (non CR). Prior to the infusion, subjects were pre-conditioned with 60 mg/kg
  • FIG. 2A shows percent progression-free survival (PFS) curves for non-Hodgkin lymphoma (NHL) subjects treated with a single infusion of 2 x 10 6 CAR-expressing T cells per kilogram (kg) weight of the subject. Separate curves are shown for subjects who achieved complete remission (CR) and for subjects that did not (non CR). Prior to the infusion, subjects 2
  • PFS percent progression-free survival
  • FIG. 2B shows percent overall survival (OS) curves for non-Hodgkin lymphoma (NHL) subjects treated with a single infusion of 2 x 10 6 CAR-expressing T cells per kilogram (kg) weight of the subject. Separate curves are shown for subjects who achieved complete remission (CR) and for subjects that did not (non CR). Prior to the infusion, subjects were pre- conditioned with 60 mg/kg cyclophosphamide and 25 mg/m fludarabine (Flu) daily for 3-5 days.
  • OS percent overall survival
  • PFS percent progression-free survival
  • FIG. 4A-E shows correlation of CAR-T cell expansion with the percentage of abnormal B cells present in bone marrow (A), the tumor cross-sectional area (B), the absolute abnormal B cell count in blood (C), the maximum SUV on PET imaging (D) and the immune checkpoint biomarker CD200 (E) for patients treated with Cy/Fu and 2xl0 6 CAR-T cells/kg.
  • FIG. 5 shows the overall survival (OS) and progression-free survival (PFS) for all CLL patients in the study. The median follow-up is 12.4 months.
  • FIG. 6A and FIG. 6B show progression free survival (PFS) and overall survival (OS) in patients as measured by IWCLL 2008 nodal response criteria, after Cy/Flu
  • FIG. 6B shows PFS and OS in patients with CR, PR or no response (SD/PD), which excluded one patient in FIG. 6A that died prior to restaging.
  • SD/PD no response
  • FIG. 6A and 6B separate curves are shown for the group of subjects who achieved CR, subjects who achieved PR, and non-responders.
  • the median PFS and OS follow-up for patients in CR/PR is 12.3 and 12.4 months, respectively.
  • mPFS median PFS
  • mOS median OS
  • NR not reached.
  • FIG. 7 shows percent progression-free survival (PFS) and overall-survival (OS) curves for fourteen subjects that achieved complete remission (CR) from bone marrow 4 weeks after CAR-T cell infusion by flow cytometry and had no detectable malignant IGH copies (IGHseq-negative) compared to those who had detectable malignant IGH copies (IGHseq- positive).
  • PFS percent progression-free survival
  • OS overall-survival
  • FIG. 8 shows CD4 + /EGFRt + and CD8 + /EGFRt + CAR-T cell counts for fourteen subjects that achieved complete remission (CR) and had IGH deep sequencing of bone marrow performed.
  • FIG. 9A shows the peak CD4+/EGFRt+ (left) and CD8+/EGFRt+ (right) CAR-T cell counts in blood from patients who did (Yes) or did not (No) clear disease from the bone marrow by high-resolution flow cytometry.
  • FIG. 9B shows the peak CD4+/EGFRt+ (left) and CD8+/EGFRt+ (right) CAR-T cell counts in blood from patients who cleared disease from the bone marrow by high-resolution flow cytometry and did or did not have detectable malignant IGH sequences in marrow.
  • FIG. 10A shows an estimated probability curve of response and an estimated probability curve of developing Grade 3-5 neurotoxicity constructed based on the number of CD4 + /EGFRt + or CD8 + /EGFRt + CAR-T cells in the blood.
  • FIG. 10B shows estimated probability curves of bone marrow response, complete or partial remission (CR/PR) by rWCLL criteria, developing Grade 2-5 cytokine release syndrome (CRS), and developing Grade 2-5 neurotoxicity (NT) constructed based on the number of CD4 + /EGFRt + or CD8 + /EGFRt + CAR-T cells in the blood.
  • CR/PR complete or partial remission
  • CRS Grade 2-5 cytokine release syndrome
  • NT Grade 2-5 neurotoxicity
  • FIG. 11 shows a waterfall plot of the change in cross-sectional area of the 6 largest lymph nodes on CT scan by rWCLL (2008) imaging criteria at best response in high-risk CLL patients after CAR-T cell immunotherapy.
  • Four patients (2 CR, 1 SD, 1 died) without high- resolution imaging to enable tumor measurement are not shown.
  • compositions for use in cell therapy for the treatment of diseases or conditions, including various cancers and tumors.
  • the methods involve
  • the receptors may include chimeric receptors, e.g., chimeric antigen receptors (CARs), and other transgenic antigen receptors including transgenic T cell receptors (TCRs).
  • CARs chimeric antigen receptors
  • TCRs transgenic T cell receptors
  • the cells, populations, and compositions are administered to a subject having the particular disease or condition to be treated, e.g., via adoptive cell therapy, such as adoptive T cell therapy.
  • adoptive cell therapy such as adoptive T cell therapy.
  • the methods involve treating a subject having a chronic lymphocytic leukemia (CLL) or a non-Hodgkin lymphoma (NHL) with a dose of antigen receptor-expressing cells (e.g. CAR-expressing cells).
  • CLL chronic lymphocytic leukemia
  • NHS non-Hodgkin lymphoma
  • the subject has been preconditioned with an immunodepleting (e.g. lymphodepleting) therapy.
  • an immunodepleting e.g. lymphodepleting
  • Preconditioning subjects with immunodepleting e.g., lymphodepleting
  • ACT adoptive cell therapy
  • Preconditioning with lymphodepleting agents have been effective in improving the efficacy of transferred tumor infiltrating lymphocyte (TIL) cells in cell therapy, including to improve response and/or persistence of the transferred cells.
  • TIL tumor infiltrating lymphocyte
  • Such preconditioning can be carried out with the goal of reducing the risk of one or more of various outcomes that could dampen efficacy of the therapy.
  • cytokine sink by which T cells, B cells, NK cells compete with TILs for homeostatic and activating cytokines, such as IL-2, IL-7, and/or IL-15; suppression of TILs by regulatory T cells, NK cells, or other cells of the immune system; impact of negative regulators in the tumor microenvironment.
  • the methods comprise administration of a
  • the methods include administering a preconditioning agent, such as a lymphodepleting or chemotherapeutic agent, such as cyclophosphamide, fludarabine, or combinations thereof.
  • a preconditioning agent such as a lymphodepleting or chemotherapeutic agent, such as cyclophosphamide, fludarabine, or combinations thereof.
  • the methods include administration of fludarabine and, optionally, another chemotherapeutic other than fludarabine.
  • the other chemotherapeutic agent is
  • the subject may be administered a lymphodepleting therapy at least 2 days prior, such as at least 3, 4, 5, 6, or 7 days prior, to the administration of the dose of cells.
  • the lymphodepleting therapy is administered or is initiated at least or at least about or at or about 48 hours or at least or at least about 96 hours prior to the administration of the dose of cells.
  • the lymphodepleting therapy is administered or is initiated between at or about 48 hours and at or about 96 hours prior to administration of the dose of cells.
  • the methods include administering a preconditioning agent, such as a lymphodepleting or chemotherapeutic agent, such as cyclophosphamide, fludarabine, or combinations thereof, to a subject prior to the first or subsequent dose.
  • a preconditioning agent such as a lymphodepleting or chemotherapeutic agent, such as cyclophosphamide, fludarabine, or combinations thereof.
  • the subject may be administered a preconditioning agent at least 2 days prior, such as at least 3, 4, 5, 6, or 7 days prior, to the first or subsequent dose.
  • the subject is administered a preconditioning agent no more than 7 days prior, such as no more than 6, 5, 4, 3, or 2 days prior, to the first or subsequent dose.
  • the subject is preconditioned with cyclophosphamide at a dose between or between about 20 mg/kg and 100 mg/kg, such as between or between about 40 mg/kg and 80 mg/kg or between or between about 30 mg/kg and 60 mg/kg. In some aspects, the subject is preconditioned with or with about 60 mg/kg of cyclophosphamide. In some embodiments, the cyclophosphamide can be administered in a single dose or can be
  • the cyclophosphamide is administered once daily for one or two days.
  • the subject is administered cyclophosphamide at a dose between or between about 100 mg/m and 500 mg/m 2 , inclusive, such as between or between about 200 mg/m 2 and 400 mg/m 2 , or 250 mg/m 2 and 350 mg/m 2 , inclusive. In some instances, the subject is administered about 300 mg/m 2 of cyclophosphamide.
  • the cyclophosphamide can be administered in a single dose or can be administered in a plurality of doses, such as given daily, every other day or every three days.
  • cyclophosphamide is administered daily, such as for 1- 5 days, for example, for 3 to 5 days.
  • the subject is administered about 300 mg/m of cyclophosphamide, daily for 3 days, prior to initiation of the cell therapy.
  • the subject is administered fludarabine at a dose between or between about 1 mg/m 2 and 100 mg/m 2 , such as between or between about 10 mg/m 2 and 75 mg/m 2 , 15 mg/m 2 and 50 mg/m 2 , 20 mg/m 2 and 40 mg/m 2 , 20 mg/m 2 and 30 mg/m 2 , 24 mg/m 2 and 35 mg/m 2 or 24 mg/m 2 and 26 mg/m 2.
  • the subject is administered 25 mg/m of fludarabine.
  • the subject is administered about 30 mg/m of fludarabine.
  • the fludarabine can be administered in a single dose or can be administered in a plurality of doses, such as given daily, every other day or every three days. In some embodiments, fludarabine is administered daily, such as for 1-5 days, for example, for 3 to 5 days. In some instances, the subject is administered about 30 mg/m of fludarabine, daily for 3 days, prior to initiation of the cell therapy.
  • the lymphodepleting agent comprises a combination of agents, such as a combination of cyclophosphamide and fludarabine.
  • the combination of agents may include cyclophosphamide at any dose or administration schedule, such as those described above, and fludarabine at any dose or administration schedule, such as those described above.
  • the subject is administered 30-60 mg/kg (-1-2 g/m ) of cyclophosphamide and 3 to 5 doses of 25 mg/m fludarabine prior to the dose of cells.
  • the subject is administered 60 mg/kg ( ⁇ 2 g/m ) of cyclophosphamide and 3 to 5 doses of 25 mg/m fludarabine prior to the first or subsequent dose.
  • cyclophosphamide at any dose or administration schedule, such as those described above
  • fludarabine at any dose or administration schedule, such as those described above.
  • the subject is administered 30-60 mg/kg (-1-2 g/m ) of cyclophosphamide and
  • lymphodepletion chemotherapy can be modified by reducing or omitting the dose of
  • cyclophosphamide or administering a regimen of a lower total dose of cyclophosphamide administered concurrently with fludarabine, to minimize toxicity in subjects, such as subjects who have received multiple previous cycles of chemotherapy, have previously undergone allogeneic transplantation, have poor marrow reserve, and/or have other serious comorbidities.
  • the antigen receptor e.g. CAR
  • the antigen associated with the disease or disorder is selected from CD20, CD19, CD22, ROR1, CD45, CD21, CD5, CD33, Igkappa, Iglambda, CD79a, CD79b or CD30.
  • the methods include administration of the cells or a composition containing the cells to a subject, tissue, or cell, such as one having, at risk for, or suspected of having the disease, condition or disorder.
  • the subject is the subject is an adult. In some embodiments, the subject is over at or about 30, 40, 50, 60, or 70 years of age.
  • the provided methods involve adoptive cell therapy methods, e.g. CAR+ T cells, for treating chronic lymphocytic leukemia (CLL).
  • CLL chronic lymphocytic leukemia
  • CLL is the most common adult leukemia.
  • patients with high-risk disease including those that manifest by del(17)(pl3.1), p53 mutation, complex kayotype or umutated immunoglobulin variable regions, require earlier therapy and/or have shorter survival (Dohner et al. (2000) N. Engl. J. Med., 343: 1910-1916; Stilgenbauer et al. (2014) Blood, 123:3247-3254; Thompson et al. (2015) Cancer, 121 :3612-3621).
  • CLL treatments for high-risk CLL include chemotherapy (Hallek et al. (2010) Lancet 376: 1164- 1174), although recently the BTK inhibitor, ibrutinib, has recently been approved initially for relapsed and refractory disease and subsequently for first-line therapy (Burger et al. (2015) N. Engl J. Med., 373:2425-2437; Byrd et al. (2013) N. Engl. J. Med., 369:32-42). While the overall response rate (ORR) to ibrutinib is high, the complete response rate (CR; or complete remission) can, in some cases, be low, and survival of patients who progress on ibrutinib may be short.
  • ORR overall response rate
  • CR complete response rate
  • T cell-based therapies such as adoptive T cell therapies (including those involving the administration of cells expressing chimeric receptors specific for a disease or disorder of interest, such as chimeric antigen receptors (CARs) and/or other recombinant antigen receptors, as well as other adoptive immune cell and adoptive T cell therapies) can be effective in the treatment of cancer and other diseases and disorders.
  • adoptive T cell therapies including those involving the administration of cells expressing chimeric receptors specific for a disease or disorder of interest, such as chimeric antigen receptors (CARs) and/or other recombinant antigen receptors, as well as other adoptive immune cell and adoptive T cell therapies
  • CARs chimeric antigen receptors
  • the engineered expression of recombinant receptors, such as chimeric antigen receptors (CARs) on the surface of T cells enables the redirection of T-cell specificity.
  • CAR-T cells for example anti-CD19 CAR- T cells
  • have produced durable, complete responses in both leukemia and lymphoma patients (Porter et al. (2015) Sci Transl Med., 7:303ral39; Kochenderfer (2015) J. Clin. Oncol., 33: 540- 9; Lee et al. (2015) Lancet, 385:517-28; Maude et al. (2014) N Engl J Med, 371 : 1507- 17).
  • the provided methods and uses provide for or achieve improved or more durable responses or efficacy as compared to certain alternative methods, such as in particular groups of subjects treated, such as in patients with a leukemia, such as CLL or NHL, including those with high-risk disease.
  • the methods are advantageous by virtue of administering T cell therapy, such as a composition including cells for adoptive cell therapy, e.g., such as a T cell therapy (e.g. CAR-expressing T cells) , and a lymphodepleting therapy, e.g. such as cyclophosphamide, fludarabine, or combinations thereof.
  • T cell therapy such as a composition including cells for adoptive cell therapy, e.g., such as a T cell therapy (e.g. CAR-expressing T cells)
  • a lymphodepleting therapy e.g. such as cyclophosphamide, fludarabine, or combinations thereof.
  • the provided methods are based on observations that a high rate of elimination of marrow disease and molecular CR can be achieved in patients with high-risk ibrutinib refractory CLL after lympodepletion and CLL-targeted CAR-T cell therapy, such as anti-CD 19 CAR+ T cell therapy. This result was achieved with relatively low incidence of serious toxicity that was generally manageable.
  • the methods include administration of cells to a subject selected or identified as having a certain prognosis or risk of CLL.
  • Chronic lymphocytic leukemia (CLL) is a generally a variable disease. Some subjects with CLL may survive without treatment while others may require immediate intervention.
  • subjects with CLL may be classified into groups that may inform disease prognosis and/or recommended treatment strategy. In some cases, these groups may be "low risk,” “intermediate risk,” “high risk,” and/or “very high risk” and patients may be classified as such depending on a number of factors including, but not limited to, genetic abnormalities and/or morphological or physical characteristics. In some embodiments, subjects treated in accord with the method are classified or identified based on the risk of CLL. In some embodiments, the subject is one that has high risk CLL.
  • the Rai system comprises 5 stages: Rai stage 0: lymphocytosis and no enlargement of the lymph nodes, spleen, or liver, and with near normal red blood cell and platelet counts; lymphocytes in blood > 15000/mcL, and > 40% lymphocytes in the bone marrow.
  • Rai stage I lymphocytosis plus enlarged lymph nodes. The spleen and liver are not enlarged and the red blood cell and platelet counts are near normal.
  • Rai stage II lymphocytosis plus an enlarged spleen (and possibly an enlarged liver), with or without enlarged lymph nodes. The red blood cell and platelet counts are near normal.
  • Rai stage III lymphocytosis plus anemia (too few red blood cells), with or without enlarged lymph nodes, spleen, or liver. Platelet counts are near normal.
  • Rai stage IV lymphocytosis plus thrombocytopenia (too few blood platelets), with or without anemia, enlarged lymph nodes, spleen, or liver.
  • Rai stages may be further grouped into risk groups as follows: Stage 0 is considered low risk; stages I and II are considered intermediate risk; stages III and IV are considered high risk and in some grading systems also include disease-related anemia (hemoglobin level ⁇ 11.0 g/dL or hematocrit ⁇ 33%) or platelets ⁇ 100,000/mcL.
  • subjects may also be, or alternatively be, grouped into classes according to the Binet system, which in some respects involves assessing the number of affected lymphoid tissue groups (neck lymph nodes, groin lymph nodes, underarm lymph nodes, spleen, and liver) and by whether or not the patient has anemia (too few red blood cells) or
  • the Binet system comprises three stages: Binet stage A: Hemoglobin > 10 g/dL, platelets > 100,000/mm3, and ⁇ 3 enlarged areas; Binet stage B: Hemoglobin > 10 g/dL, platelets > 100,000/mm3, and > 3 enlarged areas; and Binet stage C: Hemoglobin ⁇ 10 g/dL, platelets ⁇ 100,000/mm3, and any number of enlarged areas and anemia and/or thrombocytopenia are present.
  • Binet stage A Hemoglobin > 10 g/dL, platelets > 100,000/mm3, and > 3 enlarged areas
  • Binet stage B Hemoglobin > 10 g/dL, platelets > 100,000/mm3, and > 3 enlarged areas
  • Binet stage C Hemoglobin ⁇ 10 g/dL, platelets ⁇ 100,000/mm3, and any number of enlarged areas and anemia and/or thrombocytopenia are present.
  • prognostic genetic abnormalities include cytogenetic abnormalities, which may include deletion of the long arm of chromosome 13 (del 13q), del l lq, trisomy 12, del 17p and del 6q. Deletions of l lq, 13q, 17p, and trisomy 12 can have prognostic value and may contribute to CLL pathogenesis and evolution and inform outcome and therapeutic strategies. Abnormalities also include some that are not detectable by more traditional methods such as FISH analysis.
  • chromosomal translocations can be associated with poor outcomes and/or poor prognosis.
  • Complex karyotypes generally defined as the presence of three or more chromosomal abnormalities, are detected in nearly 16% of CLL subjects and have been associated with unmutated IgHV status and CD38 expression.
  • CK can be predictive of shortened time to first therapy (TTFT) and overall survival (OS) in CLL subjects treated with salvage therapies, including chlorodeoxyadenosine (cdA).
  • TTFT time to first therapy
  • OS overall survival
  • the number of karyotypic abnormalities can be associated with shorter progression-free survival (PFS) and OS following hematopoietic stem cell transplantation (HSCT) following conditioning.
  • PFS progression-free survival
  • HSCT hematopoietic stem cell transplantation
  • the subject exhibits one or more cytogenetic abnormalities, such as one or more of complex karyotype, deletion of the long arm of chromosome 13 (del 13q), del 11, trisomy 12, del 17p, del 6q, and del 13q.l4.
  • any one or more of the cytogenetic abnormalities can be detected by fluorescence in situ hybridization (FISH).
  • FISH fluorescence in situ hybridization
  • the subjects with CLL exhibit Richter's syndrome (RS).
  • RS is defined as the transformation of CLL into an aggressive lymphoma, most commonly diffuse large B-cell lymphoma (DLBCL) (see, e.g., Parikh et al. Blood 2014 123: 1647-1657).
  • the subjects with CLL and/or RS exhibit neurological symptoms or neurological complications, such as symptoms or complications in the central nervous system (CNS).
  • CNS central nervous system
  • magnetic resonance imaging (MRI) of the CNS (e.g. brain, spine) and/or a lumbar puncture with cerebral spinal fluid (CSF) analysis can be used to evaluate CNS-related symptoms, e.g., presence of monoclonal population of lymphocytes in the CSF (see, e.g., Mozzam et al., J. Neurooncol. 2012 106: 185-200; Strati et al., Haematologica 2016 101: 458-465).
  • the methods include administration of cells to a subject selected or identified as having high-risk NHL.
  • the subject exhibits one or more cytogenetic abnormalities, such as associated with high-risk NHL.
  • the subject is selected or identified based on having a disease or condition characterized or determined to be aggressive NHL, diffuse large B cell lymphoma (DLBCL), primary mediastinal large B cell lymphoma (PMBCL), T cell/histocyte-rich large B cell lymphoma (TCHRBCL), Burkitt lymphoma, mantle cell lymphoma (MCL), and/or follicular lymphoma (FL).
  • DLBCL diffuse large B cell lymphoma
  • PMBCL primary mediastinal large B cell lymphoma
  • TCHRBCL T cell/histocyte-rich large B cell lymphoma
  • MCL mantle cell lymphoma
  • FL follicular lymphoma
  • the subject has been previously treated with a therapy or a therapeutic agent targeting the disease or condition, e.g. CLL or NHL, prior to administration of the cells expressing the recombinant antigen receptor.
  • the therapeutic agent is a kinase inhibitor, such as an inhibitor of Bruton's tyrosine kinase (Btk), for example, ibrutinib.
  • the therapeutic agent is an inhibitor of B-cell lymphoma-2 (Bcl-2), for example, venetoclax.
  • the therapeutic agent is an antibody (e.g.
  • the therapeutic agent is an anti-CD20 antibody, e.g., rituximab.
  • the therapeutic agent is a depleting chemotherapy that is a combination therapy that includes rituximab, e.g., a combination therapy of fludarabine and rituximab or a combination therapy of anthracycline and rituximab.
  • the subject has been previously treated with hematopoietic stem cell transplantation (HSCT), e.g., allogenic HSCT or autogenic HSCT.
  • HSCT hematopoietic stem cell transplantation
  • the subject has been treated or has previously received at least or about at least or about 1, 2, 3, or 4 other therapies for treating the NHL or CLL other than the
  • lymphodepleting therapy and/or the dose of cells expressing the antigen receptor In some embodiments, the subject has been previously treated with chemotherapy or radiation therapy.
  • the subject is refractory or non-responsive to the other therapy or therapeutic agent.
  • the subject has persistent or relapsed disease, e.g., following treatment with another therapy or therapeutic intervention, including chemotherapy or radiation.
  • treatments or therapies may not be recommended for CLL subjects in the low and intermediate risk categories.
  • treatment strategies for high risk and very high risk subjects may include fludarabine, cyclophosphamide, and rituximab (FCR), BTK inhibitors (e.g. ibrutinib), and/or allogeneic stem cell transplantation.
  • FCR fludarabine
  • cyclophosphamide and rituximab
  • BTK inhibitors e.g. ibrutinib
  • allogeneic stem cell transplantation e.g. ibrutinib
  • subjects treated for CLL exhibit poor long-term outcomes.
  • refractory (R/R) high-risk CLL subjects exhibit poor survival after Ibrutinib discontinuation (Jain et al.
  • the provided methods are for use in subjects having a cancer in which the subject and/or the cancer is resistant to inhibition by irbrutinib or comprises a population of cells that are resistant to inhibition by the inhibitor.
  • the patient is one that is selected that is or is likely to become refractory to ibrutinib based on high-risk cytogenetics and/or based on the presence of, such as by early detection of, mutations prior to relapse that confer ibrutinib resistance.
  • provided methods are for use in a subject having a cancer in which the subject and/or the cancer comprises a mutation or disruption in a nucleic acid encoding BTK, in which such mutation is capable of reducing or preventing inhibition of the BTK by the inhibitor, e.g. ibrutinib.
  • the mutation in the nucleic acid encoding BTK contains a substitution at position C481, optionally C481S or C481R, and/or a substitution at position T474, optionally T474I or T474M.
  • the provided methods are for use in a subject having a cancer in which at the time of administration of the adoptive cell therapy, e.g., such as a T cell therapy (e.g. CAR-expressing T cells) and/or at the time of administering the lymphodepleting therapy, the subject has relapsed following remission after treatment with, or been deemed refractory to treatment with ibrutinib.
  • adoptive cell therapy e.g., such as a T cell therapy (e.g. CAR-expressing T cells) and/or at the time of administering the lymphodepleting therapy
  • the cell therapy e.g., adoptive cell therapy, e.g., adoptive T cell therapy
  • the cells are isolated and/or otherwise prepared from the subject who is to receive the cell therapy, or from a sample derived from such a subject.
  • the cells are derived from a subject, e.g., patient, in need of a treatment and the cells, and following isolation and processing are administered to the same subject.
  • the cell therapy e.g., adoptive cell therapy, e.g., adoptive T cell therapy
  • the cells are isolated and/or otherwise prepared from a subject other than a subject who is to receive or who ultimately receives the cell therapy, e.g., a first subject.
  • the cells then are administered to a different subject, e.g., a second subject, of the same species.
  • the first and second subjects are genetically identical.
  • the first and second subjects are genetically similar.
  • the second subject expresses the same HLA class or supertype as the first subject.
  • the cells can be administered by any suitable means, for example, by bolus infusion, by injection, e.g., intravenous or subcutaneous injections, intraocular injection, periocular injection, subretinal injection, intravitreal injection, trans-septal injection, subscleral injection, intrachoroidal injection, intracameral injection, subconjunctival injection, subconjunctival injection, sub-Tenon's injection, retrobulbar injection, peribulbar injection, or posterior juxtascleral delivery. In some embodiments, they are administered by parenteral,
  • intrapulmonary, and intranasal and, if desired for local treatment, intralesional administration.
  • Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
  • a given dose is administered by a single bolus administration of the cells. In some embodiments, it is administered by multiple bolus administrations of the cells, for example, over a period of no more than 3 days, or by continuous infusion administration of the cells.
  • the appropriate dosage may depend on the type of disease to be treated, the type of cells or recombinant receptors, the severity and course of the disease, whether the cells are administered for preventive or therapeutic purposes, previous therapy, the subject's clinical history and response to the cells, and the discretion of the attending physician.
  • the compositions and cells are in some embodiments suitably administered to the subject at one time or over a series of treatments.
  • the biological activity of the engineered cell populations in some aspects is measured by any of a number of known methods.
  • Parameters to assess include specific binding of an engineered or natural T cell or other immune cell to antigen, in vivo, e.g., by imaging, or ex vivo, e.g., by ELISA or flow cytometry.
  • the ability of the engineered cells to destroy target cells can be measured using any suitable method known in the art, such as cytotoxicity assays described in, for example, Kochenderfer et al., J. Immunotherapy, 32(7): 689-702 (2009), and Herman et al. J.
  • the biological activity of the cells also can be measured by assaying expression and/or secretion of certain cytokines, such as CD 107a, IFNy, IL-2, and TNF.
  • the biological activity is measured by assessing clinical outcome, such as reduction in tumor burden or load.
  • toxic outcomes, persistence and/or expansion of the cells, and/or presence or absence of a host immune response are assessed.
  • engineered cells are modified in any number of ways, such that their therapeutic or prophylactic efficacy is increased.
  • the engineered CAR or TCR expressed by the population can be conjugated either directly or indirectly through a linker to a targeting moiety.
  • the practice of conjugating compounds, e.g., the CAR or TCR, to targeting moieties is known in the art. See, for instance, Wadwa et al., J. Drug Targeting 3: 1 1 1 (1995), and U.S. Patent 5,087,616.
  • the cells are administered as part of a combination treatment, such as simultaneously with or sequentially with, in any order, another therapeutic intervention, such as an antibody or engineered cell or receptor or agent, such as a cytotoxic or therapeutic agent.
  • the cells in some embodiments are co-administered with one or more additional therapeutic agents or in connection with another therapeutic intervention, either simultaneously or sequentially in any order.
  • the cells are co-administered with another therapy sufficiently close in time such that the cell populations enhance the effect of one or more additional therapeutic agents, or vice versa.
  • the cells are administered prior to the one or more additional therapeutic agents.
  • the cells are administered after the one or more additional therapeutic agents.
  • the one or more additional agent includes a cytokine, such as IL-2, for example, to enhance persistence.
  • Also provided herein are methods of prognosis or staging of subjects after treatment with cell therapy e.g., such as a T cell therapy (e.g. CAR-expressing T cells), methods of monitoring response in subjects having received such a cell therapy and/or methods of predicting durability of response to such a cell therapy, in which such methods involve sequencing of the immunoglobulin heavy chain (IGH) locus in samples containing or potentially containing tumor cells, obtained from of subjects that have received the cell therapy.
  • such methods involve sequencing the IGH locus of harvested samples, such as those potentially leukemia cells, e.g. B cells, from marrow or blood, and/or samples prepared therefrom, to detect the presence or absence of residual tumor.
  • typical methods for prognosis, staging and/or monitoring response rates in subjects having a leukemia or lymphoma, e.g. CLL, to a therapy involve measuring lymph node size.
  • a common criteria for assessing response rates is the International Workshop on Chronic Lymphocytic Leukemia (IWCLL) response criteria (Hallek, et al., Blood 2008, Jun 15; 111(12): 5446-5456), which, in some aspects, requires that all lymph nodes be ⁇ 15 mm. In some cases, however, it is found that responses to cell therapy is rapid and may be achieved prior to measurable change in lymph node size.
  • IWCLL Chronic Lymphocytic Leukemia
  • early restaging by tumor criteria alone may not be an optimal determinant of prognosis.
  • a cell therapy e.g. T cell therapy, such as CAR+ T cells
  • IGH sequencing is performed no more than 3 months, such as no more than 2 months or no more than 1 month after initiation of administration of a cell therapy.
  • IGH sequencing is carried out on at or about or within 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks or 12 weeks after initiation of the cell therapy.
  • the IGH sequence methods are used to provide prognostic information for stage a subject after treatment with a cell therapy.
  • the subject if lack of detectable malignant IGH copies are detected or observed, the subject is identified as responding to the cell therapy, likely to be responding, and/or likely to exhibit or develop a response such as a CR and/or a durable response.
  • lack of detection of malignant IGH copies by the provided methods is used to identify, such as identify early, e.g.
  • the subject is identified as not responding to the cell therapy and/or not exhibiting a complete response and/or to have poorer prognosis or to need additional treatment.
  • detection of malignant IGH copies by the provided methods is used to identify, such as identify early, e.g.
  • the methods are carried out on subjects receiving a cell therapy, such as containing engineered T cells, e.g. CAR+ T cells, for treating a B cell malignancy, e.g. CLL or NHL. In some embodiments, the methods are carried out on subjects having received a cell therapy for treating CLL.
  • a cell therapy such as containing engineered T cells, e.g. CAR+ T cells, for treating a B cell malignancy, e.g. CLL or NHL.
  • the methods are carried out on subjects having received a cell therapy for treating CLL.
  • the IGH sequencing methods are used to assess or determine the durability of response to a cell therapy, e.g. CAR+ T cell therapy.
  • a cell therapy e.g. CAR+ T cell therapy.
  • the subject if lack of detectable malignant IGH copies are detected the subject is predicted to exhibit or likely to exhibit a durable response to the cell therapy and/or to be at a low or relatively low risk of relapse or to have a high likelihood of exhibiting progression free survival for at least a certain period of time.
  • lack of detection of malignant IGH copies by the provided methods is used to identify, such as identify early, e.g.
  • if malignant IGH copies are detected the subject is predicted not to exhibit or not likely to exhibit a durable response to the cell therapy and/or to be at a high or relatively high risk of relapse or to have a low likelihood of exhibiting progression free survival for at least a certain period of time.
  • detection of malignant IGH copies by the provided methods is used to identify, such as to identify early, e.g.
  • the methods are carried out on subjects receiving a cell therapy, such as containing engineered T cells, e.g. CAR+ T cells, for treating a B cell malignancy, e.g. CLL or NHL.
  • a cell therapy such as containing engineered T cells, e.g. CAR+ T cells, for treating a B cell malignancy, e.g. CLL or NHL.
  • a dose of cells is administered to subjects in accord with the provided methods.
  • the size or timing of the doses is determined as a function of the particular disease or condition in the subject. It is within the level of a skilled artisan to empirically determine the size or timing of the doses for a particular disease in view of the provided description.
  • the cells, or individual populations of sub-types of cells are administered to the subject at a range of about 0.1 million to about 100 billion cells and/or that amount of cells per kilogram of body weight of the subject, such as, e.g. , 0.1 million to about 50 billion cells (e.g. , about 5 million cells, about 25 million cells, about 500 million cells, about 1 billion cells, about 5 billion cells, about 20 billion cells, about 30 billion cells, about 40 billion cells, or a range defined by any two of the foregoing values), 1 million to about 50 billion cells (e.g.
  • the cell therapy comprises administration of a dose comprising a number of cells that is at least or at least about or is or is about 0.1 x 10 6 cells/kg body weight of the subject, 0.2 x 10 6 cells/kg, 0.3 x 10 6 cells/kg, 0.4 x 10 6 cells/kg, 0.5 x 10 6 cells/kg, 1 x 10 6 cell/kg, 2.0 x 10 6 cells/kg, 3 x 10 6 cells/kg or 5 x 10 6 cells/kg.
  • the cell therapy comprises administration of a dose comprising a number of cells is between or between about 0.1 x 10 6 cells/kg body weight of the subject and 1.0 x 10 7 cells/kg, between or between about 0.5 x 10 6 cells/kg and 5 x 10 6 cells/kg, between or between about 0.5 x 10 6 cells/kg and 3 x 10 6 cells/kg, between or between about 0.5 x 10 6 cells/kg and 2 x 10 6 cells/kg, between or between about 0.5 x 10 6 cells/kg and 1 x 10 6 cell/kg, between or between about 1.0 x 10 6 cells/kg body weight of the subject and 5 x 10 6 cells/kg, between or between about 1.0 x 10 6 cells/kg and 3 x 10 6 cells/kg, between or between about 1.0 x 10 6 cells/kg and 2 x 10 6 cells/kg, between or between about 2.0 x 10 6 cells/kg body weight of the subject and 5 x 10 6 cells/kg, between or between about 2.0 x 10 6 cells/kg body weight of
  • the dose of cells comprises between at or about 2 x 10 5 of the cells/kg and at or about 2 x 10 6 of the cells/kg, such as between at or about 4 x 10 5 of the cells/kg and at or about 1 x 10 6 of the cells/kg or between at or about 6 x 10 5 of the cells/kg and at or about 8 x 10 5 of the cells/kg.
  • the dose of cells comprises no more than 2 x 10 5 of the cells (e.g.
  • antigen-expressing such as CAR-expressing cells
  • CAR-expressing cells per kilogram body weight of the subject (cells/kg), such as no more than at or about 3 x 10 5 cells/kg, no more than at or about 4 x 10 5 cells/kg, no more than at or about 5 x 10 5 cells/kg, no more than at or about 6 x 10 5 cells/kg, no more than at or about 7 x 10 5 cells/kg, no more than at or about 8 x 10 5 cells/kg, no more than at or about 9 x 10 5 cells/kg, no more than at or about 1 x 10 6 cells/kg, or no more than at or about 2 x 10 6 cells/kg.
  • the dose of cells comprises at least or at least about or at or about 2 x 10 5 of the cells (e.g. antigen-expressing, such as CAR- expressing cells) per kilogram body weight of the subject (cells/kg), such as at least or at least about or at or about 3 x 10 5 cells/kg, at least or at least about or at or about 4 x 10 5 cells/kg, at least or at least about or at or about 5 x 10 5 cells/kg, at least or at least about or at or about 6 x 10 5 cells/kg, at least or at least about or at or about 7 x 10 5 cells/kg, at least or at least about or at or about 8 x 10 5 cells/kg, at least or at least about or at or about 9 x 10 5 cells/kg, at least or at least about or at or about 1 x 10 6 cells/kg, or at least or at least about or at or about 2 x 10 6 cells/kg.
  • the cells e.g. antigen-expressing, such as CAR- expressing cells
  • the dose includes fewer than about 1 x 10 total recombinant receptor (e.g., CAR)-expressing cells, T cells, or peripheral blood mononuclear cells (PBMCs), e.g., in the range of about 1 x 10 6 to 1 x 10 s such cells, such as 2 x 10 6 , 5 x 10 6 , 1 x 10 7 , 5 x 10 7 , or 1 x 10 s or total such cells, or the range between any two of the foregoing values.
  • CAR total recombinant receptor
  • PBMCs peripheral blood mononuclear cells
  • the dose includes between about 1 x 10 6 and 3 x 10 s total recombinant receptor (e.g., CAR)- expressing cells, e.g., in the range of about 1 x 10 7 to 2 x 108 such cells, such as 1 x 107 , 5 x 107 ,
  • CAR total recombinant receptor
  • the patient is administered multiple doses, and each of the doses or the total dose can be within any of the foregoing values.
  • the dose of cells comprises the administration of from or from about 1 x 10 5 to 5 x 108 total recombinant receptor-expressing T cells or total T cells, 1 x 10 5 to 1 x 108 total recombinant receptor- expressing T cells or total T cells, from or from about 5 x 10 5 to 1 x 107 total recombinant receptor-expressing T cells or total T cells, or from or from about 1 x 10 6 to 1 x 10 7 total recombinant receptor-expressing T cells or total T cells, each inclusive.
  • administration of a given "dose” encompasses administration of the given amount or number of cells as a single composition and/or single uninterrupted administration, e.g., as a single injection or continuous infusion, and also encompasses administration of the given amount or number of cells as a split dose, provided in multiple individual compositions or infusions, over a specified period of time, which is no more than 3 days.
  • the dose is a single or continuous administration of the specified number of cells, given or initiated at a single point in time.
  • the dose is administered in multiple injections or infusions over a period of no more than three days, such as once a day for three days or for two days or by multiple infusions over a single day period.
  • the cells of the dose are administered in a single
  • the cells of the dose are administered in a plurality of compositions, collectively containing the cells of the dose.
  • split dose refers to a dose that is split so that it is administered over more than one day. This type of dosing is encompassed by the present methods and is considered to be a single dose.
  • the dose of cells may be administered as a split dose.
  • the dose may be administered to the subject over 2 days or over 3 days.
  • Exemplary methods for split dosing include administering 25% of the dose on the first day and administering the remaining 75% of the dose on the second day. In other embodiments, 33% of the dose may be administered on the first day and the remaining 67% administered on the second day. In some aspects, 10% of the dose is administered on the first day, 30% of the dose is administered on the second day, and 60% of the dose is administered on the third day. In some embodiments, the split dose is not spread over more than 3 days.
  • the dose of cells is generally large enough to be effective in reducing disease burden.
  • the cells are administered at a desired dosage, which in some aspects includes a desired dose or number of cells or cell type(s) and/or a desired ratio of cell types.
  • the dosage of cells in some embodiments is based on a total number of cells (or number per kg body weight) and a desired ratio of the individual populations or sub-types, such as the CD4+ to CD8+ ratio.
  • the dosage of cells is based on a desired total number (or number per kg of body weight) of cells in the individual populations or of individual cell types.
  • the dosage is based on a combination of such features, such as a desired number of total cells, desired ratio, and desired total number of cells in the individual populations.
  • the populations or sub-types of cells are administered at or within a tolerated difference of a desired dose of total cells, such as a desired dose of T cells.
  • a desired dose is a desired number of cells or a desired number of cells per unit of body weight of the subject to whom the cells are
  • the desired dose is at or above a minimum number of cells or minimum number of cells per unit of body weight.
  • the individual populations or sub-types are present at or near a desired output ratio (such as CD4 + to CD8 + ratio), e.g., within a certain tolerated difference or error of such a ratio.
  • the cells are administered at or within a tolerated difference of a desired dose of one or more of the individual populations or sub-types of cells, such as a desired dose of CD4+ cells and/or a desired dose of CD8+ cells.
  • the desired dose is a desired number of cells of the sub-type or population, or a desired number of such cells per unit of body weight of the subject to whom the cells are administered, e.g., cells/kg.
  • the desired dose is at or above a minimum number of cells of the population or subtype, or minimum number of cells of the population or sub-type per unit of body weight.
  • the dosage is based on a desired fixed dose of total cells and a desired ratio, and/or based on a desired fixed dose of one or more, e.g., each, of the individual sub-types or sub-populations.
  • the dosage is based on a desired fixed or minimum dose of T cells and a desired ratio of CD4 + to CD8 + cells, and/or is based on a desired fixed or minimum dose of CD4 + and/or CD8 + cells.
  • the cells are administered at or within a tolerated range of a desired output ratio of multiple cell populations or sub-types, such as CD4+ and CD8+ cells or sub-types.
  • the desired ratio can be a specific ratio or can be a range of ratios, for example, in some embodiments, the desired ratio (e.g., ratio of CD4 + to CD8 + cells) is between at or about 5: 1 and at or about 5: 1 (or greater than about 1:5 and less than about 5: 1), or between at or about 1:3 and at or about 3: 1 (or greater than about 1:3 and less than about 3: 1), such as between at or about 2: 1 and at or about 1:5 (or greater than about 1 :5 and less than about 2: 1, such as at or about 5: 1, 4.5: 1, 4: 1, 3.5: 1, 3: 1, 2.5: 1, 2: 1, 1.9: 1, 1.8: 1, 1.7: 1, 1.6: 1, 1.5: 1, 1.4: 1, 1.3: 1, 1.2
  • the tolerated difference is within about 1%, about 2%, about 3%, about 4% about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50% of the desired ratio, including any value in between these ranges.
  • the numbers and/or concentrations of cells refer to the number of recombinant receptor (e.g., CAR)-expressing cells. In other embodiments, the numbers and/or concentrations of cells refer to the number or concentration of all cells, T cells, or peripheral blood mononuclear cells (PBMCs) administered.
  • CAR recombinant receptor
  • PBMCs peripheral blood mononuclear cells
  • the size of the dose is determined based on one or more criteria such as response of the subject to prior treatment, e.g. chemotherapy, disease burden in the subject, such as tumor load, bulk, size, or degree, extent, or type of metastasis, stage, and/or likelihood or incidence of the subject developing toxic outcomes, e.g., CRS, macrophage activation syndrome, tumor lysis syndrome, neurotoxicity, and/or a host immune response against the cells and/or recombinant receptors being administered.
  • a host immune response against the cells and/or recombinant receptors being administered e.g., CRS, macrophage activation syndrome, tumor lysis syndrome, neurotoxicity, and/or a host immune response against the cells and/or recombinant receptors being administered.
  • the methods also include administering one or more additional doses of cells expressing a chimeric antigen receptor (CAR) and/or lymphodepleting therapy, and/or one or more steps of the methods are repeated.
  • the one or more additional dose is the same as the initial dose.
  • the one or more additional dose is different from the initial dose, e.g., higher, such as 2-fold, 3-fold, 4-fold, 5- fold, 6-fold, 7-fold, 8-fold, 9-fold or 10-fold or more higher than the initial dose, or lower, such as e.g., higher, such as 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold or 10-fold or more lower than the initial dose.
  • administration of one or more additional doses is determined based on response of the subject to the initial treatment or any prior treatment, disease burden in the subject, such as tumor load, bulk, size, or degree, extent, or type of metastasis, stage, and/or likelihood or incidence of the subject developing toxic outcomes, e.g., CRS, macrophage activation syndrome, tumor lysis syndrome, neurotoxicity, and/or a host immune response against the cells and/or recombinant receptors being
  • toxic outcomes e.g., CRS, macrophage activation syndrome, tumor lysis syndrome, neurotoxicity, and/or a host immune response against the cells and/or recombinant receptors being
  • the administration effectively treats the subject despite the subject having become resistant to another therapy.
  • at least or about at least 50% of subjects, at least or about at least 60% of the subjects, at least or about at least 70% of the subjects, at least or about at least 80% of the subjects or at least or about at least 90% of the subjects treated according to the method achieve complete remission (CR) and/or achieve an objective response (OR).
  • the administration in accord with the provided methods generally reduces or prevents the expansion or burden of the disease or condition in the subject.
  • the methods generally reduce tumor size, bulk, metastasis, percentage of blasts in the bone marrow or molecularly detectable cancer, and/or improve prognosis or survival or other symptom associated with tumor burden.
  • progression-free survival is described as the length of time during and after the treatment of a disease, such as cancer, that a subject lives with the disease but it does not get worse.
  • objective response is described as a measurable response.
  • objective response rate is described as the proportion of patients who achieved CR or PR.
  • overall survival is described as the length of time from either the date of diagnosis or the start of treatment for a disease, such as cancer, that subjects diagnosed with the disease are still alive.
  • event-free survival is described as the length of time after treatment for a cancer ends that the subject remains free of certain complications or events that the treatment was intended to prevent or delay. These events may include the return of the cancer or the onset of certain symptoms, such as bone pain from cancer that has spread to the bone, or death.
  • the method reduces the burden of the disease or condition, e.g., number of tumor cells, size of tumor, duration of patient survival or event-free survival, to a greater degree and/or for a greater period of time as compared to the reduction that would be observed with a comparable method using an alternative dosing regimen, such as one in which the subject receives one or more alternative therapeutic agents and/or one in which the subject does not receive a dose of cells and/or a lymphodepleting agent in accord with the provided methods.
  • the burden of a disease or condition in the subject is detected, assessed, or measured.
  • Disease burden may be detected in some aspects by detecting the total number of disease or disease-associated cells, e.g., tumor cells, in the subject, or in an organ, tissue, or bodily fluid of the subject, such as blood or serum.
  • survival of the subject survival within a certain time period, extent of survival, presence or duration of event- free or symptom-free survival, or relapse-free survival, is assessed.
  • any symptom of the disease or condition is assessed.
  • the measure of disease or condition burden is specified.
  • the event-free survival rate or overall survival rate of the subject is improved by the methods, as compared with other methods, for example, methods in which the subject receives one or more alternative therapeutic agents and/or one in which the subject does not receive a dose of cells and/or a lymphodepleting agent in accord with the provided methods.
  • event-free survival rate or probability for subjects treated by the methods at 6 months following the dose is greater than about 40%, greater than about 50%, greater than about 60%, greater than about 70%, greater than about 80%, greater than about 90%, or greater than about 95%.
  • overall survival rate is greater than about 40%, greater than about 50%, greater than about 60%, greater than about 70%, greater than about 80%, greater than about 90%, or greater than about 95%.
  • the subject treated with the methods exhibits event-free survival, relapse-free survival, or survival to at least 6 months, or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 years.
  • the time to progression is improved, such as a time to progression of greater than at or about 6 months, or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 years.
  • the probability of relapse is reduced as compared to other methods, for example, methods in which the subject receives one or more alternative therapeutic agents and/or one in which the subject does not receive a dose of cells and/or a lymphodepleting agent in accord with the provided methods.
  • the probability of relapse at 6 months following the first dose is less than about 80%, less than about 70%, less than about 60%, less than about 50%, less than about 40%, less than about 30%, less than about 20%, or less than about 10%.
  • Disease burden can encompass a total number of cells of the disease in the subject or in an organ, tissue, or bodily fluid of the subject, such as the organ or tissue of the tumor or another location, e.g., which would indicate metastasis.
  • tumor cells may be detected and/or quantified in the blood or bone marrow in the context of certain hematological malignancies.
  • Disease burden can include, in some embodiments, the mass of a tumor, the number or extent of metastases and/or the percentage of blast cells present in the bone marrow.
  • response assessment utilizes any of clinical, hematologic, and/or molecular methods. 1. /WCLL Response Criteria
  • response rates in subjects are based on the International Workshop on Chronic Lymphocytic Leukemia (IWCLL) response criteria (Hallek, et al., Blood 2008, Jun 15; 111(12): 5446-5456; also called IWCLL 2008).
  • IWCLL Chronic Lymphocytic Leukemia
  • CR complete remission
  • PR partial remission
  • PD progressive disease
  • the subjects exhibits a CR or OR if, within 1 month of the administration of the dose of cells, lymph nodes in the subject are less than at or about 20 mm in size, less than at or about 10 mm in size or less than at or about 10 mm in size.
  • a subject has leukemia.
  • the extent of disease burden can be determined by assessment of residual leukemia in blood or bone marrow.
  • a subject exhibits morphologic disease if there are greater than or equal to 5% blasts in the bone marrow, for example, as detected by light microscopy, such as greater than or equal to 10% blasts in the bone marrow, greater than or equal to 20% blasts in the bone marrow, greater than or equal to 30% blasts in the bone marrow, greater than or equal to 40% blasts in the bone marrow or greater than or equal to 50% blasts in the bone marrow.
  • a subject exhibits complete or clinical remission if there are less than 5% blasts in the bone marrow.
  • a subject may exhibit complete remission, but a small proportion of morphologically undetectable (by light microscopy techniques) residual leukemic cells are present.
  • a subject is said to exhibit minimum residual disease (MRD) if the subject exhibits less than 5% blasts in the bone marrow and exhibits molecularly detectable cancer.
  • MRD minimum residual disease
  • molecularly detectable cancer can be assessed using any of a variety of molecular techniques that permit sensitive detection of a small number of cells.
  • such techniques include PCR assays, which can determine unique Ig/T-cell receptor gene rearrangements or fusion transcripts produced by chromosome translocations.
  • flow cytometry can be used to identify cancer cell based on leukemia- specific immunophenotypes.
  • molecular detection of cancer can detect as few as 1 leukemia cell in 10,000 normal cells or 1 leukemia cell in 100,000 normal cells.
  • a subject exhibits MRD that is molecularly detectable if at least or greater than 1 leukemia cell in 10,000 cells detected or 1 leukemia cell in 100,000 cells is detected, such as by PCR or flow cytometry.
  • the disease burden of a subject is molecularly undetectable or MRD " , such that, in some cases, no leukemia cells are able to be detected in the subject using PCR or flow cytometry techniques.
  • an index clone of the leukemia is not detected in the bone marrow of the subject (or in the bone marrow of greater than 50%, 60%, 70%, 80%, 90% or more of the subjects treated according to the methods.
  • an index clone of the leukemia is assessed by IGH deep sequencing.
  • the index clone is not detected at a time that is at or about or at least at or about 1, 2, 3, 4, 5, 6, 12, 18 or 24 months following the administration of the cells.
  • MRD is detected by flow cytometry.
  • Flow cytometry can be used to monitor bone marrow and peripheral blood samples for cancer cells.
  • flow cytometry is used to detect or monitor the presence of cancer cells in bone marrow.
  • multiparameter immunological detection by flow cytometry is used to detect cancer cells (see for example, Coustan-Smith et al., (1998) Lancet 351:550-554).
  • multiparameter immunological detection by mass cytometry is used to detect cancer cells.
  • 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45 or 50 parameters can be used to detect cancer cells.
  • bone marrow is harvested by bone marrow aspirates or bone marrow biopsies, and lymphocytes are isolated for analysis.
  • Monoclonal and/or polyclonal antibodies conjugated to a fluorochrome e.g.
  • fluorescein isothiocyanate FITC
  • phycoerythrin phycoerythrin
  • peridinin chlorophyll protein or biotin
  • TdT terminal deoxynucleotidyl transferase
  • CD3, CD10, CDl lc CD13, CD14, CD33, CD19, CD20, CD21, CD22, CD23, CD34, CD45, CD56, CD79b, IgM, and/or KORSA3544
  • Labeled cells can then be detected using flow cytometry, such as multiparameter flow cytometry, or mass cytometry, to detect multiple epitopes.
  • Lymphoid cells can be identified and gated based on a light-scatter dot plot and then secondarily gated to identify cell populations expressing the immunophenotypic features of interest. Exemplary epitopes are set forth in Table 1 below. Other immunologic classification of leukemias and lymphomas are provided by Foon and Todd (Blood (1986) 68(1): 1-31). In some aspects, flow cytometric assessment of MRD can be achieved by quantifying live lymphocytes bearing one or more CLL immunophenotypes (e.g., low forward/side scatter; CD3 neg ; CD5 + ; CD14 neg ; CD19 + ; CD23 + ; CD45 + ; CD56 neg ).
  • CLL immunophenotypes e.g., low forward/side scatter; CD3 neg ; CD5 + ; CD14 neg ; CD19 + ; CD23 + ; CD45 + ; CD56 neg ).
  • lymphoma CD23-; CD 10-/+;
  • Pan-B markers e.g., CD19, CD20, CD79a
  • sIG surface immunoglobulins
  • cylg cytoplasmic immunoglobulins b. IGH Deep Sequencing
  • deep sequencing of the immunoglobulin heavy chain (IGH) locus of harvested B cells can be used to detect minimal residual disease (MRD).
  • MRD minimal residual disease
  • Clonal presence of a particular IgG rearrangement can provide a marker to detect the presence of B cell malignancies, such as CLL or NHL and/or residual presence of malignant cells thereof.
  • cells such as a population containing or suspected of containing B cells are harvested and isolated from blood.
  • cells are harvested and isolated from bone marrow, e.g., from bone marrow aspirates or bone marrow biopsies and/or from other biological samples.
  • polymerase chain reaction (PCR) amplification of the complementarity determining region 3 (CDR3) is achieved using primers to highly conserved sequences within the V and J regions of the gene locus, which may be used to identify clonal populations of cells for purposes of assessing minimal residual disease.
  • Other methods for detecting clonal populations such as single cell sequencing approaches, including those providing information regarding number of cells of a particular lineage and/or expressing a particular variable chain such as variable heavy chain or binding site thereof, such as a clonal population, may be used.
  • the IGH DNA is amplified using a degenerate primers or primers recognizing regions of variable chains shared among different cell clones, such as those recognizing consensus V and degenerate consensus J region of the IGH sequence.
  • a degenerate primers or primers recognizing regions of variable chains shared among different cell clones, such as those recognizing consensus V and degenerate consensus J region of the IGH sequence.
  • An exemplary sequence of the V region is
  • ACACGGCCTCGTGTATTACTGT SEQ ID NO: 17
  • An exemplary degenerate consensus sequence of the J region is ACCTGAGGAGACGGTGACC (SEQ ID NO: 18).
  • the PCR product or sequencing result in some aspects is specific to the rearranged allele and serves as a clonal marker for MRD detection.
  • PCR products can be sequenced to yield patient- specific oligonucleotides constructed as probes for allele- specific PCR for sensitive detection of MRD following treatment of B-cell malignancies with CAR-T cell therapy, e.g. CD19 CAR- T cell therapy.
  • CAR-T cell therapy e.g. CD19 CAR- T cell therapy.
  • V region family- specific primers for the framework region 1 can be used instead.
  • persistence of PCR-detectable tumor cells such as cells of the B cell malignancy such as the NHL or CLL, such as detectable IGH sequences corresponding to the malignant or clonal IGH sequences, after treatment is associated with increased risk of relapse.
  • patients who are negative for malignant IGH sequences following treatment may be deemed to have increased likelihood of PFS or to enter into CR or durable CR or prolonged survival, compared to patients with persistent malignant IGH sequences.
  • such prognostic and staging determinations are particularly relevant for treatments in which clearance of malignant cells is observed within a short period of time following administration of the therapy, e.g., in comparison to resolution of other clinical symptoms such as lymph node size or other staging criteria.
  • absence of detectable IGH or minimal residual disease in a sample such as the bone marrow may be a preferred readout for response or likelihood of response or durability thereof, as compared to other available staging or prognostic approaches.
  • results from MRD e.g., IGH deep sequencing information, may inform further intervention or lack thereof.
  • a subject deemed negative for malignant IGH may in some aspects be not further treated or not be further administered a dose of the therapy provided, or that the subject be administered a lower or reduced dose.
  • a subject exhibiting MRD via IGH deep sequencing be further treated, e.g., with the therapy initially administered at a similar or higher dose or with a further treatment.
  • Lugano criteria include evaluation by imaging, tumor bulk measurements, and assessments of spleen, liver, and bone marrow involvement.
  • response assessed using the Lugano criteria involves the use of positron emission tomography (PET)-computed tomography (CT) and/or CT as appropriate for imaging evaluation.
  • PET-CT evaluations may further comprise the use of fluorodeoxyglucose (FDG), to assess FDG uptake, in FDG-avid lymphomas.
  • FDG fluorodeoxyglucose
  • FDG-avid lymphomas include Hodgkin lymphoma (HL) and certain non-Hodgkin lymphomas (NHL), including diffuse large B cellular lymphoma (DLBCL), marginal zone NHL with an aggressive transformation, and FDG-avid nodal lymphomas (essentially all histologic types except: chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma, lymphoplasmacytic lymphoma / Waldenstrom
  • CLL chronic lymphocytic leukemia
  • small lymphocytic lymphoma small lymphocytic lymphoma
  • lymphoplasmacytic lymphoma Waldenstrom
  • the post-treatment scans are taken as long as possible after administration of treatment. In some aspects the post-treatment scans are taken a minimum of 3 weeks after therapy, such as 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 1 1 weeks, 12, weeks or more after administration of treatment.
  • a 5-point scale such as the Deauville five-point scale (Deauville 5ps) may be used for evaluation or staging.
  • the Deauville score is based on visual interpretation of
  • FDG fluorodeoxyglucose
  • the 5-point scale comprises the following criteria: 1 , no uptake above background; 2, uptake ⁇ mediastinum; 3, uptake > mediastinum but ⁇ liver; 4, uptake moderately > liver; 5, uptake markedly higher than liver (e.g., maximum standard uptake value (SUV M A X >2X liver; 5a) and/or new lesion (on response evaluation) that is possibly related to lymphoma (5b); X, new areas of uptake unlikely to be related to lymphoma.
  • 1 no uptake above background
  • 2, uptake ⁇ mediastinum 3, uptake > mediastinum but ⁇ liver
  • 5, uptake markedly higher than liver e.g., maximum standard uptake value (SUV M A X >2X liver; 5a) and/or new lesion (on response evaluation) that is possibly related to lymphoma (5b);
  • X new areas of uptake unlikely to be related to lymphoma.
  • a Deauville score of 1 or 2 is considered to represent complete metabolic response (CMR) at interim and end of treatment.
  • a Deauville score of 3 also represents CMR, but interpretation of score 3 depends on the timing of the assessment, the clinical context and the treatment.
  • a Deauville score of 4 or 5 at interim is considered to represent partial metabolic response.
  • a Deauville score of 4 or 5 at the end of treatment represents residual metabolic disease, if the uptake has reduced from baseline; no metabolic response (NMR) if there is no change in uptake from baseline; and progressive metabolic disease (PMD) if there in an increase in uptake from baseline and/or there are new lesions. At interim and end of treatment, NMR or PMD indicates treatment failure.
  • a complete response at the end of treatment involves a complete metabolic response and a complete radiologic response at various measureable sites.
  • these sites include lymph nodes and extralymphatic sites, wherein a CR is described as a score of 1, 2, or 3 with or without a residual mass on the 5- point scale, when PET-CT is used.
  • uptake may be greater than normal mediastinum and/or liver.
  • a CR is described as no extralymphatic sites of disease and target nodes/nodal masses must regress to ⁇ 1.5 cm in longest transverse diameter of a lesion (LDi).
  • Further sites of assessment include the bone marrow wherein PET-CT-based assessment should indicate a lack of evidence of FDG-avid disease in marrow and a CT-based assessment should indicate a normal morphology, which if indeterminate should be IHC negative. Further sites may include assessment of organ enlargement, which should regress to normal.
  • non- measured lesions and new lesions are assessed, which in the case of CR should be absent.
  • RECIST Response Evaluation Criteria in Solid Tumors
  • the RECIST criteria are used to determine objective tumor response for target lesions.
  • a complete response as determined using RECIST criteria is described as the disappearance of all target lesions and any pathological lymph nodes (whether target or non-target) must have reduction in short axis to ⁇ 10 mm.
  • a partial response as determined using RECIST criteria is described as at least a 30% decrease in the sum of diameters of target lesions, taking as reference the baseline sum diameters.
  • progressive disease is described as at least a 20% increase in the sum of diameters of target lesions, taking as reference the smallest sum on study (this includes the baseline sum if that is the smallest on study). In addition to the relative increase of 20%, the sum must also demonstrate an absolute increase of at least 5 mm (in some aspects the appearance of one or more new lesions is also considered progression).
  • stable disease is described as neither sufficient shrinkage to qualify for PR nor sufficient increase to qualify for PD, taking as reference the smallest sum diameters while on study.
  • the method does not cause or reduces the likelihood of toxicity or toxic outcomes, such as cytokine release syndrome (CRS), severe CRS (sCRS), macrophage activation syndrome, tumor lysis syndrome, fever of at least at or about 38 degrees Celsius for three or more days and a plasma level of CRP of at least at or about 20 mg/dL, neurotoxicity and/or neurotoxicity.
  • CRS cytokine release syndrome
  • sCRS severe CRS
  • macrophage activation syndrome tumor lysis syndrome
  • tumor lysis syndrome fever of at least at or about 38 degrees Celsius for three or more days and a plasma level of CRP of at least at or about 20 mg/dL, neurotoxicity and/or neurotoxicity.
  • at least 50% of subjects treated according to the method e.g. at least 60%, at least 70%, at least 80%, at least 90% or more of the subjects treated
  • do not exhibit a toxic outcome e.g. CRS or neurotoxicity
  • do not exhibit a severe toxic outcome e.g. severe CRS or severe neurotoxicity
  • adoptive T cell therapy such as treatment with T cells expressing chimeric antigen receptors
  • T cells expressing chimeric antigen receptors can induce toxic effects or outcomes such as cytokine release syndrome and neurotoxicity.
  • effects or outcomes parallel high levels of circulating cytokines, which may underlie the observed toxicity.
  • the toxic outcome is or is associated with or indicative of cytokine release syndrome (CRS) or severe CRS (sCRS).
  • CRS cytokine release syndrome
  • sCRS severe CRS
  • CRS can occur in some cases following adoptive T cell therapy and administration to subjects of other biological products. See Davila et al., Sci Transl Med 6, 224ra25 (2014); Brentjens et al., Sci. Transl. Med. 5, 177ra38 (2013); Grupp et al., N. Engl. J. Med. 368, 1509-1518 (2013); and Kochenderfer et al., Blood 119, 2709-2720 (2012); Xu et al., Cancer Letters 343 (2014) 172-78.
  • CRS is caused by an exaggerated systemic immune response mediated by, for example, T cells, B cells, NK cells, monocytes, and/or macrophages. Such cells may release a large amount of inflammatory mediators such as cytokines and chemokines. Cytokines may trigger an acute inflammatory response and/or induce endothelial organ damage, which may result in microvascular leakage, heart failure, or death. Severe, life-threatening CRS can lead to pulmonary infiltration and lung injury, renal failure, or disseminated intravascular coagulation. Other severe, life-threatening toxicities can include cardiac toxicity, respiratory distress, neurologic toxicity and/or hepatic failure.
  • CRS may be treated using anti-inflammatory therapy such as an anti-IL-6 therapy, e.g., anti-IL-6 antibody, e.g., tocilizumab, or antibiotics.
  • anti-IL-6 therapy e.g., anti-IL-6 antibody, e.g., tocilizumab, or antibiotics.
  • anti-IL-6 antibody e.g., tocilizumab
  • antibiotics antibiotics.
  • signs and symptoms of CRS are known and include those described herein.
  • a particular dosage regimen or administration effects or does not effect a given CRS -associated outcome, sign, or symptom, particular outcomes, signs, and symptoms and/or quantities or degrees thereof may be specified.
  • CRS In the context of administering CAR-expressing cells, CRS typically occurs 6-20 days after infusion of cells that express a CAR. See Xu et al., Cancer Letters 343 (2014) 172- 78. In some cases, CRS occurs less than 6 days or more than 20 days after CAR T cell infusion. The incidence and timing of CRS may be related to baseline cytokine levels or tumor burden at the time of infusion. Commonly, CRS involves elevated serum levels of interferon (IFN)-y, tumor necrosis factor (TNF)-a, and/or interleukin (IL)-2. Other cytokines that may be rapidly induced in CRS are IL- ⁇ , IL-6, IL-8, and IL-10.
  • IFN interferon
  • TNF tumor necrosis factor
  • IL interleukin
  • Exemplary outcomes associated with CRS include fever, rigors, chills, hypotension, dyspnea, acute respiratory distress syndrome (ARDS), encephalopathy, ALT/AST elevation, renal failure, cardiac disorders, hypoxia, neurologic disturbances, and death.
  • Neurological complications include delirium, seizure-like activity, confusion, word-finding difficulty, aphasia, and/or becoming obtunded.
  • Other CRS-related outcomes include fatigue, nausea, headache, seizure, tachycardia, myalgias, rash, acute vascular leak syndrome, liver function impairment, and renal failure.
  • CRS is associated with an increase in one or more factors such as serum-ferritin, d-dimer, aminotransferases, lactate dehydrogenase and triglycerides, or with hypofibrinogenemia or hepatosplenomegaly.
  • factors such as serum-ferritin, d-dimer, aminotransferases, lactate dehydrogenase and triglycerides, or with hypofibrinogenemia or hepatosplenomegaly.
  • outcomes associated with CRS include one or more of:
  • cytokines such as a max fold change, e.g., of at least at or about 75, compared to pre-treatment levels of at least two cytokines (e.g., at least two of the group consisting of interferon gamma (IFNy), GM-CSF, IL-6, IL-10, Flt-3L, fracktalkine, and IL-5, and/or tumor necrosis factor alpha (TNFa)), or a max fold change, e.g., of at least at or about 250 of at least one of such cytokines; and/or at least one clinical sign of toxicity, such as hypotension (e.g., as measured by at least one intravenous vaso
  • Exemplary CRS -related outcomes include increased or high serum levels of one or more factors, including cytokines and chemokines and other factors associated with CRS.
  • Exemplary outcomes further include increases in synthesis or secretion of one or more of such factors.
  • Such synthesis or secretion can be by the T cell or a cell that interacts with the T cell, such as an innate immune cell or B cell.
  • the CRS -associated serum factors or CRS-related outcomes include inflammatory cytokines and/or chemokines, including interferon gamma (IFN- ⁇ ), TNF- a, IL- ⁇ , IL-2, IL-6, IL-7, IL-8, IL-10, IL-12, sIL-2Ra, granulocyte macrophage colony stimulating factor (GM-CSF), macrophage inflammatory protein (MIP)-l, tumor necrosis factor alpha (TNFa), IL-6, and IL-10, IL- ⁇ , IL-8, IL-2, MIP-1, Flt-3L, fracktalkine, and/or IL-5.
  • IFN- ⁇ interferon gamma
  • TNF- a TNF- a
  • IL- ⁇ interferon gamma
  • IL- ⁇ interferon gamma
  • IL- ⁇ interferon gamma
  • IL- ⁇ interferon gamma
  • IL- ⁇
  • the factor or outcome includes C reactive protein (CRP).
  • CRP C reactive protein
  • CRP also is a marker for cell expansion.
  • subjects that are measured to have high levels of CRP do not have CRS.
  • a measure of CRS includes a measure of CRP and another factor indicative of CRS.
  • one or more inflammatory cytokines or chemokines are monitored before, during, or after CAR treatment.
  • the one or more cytokines or chemokines include IFN- ⁇ , TNF-a, IL-2, IL- ⁇ , IL-6, IL-7, IL-8, IL-10, IL-12, sIL-2Ra, granulocyte macrophage colony stimulating factor (GM-CSF), or macrophage inflammatory protein (MIP).
  • IFN- ⁇ , TNF-a, and IL-6 are monitored.
  • Factors include fevers, hypoxia, hypotension, neurologic changes, elevated serum levels of inflammatory cytokines, such as a set of seven cytokines (IFNy, IL-5, IL-6, IL-10, Flt-3L, fractalkine, and GM-CSF) whose treatment- induced elevation can correlate well with both pretreatment tumor burden and sCRS symptoms.
  • cytokines such as a set of seven cytokines (IFNy, IL-5, IL-6, IL-10, Flt-3L, fractalkine, and GM-CSF
  • Other guidelines on the diagnosis and management of CRS are known (see e.g., Lee et al, Blood. 2014;124(2): 188-95).
  • the criteria reflective of CRS grade are those detailed in Table 2 below.
  • a subject is deemed to develop "severe CRS" ("sCRS") in response to or secondary to administration of a cell therapy or dose of cells thereof, if, following administration, the subject displays: (1) fever of at least 38 degrees Celsius for at least three days; (2) cytokine elevation that includes either (a) a max fold change of at least 75 for at least two of the following group of seven cytokines compared to the level immediately following the administration: interferon gamma (IFNy), GM-CSF, IL-6, IL-10, Flt-3L, fracktalkine, and IL-5 and/or (b) a max fold change of at least 250 for at least one of the following group of seven cytokines compared to the level immediately following the administration: interferon gamma (IFNy), GM-CSF, IL-6, IL-10, Flt-3L, fracktalkine, and IL-5; and (c) at least one clinical sign of toxicity such as hypotension (requiring at
  • the CRS encompasses a combination of (1) persistent fever (fever of at least 38 degrees Celsius for at least three days) and (2) a serum level of CRP of at least at or about 20 mg/dL.
  • the CRS encompasses hypotension requiring the use of two or more vasopressors or respiratory failure requiring mechanical ventilation.
  • the method of measuring or detecting the various outcomes may be specified.
  • the toxic outcome is or is associated with neurotoxicity.
  • symptoms associated with a clinical risk of neurotoxicity include confusion, delirium, expressive aphasia, obtundation, myoclonus, lethargy, altered mental status, convulsions, seizure-like activity, seizures (optionally as confirmed by electroencephalogram [EEG]), elevated levels of beta amyloid ( ⁇ ), elevated levels of glutamate, and elevated levels of oxygen radicals.
  • neurotoxicity is graded based on severity (e.g., using a Grade 1-5 scale (see, e.g., Guido Cavaletti & Paola Marmiroli Nature Reviews Neurology 6, 657-666 (December 2010); National Cancer Institute— Common Toxicity Criteria version 4.03 (NCI-CTCAE v4.03).
  • Grade 1-5 scale see, e.g., Guido Cavaletti & Paola Marmiroli Nature Reviews Neurology 6, 657-666 (December 2010); National Cancer Institute— Common Toxicity Criteria version 4.03 (NCI-CTCAE v4.03).
  • neurologic symptoms may be the earliest symptoms of sCRS. In some embodiments, neurologic symptoms are seen to begin 5 to 7 days after cell therapy infusion. In some embodiments, duration of neurologic changes may range from 3 to 19 days. In some cases, recovery of neurologic changes occurs after other symptoms of sCRS have resolved. In some embodiments, time or degree of resolution of neurologic changes is not hastened by treatment with anti-IL-6 and/or steroid(s).
  • a subject is deemed to develop "severe neurotoxicity" in response to or secondary to administration of a cell therapy or dose of cells thereof, if, following
  • the subject displays symptoms that limit self-care (e.g. bathing, dressing and undressing, feeding, using the toilet, taking medications) from among: 1) symptoms of peripheral motor neuropathy, including inflammation or degeneration of the peripheral motor nerves; 2) symptoms of peripheral sensory neuropathy, including inflammation or degeneration of the peripheral sensory nerves, dysesthesia, such as distortion of sensory perception, resulting in an abnormal and unpleasant sensation, neuralgia, such as intense painful sensation along a nerve or a group of nerves, and/or paresthesia, such as functional disturbances of sensory neurons resulting in abnormal cutaneous sensations of tingling, numbness, pressure, cold and warmth in the absence of stimulus.
  • severe neurotoxicity includes neurotoxicity with a grade of 3 or greater, such as set forth in Table 3.
  • the methods reduce symptoms associated with neurotoxicity compared to other methods.
  • subjects treated according to the present methods may have reduced symptoms of neurotoxicity, such as limb weakness or numbness, loss of memory, vision, and/or intellect, uncontrollable obsessive and/or compulsive behaviors, delusions, headache, cognitive and behavioral problems including loss of motor control, cognitive deterioration, and autonomic nervous system dysfunction, and sexual dysfunction, compared to subjects treated by other methods.
  • subjects treated according to the present methods may have reduced symptoms associated with peripheral motor neuropathy, peripheral sensory neuropathy, dysethesia, neuralgia or paresthesia.
  • the methods reduce outcomes associated with neurotoxicity including damages to the nervous system and/or brain, such as the death of neurons. In some aspects, the methods reduce the level of factors associated with neurotoxicity such as beta amyloid ( ⁇ ), glutamate, and oxygen radicals.
  • the cells for use in or administered in connection with the provided methods contain or are engineered to contain an engineered receptor, e.g., an engineered antigen receptor, such as a chimeric antigen receptor (CAR), or a T cell receptor (TCR).
  • an engineered receptor e.g., an engineered antigen receptor, such as a chimeric antigen receptor (CAR), or a T cell receptor (TCR).
  • populations of such cells compositions containing such cells and/or enriched for such cells, such as in which cells of a certain type such as T cells or CD8+ or CD4+ cells are enriched or selected.
  • compositions are pharmaceutical compositions and formulations for administration, such as for adoptive cell therapy.
  • therapeutic methods for administering the cells and compositions to subjects e.g., patients, in accord with the provided methods.
  • the cells include one or more nucleic acids introduced via genetic engineering, and thereby express recombinant or genetically engineered products of such nucleic acids.
  • gene transfer is accomplished by first stimulating the cells, such as by combining it with a stimulus that induces a response such as proliferation, survival, and/or activation, e.g., as measured by expression of a cytokine or activation marker, followed by transduction of the activated cells, and expansion in culture to numbers sufficient for clinical applications.
  • the cells generally express recombinant receptors, such as antigen receptors including functional non-TCR antigen receptors, e.g., chimeric antigen receptors (CARs), and other antigen-binding receptors such as transgenic T cell receptors (TCRs). Also among the receptors are other chimeric receptors.
  • antigen receptors including functional non-TCR antigen receptors, e.g., chimeric antigen receptors (CARs), and other antigen-binding receptors such as transgenic T cell receptors (TCRs).
  • CARs chimeric antigen receptors
  • TCRs transgenic T cell receptors
  • chimeric receptors such as a chimeric antigen receptors, contain one or more domains that combine a ligand-binding domain (e.g. antibody or antibody fragment) that provides specificity for a desired antigen (e.g., tumor antigen) with intracellular signaling domains.
  • the intracellular signaling domain is an activating intracellular domain portion, such as a T cell activating domain, providing a primary activation signal.
  • the intracellular signaling domain contains or additionally contains a costimulatory signaling domain to facilitate effector functions.
  • chimeric receptors when genetically engineered into immune cells can modulate T cell activity, and, in some cases, can modulate T cell differentiation or homeostasis, thereby resulting in genetically engineered cells with improved longevity, survival and/or persistence in vivo, such as for use in adoptive cell therapy methods.
  • Exemplary antigen receptors including CARs, and methods for engineering and introducing such receptors into cells, include those described, for example, in international patent application publication numbers WO200014257, WO2013126726, WO2012/129514, WO2014031687, WO2013/166321, WO2013/071154, WO2013/123061 U.S. patent application publication numbers US2002131960, US2013287748, US20130149337, U.S.
  • the antigen receptors include a CAR as described in U.S. Patent No.: 7,446,190, and those described in International Patent Application Publication No.: WO/2014055668 Al.
  • the CARs include CARs as disclosed in any of the aforementioned publications, such as WO2014031687, US 8,339,645, US 7,446,179, US 2013/0149337, U.S. Patent No.: 7,446,190, US Patent No.: 8,389,282, Kochenderfer et al., 2013, Nature Reviews Clinical Oncology, 10, 267-276 (2013); Wang et al. (2012) J. Immunother. 35(9): 689-701; and Brentjens et al., Sci Transl Med. 2013 5(177). See also WO2014031687, US 8,339,645, US 7,446,179, US
  • the chimeric receptors such as CARs, generally include an extracellular antigen binding domain, such as a portion of an antibody molecule, generally a variable heavy (VH) chain region and/or variable light (VL) chain region of the antibody, e.g., an scFv antibody fragment.
  • VH variable heavy
  • VL variable light
  • the antigen targeted by the receptor is a polypeptide. In some embodiments, it is a carbohydrate or other molecule. In some embodiments, the antigen is selectively expressed or overexpressed on cells of the disease or condition, e.g., the tumor or pathogenic cells, as compared to normal or non-targeted cells or tissues. In other embodiments, the antigen is expressed on normal cells and/or is expressed on the engineered cells.
  • Antigens targeted by the receptors in some embodiments include antigens associated with a B cell malignancy, such as any of a number of known B cell marker. In some
  • the antigen targeted by the receptor is CD20, CD19, CD22, ROR1, CD45, CD21, CD5, CD33, Igkappa, Iglambda, CD79a, CD79b or CD30.
  • the scFv and/or VH domains is derived from FMC63.
  • FMC63 generally refers to a mouse monoclonal IgGl antibody raised against Nairn- 1 and -16 cells expressing CD19 of human origin (Ling, N. R., et al. (1987). Leucocyte typing III. 302).
  • the FMC63 antibody comprises CDRH1 and H2 set forth in SEQ ID NOS: 38, 39 respectively, and CDRH3 seq forth in SEQ ID NOS: 40 or 54 and CDRL1 set forth in SEQ ID NOS: 35 and CDR L2 36 or 55 and CDR L3 sequences 37 or 56.
  • the FMC63 antibody comprises the heavy chain variable region (V H ) comprising the amino acid sequence of SEQ ID NO: 41 and the light chain variable region (V L ) comprising the amino acid sequence of SEQ ID NO: 42.
  • the svFv comprises a variable light chain containing the CDRL1 sequence of 35, a CDRL2 sequence of 36, and a CDRL3 sequence of 37 and/or a variable heavy chain
  • the scFv comprises a variable heavy chain region of FMC63 set forth in SEQ ID NO:41 and a variable light chain region of FMC63 set forth in 42.
  • the variable heavy and variable light chain are connected by a linker.
  • the linker is set forth in SEQ ID NO:24.
  • the scFv comprises, in order, a VH, a linker, and a VL.
  • the scFv comprises, in order, a VL, a linker, and a VH.
  • the svFc is encoded by a sequence of nucleotides set forth in SEQ ID NO:25 or a sequence that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:25.
  • the scFv comprises the sequence of amino acids set forth in SEQ ID NO:43 or a sequence that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:43.
  • the scFv is derived from SJ25C1.
  • SJ25C1 is a mouse monoclonal IgGl antibody raised against Nairn- 1 and -16 cells expressing CD 19 of human origin (Ling, N. R., et al. (1987). Leucocyte typing III. 302).
  • the SJ25C1 antibody comprises CDRH1, H2 and H3 set forth in SEQ ID NOS: 47-49, respectively, and CDRL1, L2 and L3 sequences set forth in SEQ ID NOS: 44-46, respectively.
  • the SJ25C1 antibody comprises the heavy chain variable region (V H ) comprising the amino acid sequence of SEQ ID NO: 50 and the light chain variable region (V L ) comprising the amino acid sequence of SEQ ID NO: 51.
  • the svFv comprises a variable light chain containing hte CDRLl sequence of 44, a CDRL2 sequence of 45, and a CDRL3 sequence of 46 and/or a variable heavy chain containing a CDRH1 sequence of 47, a CDRH2 sequence of 48, and a CDRH3 sequence of 49.
  • the scFv comprises a variable heavy chain region of SJ25C1 set forth in SEQ ID NO:50 and a variable light chain region of SJ25C1 set forth in 51.
  • the variable heavy and variable light chain are connected by a linker.
  • the linker is set forth in SEQ ID NO:52.
  • the scFv comprises, in order, a VH, a linker, and a VL.
  • the scFv comprises, in order, a VL, a linker, and a VH.
  • the scFv comprises the sequence of amino acids set forth in SEQ ID NO:53 or a sequence that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:53.
  • the chimeric antigen receptor includes an extracellular portion containing an antibody or antibody fragment. In some aspects, the chimeric antigen receptor includes an extracellular portion containing the antibody or fragment and an intracellular signaling domain. In some embodiments, the antibody or fragment includes an scFv.
  • the antibody portion of the recombinant receptor e.g., CAR
  • an immunoglobulin constant region such as a hinge region, e.g., an IgG4 hinge region, and/or a CH1/CL and/or Fc region.
  • the constant region or portion is of a human IgG, such as IgG4 or IgGl.
  • the portion of the constant region serves as a spacer region between the antigen-recognition component, e.g., scFv, and transmembrane domain.
  • the spacer can be of a length that provides for increased responsiveness of the cell following antigen binding, as compared to in the absence of the spacer.
  • Exemplary spacers include, but are not limited to, those described in Hudecek et al. (2013) Clin. Cancer Res., 19:3153, international patent application publication number WO2014031687, U.S. Patent No. 8,822,647 or published app. No. US2014/0271635.
  • the constant region or portion is of a human IgG, such as IgG4 or IgGl.
  • the spacer has the sequence ESKYGPPCPPCP (set forth in SEQ ID NO: 1), and is encoded by the sequence set forth in SEQ ID NO: 2.
  • the spacer has the sequence set forth in SEQ ID NO: 3.
  • the spacer has the sequence set forth in SEQ ID NO: 4.
  • the constant region or portion is of IgD.
  • the spacer has the sequence set forth in SEQ ID NO: 5.
  • the spacer has a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to any of SEQ ID NOS: 1, 3, 4 or 5.
  • the spacer has the sequence set forth in SEQ ID NOS: 26-34.
  • the spacer has a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to any of SEQ ID NOS: 26-34.
  • the antigen receptor comprises an intracellular domain linked directly or indirectly to the extracellular domain.
  • the chimeric antigen receptor includes a transmembrane domain linking the extracellular domain and the intracellular signaling domain.
  • the intracellular signaling domain comprises an IT AM.
  • the antigen recognition domain e.g. extracellular domain
  • the chimeric receptor generally is linked to one or more intracellular signaling components, such as signaling components that mimic activation through an antigen receptor complex, such as a TCR complex, in the case of a CAR, and/or signal via another cell surface receptor.
  • the chimeric receptor comprises a transmembrane domain linked or fused between the extracellular domain (e.g. scFv) and intracellular signaling domain .
  • the antigen -binding component e.g., antibody
  • the antigen -binding component is linked to one or more transmembrane and intracellular signaling domains.
  • a transmembrane domain that naturally is associated with one of the domains in the receptor e.g., CAR
  • the transmembrane domain is selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
  • the transmembrane domain in some embodiments is derived either from a natural or from a synthetic source. Where the source is natural, the domain in some aspects is derived from any membrane-bound or transmembrane protein.
  • Transmembrane regions include those derived from (i.e. comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CDS, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154.
  • the transmembrane domain in some embodiments is synthetic.
  • the synthetic transmembrane domain comprises predominantly hydrophobic residues such as leucine and valine. In some aspects, a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
  • the linkage is by linkers, spacers, and/or transmembrane domain(s). In some aspects, the transmembrane domain contains a
  • the extracellular domain and transmembrane domain can be linked directly or indirectly. In some embodiments, the extracellular domain and
  • transmembrane are linked by a spacer, such as any described herein.
  • the receptor contains extracellular portion of the molecule from which the transmembrane domain is derived, such as a CD28 extracellular portion.
  • intracellular signaling domains are those that mimic or approximate a signal through a natural antigen receptor, a signal through such a receptor in combination with a costimulatory receptor, and/or a signal through a costimulatory receptor alone.
  • a short oligo- or polypeptide linker for example, a linker of between 2 and 10 amino acids in length, such as one containing glycines and serines, e.g., glycine- serine doublet, is present and forms a linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR.
  • T cell activation is in some aspects described as being mediated by two classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences), and those that act in an antigen- independent manner to provide a secondary or co- stimulatory signal (secondary cytoplasmic signaling sequences).
  • primary cytoplasmic signaling sequences those that initiate antigen-dependent primary activation through the TCR
  • secondary cytoplasmic signaling sequences those that act in an antigen- independent manner to provide a secondary or co- stimulatory signal.
  • the CAR includes one or both of such signaling components.
  • the receptor e.g., the CAR
  • the CAR generally includes at least one intracellular signaling component or components.
  • the CAR includes a primary cytoplasmic signaling sequence that regulates primary activation of the TCR complex.
  • Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine -based activation motifs or ITAMs.
  • ITAM containing primary cytoplasmic signaling sequences include those derived from CD3 zeta chain, FcR gamma, CD3 gamma, CD3 delta and CD3 epsilon.
  • cytoplasmic signaling molecule(s) in the CAR contain(s) a cytoplasmic signaling domain, portion thereof, or sequence derived from CD3 zeta.
  • the receptor includes an intracellular component of a TCR complex, such as a TCR CD3 chain that mediates T-cell activation and cytotoxicity, e.g., CD3 zeta chain.
  • the antigen-binding portion is linked to one or more cell signaling modules.
  • cell signaling modules include CD3 transmembrane domain, CD3 intracellular signaling domains, and/or other CD transmembrane domains.
  • the receptor e.g., CAR
  • the receptor further includes a portion of one or more additional molecules such as Fc receptor ⁇ , CD8, CD4, CD25, or CD16.
  • the CAR or other chimeric receptor includes a chimeric molecule between CD3-zeta (CD3 ⁇ ) or Fc receptor ⁇ and CD8, CD4, CD25 or CD16.
  • the cytoplasmic domain or intracellular signaling domain of the receptor activates at least one of the normal effector functions or responses of the immune cell, e.g., T cell engineered to express the CAR.
  • the CAR induces a function of a T cell such as cytolytic activity or T-helper activity, such as secretion of cytokines or other factors.
  • a truncated portion of an intracellular signaling domain of an antigen receptor component or costimulatory molecule is used in place of an intact immunostimulatory chain, for example, if it transduces the effector function signal.
  • the intracellular signaling domain or domains include the cytoplasmic sequences of the T cell receptor (TCR), and in some aspects also those of co-receptors that in the natural context act in concert with such receptors to initiate signal transduction following antigen receptor engagement.
  • full activation In the context of a natural TCR, full activation generally requires not only signaling through the TCR, but also a costimulatory signal.
  • a component for generating secondary or co-stimulatory signal is also included in the CAR.
  • the CAR does not include a component for generating a costimulatory signal.
  • an additional CAR is expressed in the same cell and provides the component for generating the secondary or costimulatory signal.
  • the chimeric antigen receptor contains an intracellular domain of a T cell costimulatory molecule.
  • the CAR includes a signaling domain and/or transmembrane portion of a costimulatory receptor, such as CD28, 4-1BB, OX40, DAP10, and ICOS.
  • the same CAR includes both the activating and
  • the chimeric antigen receptor contains an intracellular domain derived from a T cell costimulatory molecule or a functional variant thereof, such as between the transmembrane domain and intracellular signaling domain.
  • the T cell costimulatory molecule is CD28 or 4 IBB.
  • the activating domain is included within one CAR, whereas the costimulatory component is provided by another CAR recognizing another antigen.
  • the CARs include activating or stimulatory CARs, costimulatory CARs, both expressed on the same cell (see WO2014/055668).
  • the cells include one or more stimulatory or activating CAR and/or a costimulatory CAR.
  • the cells further include inhibitory CARs (iCARs, see Fedorov et al., Sci. Transl.
  • the intracellular signaling domain comprises a CD28 transmembrane and signaling domain linked to a CD3 (e.g., CD3-zeta) intracellular domain.
  • the intracellular signaling domain comprises a chimeric CD28 and CD 137 (4- IBB, TNFRSF9) co- stimulatory domains, linked to a CD3 zeta intracellular domain.
  • the CAR encompasses one or more, e.g., two or more, costimulatory domains and an activation domain, e.g., primary activation domain, in the cytoplasmic portion.
  • exemplary CARs include intracellular components of CD3-zeta, CD28, and 4- IBB.
  • the antigen receptor further includes a marker and/or cells expressing the CAR or other antigen receptor further includes a surrogate marker, such as a cell surface marker, which may be used to confirm transduction or engineering of the cell to express the receptor.
  • a surrogate marker such as a cell surface marker
  • the marker includes all or part (e.g., truncated form) of CD34, a NGFR, or epidermal growth factor receptor, such as truncated version of such a cell surface receptor (e.g., tEGFR).
  • the nucleic acid encoding the marker is operably linked to a polynucleotide encoding for a linker sequence, such as a cleavable linker sequence, e.g., T2A, P2A, E2A or F2A, e.g. set forth in any of SEQ ID NOS: 6 or 19-23.
  • a marker, and optionally a linker sequence can be any as disclosed in published patent application No. WO2014031687.
  • the marker can be a truncated EGFR (tEGFR) that is, optionally, linked to a linker sequence, such as a T2A cleavable linker sequence.
  • An exemplary polypeptide for a truncated EGFR comprises the sequence of amino acids set forth in SEQ ID NO: 7 or 16 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 7 or 16.
  • An exemplary T2A linker sequence comprises the sequence of amino acids set forth in SEQ ID NO: 6 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 6.
  • the marker is a molecule, e.g., cell surface protein, not naturally found on T cells or not naturally found on the surface of T cells, or a portion thereof.
  • the molecule is a non-self molecule, e.g., non-self protein, i.e., one that is not recognized as "self by the immune system of the host into which the cells will be adoptively transferred.
  • the marker serves no therapeutic function and/or produces no effect other than to be used as a marker for genetic engineering, e.g., for selecting cells successfully engineered.
  • the marker may be a therapeutic molecule or molecule otherwise exerting some desired effect, such as a ligand for a cell to be encountered in vivo, such as a costimulatory or immune checkpoint molecule to enhance and/or dampen responses of the cells upon adoptive transfer and encounter with ligand.
  • CARs are referred to as first, second, and/or third generation CARs.
  • a first generation CAR is one that solely provides a CD3 -chain induced signal upon antigen binding;
  • a second-generation CARs is one that provides such a signal and costimulatory signal, such as one including an intracellular signaling domain from a costimulatory receptor such as CD28 or CD137;
  • a third generation CAR is one that includes multiple costimulatory domains of different costimulatory receptors.
  • the CAR contains an antibody, e.g., an antibody fragment, a transmembrane domain that is or contains a transmembrane portion of CD28 or a functional variant thereof, and an intracellular signaling domain containing a signaling portion of CD28 or functional variant thereof and a signaling portion of CD3 zeta or functional variant thereof.
  • the CAR contains an antibody, e.g., antibody fragment, a transmembrane domain that is or contains a transmembrane portion of CD28 or a functional variant thereof, and an intracellular signaling domain containing a signaling portion of a 4- IBB or functional variant thereof and a signaling portion of CD3 zeta or functional variant thereof.
  • the receptor further includes a spacer containing a portion of an Ig molecule, such as a human Ig molecule, such as an Ig hinge, e.g. an IgG4 hinge, such as a hinge- only spacer.
  • an Ig molecule such as a human Ig molecule
  • an Ig hinge e.g. an IgG4 hinge, such as a hinge- only spacer.
  • the transmembrane domain of the recombinant receptor e.g., the CAR
  • transmembrane domain that comprises the sequence of amino acids set forth in SEQ ID NO: 8 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 8; in some embodiments, the transmembrane-domain containing portion of the recombinant receptor comprises the sequence of amino acids set forth in SEQ ID NO: 9 or a sequence of amino acids having at least at or about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity thereto.
  • the intracellular signaling component(s) of the recombinant receptor e.g. the CAR
  • the intracellular signaling domain can comprise the sequence of amino acids set forth in SEQ ID NO: 10 or 11 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 10 or 11.
  • the intracellular domain comprises an intracellular costimulatory signaling domain of 4-1BB (e.g. (Accession No. Q07011.1) or functional variant or portion thereof, such as the sequence of amino acids set forth in SEQ ID NO: 12 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 12.
  • 4-1BB e.g. (Accession No. Q07011.1
  • functional variant or portion thereof such as the sequence of amino acids set forth in SEQ ID NO: 12 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 12.
  • the intracellular signaling domain of the recombinant receptor comprises a human CD3 zeta stimulatory signaling domain or functional variant thereof, such as an 112 AA cytoplasmic domain of isoform 3 of human CD3 ⁇ (Accession No.: P20963.2) or a CD3 zeta signaling domain as described in U.S. Patent No.: 7,446,190 or U.S. Patent No. 8,911,993.
  • a human CD3 zeta stimulatory signaling domain or functional variant thereof such as an 112 AA cytoplasmic domain of isoform 3 of human CD3 ⁇ (Accession No.: P20963.2) or a CD3 zeta signaling domain as described in U.S. Patent No.: 7,446,190 or U.S. Patent No. 8,911,993.
  • the intracellular signaling domain comprises the sequence of amino acids as set forth in SEQ ID NO: 13, 14 or 15 or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 13, 14 or 15.
  • the spacer contains only a hinge region of an IgG, such as only a hinge of IgG4 or IgGl, such as the hinge only spacer set forth in SEQ ID NO: 1.
  • the spacer is or contains an Ig hinge, e.g., an IgG4-derived hinge, optionally linked to a CH2 and/or CH3 domains.
  • the spacer is an Ig hinge, e.g., an IgG4 hinge, linked to CH2 and CH3 domains, such as set forth in SEQ ID NO: 4.
  • the spacer is an Ig hinge, e.g., an IgG4 hinge, linked to a CH3 domain only, such as set forth in SEQ ID NO: 3.
  • the spacer is or comprises a glycine- serine rich sequence or other flexible linker such as known flexible linkers.
  • the CAR includes an antibody such as an antibody fragment, including scFvs, a spacer, such as a spacer containing a portion of an immunoglobulin molecule, such as a hinge region and/or one or more constant regions of a heavy chain molecule, such as an Ig-hinge containing spacer, a transmembrane domain containing all or a portion of a CD28-derived transmembrane domain, a CD28-derived intracellular signaling domain, and a CD3 zeta signaling domain.
  • an antibody such as an antibody fragment, including scFvs
  • a spacer such as a spacer containing a portion of an immunoglobulin molecule, such as a hinge region and/or one or more constant regions of a heavy chain molecule, such as an Ig-hinge containing spacer, a transmembrane domain containing all or a portion of a CD28-derived transmembrane domain, a CD28-derived intracellular signaling domain
  • the CAR includes an antibody or fragment, such as scFv, a spacer such as any of the Ig-hinge containing spacers, a CD28-derived transmembrane domain, a 4-lBB-derived intracellular signaling domain, and a CD3 zeta-derived signaling domain.
  • nucleic acid molecules encoding such CAR constructs further includes a sequence encoding a T2A ribosomal skip element and/or a tEGFR sequence, e.g., downstream of the sequence encoding the CAR.
  • the sequence encodes a T2A ribosomal skip element set forth in SEQ ID NO: 6, or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 6.
  • T cells expressing an antigen receptor e.g.
  • CAR can also be generated to express a truncated EGFR (EGFRt) as a non-immunogenic selection epitope (e.g. by introduction of a construct encoding the CAR and EGFRt separated by a T2A ribosome switch to express two proteins from the same construct), which then can be used as a marker to detect such cells (see e.g. U.S. Patent No. 8,802,374).
  • EGFRt truncated EGFR
  • the sequence encodes a tEGFR sequence set forth in SEQ ID NO: 7 or 16, or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 7 or 16.
  • the recombinant receptors, such as CARs, expressed by the cells administered to the subject generally recognize or specifically bind to a molecule that is expressed in, associated with, and/or specific for the disease or condition or cells thereof being treated.
  • the receptor Upon specific binding to the molecule, e.g., antigen, the receptor generally delivers an immuno stimulatory signal, such as an ITAM-transduced signal, into the cell, thereby promoting an immune response targeted to the disease or condition.
  • the cells express a CAR that specifically binds to an antigen expressed by a cell or tissue of the disease or condition or associated with the disease or condition.
  • the genetically engineered antigen receptors include recombinant T cell receptors (TCRs) and/or TCRs cloned from naturally occurring T cells.
  • TCRs recombinant T cell receptors
  • a high-affinity T cell clone for a target antigen e.g., a cancer antigen
  • the TCR clone for a target antigen has been generated in transgenic mice engineered with human immune system genes (e.g., the human leukocyte antigen system, or HLA). See, e.g., tumor antigens (see, e.g., Parkhurst et al. (2009) Clin Cancer Res.
  • phage display is used to isolate TCRs against a target antigen (see, e.g., Varela-Rohena et al. (2008) Nat Med. 14: 1390-1395 and Li (2005) Nat Biotechnol. 23:349-354.
  • the TCR alpha and beta chains are isolated and cloned into a gene expression vector.
  • the TCR alpha and beta genes are linked via a picornavirus 2A ribosomal skip peptide so that both chains are coexpression.
  • genetic transfer of the TCR is accomplished via retroviral or lentiviral vectors, or via transposons (see, e.g., Baum et al. (2006) Molecular Therapy: The Journal of the American Society of Gene Therapy. 13: 1050-1063; Frecha et al. (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18: 1748- 1757; an hackett et al. (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18:674-683.
  • the provided methods involve administering to a subject having a disease or condition cells expressing a recombinant antigen receptor.
  • a recombinant antigen receptor e.g., CARs or TCRs
  • exemplary methods include those for transfer of nucleic acids encoding the receptors, including via viral, e.g., retroviral or lentiviral, transduction, transposons, and electroporation.
  • the genetic engineering generally involves introduction of a nucleic acid encoding the recombinant or engineered component into a composition containing the cells, such as by retroviral transduction, transfection, or transformation.
  • recombinant nucleic acids are transferred into cells using recombinant infectious virus particles, such as, e.g., vectors derived from simian virus 40 (SV40), adenoviruses, adeno-associated virus (AAV).
  • recombinant nucleic acids are transferred into T cells using recombinant lentiviral vectors or retroviral vectors, such as gamma-retroviral vectors (see, e.g., Koste et al. (2014) Gene Therapy 2014 Apr 3. doi: 10.1038/gt.2014.25; Carlens et al.
  • the retroviral vector has a long terminal repeat sequence (LTR), e.g., a retroviral vector derived from the Moloney murine leukemia virus (MoMLV), myeloproliferative sarcoma virus (MPSV), murine embryonic stem cell virus (MESV), murine stem cell virus (MSCV), spleen focus forming virus (SFFV), or adeno-associated virus (AAV).
  • LTR long terminal repeat sequence
  • MoMLV Moloney murine leukemia virus
  • MPSV myeloproliferative sarcoma virus
  • MMV murine embryonic stem cell virus
  • MSCV murine stem cell virus
  • SFFV spleen focus forming virus
  • AAV adeno-associated virus
  • retroviral vectors are derived from murine retroviruses.
  • the retroviruses include those derived from any avian or mammalian cell source.
  • the retroviruses typically are amphotropic, meaning that they are capable of
  • the gene to be expressed replaces the retroviral gag, pol and/or env sequences.
  • retroviral systems e.g., U.S. Pat. Nos. 5,219,740; 6,207,453; 5,219,740; Miller and Rosman (1989) BioTechniques 7:980-990; Miller, A. D. (1990) Human Gene Therapy 1:5-14; Scarpa et al. (1991) Virology 180:849-852; Burns et al. (1993) Proc. Natl. Acad. Sci. USA 90:8033-8037; and Boris-Lawrie and Temin (1993) Cur. Opin. Genet. Develop. 3: 102-109.
  • recombinant nucleic acids are transferred into T cells via electroporation (see, e.g., Chicaybam et al, (2013) PLoS ONE 8(3): e60298 and Van Tedeloo et al. (2000) Gene Therapy 7(16): 1431-1437).
  • recombinant nucleic acids are transferred into T cells via transposition (see, e.g., Manuri et al. (2010) Hum Gene Ther 21(4): 427-437; Sharma et al. (2013) Molec Ther Nucl Acids 2, e74; and Huang et al. (2009) Methods Mol Biol 506: 115-126).
  • the cells may be transfected either during or after expansion e.g. with a T cell receptor (TCR) or a chimeric antigen receptor (CAR).
  • TCR T cell receptor
  • CAR chimeric antigen receptor
  • This transfection for the introduction of the gene of the desired receptor can be carried out with any suitable retroviral vector, for example.
  • the genetically modified cell population can then be liberated from the initial stimulus (the CD3/CD28 stimulus, for example) and subsequently be stimulated with a second type of stimulus e.g. via a de novo introduced receptor).
  • This second type of stimulus may include an antigenic stimulus in form of a peptide/MHC molecule, the cognate (cross-linking) ligand of the genetically introduced receptor (e.g.
  • a vector may be used that does not require that the cells, e.g., T cells, are activated.
  • the cells may be selected and/or transduced prior to activation.
  • the cells may be engineered prior to, or subsequent to culturing of the cells, and in some cases at the same time as or during at least a portion of the culturing.
  • genes for introduction are those to improve the efficacy of therapy, such as by promoting viability and/or function of transferred cells; genes to provide a genetic marker for selection and/or evaluation of the cells, such as to assess in vivo survival or localization; genes to improve safety, for example, by making the cell susceptible to negative selection in vivo as described by Lupton S. D. et al., Mol. and Cell Biol., 11:6 (1991); and Riddell et al., Human Gene Therapy 3:319-338 (1992); see also the publications of
  • the nucleic acids are heterologous, i.e., normally not present in a cell or sample obtained from the cell, such as one obtained from another organism or cell, which for example, is not ordinarily found in the cell being engineered and/or an organism from which such cell is derived.
  • the nucleic acids are not naturally occurring, such as a nucleic acid not found in nature, including one comprising chimeric combinations of nucleic acids encoding various domains from multiple different cell types.
  • the cells generally are eukaryotic cells, such as mammalian cells, and typically are human cells.
  • the cells are derived from the blood, bone marrow, lymph, or lymphoid organs, are cells of the immune system, such as cells of the innate or adaptive immunity, e.g., myeloid or lymphoid cells, including lymphocytes, typically T cells and/or NK cells.
  • Other exemplary cells include stem cells, such as multipotent and pluripotent stem cells, including induced pluripotent stem cells (iPSCs).
  • the cells typically are primary cells, such as those isolated directly from a subject and/or isolated from a subject and frozen.
  • the cells include one or more subsets of T cells or other cell types, such as whole T cell populations, CD4+ cells, CD8+ cells, and subpopulations thereof, such as those defined by function, activation state, maturity, potential for differentiation, expansion, recirculation, localization, and/or persistence capacities, antigen-specificity, type of antigen receptor, presence in a particular organ or compartment, marker or cytokine secretion profile, and/or degree of differentiation.
  • the cells may be allogeneic and/or autologous.
  • the methods include off-the-shelf methods.
  • the cells are pluripotent and/or multipotent, such as stem cells, such as induced pluripotent stem cells (iPSCs).
  • the methods include isolating cells from the subject, preparing, processing, culturing, and/or engineering them, and reintroducing them into the same subject, before or after cryopreservation.
  • T cells and/or of CD4+ and/or of CD8+ T cells are naive T (TN) cells, effector T cells (TEFF), memory T cells and sub-types thereof, such as stem cell memory T (TSCMX central memory T (TCMX effector memory T (TEMX or terminally differentiated effector memory T cells, tumor-infiltrating lymphocytes (TIL), immature T cells, mature T cells, helper T cells, cytotoxic T cells, mucosa-associated invariant T (MAIT) cells, naturally occurring and adaptive regulatory T (Treg) cells, helper T cells, such as TH1 cells, TH2 cells, TH3 cells, TH17 cells, TH9 cells, TH22 cells, follicular helper T cells, alpha/beta T cells, and delta/gamma T cells.
  • TCMX central memory T TCMX effector memory T (TEMX or terminally differentiated effector memory T cells
  • TIL tumor-infiltrating lymphocytes
  • TIL
  • the cells are natural killer (NK) cells.
  • the cells are monocytes or granulocytes, e.g., myeloid cells, macrophages, neutrophils, dendritic cells, mast cells, eosinophils, and/or basophils.
  • the cells include one or more nucleic acids introduced via genetic engineering, and thereby express recombinant or genetically engineered products of such nucleic acids.
  • the nucleic acids are heterologous, i.e., normally not present in a cell or sample obtained from the cell, such as one obtained from another organism or cell, which for example, is not ordinarily found in the cell being engineered and/or an organism from which such cell is derived.
  • the nucleic acids are not naturally occurring, such as a nucleic acid not found in nature, including one comprising chimeric combinations of nucleic acids encoding various domains from multiple different cell types.
  • preparation of the engineered cells includes one or more culture and/or preparation steps.
  • the cells for introduction of the nucleic acid encoding the transgenic receptor such as the CAR may be isolated from a sample, such as a biological sample, e.g., one obtained from or derived from a subject.
  • the subject from which the cell is isolated is one having the disease or condition or in need of a cell therapy or to which cell therapy will be administered.
  • the subject in some embodiments is a human in need of a particular therapeutic intervention, such as the adoptive cell therapy for which cells are being isolated, processed, and/or engineered.
  • the cells in some embodiments are primary cells, e.g., primary human cells.
  • the samples include tissue, fluid, and other samples taken directly from the subject, as well as samples resulting from one or more processing steps, such as separation, centrifugation, genetic engineering (e.g. transduction with viral vector), washing, and/or incubation.
  • the biological sample can be a sample obtained directly from a biological source or a sample that is processed.
  • Biological samples include, but are not limited to, body fluids, such as blood, plasma, serum, cerebrospinal fluid, synovial fluid, urine and sweat, tissue and organ samples, including processed samples derived therefrom.
  • the sample from which the cells are derived or isolated is blood or a blood-derived sample, or is or is derived from an apheresis or leukapheresis product.
  • exemplary samples include whole blood, peripheral blood mononuclear cells (PBMCs), leukocytes, bone marrow, thymus, tissue biopsy, tumor, leukemia, lymphoma, lymph node, gut associated lymphoid tissue, mucosa associated lymphoid tissue, spleen, other lymphoid tissues, liver, lung, stomach, intestine, colon, kidney, pancreas, breast, bone, prostate, cervix, testes, ovaries, tonsil, or other organ, and/or cells derived therefrom.
  • Samples include, in the context of cell therapy, e.g., adoptive cell therapy, samples from autologous and allogeneic sources.
  • the cells are derived from cell lines, e.g., T cell lines.
  • the cells in some embodiments are obtained from a xenogeneic source, for example, from mouse, rat, non-human primate, and pig.
  • isolation of the cells includes one or more preparation and/or non-affinity based cell separation steps.
  • cells are washed, centrifuged, and/or incubated in the presence of one or more reagents, for example, to remove unwanted
  • cells from the circulating blood of a subject are obtained, e.g., by apheresis or leukapheresis.
  • the samples contain lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and/or platelets, and in some aspects contains cells other than red blood cells and platelets.
  • the blood cells collected from the subject are washed, e.g., to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
  • the cells are washed with phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • the wash solution lacks calcium and/or magnesium and/or many or all divalent cations.
  • a washing step is
  • a washing step is accomplished by tangential flow filtration (TFF) according to the manufacturer's instructions.
  • the cells are resuspended in a variety of biocompatible buffers after washing, such as, for example, Ca ++ /Mg ++ free PBS.
  • components of a blood cell sample are removed and the cells directly resuspended in culture media.
  • the methods include density-based cell separation methods, such as the preparation of white blood cells from peripheral blood by lysing the red blood cells and centrifugation through a Percoll or Ficoll gradient.
  • the isolation methods include the separation of different cell types based on the expression or presence in the cell of one or more specific molecules, such as surface markers, e.g., surface proteins, intracellular markers, or nucleic acid. In some embodiments, any known method for separation based on such markers may be used. In some embodiments, the separation is affinity- or immunoaffinity-based separation.
  • the isolation in some aspects includes separation of cells and cell populations based on the cells' expression or expression level of one or more markers, typically cell surface markers, for example, by incubation with an antibody or binding partner that specifically binds to such markers, followed generally by washing steps and separation of cells having bound the antibody or binding partner, from those cells having not bound to the antibody or binding partner.
  • Such separation steps can be based on positive selection, in which the cells having bound the reagents are retained for further use, and/or negative selection, in which the cells having not bound to the antibody or binding partner are retained. In some examples, both fractions are retained for further use. In some aspects, negative selection can be particularly useful where no antibody is available that specifically identifies a cell type in a heterogeneous population, such that separation is best carried out based on markers expressed by cells other than the desired population.
  • the separation need not result in 100% enrichment or removal of a particular cell population or cells expressing a particular marker.
  • positive selection of or enrichment for cells of a particular type refers to increasing the number or percentage of such cells, but need not result in a complete absence of cells not expressing the marker.
  • negative selection, removal, or depletion of cells of a particular type refers to decreasing the number or percentage of such cells, but need not result in a complete removal of all such cells.
  • multiple rounds of separation steps are carried out, where the positively or negatively selected fraction from one step is subjected to another separation step, such as a subsequent positive or negative selection.
  • a single separation step can deplete cells expressing multiple markers simultaneously, such as by incubating cells with a plurality of antibodies or binding partners, each specific for a marker targeted for negative selection.
  • multiple cell types can simultaneously be positively selected by incubating cells with a plurality of antibodies or binding partners expressed on the various cell types.
  • T cells such as cells positive or expressing high levels of one or more surface markers, e.g., CD28 + , CD62L + , CCR7 + , CD27 + , CD127 + , CD4 + , CD8 + , CD45RA + , and/or CD45RO + T cells, are isolated by positive or negative selection techniques.
  • surface markers e.g., CD28 + , CD62L + , CCR7 + , CD27 + , CD127 + , CD4 + , CD8 + , CD45RA + , and/or CD45RO + T cells.
  • CD3 + , CD28 + T cells can be positively selected using CD3/CD28 conjugated magnetic beads (e.g., DYNABEADS® M-450 CD3/CD28 T Cell Expander).
  • CD3/CD28 conjugated magnetic beads e.g., DYNABEADS® M-450 CD3/CD28 T Cell Expander
  • isolation is carried out by enrichment for a particular cell population by positive selection, or depletion of a particular cell population, by negative selection.
  • positive or negative selection is accomplished by incubating cells with one or more antibodies or other binding agent that specifically bind to one or more surface markers expressed or expressed (marker "1" ) at a relatively higher level (marker hlgh ) on the positively or negatively selected cells, respectively.
  • T cells are separated from a PBMC sample by negative selection of markers expressed on non-T cells, such as B cells, monocytes, or other white blood cells, such as CD 14.
  • a CD4 + or CD8 + selection step is used to separate CD4 + helper and CD8 + cytotoxic T cells.
  • Such CD4 + and CD8 + populations can be further sorted into sub-populations by positive or negative selection for markers expressed or expressed to a relatively higher degree on one or more naive, memory, and/or effector T cell subpopulations.
  • CD8 + cells are further enriched for or depleted of naive, central memory, effector memory, and/or central memory stem cells, such as by positive or negative selection based on surface antigens associated with the respective subpopulation.
  • enrichment for central memory T (T CM ) cells is carried out to increase efficacy, such as to improve long-term survival, expansion, and/or engraftment following administration, which in some aspects is particularly robust in such sub-populations. See Terakura et al. (2012) Blood.1:72-82; Wang et al. (2012) J Immunother. 35(9):689-701.
  • combining TcM-enriched CD8 + T cells and CD4 + T cells further enhances efficacy.
  • memory T cells are present in both CD62L + and CD62L " subsets of CD8 + peripheral blood lymphocytes.
  • PBMC can be enriched for or depleted of CD62L " CD8 + and/or CD62L + CD8 + fractions, such as using anti-CD8 and anti-CD62L antibodies.
  • the enrichment for central memory T (T CM ) cells is based on positive or high surface expression of CD45RO, CD62L, CCR7, CD28, CD3, and/or CD 127; in some aspects, it is based on negative selection for cells expressing or highly expressing
  • isolation of a CD8 + population enriched for T CM cells is carried out by depletion of cells expressing CD4, CD 14, CD45RA, and positive selection or enrichment for cells expressing CD62L.
  • enrichment for central memory T (T CM ) cells is carried out starting with a negative fraction of cells selected based on CD4 expression, which is subjected to a negative selection based on expression of CD 14 and
  • CD45RA and a positive selection based on CD62L. Such selections in some aspects are carried out simultaneously and in other aspects are carried out sequentially, in either order.
  • the same CD4 expression-based selection step used in preparing the CD8 + cell population or subpopulation also is used to generate the CD4 + cell population or sub- population, such that both the positive and negative fractions from the CD4-based separation are retained and used in subsequent steps of the methods, optionally following one or more further positive or negative selection steps.
  • a sample of PBMCs or other white blood cell sample is subjected to selection of CD4 + cells, where both the negative and positive fractions are retained.
  • the negative fraction then is subjected to negative selection based on expression of CD 14 and CD45RA or CD 19, and positive selection based on a marker characteristic of central memory T cells, such as CD62L or CCR7, where the positive and negative selections are carried out in either order.
  • CD4 + T helper cells are sorted into naive, central memory, and effector cells by identifying cell populations that have cell surface antigens.
  • CD4 + lymphocytes can be obtained by standard methods.
  • naive CD4 + T lymphocytes are CD45RO " , CD45RA + , CD62L + , CD4 + T cells.
  • central memory CD4 + cells are CD62L + and CD45RO + .
  • effector CD4 + cells are CD62L " and CD45RO " .
  • a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CDl lb, CD16, HLA-DR, and CD8.
  • the antibody or binding partner is bound to a solid support or matrix, such as a magnetic bead or paramagnetic bead, to allow for separation of cells for positive and/or negative selection.
  • the cells and cell populations are separated or isolated using immunomagnetic (or affinitymagnetic) separation techniques (reviewed in Methods in Molecular Medicine, vol. 58: Metastasis Research
  • the sample or composition of cells to be separated is incubated with small, magnetizable or magnetically responsive material, such as magnetically responsive particles or microparticles, such as paramagnetic beads (e.g., such as Dynalbeads or MACS beads).
  • the magnetically responsive material, e.g., particle generally is directly or indirectly attached to a binding partner, e.g., an antibody, that specifically binds to a molecule, e.g., surface marker, present on the cell, cells, or population of cells that it is desired to separate, e.g., that it is desired to negatively or positively select.
  • a binding partner e.g., an antibody
  • the magnetic particle or bead comprises a magnetically responsive material bound to a specific binding member, such as an antibody or other binding partner.
  • a specific binding member such as an antibody or other binding partner.
  • Suitable magnetic particles include those described in Molday, U.S. Pat. No. 4,452,773, and in European Patent Specification EP 452342 B, which are hereby incorporated by reference.
  • Colloidal sized particles such as those described in Owen U.S. Pat. No. 4,795,698, and Liberti et al., U.S. Pat. No. 5,200,084 are other examples.
  • the incubation generally is carried out under conditions whereby the antibodies or binding partners, or molecules, such as secondary antibodies or other reagents, which specifically bind to such antibodies or binding partners, which are attached to the magnetic particle or bead, specifically bind to cell surface molecules if present on cells within the sample.
  • the antibodies or binding partners, or molecules such as secondary antibodies or other reagents, which specifically bind to such antibodies or binding partners, which are attached to the magnetic particle or bead, specifically bind to cell surface molecules if present on cells within the sample.
  • the sample is placed in a magnetic field, and those cells having magnetically responsive or magnetizable particles attached thereto will be attracted to the magnet and separated from the unlabeled cells.
  • those cells having magnetically responsive or magnetizable particles attached thereto will be attracted to the magnet and separated from the unlabeled cells.
  • positive selection cells that are attracted to the magnet are retained; for negative selection, cells that are not attracted (unlabeled cells) are retained.
  • a combination of positive and negative selection is performed during the same selection step, where the positive and negative fractions are retained and further processed or subject to further separation steps.
  • the magnetically responsive particles are coated in primary antibodies or other binding partners, secondary antibodies, lectins, enzymes, or streptavidin.
  • the magnetic particles are attached to cells via a coating of primary antibodies specific for one or more markers.
  • the cells, rather than the beads are labeled with a primary antibody or binding partner, and then cell-type specific secondary antibody- or other binding partner (e.g., streptavidin)-coated magnetic particles, are added.
  • streptavidin-coated magnetic particles are used in conjunction with biotinylated primary or secondary antibodies.
  • the magnetically responsive particles are left attached to the cells that are to be subsequently incubated, cultured and/or engineered; in some aspects, the particles are left attached to the cells for administration to a patient.
  • the magnetizable or magnetically responsive particles are removed from the cells. Methods for removing magnetizable particles from cells are known and include, e.g., the use of competing non-labeled antibodies, and magnetizable particles or antibodies conjugated to cleavable linkers. In some embodiments, the magnetizable particles are biodegradable.
  • the affinity-based selection is via magnetic-activated cell sorting (MACS) (Miltenyi Biotech, Auburn, CA). Magnetic Activated Cell Sorting (MACS) systems are capable of high-purity selection of cells having magnetized particles attached thereto.
  • MACS operates in a mode wherein the non-target and target species are sequentially eluted after the application of the external magnetic field. That is, the cells attached to magnetized particles are held in place while the unattached species are eluted. Then, after this first elution step is completed, the species that were trapped in the magnetic field and were prevented from being eluted are freed in some manner such that they can be eluted and recovered.
  • the non-target cells are labelled and depleted from the heterogeneous population of cells.
  • the isolation or separation is carried out using a system, device, or apparatus that carries out one or more of the isolation, cell preparation, separation, processing, incubation, culture, and/or formulation steps of the methods.
  • the system is used to carry out each of these steps in a closed or sterile environment, for example, to minimize error, user handling and/or contamination.
  • the system is a system as described in International Patent Application, Publication Number WO2009/072003, or US 20110003380 Al.
  • the system or apparatus carries out one or more, e.g., all, of the isolation, processing, engineering, and formulation steps in an integrated or self-contained system, and/or in an automated or programmable fashion.
  • the system or apparatus includes a computer and/or computer program in communication with the system or apparatus, which allows a user to program, control, assess the outcome of, and/or adjust various aspects of the processing, isolation, engineering, and formulation steps.
  • the separation and/or other steps is carried out using CliniMACS system (Miltenyi Biotic), for example, for automated separation of cells on a clinical-scale level in a closed and sterile system.
  • Components can include an integrated microcomputer, magnetic separation unit, peristaltic pump, and various pinch valves.
  • the integrated computer in some aspects controls all components of the instrument and directs the system to perform repeated procedures in a standardized sequence.
  • the magnetic separation unit in some aspects includes a movable permanent magnet and a holder for the selection column.
  • the peristaltic pump controls the flow rate throughout the tubing set and, together with the pinch valves, ensures the controlled flow of buffer through the system and continual suspension of cells.
  • the CliniMACS system in some aspects uses antibody-coupled magnetizable particles that are supplied in a sterile, non-pyrogenic solution.
  • the cells after labelling of cells with magnetic particles the cells are washed to remove excess particles.
  • a cell preparation bag is then connected to the tubing set, which in turn is connected to a bag containing buffer and a cell collection bag.
  • the tubing set consists of pre-assembled sterile tubing, including a pre-column and a separation column, and are for single use only. After initiation of the separation program, the system automatically applies the cell sample onto the separation column. Labelled cells are retained within the column, while unlabeled cells are removed by a series of washing steps.
  • the cell populations for use with the methods described herein are unlabeled and are not retained in the column. In some embodiments, the cell populations for use with the methods described herein are labeled and are retained in the column. In some embodiments, the cell populations for use with the methods described herein are eluted from the column after removal of the magnetic field, and are collected within the cell collection bag.
  • separation and/or other steps are carried out using the CliniMACS Prodigy system (Miltenyi Biotec).
  • the CliniMACS Prodigy system in some aspects is equipped with a cell processing unity that permits automated washing and
  • the CliniMACS Prodigy system can also include an onboard camera and image recognition software that determines the optimal cell fractionation endpoint by discerning the macroscopic layers of the source cell product. For example, peripheral blood is automatically separated into erythrocytes, white blood cells and plasma layers.
  • the CliniMACS Prodigy system can also include an integrated cell cultivation chamber which accomplishes cell culture protocols such as, e.g., cell differentiation and expansion, antigen loading, and long-term cell culture. Input ports can allow for the sterile removal and replenishment of media and cells can be monitored using an integrated microscope. See, e.g., Klebanoff et al. (2012) J Immunother. 35(9): 651-660, Terakura et al. (2012) Blood.1:72-82, and Wang et al. (2012) Immunother. 35(9):689-701.
  • a cell population described herein is collected and enriched (or depleted) via flow cytometry, in which cells stained for multiple cell surface markers are carried in a fluidic stream.
  • a cell population described herein is collected and enriched (or depleted) via preparative scale (FACS)-sorting.
  • a cell population described herein is collected and enriched (or depleted) by use of
  • MEMS microelectromechanical systems
  • FACS-based detection system see, e.g., WO 2010/033140, Cho et al. (2010) Lab Chip 10, 1567-1573; and Godin et al. (2008) J Biophoton. 1(5):355— 376.
  • cells can be labeled with multiple markers, allowing for the isolation of well-defined T cell subsets at high purity.
  • the antibodies or binding partners are labeled with one or more detectable marker, to facilitate separation for positive and/or negative selection.
  • separation may be based on binding to fluorescently labeled antibodies.
  • separation of cells based on binding of antibodies or other binding partners specific for one or more cell surface markers are carried in a fluidic stream, such as by fluorescence- activated cell sorting (FACS), including preparative scale (FACS) and/or
  • MEMS microelectromechanical systems
  • the preparation methods include steps for freezing, e.g., cryopreserving, the cells, either before or after isolation, incubation, and/or engineering.
  • the freeze and subsequent thaw step removes granulocytes and, to some extent, monocytes in the cell population.
  • the cells are suspended in a freezing solution, e.g., following a washing step to remove plasma and platelets. Any of a variety of known freezing solutions and parameters in some aspects may be used.
  • a freezing solution e.g., following a washing step to remove plasma and platelets.
  • Any of a variety of known freezing solutions and parameters in some aspects may be used.
  • PBS containing 20% DMSO and 8% human serum albumin (HSA), or other suitable cell freezing media. This is then diluted 1 : 1 with media so that the final concentration of DMSO and HSA are 10% and 4%, respectively.
  • the cells are generally then frozen to -80° C. at a rate of 1° per minute and stored in the vapor phase of a liquid
  • the cells are incubated and/or cultured prior to or in connection with genetic engineering.
  • the incubation steps can include culture, cultivation, stimulation, activation, and/or propagation.
  • the incubation and/or engineering may be carried out in a culture vessel, such as a unit, chamber, well, column, tube, tubing set, valve, vial, culture dish, bag, or other container for culture or cultivating cells.
  • the compositions or cells are incubated in the presence of stimulating conditions or a stimulatory agent. Such conditions include those designed to induce proliferation, expansion, activation, and/or survival of cells in the population, to mimic antigen exposure, and/or to prime the cells for genetic engineering, such as for the introduction of a recombinant antigen receptor.
  • the conditions can include one or more of particular media, temperature, oxygen content, carbon dioxide content, time, agents, e.g., nutrients, amino acids, antibiotics, ions, and/or stimulatory factors, such as cytokines, chemokines, antigens, binding partners, fusion proteins, recombinant soluble receptors, and any other agents designed to activate the cells.
  • the stimulating conditions or agents include one or more agent, e.g., ligand, which is capable of activating an intracellular signaling domain of a TCR complex.
  • the agent turns on or initiates TCR/CD3 intracellular signaling cascade in a T cell.
  • Such agents can include antibodies, such as those specific for a TCR, e.g. anti-CD3.
  • the stimulating conditions include one or more agent, e.g. ligand, which is capable of stimulating a costimulatory receptor, e.g., anti-CD28.
  • agents and/or ligands may be, bound to solid support such as a bead, and/or one or more cytokines.
  • the expansion method may further comprise the step of adding anti-CD3 and/or anti CD28 antibody to the culture medium (e.g., at a concentration of at least about 0.5 ng/ml).
  • the stimulating agents include IL-2, IL-15 and/or IL-7. In some aspects, the IL-2 concentration is at least about 10 units/mL.
  • incubation is carried out in accordance with techniques such as those described in US Patent No. 6,040,177 to Riddell et al., Klebanoff et al.(2012) J
  • the T cells are expanded by adding to a culture-initiating composition feeder cells, such as non-dividing peripheral blood mononuclear cells (PBMC), (e.g., such that the resulting population of cells contains at least about 5, 10, 20, or 40 or more PBMC feeder cells for each T lymphocyte in the initial population to be expanded); and incubating the culture (e.g. for a time sufficient to expand the numbers of T cells).
  • PBMC peripheral blood mononuclear cells
  • the non-dividing feeder cells can comprise gamma-irradiated PBMC feeder cells.
  • the PBMC are irradiated with gamma rays in the range of about 3000 to 3600 rads to prevent cell division.
  • the feeder cells are added to culture medium prior to the addition of the populations of T cells.
  • the stimulating conditions include temperature suitable for the growth of human T lymphocytes, for example, at least about 25 degrees Celsius, generally at least about 30 degrees, and generally at or about 37 degrees Celsius.
  • the incubation may further comprise adding non-dividing EBV-transformed lymphoblastoid cells (LCL) as feeder cells.
  • LCL can be irradiated with gamma rays in the range of about 6000 to 10,000 rads.
  • the LCL feeder cells in some aspects is provided in any suitable amount, such as a ratio of LCL feeder cells to initial T lymphocytes of at least about 10: 1.
  • antigen-specific T cells such as antigen-specific CD4+ and/or CD8+ T cells
  • antigen-specific T cell lines or clones can be generated to cytomegalovirus antigens by isolating T cells from infected subjects and stimulating the cells in vitro with the same antigen.
  • the dose of cells comprising cells engineered with a recombinant antigen receptor is provided as a composition or formulation, such as a pharmaceutical composition or formulation.
  • a composition or formulation such as a pharmaceutical composition or formulation.
  • Such compositions can be used in accord with the provided methods, such as in the prevention or treatment of diseases, conditions, and disorders, or in detection, diagnostic, and prognostic methods.
  • composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • a "pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject.
  • a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
  • the choice of carrier is determined in part by the particular cell or agent and/or by the method of administration. Accordingly, there are a variety of suitable formulations.
  • the pharmaceutical composition can contain preservatives. Suitable preservatives may include, for example, methylparaben, propylparaben, sodium benzoate, and benzalkonium chloride. In some aspects, a mixture of two or more preservatives is used. The preservative or mixtures thereof are typically present in an amount of about 0.0001% to about 2% by weight of the total composition. Carriers are described, e.g., by Remington's
  • Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins;
  • hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other
  • carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG).
  • chelating agents such as EDTA
  • sugars such as sucrose, mannitol, trehalose or sorbitol
  • salt-forming counter-ions such as sodium
  • metal complexes e.g. Zn-protein complexes
  • non-ionic surfactants such as polyethylene glycol (PEG).
  • Buffering agents in some aspects are included in the compositions. Suitable buffering agents include, for example, citric acid, sodium citrate, phosphoric acid, potassium phosphate, and various other acids and salts. In some aspects, a mixture of two or more buffering agents is used. The buffering agent or mixtures thereof are typically present in an amount of about 0.001% to about 4% by weight of the total composition. Methods for preparing administrable pharmaceutical compositions are known. Exemplary methods are described in more detail in, for example, Remington: The Science and Practice of Pharmacy, Lippincott Williams & Wilkins; 21st ed. (May 1, 2005).
  • the formulation or composition may also contain more than one active ingredient useful for the particular indication, disease, or condition being prevented or treated with the cells or agents, where the respective activities do not adversely affect one another.
  • active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
  • the pharmaceutical composition further includes other pharmaceutically active agents or drugs, such as chemotherapeutic agents, e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc.
  • chemotherapeutic agents e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rit
  • the agents or cells are administered in the form of a salt, e.g., a pharmaceutically acceptable salt.
  • Suitable pharmaceutically acceptable acid addition salts include those derived from mineral acids, such as hydrochloric, hydrobromic, phosphoric, metaphosphoric, nitric, and sulphuric acids, and organic acids, such as tartaric, acetic, citric, malic, lactic, fumaric, benzoic, glycolic, gluconic, succinic, and arylsulphonic acids, for example, p-toluenesulphonic acid.
  • Active ingredients may be entrapped in microcapsules, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • the pharmaceutical composition is formulated as an inclusion complex, such as cyclodextrin inclusion complex, or as a liposome.
  • Liposomes can serve to target the agent or host cells (e.g., T-cells or NK cells) to a particular tissue.
  • Many methods are available for preparing liposomes, such as those described in, for example, Szoka et al., Ann. Rev. Biophys. Bioeng., 9: 467 (1980), and U.S. Patents 4,235,871, 4,501,728, 4,837,028, and 5,019,369.
  • the pharmaceutical composition in some aspects can employ time-released, delayed release, and sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated.
  • time-released, delayed release, and sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated.
  • release delivery systems are available and known. Such systems can avoid repeated
  • the pharmaceutical composition in some embodiments contains agents or cells in amounts effective to treat or prevent the disease or condition, such as a therapeutically effective or prophylactic ally effective amount.
  • agents or cells in amounts effective to treat or prevent the disease or condition, such as a therapeutically effective or prophylactic ally effective amount.
  • embodiments is monitored by periodic assessment of treated subjects. For repeated
  • the desired dosage can be delivered by a single bolus administration of the composition, by multiple bolus administrations of the composition, or by continuous infusion administration of the composition.
  • the agents or cells can be administered by any suitable means, for example, by bolus infusion, by injection, e.g., intravenous or subcutaneous injections, intraocular injection, periocular injection, subretinal injection, intravitreal injection, trans-septal injection, subscleral injection, intrachoroidal injection, intracameral injection, subconjectval injection, subconjuntival injection, sub-Tenon's injection, retrobulbar injection, peribulbar injection, or posterior juxtascleral delivery. In some embodiments, they are administered by parenteral,
  • intrapulmonary, and intranasal and, if desired for local treatment, intralesional administration.
  • Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
  • a given dose is administered by a single bolus administration of the cells or agent. In some embodiments, it is administered by multiple bolus administrations of the cells or agent, for example, over a period of no more than 3 days, or by continuous infusion administration of the cells or agent.
  • the appropriate dosage may depend on the type of disease to be treated, the type of agent or agents, the type of cells or recombinant receptors, the severity and course of the disease, whether the agent or cells are administered for preventive or therapeutic purposes, previous therapy, the subject's clinical history and response to the agent or the cells, and the discretion of the attending physician.
  • the compositions are in some embodiments suitably administered to the subject at one time or over a series of treatments.
  • the cells or agents may be administered using standard administration techniques, formulations, and/or devices. Provided are formulations and devices, such as syringes and vials, for storage and administration of the compositions. With respect to cells, administration can be autologous or heterologous.
  • immunoresponsive cells or progenitors can be obtained from one subject, and administered to the same subject or a different, compatible subject.
  • Peripheral blood derived immunoresponsive cells or their progeny e.g., in vivo, ex vivo or in vitro derived
  • a therapeutic composition e.g., a pharmaceutical composition containing a genetically modified immunoresponsive cell or an agent that treats or ameliorates symptoms of neurotoxicity
  • a therapeutic composition e.g., a pharmaceutical composition containing a genetically modified immunoresponsive cell or an agent that treats or ameliorates symptoms of neurotoxicity
  • it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion).
  • Formulations include those for oral, intravenous, intraperitoneal, subcutaneous, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository
  • the agent or cell populations are administered.
  • the agent or cell populations are administered.
  • parenterally includes intravenous, intramuscular, subcutaneous, rectal, vaginal, and intraperitoneal administration.
  • the agent or cell populations are administered to a subject using peripheral systemic delivery by intravenous, intraperitoneal, or subcutaneous injection.
  • compositions in some embodiments are provided as sterile liquid preparations, e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may in some aspects be buffered to a selected pH.
  • sterile liquid preparations e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may in some aspects be buffered to a selected pH.
  • Liquid preparations are normally easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions are somewhat more convenient to administer, especially by injection. Viscous compositions, on the other hand, can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues.
  • Liquid or viscous compositions can comprise carriers, which can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
  • carriers can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
  • Sterile injectable solutions can be prepared by incorporating the agent or cells in a solvent, such as in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like.
  • a suitable carrier such as sterile water, physiological saline, glucose, dextrose, or the like.
  • the compositions can also be lyophilized.
  • the compositions can contain auxiliary substances such as wetting, dispersing, or emulsifying agents (e.g., methylcellulose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired. Standard texts may in some aspects be consulted to prepare suitable preparations.
  • compositions including antimicrobial preservatives, antioxidants, chelating agents, and buffers, can be added.
  • antimicrobial preservatives for example, parabens, chlorobutanol, phenol, sorbic acid, and the like.
  • Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin.
  • Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
  • the formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
  • kits that include a composition comprising a therapeutically effective amount of any of the engineered cells described herein, and instructions for administering, to a subject for treating a disease or condition.
  • the instructions can specify some or all of the elements of the methods provided herein.
  • the instructions specify particular instructions for administration of the cells for cell therapy, e.g., doses, timing, selection and/or identification of subjects for administration and conditions for administration.
  • the articles of manufacture and/or kits further comprise an agent for lymphodepleting therapy, and optionally further includes instructions for administering the lymphodepleting therapy.
  • the instructions can be included as a label or package insert accompanying the compositions for administration.
  • the instructions specify the criteria for selection or
  • such criteria include subjects having a high-risk CLL.
  • the instructions specify the subject is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk CLL, optionally selected from among: complex karyotype, deletion of the long arm of chromosome 13 (del 13q), del 11, trisomy 12, del 17p, del 6q, and del 13q. l4, optionally as detected by FISH; the subject is or has been identified as having high-risk CLL; and/or the subject is or has been identified as having extramedullary disease; and/or the subject is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • the criteria for selection or identification include that the subjects have a high risk NHL.
  • the subject is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk CLL, optionally selected from among: complex karyotype, deletion of the long arm of chromosome 13 (del 13q),
  • abnormalities optionally associated with high-risk NHL
  • the subject is or has been identified as having high-risk NHL
  • the NHL is selected from the group consisting of aggressive NHL, diffuse large B cell lymphoma (DLBCL), primary mediastinal large B cell lymphoma
  • PMBCL T cell/histocyte-rich large B cell lymphoma
  • TCHRBCL T cell/histocyte-rich large B cell lymphoma
  • MCL mantle cell lymphoma
  • FL follicular lymphoma
  • the subject is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • the instructions specify that the subject is one that has received one or more previous or prior therapies for treating the leukemia, e.g. CLL or NHL, such as has received 2, 3, or 4 more prior therapies.
  • the instructions specify the subject is selected for treatment with the cell therapy, e.g. CAR+ T cells, if the subject is identified to be or likely to be refractory to and/or has relapsed after receiving one or more of such prior therapies.
  • the instructions specify the dose of cells to be administered.
  • the instructions specify the dose (i) comprises (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg, (c) no more than at or about 2 x 10 6 of the cells/kg, (d) no more than at or about 2 x 10 5 of the cells/kg and/or (e) between at or about 2 x 10 5 of the cells/kg and at or about 2 x 10 6 of the cells/kg.
  • the instructions specify particulars of the cell therapy, including the target of the cell therapy, e.g. that the cell therapy is a CD19-targeted cell therapy.
  • the instructions specify that the cell therapy includes
  • CAR+ engineered cells that comprise a defined ratio of CD4 + cells expressing the CAR to CD8 + cells expressing the CAR and/or of CD4 + cells to CD8 + cells, which ratio optionally is approximately 1: 1 or is between approximately 1:3 and approximately 3: 1.
  • the articles of manufacture and/or kits further include one or more additional agents for therapy, e.g., lymphodepleting therapy and/or combination therapy, as described herein, and optionally instructions for administering the additional agents.
  • the articles of manufacture and/or kits further include one or more reagents for assaying biological samples, e.g., biological samples from subjects who are candidates for administration or who have been administered the therapy, and optionally instructions for use of the reagents or assays.
  • the reagents can be used prior to the
  • the article of manufacture and/or kits further contain reagents for measuring the level of particular biomarkers, e.g., cytokines, that are associated with toxicity, and instructions for measuring.
  • the reagents include
  • components for performing an in vitro assay to measure the biomarkers such as an in vitro assay to measure the biomarkers
  • the in vitro assay is selected from among an enzyme linked immunosorbent assay (ELISA), immunoblotting, immunoprecipitation, radioimmunoassay (RIA), immunostaining, flow cytometry assay, surface plasmon resonance (SPR), chemiluminescence assay, lateral flow immunoassay, inhibition assay and avidity assay.
  • the reagent is a binding reagent that specifically binds the biomarkers.
  • the binding reagent is an antibody or antigen-binding fragment thereof, an aptamer or a nucleic acid probe.
  • the articles of manufacture and/or kits may include a container and a label or package insert on or associated with the container.
  • Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container in some embodiments holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition.
  • the container has a sterile access port.
  • Exemplary containers include an intravenous solution bags, vials, including those with stoppers pierceable by a needle for injection, or bottles or vials for orally administered agents.
  • the label or package insert may indicate that the composition is used for treating a disease or condition, such as a CLL or NHL.
  • the article of manufacture may include a container with a composition contained therein, wherein the composition includes engineered cells expressing a recombinant receptor; and, in some cases, one or more further containers with a composition contained therein, wherein the composition includes one or more further agent or agents.
  • the article of manufacture may further include a package insert indicating that the compositions can be used to treat a particular condition.
  • the article of manufacture may further include another or the same container comprising a pharmaceutically- acceptable buffer. It may further include other materials such as other buffers, diluents, filters, needles, and/or syringes.
  • CAR chimeric antigen receptor
  • the subject is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk CLL, optionally selected from among: complex karyotype, deletion of the long arm of chromosome 13 (del 13q), del 11, trisomy 12, del 17p, del 6q, and del 13q. l4, optionally as detected by FISH;
  • the subject is or has been identified as having high-risk CLL; and/or
  • the subject is or has been identified as having extramedullary disease; and/or
  • the subject is or has been identified as having central nervous system (CNS) disease; and/or
  • the subject is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • the subject has been treated with two or more, optionally 3, 4, 5, 6, 7, 8, or 9 or more, therapies for the CLL, other than the lymphodepleting therapy and/or other than another dose of cells expressing the CAR.
  • the subject has been treated with two or more, optionally 3, 4, 5, 6, 7, 8, or 9 or more, therapies for the CLL, other than another dose of cells expressing the CAR or other than another dose of cells expressing the CAR and the preconditioning therapy.
  • (i) further comprises administering another chemotherapeutic agent other than the fludarabine, which optionally is cyclophosphamide;
  • (ii) is initiated at a time that is at least at or about 48 hours prior to or is between at or about 48 and at or about 96 hours prior to the administration of the cells;
  • (iii) comprises the administration of cyclophosphamide at about 30-60 mg/kg, optionally once daily for one or two days, and/or the fludarabine at about 25 mg/m , daily for 3-5 days.
  • the dose of cells comprises a defined ratio of CD4+ cells expressing the CAR to CD8+ cells expressing the CAR and/or of CD4+ cells to CD8+ cells, which optionally is approximately 1: 1 or is between approximately 1:3 and approximately 3: 1.
  • the subject exhibits CR, OR, or lymph nodes of less than at or about 20 mm in size, within 1 month of the administration of the dose of cells; and/or wherein a malignant immunoglobulin heavy chain (IGH) locus and/or an index clone of the CLL is not detected in the bone marrow of the subject (or in the bone marrow of greater than 50% of subjects treated according to the methods), optionally as assessed by IGH deep sequencing, optionally at a time that is at or about or at least at or about 1, 2, 3, 4, 5, 6, 12, 18, or 24 months following the administration of the cell dose.
  • IGH immunoglobulin heavy chain
  • CR complete remission
  • PFS progression-free survival
  • OS overall survival
  • subjects treated according to the method exhibit a median PFS or OS of greater than at or about 6 months, 12 months, or 18 months;
  • the subject exhibits PFS or OS following therapy for at least at or about 6, 12, 18 or more months.
  • the CAR comprises an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta.
  • a method of treating a subject having a non-Hodgkin lymphoma comprising administering to the subject a dose of cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen expressed by the NHL, wherein:
  • said dose comprises (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg, (c) no more than at or about 2 x 10 6 of the cells/kg, (d) no more than at or about 2 x 10 5 of the cells/kg and/or (e) between at or about 2 x 10 5 of the cells/kg and at or about 2 x 10 6 of the cells/kg, and (ii) comprises a defined ratio of CD4 + cells expressing the CAR to CD8 + cells expressing the CAR and/or of CD4 + cells to CD8 + cells, which ratio optionally is approximately 1: 1 or is between approximately 1:3 and approximately 3: 1, wherein, prior to the administration, the subject has been preconditioned with a lymphodepleting therapy comprising the administration of fludarabine.
  • a method of treating a subject having a non-Hodgkin lymphoma comprising administering to the subject a dose of cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen expressed by the NHL, wherein:
  • said dose comprises (a) at or about 1 x 10 total cells or total CAR-expressing cells; (b) at or about 1.5 x 10 total cells or total CAR-expressing cells, (c) no more than at or about 1 x 10 7 total cells or total CAR-expressing cells, (d) no more than at or about 1.5 x 108 total cells or total CAR-expressing cells and/or (e) between at or about 1 x 10 total cells or total CAR- expressing cells and at or about 1.5 x 10 total cells or total CAR-expressing cells, and (ii) comprises a defined ratio of CD4 + cells expressing the CAR to CD8 + cells expressing the CAR and/or of CD4 + cells to CD8 + cells, which ratio optionally is approximately 1: 1 or is between approximately 1:3 and approximately 3: 1,
  • the subject has been preconditioned with a lymphodepleting therapy comprising the administration of fludarabine.
  • the subject is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk NHL;
  • the subject is or has been identified as having high-risk NHL; and/or
  • the NHL is selected from the group consisting of aggressive NHL, diffuse large B cell lymphoma (DLBCL), primary mediastinal large B cell lymphoma (PMBCL), T cell/histocyte- rich large B cell lymphoma (TCHRBCL), Burkitt's lymphoma, mantle cell lymphoma (MCL), and/or follicular lymphoma (FL); and/or
  • the subject is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • (i) further comprises administering another chemotherapeutic agent other than the fludarabine, which optionally is cyclophosphamide;
  • (ii) is initiated at a time that is at least at or about 48 hours prior to or is between at or about 48 and at or about 96 hours prior to the administration of the cells;
  • (iii) comprises the administration of cyclophosphamide at about 30-60 mg/kg, optionally once daily for one or two days, and/or the fludarabine at about 25 mg/m , daily for 3-5 days.
  • the defined ratio is a defined ratio of CD4+ cells expressing the CAR to CD8+ cells expressing the CAR of at or about 1: 1 and/or is a defined ratio of CD4+ cells to CD8+ cells, which is at or about 1: 1.
  • subjects treated according to the method exhibit a median PFS or OS of greater than at or about 6 months, 12 months, or 18 months;
  • the subject exhibits PFS or OS following therapy for at least at or about 6, 12, 18 or more months.
  • the CAR comprises an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta.
  • the CAR comprises, in order, an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is or comprises a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta signaling domain; or
  • the CAR comprises, in order, an scFv specific for the antigen, a spacer, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is or comprises a CD3zeta signaling domain;
  • the spacer is optionally a polypeptide spacer that (a) comprises or consists of all or a portion of an immunoglobulin hinge or a modified version thereof or comprises about 15 amino acids or less, and does not comprise a CD28 extracellular region or a CD8 extracellular region, (b) comprises or consists of all or a portion of an immunoglobulin hinge, optionally an IgG4 hinge, or a modified version thereof and/or comprises about 15 amino acids or less, and does not comprise a CD28 extracellular region or a CD8 extracellular region, or (c) is at or about 12 amino acids in length and/or comprises or consists of all or a portion of an immunoglobulin hinge, optionally an IgG4, or a modified version thereof; or (d) has or consists of the sequence of SEQ ID NO: 1, a sequence encoded by SEQ ID NO: 2, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID 0:N 34, or a variant of
  • the costimulatory domain comprises SEQ ID NO: 12 or a variant thereof having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity thereto; and/or the primary signaling domain comprises SEQ ID NO: 13 or 14 or 15 having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity thereto; and/or
  • the scFv comprises a CDRL1 sequence of RASQDISKYLN (SEQ ID NO: 35), a CDRL2 sequence of SRLHSGV (SEQ ID NO: 36), and/or a CDRL3 sequence of GNTLPYTFG (SEQ ID NO: 37) and/or a CDRHl sequence of DYGVS (SEQ ID NO: 38), a CDRH2 sequence of VIWGSETTYYNSALKS (SEQ ID NO: 39), and/or a CDRH3 sequence of YAMDYWG (SEQ ID NO: 40) or wherein the scFv comprises a variable heavy chain region of FMC63 and a variable light chain region of FMC63 and/or a CDRL1 sequence of FMC63, a CDRL2 sequence of FMC63, a CDRL3 sequence of FMC63, a CDRHl sequence of FMC63, a CDRH2 sequence of FMC63, and a CDRH3 sequence of FMC63 or binds to the same epi
  • a method of prognosis comprising detecting the presence or absence of a malignant immunoglobulin heavy chain (IGH) locus sequence in a sample from a subject having a B cell malignancy, said subject having previously received administration of a cell therapy comprising a dose or composition of genetically engineered cells expressing a recombinant receptor for treating the B cell malignancy, wherein detecting the presence or absence of the malignant IGH sequence determines the prognosis of the subject in response to the cell therapy.
  • IGH immunoglobulin heavy chain
  • a method of predicting durability of response to a cell therapy comprising detecting the presence or absence of a malignant immunoglobulin heavy chain locus (IGH) sequence in a sample from a subject having a B cell malignancy, said subject having previously received administration of a cell therapy comprising a dose or composition of genetically engineered cells expressing a recombinant receptor for treating the B cell
  • IGH immunoglobulin heavy chain locus
  • B cell malignancy is selected from and/or is acute lymphoblastic leukemia (ALL), adult ALL, chronic lymphoblastic leukemia (CLL), non-Hodgkin lymphoma (NHL), and Diffuse Large B-Cell Lymphoma
  • ALL acute lymphoblastic leukemia
  • CLL chronic lymphoblastic leukemia
  • NHL non-Hodgkin lymphoma
  • the NHL is selected from the group consisting of aggressive NHL, diffuse large B cell lymphoma (DLBCL), NOS (de novo and transformed from indolent), primary mediastinal large B cell lymphoma (PMBCL), T
  • TCHRBCL cell/histocyte-rich large B cell lymphoma
  • MCL mantle cell lymphoma
  • FL3B follicular lymphoma Grade 3B
  • the CAR comprises an extracellular antigen-recognition domain that specifically binds to the antigen and an intracellular signaling domain comprising an IT AM, wherein optionally, the intracellular signaling domain comprises an intracellular domain of a CD3-zeta ( ⁇ )3 ⁇ ) chain; and/or wherein the CAR further comprises a costimulatory signaling region, which optionally comprises a signaling domain of CD28 or 4- 1BB.
  • the CAR comprises an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta.
  • the CAR comprises, in order, an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is or comprises a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta signaling domain; or
  • the CAR comprises, in order, an scFv specific for the antigen, a spacer, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is or comprises a CD3zeta signaling domain; and wherein:
  • the spacer is optionally a polypeptide spacer that (a) comprises or consists of all or a portion of an immunoglobulin hinge or a modified version thereof or comprises about 15 amino acids or less, and does not comprise a CD28 extracellular region or a CD8 extracellular region, (b) comprises or consists of all or a portion of an immunoglobulin hinge, optionally an IgG4 hinge, or a modified version thereof and/or comprises about 15 amino acids or less, and does not comprise a CD28 extracellular region or a CD8 extracellular region, or (c) is at or about 12 amino acids in length and/or comprises or consists of all or a portion of an immunoglobulin hinge, optionally an IgG4, or a modified version thereof; or (d) has or consists of the sequence of SEQ ID NO: 1, a sequence encoded by SEQ ID NO: 2, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID 0:N 34, or a variant of
  • the costimulatory domain comprises SEQ ID NO: 12 or a variant thereof having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity thereto; and/or
  • the primary signaling domain comprises SEQ ID NO: 13 or 14 or 15 having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity thereto; and/or
  • the scFv comprises a CDRL1 sequence of RASQDISKYLN (SEQ ID NO: 35), a CDRL2 sequence of SRLHSGV (SEQ ID NO: 36), and/or a CDRL3 sequence of GNTLPYTFG (SEQ ID NO: 37) and/or a CDRH1 sequence of DYGVS (SEQ ID NO: 38), a CDRH2 sequence of VIWGSETTYYNSALKS (SEQ ID NO: 39), and/or a CDRH3 sequence of YAMDYWG (SEQ ID NO: 40) or wherein the scFv comprises a variable heavy chain region of FMC63 and a variable light chain region of FMC63 and/or a CDRL1 sequence of FMC63, a CDRL2 sequence of FMC63, a CDRL3 sequence of FMC63, a CDRH1 sequence of FMC63, a CDRH2 sequence of FMC63, and a CDRH3 sequence of FMC63 or binds to the same epi
  • T cells are primary T cells obtained from a subject.
  • An article of manufacture comprising one or more dose of a cell therapy, each dose comprising cells expressing a chimeric antigen receptor (CAR), and instructions for administering the cell therapy, wherein:
  • the instructions specify the dose of cells is to be administered to a subject having a chronic lymphocytic leukemia (CLL); and
  • the instructions specify administration of a number of CAR-expressing or a number of cells, or specify administration of an amount or volume of one or more formulations
  • the specified number of cells to be administered comprises a number to administer a dose of cells comprising (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg, (c) no more than at or about 2 x 10 6 of the cells/kg, (d) no more than at or about 2 x 10 5 of the cells/kg and/or (e) between at or about 2 x 10 5 of the cells/kg and at or about 2 x 10 6 of the cells/kg.
  • An article of manufacture comprising one or more dose of a cell therapy, each dose comprising cells expressing a chimeric antigen receptor (CAR), and instructions for administering the cell therapy, wherein:
  • the instructions specify the dose of cells is to be administered to a subject having a chronic lymphocytic leukemia (CLL); and
  • the instructions specify administration of a number of CAR-expressing or a number of cells, or specify administration of an amount or volume of one or more formulations
  • the specified number of cells to be administered comprises a number to administer a dose of cells comprising (a) at or about 1 x 10 7 total cells or total CAR-expressing cells; (b) at or about 1.5 x 108 total cells or total CAR-expressing cells, (c) no more than at or about 1 x 10 total cells or total CAR-expressing cells, (d) no more than at or about 1.5 x 10 total cells or total CAR-expressing cells and/or (e) between at or about 1 x 10 7 total cells or total CAR-expressing cells and at or about 1.5 x 108 total cells or total CAR-expressing cells.
  • cytogenetic abnormalities optionally associated with high-risk CLL, optionally selected from among: complex karyotype, deletion of the long arm of chromosome 13 (del 13q), del 11, trisomy 12, del 17p, del 6q, and del 13q. l4, optionally as detected by FISH;
  • CNS central nervous system
  • a kinase inhibitor optionally an inhibitor of Btk, optionally ibrutinib
  • HSCT hematopoietic stem cell transplantation
  • An article of manufacture comprising one or more dose of a cell therapy, each dose comprising cells expressing a chimeric antigen receptor (CAR), and instructions for administering the cell therapy, wherein:
  • the instructions specify the dose of cells is to be administered to a subject having a a non-Hodgkin lymphoma (NHL);
  • the instructions specify administration of a number of CAR-expressing or a number of cells, or specify administration of an amount or volume of one or more formulations corresponding to or containing said specified number of cells, wherein the specified number of cells to be administered comprises a number to administer a dose of cells comprising (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg, (c) no more than at or about 2 x 10 6 of the cells/kg, (d) no more than at or about 2 x 10 5 of the cells/kg and/or (e) between at or about 2 x 10 5 of the cells/kg and at or about 2 x 10 6 of the cells/kg.
  • An article of manufacture comprising one or more dose of a cell therapy, each dose comprising cells expressing a chimeric antigen receptor (CAR), and instructions for
  • the instructions specify the dose of cells is to be administered to a subject having a a non-Hodgkin lymphoma (NHL);
  • the instructions specify administration of a number of CAR-expressing or a number of cells, or specify administration of an amount or volume of one or more formulations corresponding to or containing said specified number of cells, wherein the specified number of cells to be administered comprises a number to administer a dose of cells comprising (a) at or about 1 x 10 7 total cells or total CAR-expressing cells; (b) at or about 1.5 x 108 total cells or total CAR-expressing cells, (c) no more than at or about 1 x 10 total cells or total CAR-expressing cells, (d) no more than at or about 1.5 x 10 total cells or total CAR-expressing cells and/or (e) between at or about 1 x 10 7 total cells or total CAR-expressing cells and at or about 1.5 x 108 total cells or total CAR-expressing cells.
  • cytogenetic abnormalities optionally associated with high-risk NHL
  • NHL diffuse large B cell lymphoma
  • PMBCL primary mediastinal large B cell lymphoma
  • TCHRBCL T cell/histocyte-rich large B cell lymphoma
  • FL follicular lymphoma
  • lymphodepleting therapy and/or other than another dose of cells expressing the CAR are included in the lymphodepleting therapy and/or other than another dose of cells expressing the CAR.
  • (i) further comprises administering another chemotherapeutic agent other than the fludarabine, which optionally is cyclophosphamide; and/or
  • (ii) comprises the administration of cyclophosphamide at about 30-60 mg/kg, optionally once daily for one or two days, and/or the fludarabine at about 25 mg/m , daily for 3- 5 days.
  • the CAR comprises, in order, an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is or comprises a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta signaling domain; or the CAR comprises, in order, an scFv specific for the antigen, a spacer, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is or comprises a CD3zeta signaling domain;
  • the spacer is optionally a polypeptide spacer that (a) comprises or consists of all or a portion of an immunoglobulin hinge or a modified version thereof or comprises about 15 amino acids or less, and does not comprise a CD28 extracellular region or a CD8 extracellular region, (b) comprises or consists of all or a portion of an immunoglobulin hinge, optionally an IgG4 hinge, or a modified version thereof and/or comprises about 15 amino acids or less, and does not comprise a CD28 extracellular region or a CD8 extracellular region, or (c) is at or about 12 amino acids in length and/or comprises or consists of all or a portion of an immunoglobulin hinge, optionally an IgG4, or a modified version thereof; or (d) has or consists of the sequence of SEQ ID NO: 1, a sequence encoded by SEQ ID NO: 2, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID 0:N 34, or a variant of
  • the costimulatory domain comprises SEQ ID NO: 12 or a variant thereof having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity thereto; and/or
  • the primary signaling domain comprises SEQ ID NO: 13 or 14 or 15 having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity thereto; and/or
  • the scFv comprises a CDRL1 sequence of RASQDISKYLN (SEQ ID NO: 35), a CDRL2 sequence of SRLHSGV (SEQ ID NO: 36), and/or a CDRL3 sequence of GNTLPYTFG (SEQ ID NO: 37) and/or a CDRH1 sequence of DYGVS (SEQ ID NO: 38), a CDRH2 sequence of VIWGSETTYYNSALKS (SEQ ID NO: 39), and/or a CDRH3 sequence of YAMDYWG (SEQ ID NO: 40) or wherein the scFv comprises a variable heavy chain region of FMC63 and a variable light chain region of FMC63 and/or a CDRL1 sequence of FMC63, a CDRL2 sequence of FMC63, a CDRL3 sequence of FMC63, a CDRH1 sequence of FMC63, a CDRH2 sequence of FMC63, and a CDRH3 sequence of FMC63 or binds to the same epi
  • a composition comprising cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen of a chronic lymphocytic leukemia (CLL) for use in treating a subject having or suspected of having CLL, wherein the treating comprises administering to the subject a dose of cells expressing the CAR, said dose comprising (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg, (c) no more than at or about 2 x 10 6 of the cells/kg, (d) no more than at or about 2 x 10 5 of the cells/kg and/or (e) between at or about 2 x 10 5 of the cells/kg and at or about 2 x 10 6 of the cells/kg,
  • CAR chimeric antigen receptor
  • the subject has been preconditioned with a lymphodepleting therapy comprising the administration of fludarabine.
  • a composition comprising cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen of a chronic lymphocytic leukemia (CLL) for use in treating a subject having or suspected of having CLL, wherein the treating comprises
  • a dose of cells expressing the CAR comprising (a) at or about 1 x 10 7 total cells or total CAR-expressing cells; (b) at or about 1.5 x 108 total cells or total CAR-expressing cells, (c) no more than at or about 1 x 10 total cells or total CAR-expressing cells, (d) no more than at or about 1.5 x 10 total cells or total CAR-expressing cells and/or (e) between at or about 1 x 10 7 total cells or total CAR-expressing cells and at or about 1.5 x 108 total cells or total CAR-expressing cells,
  • the subject has been preconditioned with a lymphodepleting therapy comprising the administration of fludarabine.
  • composition is for use in treating a subject in which, at or prior to the administration of the dose of cells:
  • the subject is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk CLL, optionally selected from among: complex karyotype, deletion of the long arm of chromosome 13 (del 13q), del 11, trisomy 12, del 17p, del 6q, and del 13q. l4, optionally as detected by FISH;
  • the subject is or has been identified as having high-risk CLL; and/or the subject is or has been identified as having extramedullar disease; and/or the subject is or has been identified as having central nervous system (CNS) disease; and/or
  • the subject is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • compositions 97-99 wherein the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated with two or more, optionally 3, 4, 5, 6, 7, 8, or 9 or more, therapies for the CLL, other than the lymphodepleting therapy and/or other than another dose of cells expressing the CAR.
  • compositions 97-100 wherein the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated with two or more, optionally 3, 4, 5, 6, 7, 8, or 9 or more, therapies for the CLL, other than another dose of cells expressing the CAR or other than another dose of cells expressing the CAR and the preconditioning therapy.
  • compositions 97-101 wherein the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated for the CLL with a kinase inhibitor, optionally an inhibitor of Btk, optionally ibrutinib.
  • compositions 97-102 wherein the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated for the CLL with a monoclonal antibody that specifically binds to an antigen expressed by, or previously expressed by, cells of the CLL.
  • compositions 97-102 wherein the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated for the CLL with venetoclax, a combination therapy comprising fludarabine and rituximab, radiation therapy and/or hematopoietic stem cell transplantation (HSCT).
  • a combination therapy comprising fludarabine and rituximab, radiation therapy and/or hematopoietic stem cell transplantation (HSCT).
  • HSCT hematopoietic stem cell transplantation
  • compositions 97-102 wherein the composition is for use in treating a subject in which, at or immediately prior to the time of the administration of the dose of cells, the subject has relapsed following remission after treatment with, or become refractory to, one or more prior therapies for the CLL.
  • a composition comprising cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen of a non-Hodgkin lymphoma (NHL) for use in treating a subject having or suspected of having NHL, wherein the treating comprises administering to the subject a dose of cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen expressed by the NHL, wherein the treating comprises administering to the subject a dose of cells expressing the CAR, said dose (i) comprises (a) at or about 2 x 10 5 of the cells per kilogram body weight of the subject (cells/kg); (b) at or about 2 x 10 6 of the cells/kg,
  • the subject has been preconditioned with a lymphodepleting therapy comprising the administration of fludarabine.
  • a composition comprising cells expressing a chimeric antigen receptor (CAR) that specifically binds to a target antigen of a non-Hodgkin lymphoma (NHL) for use in treating a subject having or suspected of having NHL, wherein the treating comprises administering to the subject a dose of cells expressing the CAR, said dose (i) comprises (a) at or about 1 x 10 total cells or total CAR-expressing cells; (b) at or about 1.5 x 10 total cells or total CAR- expressing cells, (c) no more than at or about 1 x 10 total cells or total CAR-expressing cells,
  • the subject has been preconditioned with a lymphodepleting therapy comprising the administration of fludarabine.
  • composition is for use in treating a subject in which, at or prior to the administration of the dose of cells:
  • the subject is or has been identified as having one or more cytogenetic abnormalities, optionally associated with high-risk NHL;
  • the subject is or has been identified as having high-risk NHL; and/or
  • the NHL is selected from the group consisting of aggressive NHL, diffuse large B cell lymphoma (DLBCL), primary mediastinal large B cell lymphoma (PMBCL), T cell/histocyte- rich large B cell lymphoma (TCHRBCL), Burkitt's lymphoma, mantle cell lymphoma (MCL), and/or follicular lymphoma (FL); and/or
  • the subject is an adult and/or is over at or about 30, 40, 50, 60, or 70 years of age.
  • compositions 106-108 wherein the composition is for use in treating a subject in which, prior to the administration of the dose of cells, the subject has been treated with two or more, optionally 2, 3, or 4 or more, therapies for the NHL other than the lymphodepleting therapy and/or other than another dose of cells expressing the CAR.
  • composition is for use in treating a subject in which, at or immediately prior to the time of the administration of the dose of cells, the subject has relapsed following remission after treatment with, or become refractory to, one or more prior therapies for the NHL.
  • (i) further comprises administration of another chemotherapeutic agent other than the fludarabine, which optionally is cyclophosphamide;
  • (ii) is initiated at a time that is at least at or about 48 hours prior to or is between at or about 48 and at or about 96 hours prior to the administration of the cells;
  • (iii) comprises the administration of cyclophosphamide at about 30-60 mg/kg, optionally once daily for one or two days, and/or the fludarabine at about 25 mg/m , daily for 3-5 days.
  • composition and/or the dose of cells comprises a defined ratio of CD4+ cells expressing the CAR to CD8+ cells expressing the CAR and/or of CD4+ cells to CD8+ cells, which optionally is approximately 1: 1 or is between approximately 1:3 and approximately 3: 1.
  • compositions 97-113 wherein the composition and/or dose of cells is formulated for parenteral administration, optionally intravenous administration.
  • the CAR comprises a spacer and/or hinge region, each optionally derived from a human IgG.
  • the CAR comprises, in order, an scFv specific for the antigen, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is or comprises a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is a CD3zeta signaling domain; or
  • the CAR comprises, in order, an scFv specific for the antigen, a spacer, a transmembrane domain, a cytoplasmic signaling domain derived from a costimulatory molecule, which optionally is a 4- IBB signaling domain, and a cytoplasmic signaling domain derived from a primary signaling ITAM-containing molecule, which optionally is or comprises a CD3zeta signaling domain;
  • the spacer is optionally a polypeptide spacer that (a) comprises or consists of all or a portion of an immunoglobulin hinge or a modified version thereof or comprises about 15 amino acids or less, and does not comprise a CD28 extracellular region or a CD8 extracellular region, (b) comprises or consists of all or a portion of an immunoglobulin hinge, optionally an IgG4 hinge, or a modified version thereof and/or comprises about 15 amino acids or less, and does not comprise a CD28 extracellular region or a CD8 extracellular region, or (c) is at or about 12 amino acids in length and/or comprises or consists of all or a portion of an immunoglobulin hinge, optionally an IgG4, or a modified version thereof; or (d) has or consists of the sequence of SEQ ID NO: 1, a sequence encoded by SEQ ID NO: 2, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID 0:N 34, or a variant of
  • the costimulatory domain comprises SEQ ID NO: 12 or a variant thereof having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity thereto; and/or the primary signaling domain comprises SEQ ID NO: 13 or 14 or 15 having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity thereto; and/or
  • the scFv comprises a CDRL1 sequence of RASQDISKYLN (SEQ ID NO: 35), a CDRL2 sequence of SRLHSGV (SEQ ID NO: 36), and/or a CDRL3 sequence of GNTLPYTFG (SEQ ID NO: 37) and/or a CDRHl sequence of DYGVS (SEQ ID NO: 38), a CDRH2 sequence of VIWGSETTYYNSALKS (SEQ ID NO: 39), and/or a CDRH3 sequence of YAMDYWG (SEQ ID NO: 40) or wherein the scFv comprises a variable heavy chain region of FMC63 and a variable light chain region of FMC63 and/or a CDRL1 sequence of FMC63, a CDRL2 sequence of FMC63, a CDRL3 sequence of FMC63, a CDRHl sequence of FMC63, a CDRH2 sequence of FMC63, and a CDRH3 sequence of FMC63 or binds to the same epi
  • polypeptide and “protein” are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length.
  • Polypeptides including the provided receptors and other polypeptides, e.g., linkers or peptides, may include amino acid residues including natural and/or non-natural amino acid residues.
  • the terms also include post-expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, and phosphorylation.
  • the polypeptides may contain modifications with respect to a native or natural sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR amplification.
  • a "subject" is a mammal, such as a human or other animal, and typically is human.
  • the subject e.g., patient, to whom the agent or agents, cells, cell populations, or compositions are administered, is a mammal, typically a primate, such as a human.
  • the primate is a monkey or an ape.
  • the subject can be male or female and can be any suitable age, including infant, juvenile, adolescent, adult, and geriatric subjects.
  • the subject is a non-primate mammal, such as a rodent.
  • treatment refers to complete or partial amelioration or reduction of a disease or condition or disorder, or a symptom, adverse effect or outcome, or phenotype associated therewith.
  • Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
  • the terms do not imply complete curing of a disease or complete elimination of any symptom or effect(s) on all symptoms or outcomes.
  • delay development of a disease means to defer, hinder, slow, retard, stabilize, suppress and/or postpone development of the disease (such as cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or individual being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.
  • Preventing includes providing prophylaxis with respect to the occurrence or recurrence of a disease in a subject that may be predisposed to the disease but has not yet been diagnosed with the disease.
  • the provided cells and compositions are used to delay development of a disease or to slow the progression of a disease.
  • a function or activity is to reduce the function or activity when compared to otherwise same conditions except for a condition or parameter of interest, or alternatively, as compared to another condition.
  • cells that suppress tumor growth reduce the rate of growth of the tumor compared to the rate of growth of the tumor in the absence of the cells.
  • an "effective amount" of an agent e.g., a pharmaceutical formulation, cells, or composition, in the context of administration, refers to an amount effective, at dosages/amounts and for periods of time necessary, to achieve a desired result, such as a therapeutic or
  • a "therapeutically effective amount" of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result, such as for treatment of a disease, condition, or disorder, and/or pharmacokinetic or pharmacodynamic effect of the treatment.
  • the therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of the subject, and the populations of cells administered.
  • the provided methods involve administering the cells and/or compositions at effective amounts, e.g., therapeutically effective amounts.
  • a “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount. In the context of lower tumor burden, the prophylactically effective amount in some aspects will be higher than the therapeutically effective amount.
  • a composition refers to any mixture of two or more products, substances, or compounds, including cells. It may be a solution, a suspension, liquid, powder, a paste, aqueous, non-aqueous or any combination thereof.
  • enriching when referring to one or more particular cell type or cell population, refers to increasing the number or percentage of the cell type or population, e.g., compared to the total number of cells in or volume of the composition, or relative to other cell types, such as by positive selection based on markers expressed by the population or cell, or by negative selection based on a marker not present on the cell population or cell to be depleted.
  • the term does not require complete removal of other cells, cell type, or populations from the composition and does not require that the cells so enriched be present at or even near 100% in the enriched composition.
  • a statement that a cell or population of cells is "positive" for a particular marker refers to the detectable presence on or in the cell of a particular marker, typically a surface marker.
  • a surface marker refers to the presence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is detectable by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control or fluorescence minus one (FMO) gating control under otherwise identical conditions and/or at a level substantially similar to that for cell known to be positive for the marker, and/or at a level substantially higher than that for a cell known to be negative for the marker.
  • FMO fluorescence minus one
  • a statement that a cell or population of cells is "negative" for a particular marker refers to the absence of substantial detectable presence on or in the cell of a particular marker, typically a surface marker.
  • a surface marker refers to the absence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is not detected by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control or fluorescence minus one (FMO) gating control under otherwise identical conditions, and/or at a level substantially lower than that for cell known to be positive for the marker, and/or at a level substantially similar as compared to that for a cell known to be negative for the marker.
  • FMO fluorescence minus one
  • vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked.
  • the term includes the vector as a self- replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
  • Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as "expression vectors.”
  • Autologous T cells expressing a chimeric antigen-receptor (CAR) specific for CD 19 were administered to thirteen (13) adult human subjects with relapsed or refractory (R/R) CD19 + chronic lymphocytic leukemia (CLL).
  • the subjects ranged in age from forty (40) to seventy- three (73), with an average age of sixty-one (61). No subjects were excluded based on lymphopenia, circulating tumor, prior transplant, or test expansion.
  • the group of subjects exhibited high-risk cytogenetics (10/13 (77%) dell7p; 8/13 (62%) complex karyotype); 12/13 (92%) exhibited extramedullary disease.
  • the CAR included an scFv (in a VL- linker- VH orientation) specific for CD 19, with variable regions derived from FMC63, an IgG hinge region, a transmembrane region, and intracellular signaling domains derived from human 4 IBB and CD3zeta.
  • the construct further encoded a truncated EGFR (EGFRt), which served as a surrogate marker for CAR expression; the EGFRt-coding region was separated from the CAR sequence by a T2A skip sequence.
  • EGFRt truncated EGFR
  • CD4+ and CD8+ populations were selected by immunoaffinity-based enrichment methods, transduced with a viral vector with the CAR construct, and expanded in culture over fifteen (15) days.
  • CD8+ central memory T cell populations were engineered, except bulk CD8+ T cells were engineered in in patients with severe lymphopenia resulting in a low CD8+ central memory T cells. No difference in clinical outcome was observed between patients who received CAR+ T cells manufactured from CD4+ T cells and either bulk CD8+ T cells or CD8+ central memory T cells.
  • cyclophosphamide Cy, 60 mg/kg in combination with fludarabine (flu, 25 mg/m daily for 3-5 days (cy/flu, 11/13 subjects).
  • Cells for administration generally were formulated at a CAR + CD4 + T cell to CAR + CD8 + T cell ratio of approximately 1: 1.
  • Therapeutic compositions were successfully produced for all subjects. For 1/13 subjects, fewer than the target dose (2xl0 6 /kg CAR+) of cells were produced.
  • Marrow response was assessed by bone marrow aspirate and biopsy obtained 4 weeks after CAR-T cell infusion in those with bone marrow disease prior to lymphodepletion and 4 weeks after administration of the CAR+ T cell composition. Morphology analysis and high-resolution flow cytometry were performed on the marrow, with conventional karyotyping and FISH in patients with an identified cytogenetic abnormality. IGH deep sequencing
  • Adaptive Biotechnologies was performed on marrow from patients who had no detectable marrow disease by flow cytometry 4 weeks after CAR-T cell infusion and had an identified malignant clonal sequence before lymphodepletion. High-resolution flow cytometry was performed on blood 2 weeks, and 1, 2, 3, 6 and 12 months after CAR-T cell infusion.
  • Toxicity was graded using the National Cancer Institute— Common Toxicity Criteria version 4.03 (NCI-CTCAE v4.03), except cytokine release syndrome was graded as described in Lee et al, Blood. 2014;124(2): 188-95.
  • the objective response rate (ORR) was 91% (10/11 subjects), and 10/11 subjects (91%) were observed to be negative for tumor cells in the bone marrow as measured by flow cytometry, and five (5) of the 11 (45%) were observed to achieve complete remission (CR) as measured by Lugano criteria.
  • the ORR was 50% (1/2 subjects), with 1 of the 2 subjects observed as negative for tumor cells in the bone marrow as measured by flow cytometry, but not observed to have achieved CR by Lugano criteria.
  • PR partial remission
  • max 17-18 mm lymph nodes were observed.
  • IGH deep sequencing of bone marrow was carried out after treatment. In 4/4 (100%) of these subjects, the index clone was not detected in the bone marrow.
  • PFS progression-free survival
  • OS overall survival
  • Autologous T cells expressing a chimeric antigen-receptor (CAR) specific for CD 19 were administered to forty-one (41) adult human subjects with CD19 + non-Hodgkin lymphoma (NHL).
  • the group of subject ranged in age from twenty-eight (28) to seventy (70), with an average age of fifty-six (56). No subjects were excluded based on lymphopenia, circulating tumor, prior transplant, or test expansion.
  • the group of subjects exhibited a number of disease types including aggressive NHL (30/41 subjects, including diffuse large B-cell lymphoma (DLBCL), primary mediastinal large B cell lymphoma (PMBCL), T cell/histocyte-rich large B cell lymphoma (TCHRBCL), and Burkitt lymphoma), mantle cell lymphoma (MCL; 5/41 subjects), and follicular lymphoma (FL; 6/41 subjects). All subjects had been previously treated, with a median number of four (4) prior treatments and a range of one (1) to eleven (11) prior treatments, among all subjects, and twenty-seven (27) subjects having been treated with greater than or equal to 4 prior therapies.
  • HSCT auto- and/or alio- hematopoietic stem cell transplantation
  • the CAR included an anti-CD 19 scFv (in a VL- linker- VH orientation) with variable regions derived from FMC63, an IgG hinge region, a transmembrane region derived from human CD28, and intracellular signaling domains derived from human 41BB and CD3zeta.
  • the construct further encoded a truncated EGFR (EGFRt), which served as a surrogate marker for CAR expression; the EGFRt-coding region was separated from the CAR sequence by a T2A skip sequence.
  • EGFRt truncated EGFR
  • CD4+ and CD8+ populations were selected by immunoaffinity-based enrichment methods, transduced with a viral vector with the CAR construct, and expanded in culture over 15 days.
  • Cells for administration generally were formulated at a CD4 + T cell to CD8 + T cell ratio of approximately 1: 1, prior to administration. Therapeutic compositions were successfully produced for all subjects.
  • cyclophosphamide (Cy, 60 mg/kg) with or without etoposide (12/39 subjects), or (b) cyclophosphamide (Cy, 60 mg/kg) in combination with fludarabine (flu, 25 mg/m daily for 3-5 days (cy/flu, 27/39 subjects).
  • Lymphodepleting therapy and T cell infusions were administered out on an outpatient basis.
  • the maximum tolerated dose was dose level 2 (2xl0 6 CAR+ T cells per kg).
  • the ORR was 81% (13/16 subjects) and eight (8) subjects (50%) achieved CR.
  • Two (2) of the 6 subjects with FL were preconditioned with cy/flu and administered dose level 2.
  • the ORR was 50% (1/2) and 1 subject (50%) achieved CR.
  • Two (2) of the five (5) subjects with MCL were preconditioned with cy/flu and administered dose level 2.
  • the ORR was 100% (2/2) and 1 subject (50%) achieved CR.
  • PFS progression-free survival
  • OS overall survival
  • FIG. 2A and 2B Progression-free survival (PFS) and overall survival (OS) among the 20 subjects preconditioned with cyclophosphamide and fludarabine (cy/flu) and administered 2xl0 6 CAR+ T cells per kg are shown in FIG. 2A and 2B, with separate curves for subjects who achieved CR, versus those who did not.
  • Median PFS was not reached in the subjects who achieved CR; PFS ranged from 3 to 11+ months from first CAR+ T cell infusion.
  • Median PFS was 4.1 months in subjects who did not achieve CR.
  • Antigen-Receptor (CAR) Specific for CD19 Additional Patients
  • the subjects ranged in age from forty (40) to seventy-three (73), with a median age of sixty (60). Twelve (12) subjects had complex karyotype and eleven (11) subjects had 17p deletion. All subjects had extrameduUary disease and two (2) had central nervous system (CNS) disease. All subjects had been previously treated with one or more other therapies for CLL (with a median number of five (5), and a range of three (3) to nine (9), prior lines of treatment), including, in each case, ibrutinib (with eleven (11) (61%) having been refractory; three (3) (17%) having been intolerant). Three (3) (17%) subjects had failed prior allogeneic stem cell transplant and four (4) (22%) subjects were refractory to venetoclax.
  • the treated subjects received a lymphodepleting chemotherapy with either (a) cyclophosphamide 30-60 mg/kg x 1 in combination with fludarabine 25 mg/m 2 /day x 3 days (cy/flu, 15/18 subjects), (b) fludarabine 25 mg/m 2 /day x 3 days (flu, 2/18 subjects) or (c) cyclophosphamide 60 mg/kg (cy, 1/18 subjects).
  • Four (4) subjects with persistent disease received a second cycle of lymphodepletion chemotherapy and CAR+ T cells at a 10-fold higher dose than the first infusion.
  • the objective response rate was 76% (13/17 subjects; 8 with partial remission (PR) and 5 with complete remission (CR)).
  • PR partial remission
  • CR complete remission
  • two (2) subjects with PR based on the lymph node size criteria had negative PET scans after therapy.
  • the ORR was 77% (10/13 subjects, 7 PR and 3 CR).
  • the ORR was 50% (2/4 subjects, 2 PR).
  • the ORR was 33% (1/3 subjects).
  • Antigen-Receptor (CAR) Specific for CD19 Further Patients
  • the subjects ranged in age from 40 to 73, with a median age of 61.
  • Sixteen (16) subjects had complex karyotype and 14 subjects had 17p deletion.
  • Eight (8) subjects had high-risk histology.
  • Twenty-three (23) subjects had extramedullary disease. All subjects had been previously treated with one or more other therapies for CLL, with a median of 5 (range 3-9) prior lines of treatment, which included, in each case, treatment with ibrutinib (with 19 (79%) having been refractory; 3 (13%) having been intolerant).
  • the treated subjects received a lymphodepleting chemotherapy received either (a) cyclophosphamide 30-60 mg/kg (1-2 g/m ) x 1 in combination with fludarabine 25 mg/m /day x 3 days (cy/flu, 18/24 subjects), (b) cyclophosphamide 60
  • Subjects were assessed for response 4 weeks after the last CAR+ T cell infusion as described in Example 1.
  • the assessment of twenty-one (21) subjects receiving Cy/Flu lymphodepletion demonstrated high response rates in high-risk CLL patients at four weeks post- infusion as shown in Table 8.
  • Responses were measured in subjects by: (a) bone marrow analysis; (b) PET-CT; and (c) International Workshop Group on CLL (IWCLL) criteria.
  • CAR-T cells were detected in blood by flow cytometry in all patients to assess expansion and persistence. Among subjects who received
  • CAR-T cell expansion was also inversely correlated with immune checkpoint biomarkers PDL1 and PDL2. 2.
  • lymphodepletion and a single CD19 CAR-T cell infusion at ⁇ 2xl0 6 CAR-T cells/kg a lymph node response by IWCLL criteria was observed in 74% of patients (14/19) [95% confidence interval (CI): 49-91%]: 21% (4/19) CR; 53% (10/19) PR. Similar response rates were observed when considering only the 16 patients that were ibrutinib-refractory: 69% (11/16) ORR [95% CI: 41-89%]; 25% (4/26) CR).
  • lymph node response was also assessed by PET imaging 4 weeks after CAR-T cell infusion.
  • the CR rate in ibrutinib-refractory patients after PET-CT restaging was 64% (7/11) [95% CI: 31-89%], with a Deauville score of 1-2. More patients were staged as CR by PET-CT than by IWCLL (64% vs. 25%).
  • FISH and conventional karyotyping did not identify residual CLL in patients without detectable disease by flow cytometry; however, 2 patients had abnormalities considered to be due to the effects of prior chemotherapy on the myeloid lineage and one had a persistent constitutional translocation.
  • FIG. 6A Progression free survival (PFS) and overall survival (OS) for all CLL patients are shown in FIG. 5.
  • a lymph node response (CR/PR by rWCLL) was associated with longer PFS and OS compared to failure to respond (SD/PD).
  • FIG. 6B also depicts PFS and OS as measured by IWCLL among the same group of subjects as FIG. 6A, except excluding one patient that died prior to restaging. For both FIGS.
  • ICU intensive care unit
  • Intervention was initiated in patients with grade 2-3 cytokine release syndrome (Lee et al, Blood, 2014) that were not responding to intravenous fluids and/or low dose vasopressor support and grade 2-3 neurotoxicity.
  • ICU intensive care unit
  • 1 patient progressed to grade 3-4 CRS from day 4 that was refractory to tocilizumab and dexamethasone, developed cerebral edema on day 9 that was refractory to siltuximab and mannitol and died 11 days after CAR-T cell infusion.
  • No other patients developed greater than grade 2 CRS and only 4 patients developed grade 3 neurotoxicity.
  • Only 6/24 patients exhibited clinical symptoms sufficiently severe to require an intervention therapy, and CRS and neurotoxicity resolved in all patients treated according to these criteria, with the exception of the patient with fatal cerebral edema.
  • Elevated peak CD4+ or CD8+ CAR-T cell counts after infusion were associated with better bone marrow responses in high-risk CLL subjects as assessed by the presence (detected) or absence (none) of malignant IGH sequences in marrow 4 weeks after CAR-T cell infusion (FIG. 8).
  • Peak CD4 + /EGFRt + and CD8 + /EGFRt + CAR-T cell counts were higher in patients who ultimately cleared bone marrow by flow cytometry compared to those who failed to eliminate CLL from marrow (FIG.
  • CD47EGFRt + or CD87EGFRt + CAR-T cells in the blood (FIG. 10B).
  • the probability of bone marrow response increased then plateaued while the probability of developing a toxicity, Grade 3-5 neurotoxicity (FIG. 10A) or Grade 2-5 neurotoxicity or CRS (FIG. 10B) increased.
  • These curves demonstrate a therapeutic window of peak CD4+/EGFRt + and CD87EGFRt + CAR-T cell counts in which marrow clearance might be achieved in most patients without a high risk of neurotoxicity or CRS.
  • HTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEI IRGRTK QHGQFSLAVVSLNITSLGLRSLKEI SDGDVI ISGNKNLCYANTINWKKL artificial FGTSGQKTKI I SNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNV SRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDN CIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYG CTGPGLEGCPTNGPKIPSIATGMVGALLLLLWALGIGLFM
  • ACACGGCCTCGTGTATTACTGT exemplary degenerate sequence of the V region of IGH
  • Xi is glycine, cysteine or arginine
  • X 2 is cysteine or threonine

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Cell Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Oncology (AREA)
  • Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • General Engineering & Computer Science (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Mycology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2017/036231 2016-06-06 2017-06-06 Methods for the treatment of b cell malignancies using adoptive cell therapy Ceased WO2017214207A2 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
AU2017277396A AU2017277396B2 (en) 2016-06-06 2017-06-06 Methods for the treatment of B cell malignancies using adoptive cell therapy
JP2019516103A JP7139318B2 (ja) 2016-06-06 2017-06-06 養子細胞療法を用いてb細胞悪性腫瘍を処置するための方法
CA3024725A CA3024725A1 (en) 2016-06-06 2017-06-06 Methods for the treatment of b cell malignancies using adoptive cell therapy
EP17733663.3A EP3463437A2 (en) 2016-06-06 2017-06-06 Methods for the treatment of b cell malignancies using adoptive cell therapy
BR112018074406-9A BR112018074406A2 (pt) 2016-06-06 2017-06-06 métodos para o tratamento de malignidades de células b utilizando terapia celular adotiva
US16/307,462 US20200016199A1 (en) 2016-06-06 2017-06-06 Methods for the treatment of b cell malignancies using adoptive cell therapy
KR1020247007298A KR20240036704A (ko) 2016-06-06 2017-06-06 입양 세포 치료법을 이용한 b 세포 악성종양의 치료 방법
KR1020197000351A KR102540751B1 (ko) 2016-06-06 2017-06-06 입양 세포 치료법을 이용한 b 세포 악성종양의 치료 방법
MX2018014911A MX2018014911A (es) 2016-06-06 2017-06-06 Metodos para el tratamiento de afecciones malignas de celulas t usando terapia de celulas adoptivas.
KR1020237018556A KR102644950B1 (ko) 2016-06-06 2017-06-06 입양 세포 치료법을 이용한 b 세포 악성종양의 치료 방법
CN201780046873.8A CN109562151A (zh) 2016-06-06 2017-06-06 使用过继细胞疗法治疗b细胞恶性肿瘤的方法
JP2021199037A JP2022033929A (ja) 2016-06-06 2021-12-08 養子細胞療法を用いてb細胞悪性腫瘍を処置するための方法
JP2023189795A JP2023184646A (ja) 2016-06-06 2023-11-07 養子細胞療法を用いてb細胞悪性腫瘍を処置するための方法
US19/031,042 US20250197471A1 (en) 2016-06-06 2025-01-17 Methods for the treatment of b cell malignancies using adoptive cell therapy

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201662346547P 2016-06-06 2016-06-06
US62/346,547 2016-06-06
US201662417292P 2016-11-03 2016-11-03
US62/417,292 2016-11-03
US201662429737P 2016-12-03 2016-12-03
US62/429,737 2016-12-03

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/307,462 A-371-Of-International US20200016199A1 (en) 2016-06-06 2017-06-06 Methods for the treatment of b cell malignancies using adoptive cell therapy
US19/031,042 Continuation US20250197471A1 (en) 2016-06-06 2025-01-17 Methods for the treatment of b cell malignancies using adoptive cell therapy

Publications (3)

Publication Number Publication Date
WO2017214207A2 true WO2017214207A2 (en) 2017-12-14
WO2017214207A3 WO2017214207A3 (en) 2018-01-18
WO2017214207A8 WO2017214207A8 (en) 2018-11-29

Family

ID=59227902

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/036231 Ceased WO2017214207A2 (en) 2016-06-06 2017-06-06 Methods for the treatment of b cell malignancies using adoptive cell therapy

Country Status (11)

Country Link
US (2) US20200016199A1 (enExample)
EP (1) EP3463437A2 (enExample)
JP (3) JP7139318B2 (enExample)
KR (3) KR102540751B1 (enExample)
CN (1) CN109562151A (enExample)
AU (1) AU2017277396B2 (enExample)
BR (1) BR112018074406A2 (enExample)
CA (1) CA3024725A1 (enExample)
MA (1) MA45341A (enExample)
MX (2) MX2018014911A (enExample)
WO (1) WO2017214207A2 (enExample)

Cited By (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018085731A3 (en) * 2016-11-03 2018-07-12 Juno Therapeutics, Inc. Combination therapy of a t cell therapy and a btk inhibitor
WO2018170188A2 (en) 2017-03-14 2018-09-20 Juno Therapeutics, Inc. Methods for cryogenic storage
WO2019200347A1 (en) * 2018-04-13 2019-10-17 Fred Hutchinson Cancer Research Center Methods for adoptive cell therapy targeting ror1
WO2019213184A1 (en) * 2018-05-03 2019-11-07 Juno Therapeutics, Inc. Combination therapy of a chimeric antigen receptor (car) t cell therapy and a kinase inhibitor
US10507219B2 (en) 2014-10-20 2019-12-17 Juno Therapeutics, Inc. Methods and compositions for dosing in adoptive cell therapy
WO2020113188A3 (en) * 2018-11-30 2020-08-06 Juno Therapeutics, Inc. Methods for dosing and treatment of b cell malignancies in adoptive cell therapy
US10889652B2 (en) 2015-01-16 2021-01-12 Juno Therapeutics, Inc. Antibodies and chimeric antigen receptors specific for ROR1
US10968275B2 (en) 2016-02-02 2021-04-06 Fred Hutchinson Cancer Research Center Anti-ROR1 antibodies and uses thereof
WO2021113770A1 (en) * 2019-12-06 2021-06-10 Juno Therapeutics, Inc. Methods related to toxicity and response associated with cell therapy for treating b cell malignancies
WO2021151008A1 (en) * 2020-01-24 2021-07-29 Juno Therapuetics, Inc. Methods for dosing and treatment of follicular lymphoma and marginal zone lymphoma in adoptive cell therapy
WO2021163391A1 (en) * 2020-02-12 2021-08-19 Juno Therapeutics, Inc. Cd19-directed chimeric antigen receptor t cell compositions and methods and uses thereof
US11141436B2 (en) 2019-03-05 2021-10-12 Nkarta, Inc. Immune cells engineered to express CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
JP2022513685A (ja) * 2018-11-30 2022-02-09 ジュノー セラピューティクス インコーポレイテッド 養子細胞療法を用いた処置のための方法
WO2022254337A1 (en) * 2021-06-01 2022-12-08 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof
EP3873539A4 (en) * 2018-10-31 2023-01-18 The Children's Hospital of Philadelphia LYMPH-BASED T-CELLS FOR DIAGNOSTIC AND THERAPEUTIC USE
US11590167B2 (en) 2016-12-03 2023-02-28 Juno Therapeutic, Inc. Methods and compositions for use of therapeutic T cells in combination with kinase inhibitors
US11771718B2 (en) 2017-10-18 2023-10-03 Precigen, Inc. Polypeptide compositions comprising spacers
US11851679B2 (en) 2017-11-01 2023-12-26 Juno Therapeutics, Inc. Method of assessing activity of recombinant antigen receptors
US11944647B2 (en) 2017-06-02 2024-04-02 Juno Therapeutics, Inc. Articles of manufacture and methods for treatment using adoptive cell therapy
US12031975B2 (en) 2017-11-01 2024-07-09 Juno Therapeutics, Inc. Methods of assessing or monitoring a response to a cell therapy
US12163952B2 (en) 2017-02-27 2024-12-10 Juno Therapeutics, Inc. Determining toxicity risk in CAR T-cell therapy
EP4326286A4 (en) * 2021-04-23 2025-03-12 Myeloid Therapeutics, Inc. COMPOSITIONS AND METHODS FOR CONDITIONING PATIENTS FOR CELL THERAPY
US12258580B2 (en) 2017-11-01 2025-03-25 Juno Therapeutics, Inc. Process for generating therapeutic compositions of engineered cells
US12263190B2 (en) 2018-11-08 2025-04-01 Juno Therapeutics, Inc. Methods and combinations for treatment and T cell modulation
US12350312B2 (en) 2017-09-06 2025-07-08 Fred Hutchinson Cancer Center Methods for improving adoptive cell therapy
US12428486B2 (en) 2017-11-01 2025-09-30 Juno Therapeutics, Inc. Chimeric antigen receptors specific for B-cell maturation antigen and encoding polynucleotides

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111825769B (zh) * 2019-04-16 2022-03-25 上海科技大学 一种泛素化缺失的嵌合抗原受体及其用途
AU2020307667A1 (en) * 2019-06-27 2022-01-20 Crispr Therapeutics Ag Use of chimeric antigen receptor T cells and NK cell inhibitors for treating cancer
AU2021276312A1 (en) * 2020-05-18 2022-12-22 Robert Sackstein Compositions and methods for treatment of inflammatory disorders
CN116209461A (zh) * 2020-06-05 2023-06-02 特沙公司 Cd-30阳性癌症的治疗
EP4171585A1 (en) * 2020-06-26 2023-05-03 CRISPR Therapeutics AG Allogeneic cell therapy of b cell malignancies using genetically engineered t cells targeting cd19
JP2023546178A (ja) * 2020-10-20 2023-11-01 クリスパー セラピューティクス アクチェンゲゼルシャフト Cd19を標的とする遺伝子操作されたt細胞を用いたb細胞悪性腫瘍の同種他家細胞療法
RU2758126C1 (ru) * 2021-04-02 2021-10-26 федеральное государственное бюджетное учреждение «Национальный медицинский исследовательский центр онкологии» Министерства здравоохранения Российской Федерации Способ прогнозирования развития рецидива диффузной В-крупноклеточной лимфомы
WO2025006561A2 (en) * 2023-06-27 2025-01-02 Nkarta, Inc. Methods for treatment using cd19-directed immunotherapies

Citations (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4452773A (en) 1982-04-05 1984-06-05 Canadian Patents And Development Limited Magnetic iron-dextran microspheres
US4501728A (en) 1983-01-06 1985-02-26 Technology Unlimited, Inc. Masking of liposomes from RES recognition
US4690915A (en) 1985-08-08 1987-09-01 The United States Of America As Represented By The Department Of Health And Human Services Adoptive immunotherapy as a treatment modality in humans
US4795698A (en) 1985-10-04 1989-01-03 Immunicon Corporation Magnetic-polymer particles
US4837028A (en) 1986-12-24 1989-06-06 Liposome Technology, Inc. Liposomes with enhanced circulation time
US5019369A (en) 1984-10-22 1991-05-28 Vestar, Inc. Method of targeting tumors in humans
US5087616A (en) 1986-08-07 1992-02-11 Battelle Memorial Institute Cytotoxic drug conjugates and their delivery to tumor cells
US5200084A (en) 1990-09-26 1993-04-06 Immunicon Corporation Apparatus and methods for magnetic separation
US5219740A (en) 1987-02-13 1993-06-15 Fred Hutchinson Cancer Research Center Retroviral gene transfer into diploid fibroblasts for gene therapy
EP0452342B1 (en) 1988-12-28 1994-11-30 MILTENYI, Stefan Methods and materials for high gradient magnetic separation of biological materials
WO2000014257A1 (en) 1998-09-04 2000-03-16 Sloan-Kettering Institute For Cancer Research Fusion receptors specific for prostate-specific membrane antigen and uses thereof
US6040177A (en) 1994-08-31 2000-03-21 Fred Hutchinson Cancer Research Center High efficiency transduction of T lymphocytes using rapid expansion methods ("REM")
US6207453B1 (en) 1996-03-06 2001-03-27 Medigene Ag Recombinant AAV vector-based transduction system and use of same
US6410319B1 (en) 1998-10-20 2002-06-25 City Of Hope CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies
US6451995B1 (en) 1996-03-20 2002-09-17 Sloan-Kettering Institute For Cancer Research Single chain FV polynucleotide or peptide constructs of anti-ganglioside GD2 antibodies, cells expressing same and related methods
US20020131960A1 (en) 2000-06-02 2002-09-19 Michel Sadelain Artificial antigen presenting cells and methods of use thereof
US20030170238A1 (en) 2002-03-07 2003-09-11 Gruenberg Micheal L. Re-activated T-cells for adoptive immunotherapy
US7070995B2 (en) 2001-04-11 2006-07-04 City Of Hope CE7-specific redirected immune cells
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
US7446179B2 (en) 2000-11-07 2008-11-04 City Of Hope CD19-specific chimeric T cell receptor
WO2009072003A2 (en) 2007-12-07 2009-06-11 Miltenyi Biotec Gmbh Sample processing system and methods
WO2010033140A2 (en) 2008-05-06 2010-03-25 Innovative Micro Technology Removable/disposable apparatus for mems particle sorting device
WO2012129514A1 (en) 2011-03-23 2012-09-27 Fred Hutchinson Cancer Research Center Method and compositions for cellular immunotherapy
US8324353B2 (en) 2001-04-30 2012-12-04 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
US8339645B2 (en) 2008-05-27 2012-12-25 Canon Kabushiki Kaisha Managing apparatus, image processing apparatus, and processing method for the same, wherein a first user stores a temporary object having attribute information specified but not partial-area data, at a later time an object is received from a second user that includes both partial-area data and attribute information, the storage unit is searched for the temporary object that matches attribute information of the received object, and the first user is notified in response to a match
EP2537416A1 (en) 2007-03-30 2012-12-26 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
US8398282B2 (en) 2011-05-12 2013-03-19 Delphi Technologies, Inc. Vehicle front lighting assembly and systems having a variable tint electrowetting element
WO2013071154A1 (en) 2011-11-11 2013-05-16 Fred Hutchinson Cancer Research Center Cyclin a1-targeted t-cell immunotherapy for cancer
US20130149337A1 (en) 2003-03-11 2013-06-13 City Of Hope Method of controlling administration of cancer antigen
US8479118B2 (en) 2007-12-10 2013-07-02 Microsoft Corporation Switching search providers within a browser search box
WO2013123061A1 (en) 2012-02-13 2013-08-22 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
WO2013126726A1 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Double transgenic t cells comprising a car and a tcr and their methods of use
US20130287748A1 (en) 2010-12-09 2013-10-31 The Trustees Of The University Of Pennsylvania Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer
WO2013166321A1 (en) 2012-05-03 2013-11-07 Fred Hutchinson Cancer Research Center Enhanced affinity t cell receptors and methods for making the same
WO2014031687A1 (en) 2012-08-20 2014-02-27 Jensen, Michael Method and compositions for cellular immunotherapy
WO2014055668A1 (en) 2012-10-02 2014-04-10 Memorial Sloan-Kettering Cancer Center Compositions and methods for immunotherapy
US8802374B2 (en) 2009-11-03 2014-08-12 City Of Hope Truncated epiderimal growth factor receptor (EGFRt) for transduced T cell selection
US8822647B2 (en) 2008-08-26 2014-09-02 City Of Hope Method and compositions using a chimeric antigen receptor for enhanced anti-tumor effector functioning of T cells
US20140271635A1 (en) 2013-03-16 2014-09-18 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-cd19 chimeric antigen receptor
US9108442B2 (en) 2013-08-20 2015-08-18 Ricoh Company, Ltd. Image forming apparatus
US9405601B2 (en) 2012-12-20 2016-08-02 Mitsubishi Electric Corporation In-vehicle apparatus and program

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
HRP20150400T1 (hr) * 2008-11-07 2015-05-08 Amgen Research (Munich) Gmbh Lijeäśenje pedijatrijske akutne limfoblastiäśne leukemije
ES2778701T3 (es) * 2012-07-13 2020-08-11 The Trustees Of The Univ Of Pennsylvania Center For Technology Transfer Gestión de toxicidad para la actividad antitumoral de CAR

Patent Citations (48)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4452773A (en) 1982-04-05 1984-06-05 Canadian Patents And Development Limited Magnetic iron-dextran microspheres
US4501728A (en) 1983-01-06 1985-02-26 Technology Unlimited, Inc. Masking of liposomes from RES recognition
US5019369A (en) 1984-10-22 1991-05-28 Vestar, Inc. Method of targeting tumors in humans
US4690915A (en) 1985-08-08 1987-09-01 The United States Of America As Represented By The Department Of Health And Human Services Adoptive immunotherapy as a treatment modality in humans
US4795698A (en) 1985-10-04 1989-01-03 Immunicon Corporation Magnetic-polymer particles
US5087616A (en) 1986-08-07 1992-02-11 Battelle Memorial Institute Cytotoxic drug conjugates and their delivery to tumor cells
US4837028A (en) 1986-12-24 1989-06-06 Liposome Technology, Inc. Liposomes with enhanced circulation time
US5219740A (en) 1987-02-13 1993-06-15 Fred Hutchinson Cancer Research Center Retroviral gene transfer into diploid fibroblasts for gene therapy
EP0452342B1 (en) 1988-12-28 1994-11-30 MILTENYI, Stefan Methods and materials for high gradient magnetic separation of biological materials
US5200084A (en) 1990-09-26 1993-04-06 Immunicon Corporation Apparatus and methods for magnetic separation
US6040177A (en) 1994-08-31 2000-03-21 Fred Hutchinson Cancer Research Center High efficiency transduction of T lymphocytes using rapid expansion methods ("REM")
US6207453B1 (en) 1996-03-06 2001-03-27 Medigene Ag Recombinant AAV vector-based transduction system and use of same
US6451995B1 (en) 1996-03-20 2002-09-17 Sloan-Kettering Institute For Cancer Research Single chain FV polynucleotide or peptide constructs of anti-ganglioside GD2 antibodies, cells expressing same and related methods
WO2000014257A1 (en) 1998-09-04 2000-03-16 Sloan-Kettering Institute For Cancer Research Fusion receptors specific for prostate-specific membrane antigen and uses thereof
US6410319B1 (en) 1998-10-20 2002-06-25 City Of Hope CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies
US20020131960A1 (en) 2000-06-02 2002-09-19 Michel Sadelain Artificial antigen presenting cells and methods of use thereof
US7446179B2 (en) 2000-11-07 2008-11-04 City Of Hope CD19-specific chimeric T cell receptor
US7070995B2 (en) 2001-04-11 2006-07-04 City Of Hope CE7-specific redirected immune cells
US7265209B2 (en) 2001-04-11 2007-09-04 City Of Hope CE7-specific chimeric T cell receptor
US7354762B2 (en) 2001-04-11 2008-04-08 City Of Hope Method for producing CE7-specific redirected immune cells
US7446191B2 (en) 2001-04-11 2008-11-04 City Of Hope DNA construct encoding CE7-specific chimeric T cell receptor
US8324353B2 (en) 2001-04-30 2012-12-04 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
US20030170238A1 (en) 2002-03-07 2003-09-11 Gruenberg Micheal L. Re-activated T-cells for adoptive immunotherapy
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
US20130149337A1 (en) 2003-03-11 2013-06-13 City Of Hope Method of controlling administration of cancer antigen
US8389282B2 (en) 2007-03-30 2013-03-05 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
EP2537416A1 (en) 2007-03-30 2012-12-26 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
WO2009072003A2 (en) 2007-12-07 2009-06-11 Miltenyi Biotec Gmbh Sample processing system and methods
US20110003380A1 (en) 2007-12-07 2011-01-06 Stefan Miltenyi Sample Processing System and Methods
US8479118B2 (en) 2007-12-10 2013-07-02 Microsoft Corporation Switching search providers within a browser search box
WO2010033140A2 (en) 2008-05-06 2010-03-25 Innovative Micro Technology Removable/disposable apparatus for mems particle sorting device
US8339645B2 (en) 2008-05-27 2012-12-25 Canon Kabushiki Kaisha Managing apparatus, image processing apparatus, and processing method for the same, wherein a first user stores a temporary object having attribute information specified but not partial-area data, at a later time an object is received from a second user that includes both partial-area data and attribute information, the storage unit is searched for the temporary object that matches attribute information of the received object, and the first user is notified in response to a match
US8822647B2 (en) 2008-08-26 2014-09-02 City Of Hope Method and compositions using a chimeric antigen receptor for enhanced anti-tumor effector functioning of T cells
US8802374B2 (en) 2009-11-03 2014-08-12 City Of Hope Truncated epiderimal growth factor receptor (EGFRt) for transduced T cell selection
US20130287748A1 (en) 2010-12-09 2013-10-31 The Trustees Of The University Of Pennsylvania Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer
US8911993B2 (en) 2010-12-09 2014-12-16 The Trustees Of The University Of Pennsylvania Compositions for treatment of cancer
WO2012129514A1 (en) 2011-03-23 2012-09-27 Fred Hutchinson Cancer Research Center Method and compositions for cellular immunotherapy
US8398282B2 (en) 2011-05-12 2013-03-19 Delphi Technologies, Inc. Vehicle front lighting assembly and systems having a variable tint electrowetting element
WO2013071154A1 (en) 2011-11-11 2013-05-16 Fred Hutchinson Cancer Research Center Cyclin a1-targeted t-cell immunotherapy for cancer
WO2013123061A1 (en) 2012-02-13 2013-08-22 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
WO2013126726A1 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Double transgenic t cells comprising a car and a tcr and their methods of use
WO2013166321A1 (en) 2012-05-03 2013-11-07 Fred Hutchinson Cancer Research Center Enhanced affinity t cell receptors and methods for making the same
WO2014031687A1 (en) 2012-08-20 2014-02-27 Jensen, Michael Method and compositions for cellular immunotherapy
WO2014055668A1 (en) 2012-10-02 2014-04-10 Memorial Sloan-Kettering Cancer Center Compositions and methods for immunotherapy
US9405601B2 (en) 2012-12-20 2016-08-02 Mitsubishi Electric Corporation In-vehicle apparatus and program
US20140271635A1 (en) 2013-03-16 2014-09-18 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-cd19 chimeric antigen receptor
US9108442B2 (en) 2013-08-20 2015-08-18 Ricoh Company, Ltd. Image forming apparatus

Non-Patent Citations (96)

* Cited by examiner, † Cited by third party
Title
"Remington: The Science and Practice of Pharmacy; 21st ed.", 1 May 2005, LIPPINCOTT WILLIAMS & WILKINS
ALONSO-CAMINO ET AL., MOL THER NUCL ACIDS, vol. 2, 2013, pages e93
BALTIMORE: "Cancer Medicine. 4th ed.", vol. II, 1997, WILLIAMS AND WILKINS, article RAI KR; KEATING HJ: "Chronic lymphocytic leukemia", pages: 2697 - 728
BARRETT ET AL., CHIMERIC ANTIGEN RECEPTOR THERAPY FOR CANCER ANNUAL REVIEW OF MEDICINE, vol. 65, 2014, pages 333 - 347
BAUM ET AL., MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 13, 2006, pages 1050 - 1063
BIOCHEM BIOPHYS RES COMMUN, vol. 438, no. 1, 2013, pages 84 - 9
BORIS-LAWRIE; TEMIN, CUR. OPIN. GENET. DEVELOP., vol. 3, 1993, pages 102 - 109
BRENTJENS ET AL., SCI TRANSL MED., vol. 5, no. 177, 2013
BRENTJENS ET AL., SCI. TRANSL. MED., vol. 5, 2013, pages 177ra38
BURGER ET AL., N. ENGL J. MED., vol. 373, 2015, pages 2425 - 2437
BURNS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 8033 - 8037
BYRD ET AL., N. ENGL. J. MED., vol. 369, 2013, pages 32 - 42
CARLENS ET AL., EXP HEMATOL, vol. 28, no. 10, 2000, pages 1137 - 46
CAVALIERI ET AL., BLOOD, vol. 102, no. 2, 2003, pages 497 - 505
CHEADLE ET AL.: "Chimeric antigen receptors for T-cell based therapy", METHODS MOL BIOL., vol. 907, 2012, pages 645 - 66, XP009179541, DOI: doi:10.1007/978-1-61779-974-7_36
CHESON ET AL., JCO, vol. 32, no. 27, 20 September 2014 (2014-09-20), pages 3059 - 3067
CHICAYBAM ET AL., PLOS ONE, vol. 8, no. 3, 2013, pages e60298
CHO ET AL., LAB CHIP, vol. 10, 2010, pages 1567 - 1573
COHEN ET AL., J IMMUNOL., vol. 175, 2005, pages 5799 - 5808
COOPER ET AL., BLOOD, vol. 101, 2003, pages 1637 - 1644
COUSTAN-SMITH ET AL., LANCET, vol. 351, 1998, pages 550 - 554
DAVILA ET AL., PLOS ONE, vol. 8, no. 4, 2013, pages e61338
DAVILA ET AL., SCI TRANSL MED, vol. 6, 2014, pages 224ra25
DAVILLA ET AL., SCIENCE TRANSLATIONAL MEDICINE, vol. 6, no. 224, 2014, pages 224ra25
DOHNER ET AL., N. ENGL. J. MED., vol. 343, 2000, pages 1910 - 1916
DUDLEY ET AL., SCIENCE, vol. 298, 2002, pages 850 - 54
EISENHAUER ET AL., EUROPEAN JOURNAL OF CANCER, vol. 45, 2009, pages 228 - 247
FEDOROV ET AL., SCI. TRANSL. MEDICINE, vol. 5, no. 215, December 2013 (2013-12-01)
FOON; TODD, BLOOD, vol. 68, 1986, pages 1 - 31
FOON; TODD, BLOOD, vol. 68, no. 1, 1986, pages 1 - 31
FRECHA ET AL., MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 18, 2010, pages 1748 - 1757
GODIN ET AL., J BIOPHOTON., vol. 1, no. 5, 2008, pages 355 - 376
GRIBBEN: "ASH Education Book", vol. 2008, 1 January 2008, pages: 444 - 449
GRUPP ET AL., N. ENGL. J. MED., vol. 368, 2013, pages 1509 - 1518
GUIDO CAVALETTI; PAOLA MARMIROLI: "Nature Reviews Neurology", vol. 6, December 2010, pages: 657 - 666
HACKETT ET AL., MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 18, 2010, pages 674 - 683
HALLEK ET AL., BLOOD, vol. 111, no. 12, 15 June 2008 (2008-06-15), pages 5446 - 5456
HALLEK ET AL., LANCET, vol. 376, 2010, pages 1164 - 1174
HERMAN ET AL., J. IMMUNOLOGICAL METHODS, vol. 285, no. 1, 2004, pages 25 - 40
HUANG ET AL., METHODS MOL BIOL, vol. 506, 2009, pages 115 - 126
HUDECEK ET AL., CLIN. CANCER RES., vol. 19, 2013, pages 3153
JAIN ET AL., BLOOD, vol. 125, no. 13, 2015, pages 2062 - 2067
JOHNSON ET AL.: "Imaging for staging and response assessment in lymphoma", RADIOLOGY, vol. 2, 2015, pages 323 - 338
JOHNSTON, NATURE, vol. 346, 1990, pages 776 - 777
KLEBANOFF ET AL., J IMMUNOTHER., vol. 35, no. 9, 2012, pages 651 - 660
KOCHENDERFER ET AL., BLOOD, vol. 119, 2012, pages 2709 - 2720
KOCHENDERFER ET AL., J. IMMUNOTHERAPY, vol. 32, no. 7, 2009, pages 689 - 702
KOCHENDERFER ET AL., NATURE REVIEWS CLINICAL ONCOLOGY, vol. 10, 2013, pages 267 - 276
KOCHENDERFER, J. CLIN. ONCOL., vol. 33, 2015, pages 540 - 9
KOSTE ET AL., GENE THERAPY, 3 April 2014 (2014-04-03)
LEE ET AL., BLOOD, 2014
LEE ET AL., BLOOD, vol. 124, no. 2, 2014, pages 188 - 95
LEE ET AL., LANCET, vol. 385, 2015, pages 517 - 28
LI, NAT BIOTECHNOL., vol. 23, 2005, pages 349 - 354
LING, N. R. ET AL., LEUCOCYTE TYPING III, 1987, pages 302
LING, N. R. ET AL., LEUCOCYTE TYPING III., 1987, pages 302
LUPTON S. D ET AL., MOL. AND CELL BIOL., vol. 11, 1991, pages 6
MANURI ET AL., HUM GENE THER, vol. 21, no. 4, 2010, pages 427 - 437
MAUDE ET AL., N ENGL J MED, vol. 371, 2014, pages 1507 - 17
MILLER, A. D, HUMAN GENE THERAPY, vol. 1, 1990, pages 5 - 14
MILLER; ROSMAN, BIOTECHNIQUES, vol. 7, 1989, pages 980 - 990
MOL. CELL BIOL., vol. 7, 1987, pages 2031 - 2034
MOZZAM ET AL., J. NEUROONCOL., vol. 106, 2012, pages 185 - 200
MURANSKI ET AL., NAT CLIN PRACT ONCOL., vol. 3, no. 12, December 2006 (2006-12-01), pages 668 - 681
NATIONAL CANCER INSTITUTE-WORKING GROUP: "Guidelines for the diagnosis and treatment of chronic lymphocytic leukemia:", BLOOD, vol. 111, 2008, pages 5446 - 56
OSOL, A.: "Remington's Pharmaceutical Sciences 16th edition,", 1980
PARIKH ET AL., BLOOD, vol. 123, 2014, pages 1647 - 1657
PARK ET AL., TRENDS BIOTECHNOL., 29 November 2011 (2011-11-29), pages 550 - 557
PARKHURST ET AL., CLIN CANCER RES., vol. 15, 2009, pages 169 - 180
PORTER ET AL., SCI TRANSL MED., vol. 7, 2015, pages 303ra139
PUIGGROS ET AL., BIOMED RESEARCH INTERNATIONAL, vol. 2014, 2014
RIDDELL ET AL., HUMAN GENE THERAPY, vol. 3, 1992, pages 319 - 338
ROSENBERG ET AL., CLIN CANCER RES, vol. 17, no. 13, 2011, pages 4550 - 4557
ROSENBERG, NAT REV CLIN ONCOL., vol. 8, no. 10, 2011, pages 577 - 85
S. A. BROOKS AND U. SCHUMACHER: "Methods in Molecular Medicine", HUMANA PRESS INC., article "vol. 58: Metastasis Research Protocols, Vol. 2: Cell Behavior In Vitro and In Vivo,", pages: 17 - 25
SADELAIN ET AL., CANCER DISCOV., vol. 3, no. 4, April 2013 (2013-04-01), pages 388 - 398
SCARPA ET AL., VIROLOGY, vol. 180, 1991, pages 849 - 852
See also references of EP3463437A2
SHARMA ET AL., MOLEC THER NUCL ACIDS, vol. 2, 2013, pages e74
STILGENBAUER ET AL., BLOOD, vol. 123, 2014, pages 3247 - 3254
STILGENBAUER ET AL., LANCET ONCOL., vol. 17, 2016, pages 768 - 778
STRATI ET AL., HAEMATOLOGICA, vol. 101, 2016, pages 458 - 465
SZOKA ET AL., ANN. REV. BIOPHYS. BIOENG., vol. 9, 1980, pages 467
TERAKURA ET AL., BLOOD, vol. 1, 2012, pages 72 - 82
TERAKURA ET AL., BLOOD., vol. 1, 2012, pages 72 - 82
THEMELI ET AL., NAT BIOTECHNOL., vol. 31, no. 10, 2013, pages 928 - 933
THOMPSON ET AL., CANCER, vol. 121, 2015, pages 3612 - 3621
TURTLE ET AL., CURR. OPIN. IMMUNOL., vol. 24, no. 5, October 2012 (2012-10-01), pages 633 - 39
VAN TEDELOO ET AL., GENE THERAPY, vol. 7, no. 16, 2000, pages 1431 - 1437
VARELA-ROHENA ET AL., NAT MED., vol. 14, 2008, pages 1390 - 1395
VERHOEYEN ET AL., METHODS MOL BIOL., vol. 506, 2009, pages 97 - 114
WADWA ET AL., J. DRUG TARGETING, vol. 3, 1995, pages 1 1 1
WANG ET AL., J IMMUNOTHER., vol. 35, no. 9, 2012, pages 689 - 701
WANG ET AL., J. IMMUNOTHER., vol. 35, no. 9, 2012, pages 689 - 701
WU ET AL., CANCER, 18 March 2012 (2012-03-18), pages 160 - 75
XU ET AL., CANCER LETTERS, vol. 343, 2014, pages 172 - 78

Cited By (41)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11633426B2 (en) 2014-10-20 2023-04-25 Juno Therapeutics, Inc. Methods and compositions for dosing in adoptive cell therapy
US10507219B2 (en) 2014-10-20 2019-12-17 Juno Therapeutics, Inc. Methods and compositions for dosing in adoptive cell therapy
US10889652B2 (en) 2015-01-16 2021-01-12 Juno Therapeutics, Inc. Antibodies and chimeric antigen receptors specific for ROR1
US11919970B2 (en) 2015-01-16 2024-03-05 Juno Therapeutics, Inc. Antibodies and chimeric antigen receptors specific for ROR1
US10968275B2 (en) 2016-02-02 2021-04-06 Fred Hutchinson Cancer Research Center Anti-ROR1 antibodies and uses thereof
US11932691B2 (en) 2016-02-02 2024-03-19 Fred Hutchinson Cancer Center Anti-ROR1 antibodies and uses thereof
WO2018085731A3 (en) * 2016-11-03 2018-07-12 Juno Therapeutics, Inc. Combination therapy of a t cell therapy and a btk inhibitor
US11590167B2 (en) 2016-12-03 2023-02-28 Juno Therapeutic, Inc. Methods and compositions for use of therapeutic T cells in combination with kinase inhibitors
US12163952B2 (en) 2017-02-27 2024-12-10 Juno Therapeutics, Inc. Determining toxicity risk in CAR T-cell therapy
WO2018170188A2 (en) 2017-03-14 2018-09-20 Juno Therapeutics, Inc. Methods for cryogenic storage
US11944647B2 (en) 2017-06-02 2024-04-02 Juno Therapeutics, Inc. Articles of manufacture and methods for treatment using adoptive cell therapy
US12350312B2 (en) 2017-09-06 2025-07-08 Fred Hutchinson Cancer Center Methods for improving adoptive cell therapy
US11771718B2 (en) 2017-10-18 2023-10-03 Precigen, Inc. Polypeptide compositions comprising spacers
US12428486B2 (en) 2017-11-01 2025-09-30 Juno Therapeutics, Inc. Chimeric antigen receptors specific for B-cell maturation antigen and encoding polynucleotides
US12031975B2 (en) 2017-11-01 2024-07-09 Juno Therapeutics, Inc. Methods of assessing or monitoring a response to a cell therapy
US12258580B2 (en) 2017-11-01 2025-03-25 Juno Therapeutics, Inc. Process for generating therapeutic compositions of engineered cells
US11851679B2 (en) 2017-11-01 2023-12-26 Juno Therapeutics, Inc. Method of assessing activity of recombinant antigen receptors
WO2019200347A1 (en) * 2018-04-13 2019-10-17 Fred Hutchinson Cancer Research Center Methods for adoptive cell therapy targeting ror1
JP2021523122A (ja) * 2018-05-03 2021-09-02 ジュノー セラピューティクス インコーポレイテッド キメラ抗原受容体(car)t細胞療法とキナーゼ阻害剤の併用療法
WO2019213184A1 (en) * 2018-05-03 2019-11-07 Juno Therapeutics, Inc. Combination therapy of a chimeric antigen receptor (car) t cell therapy and a kinase inhibitor
JP7410877B2 (ja) 2018-05-03 2024-01-10 ジュノー セラピューティクス インコーポレイテッド キメラ抗原受容体(car)t細胞療法とキナーゼ阻害剤の併用療法
EP3873539A4 (en) * 2018-10-31 2023-01-18 The Children's Hospital of Philadelphia LYMPH-BASED T-CELLS FOR DIAGNOSTIC AND THERAPEUTIC USE
US12263190B2 (en) 2018-11-08 2025-04-01 Juno Therapeutics, Inc. Methods and combinations for treatment and T cell modulation
IL283298B1 (en) * 2018-11-30 2024-11-01 Juno Therapeutics Inc Methods for dosing and treatment of b cell malignancies in adoptive cell therapy
IL283298B2 (en) * 2018-11-30 2025-03-01 Juno Therapeutics Inc Methods for dosing and treating B-cell malignancies with adoptive cell therapy
WO2020113188A3 (en) * 2018-11-30 2020-08-06 Juno Therapeutics, Inc. Methods for dosing and treatment of b cell malignancies in adoptive cell therapy
JP7695882B2 (ja) 2018-11-30 2025-06-19 ジュノー セラピューティクス インコーポレイテッド 養子細胞療法を用いた処置のための方法
JP2022513685A (ja) * 2018-11-30 2022-02-09 ジュノー セラピューティクス インコーポレイテッド 養子細胞療法を用いた処置のための方法
JP2022513689A (ja) * 2018-11-30 2022-02-09 ジュノー セラピューティクス インコーポレイテッド 養子細胞療法におけるb細胞悪性腫瘍の投与および処置のための方法
EP4393547A3 (en) * 2018-11-30 2024-09-18 Juno Therapeutics, Inc. Methods for dosing and treatment of b cell malignancies in adoptive cell therapy
JP7652692B2 (ja) 2018-11-30 2025-03-27 ジュノー セラピューティクス インコーポレイテッド 養子細胞療法におけるb細胞悪性腫瘍の投与および処置のための方法
US11141436B2 (en) 2019-03-05 2021-10-12 Nkarta, Inc. Immune cells engineered to express CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
US11154575B2 (en) 2019-03-05 2021-10-26 Nkarta, Inc. Cancer immunotherapy using CD19-directed chimeric antigen receptors
US11253547B2 (en) 2019-03-05 2022-02-22 Nkarta, Inc. CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
US12398187B2 (en) 2019-03-05 2025-08-26 Nkarta, Inc. CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
WO2021113770A1 (en) * 2019-12-06 2021-06-10 Juno Therapeutics, Inc. Methods related to toxicity and response associated with cell therapy for treating b cell malignancies
WO2021151008A1 (en) * 2020-01-24 2021-07-29 Juno Therapuetics, Inc. Methods for dosing and treatment of follicular lymphoma and marginal zone lymphoma in adoptive cell therapy
JP2023519098A (ja) * 2020-02-12 2023-05-10 ジュノー セラピューティクス インコーポレイテッド Cd19指向性キメラ抗原受容体t細胞組成物ならびにその方法および使用
WO2021163391A1 (en) * 2020-02-12 2021-08-19 Juno Therapeutics, Inc. Cd19-directed chimeric antigen receptor t cell compositions and methods and uses thereof
EP4326286A4 (en) * 2021-04-23 2025-03-12 Myeloid Therapeutics, Inc. COMPOSITIONS AND METHODS FOR CONDITIONING PATIENTS FOR CELL THERAPY
WO2022254337A1 (en) * 2021-06-01 2022-12-08 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof

Also Published As

Publication number Publication date
KR20240036704A (ko) 2024-03-20
US20200016199A1 (en) 2020-01-16
KR20230085947A (ko) 2023-06-14
KR102644950B1 (ko) 2024-03-11
AU2017277396A1 (en) 2018-11-29
AU2017277396B2 (en) 2024-08-01
CA3024725A1 (en) 2017-12-14
JP2023184646A (ja) 2023-12-28
JP2019517589A (ja) 2019-06-24
KR102540751B1 (ko) 2023-06-09
EP3463437A2 (en) 2019-04-10
MA45341A (fr) 2019-04-10
WO2017214207A3 (en) 2018-01-18
MX2018014911A (es) 2019-08-12
JP7139318B2 (ja) 2022-09-20
KR20190026740A (ko) 2019-03-13
MX2024000151A (es) 2024-01-23
JP2022033929A (ja) 2022-03-02
US20250197471A1 (en) 2025-06-19
CN109562151A (zh) 2019-04-02
WO2017214207A8 (en) 2018-11-29
BR112018074406A2 (pt) 2019-03-06

Similar Documents

Publication Publication Date Title
US20250197471A1 (en) Methods for the treatment of b cell malignancies using adoptive cell therapy
US20250186503A1 (en) Methods and combinations for treatment and t cell modulation
US10507219B2 (en) Methods and compositions for dosing in adoptive cell therapy
JP2023116720A (ja) 細胞療法と免疫調節化合物の併用
US20190298772A1 (en) Combination therapy of a t cell-based therapy and a btk inhibitor
CN112584902A (zh) 嵌合抗原受体(car)t细胞疗法和激酶抑制剂的组合疗法
EP4103204A1 (en) Cd19-directed chimeric antigen receptor t cell compositions and methods and uses thereof
CN114980918A (zh) T细胞疗法与(s)-3-[4-(4-吗啉-4-基甲基-苄氧基)-1-氧代-1,3-二氢-异吲哚-2-基]-哌啶-2,6-二酮的组合
RU2795984C2 (ru) Изделия и способы для лечения с использованием адоптивной клеточной терапии
JP2022159553A (ja) 早期治療選択肢としての養子細胞療法
NZ789091A (en) Methods for the treatment of b cell malignancies using adoptive cell therapy
NZ789090A (en) Methods for the treatment of b cell malignancies using adoptive cell therapy

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 3024725

Country of ref document: CA

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17733663

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2017277396

Country of ref document: AU

Date of ref document: 20170606

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112018074406

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2019516103

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20197000351

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017733663

Country of ref document: EP

Effective date: 20190107

ENP Entry into the national phase

Ref document number: 112018074406

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20181127