WO2016171980A1 - Polypeptides targeting hiv fusion - Google Patents

Polypeptides targeting hiv fusion Download PDF

Info

Publication number
WO2016171980A1
WO2016171980A1 PCT/US2016/027424 US2016027424W WO2016171980A1 WO 2016171980 A1 WO2016171980 A1 WO 2016171980A1 US 2016027424 W US2016027424 W US 2016027424W WO 2016171980 A1 WO2016171980 A1 WO 2016171980A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
amino acid
moiety
seq
adnectin
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/027424
Other languages
English (en)
French (fr)
Inventor
Mark R. Krystal
David L. WENSEL
Jonathan Davis
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bristol Myers Squibb Co
Original Assignee
Bristol Myers Squibb Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to HK18102882.7A priority Critical patent/HK1243432A1/zh
Priority to ES16718817T priority patent/ES2884267T3/es
Priority to KR1020177033985A priority patent/KR20170138558A/ko
Priority to BR112017022790-8A priority patent/BR112017022790A2/pt
Priority to EP21176464.2A priority patent/EP3985020A1/en
Priority to AU2016252008A priority patent/AU2016252008B2/en
Priority to CR20170482A priority patent/CR20170482A/es
Priority to JP2017555557A priority patent/JP6894846B2/ja
Priority to MX2017013687A priority patent/MX2017013687A/es
Priority to CN201680036930.XA priority patent/CN107922474A/zh
Priority to EA201792269A priority patent/EA035332B1/ru
Priority to SG11201708441RA priority patent/SG11201708441RA/en
Application filed by Bristol Myers Squibb Co filed Critical Bristol Myers Squibb Co
Priority to EP16718817.6A priority patent/EP3286212B1/en
Priority to CA2983276A priority patent/CA2983276A1/en
Priority to US15/568,830 priority patent/US10407490B2/en
Publication of WO2016171980A1 publication Critical patent/WO2016171980A1/en
Priority to IL255122A priority patent/IL255122A0/en
Priority to PH12017501914A priority patent/PH12017501914A1/en
Anticipated expiration legal-status Critical
Priority to CONC2017/0011583A priority patent/CO2017011583A2/es
Priority to US16/533,941 priority patent/US11155602B2/en
Priority to AU2019226255A priority patent/AU2019226255A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/78Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/76Albumins
    • C07K14/765Serum albumin, e.g. HSA
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/79Transferrins, e.g. lactoferrins, ovotransferrins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16111Human Immunodeficiency Virus, HIV concerning HIV env
    • C12N2740/16122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes

Definitions

  • the invention is directed to polypeptides comprising a CD4 binding moiety, a gp41 binding moiety, a HIV fusion peptide inhibitor moiety and combinations thereof. More specifically, the present invention relates to polypeptides comprising a fibronectin- based scaffold domain protein that binds CD4, a fibronectin-based scaffold domain protein that binds the N17 domain of gp41, and a HIV fusion peptide inhibitor or combinations thereof. The invention also relates to the use of the innovative proteins in therapeutic applications to treat HIV.
  • AIDS Acquired immunodeficiency syndrome
  • HIV human immunodeficiency virus
  • agents are classified as either nucleotide reverse transcriptase inhibitors (NRTIs), non-nucleotide reverse transcriptase inhibitors (NNRTIs), protease inhibitors (Pis), integrase inhibitors (INIs), or entry inhibitors (one entry inhibitor, maraviroc, targets the host CCR5 protein, while the other, enfuvirtide, is a peptide that targets the gp41 region of the viral gpl60 protein).
  • NRTIs nucleotide reverse transcriptase inhibitors
  • NRTIs non-nucleotide reverse transcriptase inhibitors
  • Pro protease inhibitors
  • IPIs integrase inhibitors
  • entry inhibitors one entry inhibitor, maraviroc, targets the host CCR5 protein, while the other, enfuvirtide, is a peptide that targets the gp41 region of the viral gpl60 protein.
  • cobicistat a pharmacokinetic enhancer with
  • antiretroviral agents that require boosting.
  • gpl20/gp41 interacts with cell surface receptors on the membranes of the target cells.
  • gpl20/gp41 interacts with cell surface receptors on the membranes of the target cells.
  • cellular receptors e.g., CD4 in combination with a chemokine co-receptor such as CCR5 or CXCR4
  • a conformational change is induced in the gpl20/gp41 complex that allows gp41 to insert into the membrane of the target cell and mediate membrane fusion.
  • macrocmolecules include biologic peptides (Haqqani et al, Antiviral Res., 98: 158 (2013)).
  • the approved antiviral peptide enfuvirtide targets a region of gp41 involved in membrane fusion.
  • Larger polypeptides such as monoclonal antibodies can also inhibit different aspects of virus entry.
  • a monoclonal antibody targeting the first step of virus entry, interaction with the cellular receptor CD4 ibalizumab; Bruno et al., J. Antimicrob. Chemother. , 65: 1839 (2010)
  • a monoclonal antibody targeting the co-receptor CCR5 PRO-140; Tenorio, Curr. HIV/AIDS Rep. , 8: 1 (2011) have both shown positive results in Phase 2a trials.
  • peptide entry inhibitors Another property of peptide entry inhibitors is that enhanced or synergistic potency can be obtained if two peptide inhibitors are attached to each other, or if a single inhibitor is localized near the site of action through binding to membrane biomolecules.
  • attaching a fusion peptide inhibitor to a monoclonal antibody targeting CCR5 (Kopetzki et al, Virol. J. , 5:56 (2008)) or attaching a cholesterol moiety to the C-terminus of a peptide fusion inhibitor to place it at the surface of the target cell membrane
  • the invention is directed to polypeptides comprising a CD4 binding moiety, a gp41 binding moiety, a HIV fusion peptide inhibitor moiety and combinations thereof.
  • One embodiment of the invention is directed to polypeptides comprising a fibronectin-based scaffold domain protein that binds CD4, a fibronectin-based scaffold domain protein that binds the N17 domain of gp41, and a HIV fusion peptide inhibitor.
  • the three domains are connected to each other by linkers. In another embodiment of the invention, the three domains may be connected to each other in any order.
  • the polypeptide comprises an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the non-linker regions of SEQ ID NO: 3, 5, 7 or 9.
  • the invention is also directed to polypeptides comprising a fibronectin-based scaffold domain protein that binds CD4 and a fibronectin-based scaffold domain protein that binds the N17 domain of gp41.
  • the two domains are connected to each other by linkers. In another embodiment of the invention, the two domains may be connected to each other in any order.
  • the invention is also directed to polypeptides comprising a fibronectin-based scaffold domain protein that binds CD4 and a HIV fusion peptide inhibitor.
  • the two domains are connected to each other by linkers. In another embodiment of the invention, the two domains may be connected to each other in any order.
  • the invention is also directed to polypeptides comprising a fibronectin-based scaffold domain protein that binds the N17 domain of gp41, and a HIV fusion peptide inhibitor.
  • the two domains are connected to each other by linkers.
  • the two domains may be connected to each other in any order.
  • the polypeptide comprises an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the non-linker regions of SEQ ID NO: 410-428.
  • Another embodiment of the invention is also directed to polypeptides comprising three active domains, a fibronectin-based scaffold domain protein that binds CD4, a gp41 binding moiety and a HIV fusion peptide inhibitor moiety.
  • the invention is also directed to polypeptides comprising a fibronectin-based scaffold domain protein that binds gp41, a CD4 binding moiety and a HIV fusion peptide inhibitor moiety.
  • the invention is also directed to polypeptides comprising a CD4 binding moiety, a gp41 binding moiety and a HIV fusion peptide inhibitor.
  • the two domains are connected to each other by linkers. In another embodiment of the invention, the two domains may be connected to each other in any order.
  • the invention is also directed to polypeptides comprising two active domains, a fibronectin-based scaffold domain protein that binds CD4 and a gp41 binding moiety.
  • the invention is also directed to polypeptides comprising a fibronectin-based scaffold domain protein that binds gp41 and a CD4 binding moiety.
  • the invention is also directed to polypeptides comprising a CD4 binding moiety and a HIV fusion peptide inhibitor.
  • the invention is also directed to polypeptides comprising a gp41 binding moiety and a HIV fusion peptide inhibitor.
  • the two domains are connected to each other by linkers. In another embodiment of the invention, the two domains may be connected to each other in any order.
  • polypeptide comprises an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the non-linker regions of SEQ ID NO: 95-114 or SEQ ID NO: 115-371 or SEQ ID NO: 372-392, respectively.
  • a pharmacokinetic (PK) moiety is attached to the polypeptides of the invention.
  • PK moiety include but are not limited to polyethylene glycol, sialic acid, Fc, Fc fragment, transferrin, serum albumin (HSA), a serum albumin binding protein, and a serum immunoglobulin binding protein.
  • the PK moiety may be attached to the linker regions, or the N- or C-terminus of the polypeptide of the invention.
  • the polypeptide comprises an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the non-linker regions of SEQ ID NO: 4, 6, 8 or 10.
  • the invention is also directed to a polypeptide comprising the amino acid sequence of any one of the sequences shown in SEQ ID NO: 3-10.
  • the invention is also directed to a pharmaceutical composition comprising one or more of the polypeptides of the invention and a carrier.
  • the invention also provides a method of treating HIV in a subject comprising administering an effective amount of the polypeptides of the invention.
  • FIG. 1 is a diagram of alternative Combinectins.
  • One of the Adnectin binds CD4, a second Adnectin binds the HR1 region of gp41.
  • the peptide also binds in the HR1 region of gp41.
  • the different components of the Combinectin are connected to each other in any order by linkers. Any of the Combinectins may have a PK moiety attached, such as HSA or Fc.
  • FIG. 2 shows the amino acid sequences of Fc fusion-Combinectin 3137(SEQ ID NO:4), 3151(SEQ ID NO:6) and human serum albumin (HSA) fusion-Combinectin 3191(SEQ ID NO: 8), and 3202(SEQ ID NO: 10).
  • the Fc and HSA sequences are in bold.
  • the anti-CD4 Adnectin sequences are underlined.
  • the anti-N17 Adnectin sequences are double underlined.
  • the HIV inhibitor peptide sequences are underlined in bold.
  • the linker sequences are italicized.
  • FIG. 3 shows the potency (EC50 and EC90) of Combinectin 3137, 3151, 3191 and 3202, as described in Example 2.
  • FIG. 4 shows the PK properties of Combinectin 3137, 3151, 3191 and 3202 as described in Example 3.
  • FIG. 5 shows the amino acid sequences of anti-N17 Adnectin in combination with an HIV fusion peptide inhibitor, which correspond to the sequences described in Table 4 minus the N-terminus and C-terminus extended regions.
  • the anti-N17 Adnectin sequences are double underlined.
  • the HIV fusion peptide inhibitor sequences are underlined in bold.
  • the linker sequences are italicized.
  • FIG. 6 shows the WebLogo for the CD loop of anti-CD4 Adnectin.
  • WebLogo generates sequence logos, graphical representations of the patterns within a multiple sequence alignment. Each logo consists of stacks of letters, one stack for each position in the sequence. The overall height of each stack indicates the sequence conservation at that position (measured in bits), whereas the height of symbols within the stack reflects the relative frequency of the corresponding amino or nucleic acid at that position (Crooks, G.E. et al, "WebLogo: A sequence logo generator", Genome Research, 14: 1188-1190 (2004)).
  • FIG. 7 shows the WebLogo for the FG loop of anti-CD4 Adnectin (Schneider, T.D. et al, "Sequence Logos: A New Way to Display Consensus Sequences", Nucleic Acids Res., 18:6097-6100 (1990)).
  • FIG. 8 shows point mutation data for the HIV fusion peptide inhibitor.
  • the aspartic acid (D) near the C-terminus of the HIV fusion peptide inhibitor was replaced with the amino acids listed along the x axis.
  • Polypeptide refers to any sequence of two or more amino acids, regardless of length, post-translation modification, or function.
  • Polypeptide “peptide”, and “protein” are used interchangeably herein.
  • Polypeptides can be modified in any of a variety of standard chemical ways (e.g., an amino acid can be modified with a protecting group; the carboxy -terminal amino acid can be made into a terminal amide group; the amino-terminal residue can be modified with groups to, e.g.
  • polypeptide modifications can include the attachment of another structure such as a cyclic compound or other molecule to the polypeptide and can also include polypeptides that contain one or more amino acids in an altered configuration (i.e., R or S; or, L or D).
  • the peptides of the invention may include, for example, proteins derived from the tenth type III domain of fibronectin that have been modified to bind to CD4 or N17 domain of gp41 and are referred to herein as, "anti-CD4 Adnectin", “anti-N17 Adnectin”, “CD4 Adnectin” or "gp41 Adnectin”.
  • the polypeptides of the invention may also include peptides modeled after the heptad repeat 2 (HR2) region of HIV envelope glycoprotein gp41, which inhibit fusion by binding the heptad repeat 1 (HR1) region of gp41 and are referred to herein as "HIV fusion peptide inhibitor" or "fusion peptide inhibitor".
  • the polypeptides of the invention also include "Combinectins" comprising an anti-CD4 Adnectin linked to an anti-N17 Adnectin linked to a HIV fusion peptide inhibitor (FIG. 1).
  • the Combinectin comprises an anti-CD4 Adnectin linked to an anti- N17 Adnectin or an anti-N17 Adnectin linked to a HIV fusion peptide inhibitor or an anti-CD4 Adnectin linked to a HIV fusion peptide inhibitor.
  • polypeptide chain refers to a polypeptide wherein each of the domains thereof is joined to other domain(s) by peptide bond(s), as opposed to non- covalent interactions or disulfide bonds.
  • polypeptides are one that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would interfere with diagnostic or therapeutic uses for the polypeptide, and may include recombinant host cell proteins and other proteinaceous or nonproteinaceous solutes.
  • the polypeptides will be purified (1) to greater than 95% by weight of polypeptide as determined by the Lowry method, and most preferably more than 99% by weight, or (2) to homogeneity by SDS- PAGE under reducing or nonreducing condition using Coomassie blue or, silver stain. Ordinarily, isolated polypeptide will be prepared by at least one purification step.
  • Percent (%) amino acid sequence identity herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in a selected sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR®) software. Those skilled in the art can readily determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full- length of the sequences being compared.
  • the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows: 100 times the fraction X/Y where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A.
  • “conservative substitution” denotes the replacement of an amino acid residue by another, without altering the overall conformation and function of the peptide, including, but not limited to, replacement of an amino acid with one having similar properties (such as, for example, polarity, hydrogen bonding potential, acidic, basic, shape, hydrophobic, aromatic, and the like).
  • Amino acids with similar properties are well known in the art. For example, arginine, histidine and lysine are hydrophilic- basic amino acids and may be interchangeable. Similarly, isoleucine, a hydrophobic amino acid, may be replaced with leucine, methionine or valine.
  • Neutral hydrophilic amino acids which can be substituted for one another, include asparagine, glutamine, serine and threonine.
  • substituted or modified the present invention includes those amino acids that have been altered or modified from naturally occurring amino acids. As such it should be understood that in the context of the present invention a conservative substitution is recognized in the art as a substitution of one amino acid for another amino acid that has similar properties.
  • binding site refers to the site or portion of a protein (e.g. , CD4, gp41) that interacts or binds to a particular protein of the invention (e.g., as an epitope is recognized by an antibody). Binding sites can be formed from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Binding sites formed by contiguous amino acids are typically retained on exposure to denaturing solvents, whereas binding sites formed by tertiary folding are typically lost on treatment of denaturing solvents.
  • the binding site for an anti-CD4 moiety or anti-N17moiety of the invention may be determined by application of standard techniques typically used for epitope mapping of antibodies including, but not limited to protease mapping and mutational analysis.
  • a binding site can be determined by competition assay using a reference protein (e.g. , another Adnectin or antibody) which binds to the same polypeptide, e.g., CD4 or gp41. If the test protein and reference molecule (e.g. , another Adnectin or antibody) compete, then they bind to the same binding site or to binding sites sufficiently proximal such that binding of one molecule interferes with the other.
  • telomere binding domain of a protein of the invention is specific for CD4 or gp41.
  • binds refers to the situation in which the peptides of the invention bind CD4 or gp41at least about 20% greater than it binds a different polypeptide as measured by a technique available in the art such as, but not limited to, Scatchard analysis and/or competitive binding assays (e.g. , competition ELISA, BIACORE® SPR assay).
  • cross-reactivity refers to a protein which binds to more than one distinct protein having identical or very similar binding sites.
  • Kd is intended to refer to the dissociation equilibrium constant of a particular Adnectin-protein, fusion peptide inhibitor-protein or
  • a desired Kd may refer to the Kd of a Combinectin required to elicit a functional effect in an in vitro assay, e.g. , a cell-based luciferase assay.
  • W is intended to refer to the association rate constant for the association of, for example, a Combinectin into the Combinectin/protein complex.
  • k 0 n is intended to refer to the dissociation rate constant for the dissociation of, for example, a Combinectin from the Combinectin/protein complex.
  • IC50 refers to the concentration of, for example, a Combinectin that inhibits a response, either in an in vitro or an in vivo assay, to a level that is 50% of the maximal inhibitory response, i.e. , halfway between the maximal inhibitory response and the untreated response.
  • inhibitor or “neutralize” as used herein with respect to an activity of a protein of the invention means the ability to substantially antagonize, prohibit, prevent, restrain, slow, disrupt, eliminate, stop, reduce or reverse e.g., progression or severity of that which is being inhibited including, but not limited to, a biological activity or property, a disease or a condition.
  • the inhibition or neutralization is preferably at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or higher.
  • PK is an acronym for "pharmacokinetic” and encompasses properties of a compound including, by way of example, absorption, distribution, metabolism, and elimination by a subject.
  • a "PK modulation protein” or “PK moiety” as used herein refers to any protein, peptide, or moiety that affects the pharmacokinetic properties of a biologically active molecule when fused to or administered together with the biologically active molecule.
  • Examples of a PK modulation protein or PK moiety include PEG, human serum albumin (HSA) binders (as disclosed in U.S. Publication No. 2005/0287153, U.S. Patent No. 7,696,320, PCT Publication Nos. WO 2009/083804 and WO 2009/133208), human serum albumin, Fc or Fc fragments and variants thereof, and sugars (e.g. , sialic acid).
  • HSA human serum albumin
  • CD4 binding moiety refers to any moiety that blocks HIV surface protein gpl20 binding to the CD4 receptor on CD4+ T cells.
  • the CD4 binding moiety may be anti-CD4 -adnectin, -antibody(such as ibalizumab), -domain antibody (dAb), -antibody fragments (Fab), -bispecific antibody and fusion protein thereof.
  • gp41 binding moiety refers to any moiety that interferes with the interaction of the viral envelope glycoprotein complex (gpl20/gp41) with T cells.
  • the gp41 binding moiety may be anti-gp41 -adnectin, -antibody (Ab), -domain antibody (dAb), -antibody fragments (Fab), -bispecific antibody and fusion protein thereof.
  • a "HIV fusion peptide inhibitor moiety” refers to any moiety that inhibits fusion by binding the heptad repeat 1 (HR1) region of gp41.
  • fusion peptide inhibitor moiety include peptides derived from the NHR and CHR regions of gp41, designated NHR and CHR peptides, respectively.
  • Enfuvirtide is an example of a CHR peptide.
  • the peptides of the invention may include, for example, the CD4 monoclonal antibody ibalizumab, an anti-N17 Adnectin and a HIV fusion peptide inhibitor.
  • the peptides of the invention may include an anti-CD4 Adnectin, an anti- N17 Adnectin and the HIV fusion peptide inhibitor enfuvirtide.
  • the "half-life" of an amino acid sequence or compound can generally be defined as the time taken for the serum concentration of the polypeptide to be reduced by 50%, in vivo, for example, due to degradation of the sequence or compound and/or clearance or sequestration of the sequence or compound by natural mechanisms.
  • the half-life can be determined in any manner known per se, such as by pharmacokinetic analysis.
  • Suitable techniques will be clear to the person skilled in the art, and may, for example, generally involve the steps of suitably administering to a subject a suitable dose of the amino acid sequence or compound of the invention; collecting blood samples or other samples from the subject at regular intervals; determining the level or concentration of the amino acid sequence or compound of the invention in said blood sample; and calculating, from (a plot of) the data thus obtained, the time until the level or concentration of the amino acid sequence or compound of the invention has been reduced by 50% compared to the initial level upon dosing.
  • Half-life can be expressed using parameters such as the ti/2-alpha, ti/2-beta, HL Lambda z, and the area under the curve (AUC).
  • an "increase in half-life" refers to an increase in any one of these parameters, any two of these parameters, any three of these parameters or all four of these parameters.
  • the terms “individual”, “subject”, and “patient”, used interchangeably herein, refer to an animal, preferably a mammalian (including a nonprimate and a primate), including, but not limited to, murines, simians, humans, mammalian farm animals (e.g. , bovine, porcine, ovine), mammalian sport animals (e.g. , equine), and mammalian pets (e.g. , canine and feline); preferably the term refers to humans.
  • the subject is a mammal, is preferably a human and is infected with HIV.
  • a therapeutically effective amount refers to at least the minimal dose, but less than a toxic dose, of an agent which is necessary to impart a therapeutic benefit to a subject.
  • a therapeutically effective amount of a Combinectin of the invention is an amount which in mammals, preferably humans, results in a significant decline in circulating HIV within the infected individual.
  • the present invention provides novel polypeptides that bind to CD4 and/or gp41.
  • polypeptides comprising a CD4 binding moiety, a gp41 binding moiety, a HIV fusion peptide inhibitor moiety and combinations thereof. More specifically, the present invention relates to polypeptides comprising a fibronectin-based scaffold domain protein that binds CD4, a fibronectin-based scaffold domain protein that binds the N17 domain of gp41, and a HIV fusion peptide inhibitor or combinations thereof (herein referred to as "Combinectins").
  • CD4 and gp41 Adnectins In order to identify CD4 and gp41 Adnectins, soluble CD4 (extracellular domain) and gp41 (various artificial constructs designed to display a triple-helical segment mimicking a portion of gp41) were presented to large synthetic libraries of Adnectins. Adnectins that survived several rounds of selection were screened for CD4 or gp41 binding, for biophysical properties, and for HIV-1 inhibitory activity. The best anti-CD4 and anti-N17 Adnectin sequences that emerged from the screenings were mutated and subjected to further rounds of selection with increased selective pressure, achieved by lowering the target concentration and/or selecting for anti-CD4 or gp41 Adnectins with fast on-rates and/or slow off-rates. From this optimization process, multiple families of Adnectins, some that targeted CD4, and others targeting gp41, were identified as HIV-1 specific inhibitors with favorable biochemical and biophysical activity.
  • gp41 -targeting helical peptide was developed starting with sequences related to gp41 HR2 and containing changes for improving potency and breadth across HIV strains as well as increasing the resistance barrier. Peptides were produced at times synthetically and at other times as genetic fusions to inert or active
  • Adnectins Optimal N- and C-terminal positions were determined in fusions to a member of the gp41 Adnectin family. To identify mutations that would further increase potency, an N-terminally trimmed peptide with modest potency was used, so that improvements would be more easily detected. Small libraries of the inert Adnectin-peptide fusion were made comprising single and multiple point mutations, then the proteins were expressed and screened for biophysical properties and HIV-1 inhibitory activity. The final family of peptides consisted of optimal length peptides with various combinations of the sequences that had the most favorable profiles. I. Fibronectin Based Scaffolds - Adnectins
  • One aspect of the application provides anti-CD4 and anti-N17 Adnectins comprising a fibronectin type III (Fn3) domain in which part or all of one or more of the solvent accessible loops has been randomized or mutated. In some embodiments, one or more residues in one or more of the non-loop beta strands has also been randomized or mutated.
  • Fn3 fibronectin type III
  • the Fn3 domain is an Fn3 domain derived from the tenth type 3 module of human fibronectin ( 10 Fn3): VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKS TATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT (SEQ ID NO: l) (BC, CD, DE, and FG loops are underlined)
  • 10 Fn3 domain derived from the tenth type 3 module of human fibronectin ( 10 Fn3): VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKS TATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT (SEQ ID NO: l) (BC, CD, DE, and FG loops are underlined)
  • the non-ligand binding sequences of 10 Fn3, i.e. , the " 10 Fn3 scaffold” may be altered, provided that the 10
  • one or more of Asp 7, Glu 9, and Asp 23 is replaced by another amino acid, such as, for example, a non-negatively charged amino acid residue (e.g., Asn, Lys, etc.).
  • a non-negatively charged amino acid residue e.g., Asn, Lys, etc.
  • Both variant and wild-type 10 Fn3 proteins are characterized by the same structure, namely seven beta-strand domain sequences designated A through G and six loop regions (AB loop, BC loop, CD loop, DE loop, EF loop, and FG loop) which connect the seven beta-strand domain sequences.
  • the beta strands positioned closest to the N- and C-termini may adopt a beta-like conformation in solution.
  • the AB loop corresponds to residues 14-17
  • the BC loop corresponds to residues 23-31
  • the CD loop corresponds to residues 37-47
  • the DE loop corresponds to residues 51-56
  • the EF loop corresponds to residues 63-67
  • the FG loop corresponds to residues 75-87.
  • the anti-CD4 or anti-N17 Adnectin of the invention is a 10 Fn3 polypeptide that is at least 40%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, or 90% identical to the human 10 Fn3 domain, shown in SEQ ID NO: l . Much of the variability will generally occur in one or more of the loops.
  • Each of the beta or beta-like strands of a 10 Fn3 polypeptide may consist essentially of an amino acid sequence that is at least 40%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 100% identical to the sequence of a corresponding beta or beta-like strand of SEQ ID NO: 1, provided that such variation does not disrupt the stability of the polypeptide in physiological conditions.
  • the invention provides one or more Adnectins comprising a tenth fibronectin type III ( 10 Fn3) domain, wherein the 10 Fn3 domain comprises a loop, AB; a loop, BC; a loop, CD; a loop, DE; a loop EF; and a loop FG; and has at least one loop selected from loop BC, CD, DE, and FG with an altered amino acid sequence relative to the sequence of the corresponding loop of the human 10 Fn3 domain.
  • 10 Fn3 domain comprises a loop, AB; a loop, BC; a loop, CD; a loop, DE; a loop EF; and a loop FG; and has at least one loop selected from loop BC, CD, DE, and FG with an altered amino acid sequence relative to the sequence of the corresponding loop of the human 10 Fn3 domain.
  • the Adnectins of the present invention comprise an 10 Fn3 domain comprising an amino acid sequence at least 40%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the non-loop regions of SEQ ID NO: l, wherein at least one loop selected from BC, CD, DE, and FG is altered.
  • the BC and FG loops are altered, and in some embodiments, the BC, DE, and FG loops are altered, i.e. , the 10 Fn3 domains comprise non-naturally occurring loops.
  • the AB, CD and/or the EF loops are altered.
  • the CD and FG loops are altered.
  • the solvent-accessible amino acids in the strands between loops are altered, with or without alteration of the adjoining loops.
  • altered is meant one or more amino acid sequence alterations relative to a template sequence (corresponding human fibronectin domain) and includes amino acid additions, deletions, substitutions or a combination thereof. Altering an amino acid sequence may be accomplished through intentional, blind, or spontaneous sequence variation, generally of a nucleic acid coding sequence, and may occur by any technique, for example, PCR, error-prone PCR, or chemical DNA synthesis.
  • one or more loops selected from BC, CD, DE, and FG may be extended or shortened in length relative to the corresponding human fibronectin loop.
  • the length of the loop may be extended by 1-25 amino acids.
  • the length of the loop may be decreased by 1-11 amino acids.
  • a loop of 10 Fn3 may be altered in length as well as in sequence to obtain the greatest possible flexibility and affinity in antigen binding.
  • the Adnectins comprise a Fn3 domain that comprises an amino acid sequence at least 40%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% identical to the non-loop regions of SEQ ID NO: l, wherein at least one loop selected from BC, CD, DE, and FG is altered.
  • the altered BC loop has up to 1, 2, 3, 4, 5, 6, 7, 8 or 9 amino acid substitutions, up to 1, 2, 3, or 4 amino acid deletions, up to 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid insertions, or a combination thereof.
  • the altered CD loop has up to 1, 2, 3, 4, 5, 6,
  • the altered DE loop has up to 1, 2, 3, 4, 5, or 6 amino acid substitutions, up to 1, 2, 3, or 4 amino acid deletions, up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 amino acid insertions, or a combination thereof.
  • the FG loop has up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or 13 amino acid substitutions, up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11 amino acid deletions, up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16,17,18,19, 20, 21, 22, 23, 24, or 25 amino acid insertions, or a combination thereof.
  • the Adnectin molecules of the present invention may be modified to comprise an N-terminal extension sequence and/or a C-terminal extension.
  • an MG sequence may be placed at the N-terminus of the 10 Fn3 defined by SEQ ID NO: 1. The M will usually be cleaved off, leaving a G at the N-terminus.
  • the Adnectins described herein may also comprise alternative C-terminal tail sequences, referred to herein as truncated C-terminal or C-terminal extension sequences. Further, truncated version may be used as therapeutic molecules in the truncated form, or alternative C-terminal extensions, such as His6 tag, may be added to the truncated version.
  • the C-terminal extension sequences (also called “tails"), comprise E and D residues, and may be between 8 and 50, 10 and 30, 10 and 20, 5 and 10, and 2 and 4 amino acids in length.
  • the first residue of a C- terminal extension is a proline. In certain other embodiments, the first residue of a C- terminal extension is a glutamic acid.
  • the N-terminus may be extended by up to 1, 2, 3, 4, 5, 6, 7,
  • the C-terminus may be extended by up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14,15, or more amino acids, which may be altered in any way, before or after rounds of selection, in order to improve target binding, stability, or both.
  • both the N- and C-termini may be extended in this manner.
  • the amino acid sequence of anti-CD4 Adnectin loop region CD and FG of the invention include but are not limited to those listed in Table 1 below.
  • the CD loops described in Table 1 replace R30 through T49 of 10 Fn3 defined by SEQ ID NO: l.
  • the FG loops described in Table 1 replace D67 through N91 of 10 Fn3 defined by SEQ ID NO: l.
  • Table 1 also lists the IC50 values for each anti-CD4 Adnectin comprising the listed CD/FG loop combinations.
  • anti-CD4 Adnectin of the invention comprises an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the CD/FG loop region combinations of SEQ ID NOs: 13-94.
  • anti-CD4 Adnectin of the invention comprises an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of the CD loop regions of SEQ ID NOs: 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39,
  • anti-CD4 Adnectin of the invention comprises an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of the FG loop regions of SEQ ID NOs: 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40,
  • the anti-CD4 Adnectin comprises one or more of the conserved amino acids Y32, 134, Y36, Q46 and F48.
  • the anti- CD4 Adnectin comprises one or more of the conserved amino acids Y68, 170, V72, A74, T76, 188 and 190.
  • the anti-CD4 Adnectin comprises one or more of the conserved amino acids Y32, 134, Y36, Q46, F48, Y68, 170, V72, A74, T76, 188 and 190.
  • the full length amino acid sequence of anti-CD4 Adnectin of the invention include but are not limited to those listed in Table 2 below. Table 2 also lists the antiviral EC50 values for each anti-CD4 Adnectin. Table 2
  • the anti-CD4 Adnectin of the invention comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 95-114.
  • the anti-CD4 Adnectin of the invention comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 95-114, excluding any N-terminus extended region.
  • the anti-CD4 Adnectin of the invention comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 95-114, excluding any C-terminus extended region.
  • the anti-CD4 Adnectin of the invention comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 95-114, excluding both the N-terminus and C- terminus extended regions.
  • anti-CD4 Adnectin comprises an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the CD loop and FG loop regions of SEQ ID NOs: 95-114.
  • Anti-N17 Adnectin comprises an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the CD loop and FG loop regions of SEQ ID NOs: 95-114.
  • the full length amino acid sequence of anti-N17 Adnectin protein of the invention include but are not limited to those listed in Table 3 below. Table 3 also lists the antiviral EC50 values for each anti-N17 Adnectin.
  • the anti-N17 Adnectin of the invention comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 115-371.
  • the anti-N17 Adnectin of the invention comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 115-371, excluding any N-terminus extended region.
  • the anti-N17 Adnectin of the invention comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 115-371, excluding any C-terminus extended region.
  • the anti-N17 Adnectin of the invention comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 115-371, excluding both the N-terminus and C-terminus extended regions.
  • anti-N17 Adnectin comprises an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the BC loop, DE loop and FG loop regions of SEQ ID NOs : 115 -371.
  • the anti-N17 Adnectin DE loop are conserved amino acids.
  • the anti-N17 Adnectin comprises one or more of the conserved amino acids S52, V53, L54 and S55.
  • Y24 of the anti-CD4 Adnectin BC loop is a conserved amino acid.
  • position 26 of the anti-N17 Adnectin BC loop is valine or leucine.
  • Adnectin comprises one or more of the conserved amino acids G78 and S85.
  • position 79 of the anti-N17 Adnectin FG loop is valine or isoleucine.
  • the anti-N17 Adnectin comprises one or more of the conserved amino acids Y24, V26, L26, S52, V53, L54, S55 G78, V79, 179 and S85.
  • Point mutation analysis of the anti-N17 Adnectin showed advantages of mutating several 10 Fn3 non-loop scaffold positions. Specifically, mutating positions T56 and T58 boosted potency.
  • the anti-N17 Adnectin comprises mutating T58 to Asn, Glu, or Gin.
  • the fusogenic domain (often called the fusion peptide, or FP) is believed to be involved in insertion into and disruption of the target cell membrane.
  • the transmembrane domain containing the transmembrane anchor sequence, is located toward the C-terminal end of the protein. Between the fusogenic domain and
  • transmembrane anchor are two distinct regions, known as heptad repeat (HR) regions, each region having a plurality of heptads.
  • HR heptad repeat
  • the amino acid sequence comprising the HR1 region and the amino acid sequence comprising the HR2 region are each relatively conserved regions in the HIV-1 envelope protein.
  • a representative sequence of the external domain of gp41 (clade B consensus) is as follows:
  • the fusion peptide consists of approximately the first 23 amino acids, Ala512- Ser534.
  • the HR1 region has a plurality of contiguous 7 amino acid residue stretches or "heptads" (the 7 amino acids in each heptad designated “a” through “g"), with a predominance of hydrophobic residues at the first ("a") and fourth ("d") positions which interact homotypically to form the core of the 3-helix bundle structure. Neutral polar amino acids such as Glutamine may also occupy these positions.
  • One representative heptad begins with Leu545.
  • a highly conserved portion of HR1 consists of the 17 residues from Leu565 to Leu581, and is called "N17".
  • the C-terminal portion of gp41 comprises the HR2 region, which is believed to form an alpha helical structure during the fusion process, and bind into the grooves of the HRl triple helical structure.
  • HR2 also comprises heptads, though they do not interact homotypically but rather interact with amino acids from HRl.
  • One representative heptad begins at Trp628.
  • HIV fusion peptide inhibitor of the invention include but are not limited to the following sequences:
  • the HIV fusion peptide inhibitor comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 372-392.
  • a hydrophobic replacement of the aspartic acid (D) near the C-terminus of the HIV fusion peptide inhibitor provided at least a l Ox increase in potency (FIG. 8).
  • the HIV fusion peptide inhibitor comprises replacing "DK" with "YK", “LK”, “FK” or "WK”.
  • the HIV fusion peptide inhibitor comprises replacing C-terminal amino acids "WAS" to "WFS" or "WAL".
  • the various components of the Combinectin of the invention may be covalently or non-covalently linked.
  • the PK moiety may be directly or indirectly linked to a Combinectin via a polypeptide linker.
  • Suitable linkers are those which allow the separate domains to fold independently of each other forming a three dimensional structure that permits high affinity binding to a target molecule.
  • the linker is a glycine- serine based linker. These linkers comprise glycine and serine residues and may be between 8 and 50, 10 and 30, and 10 and 20 amino acids in length. Examples include linkers having an amino acid sequence (GS)v (SEQ ID NO: 393), G(GS)e (SEQ ID NO: 394), and G(GS)vG (SEQ ID NO: 395).
  • linkers contain glutamic acid, and include, for example, (GSE) 5 (SEQ ID NO: 396) and GGSEGGSE (SEQ ID NO: 397).
  • Other exemplary glycine-serine linkers include (GS) 4 (SEQ ID NO: 398), (GGGGS)v (SEQ ID NO: 399), (GGGGS) 5 (SEQ ID NO: 400), (GGGGS) 4 (SEQ ID NO: 401 (GGGGS) 3 G (SEQ ID NO: 402).
  • the linker is a glycine-proline based linker. These linkers comprise glycine and proline residues and may be between 3 and 30, 10 and 30, and 3 and 20 amino acids in length.
  • linkers having an amino acid sequence (GP) 3 G (SEQ ID NO: 403) and (GP) 5 G (SEQ ID NO: 404).
  • the linker may be a proline-alanine based linker having between 3 and 30, 10 and 30, and 3 and 20 amino acids in length.
  • proline alanine based linkers include, for example, (PA) 3 (SEQ ID NO: 405), (PA) 6 (SEQ ID NO: 406) and (PA (SEQ ID NO: 407).
  • the linker is a glutamic acid-proline based linker. These linkers comprise glutamic acid and proline residues and may be between 3 and 30, 10 and 30, and 3 and 20 amino acids in length.
  • linkers having an amino acid sequence ESPEPETPEDE SEQ ID NO: 408
  • (ESPEPETPED) 2 E SEQ ID NO: 409
  • Linkers or spacers may be introduced at the N-terminus of the anti-CD4 moiety, the C-terminus of the anti-CD4 moiety, the N-terminus of the anti-gp41 moiety, the C- terminus of the anti-gp41 moiety, the N-terminus of the HIV fusion peptide inhibitor, or combinations thereof.
  • the preferred linkers between the anti-CD4 Adnectin and anti-N17 Adnectin are short glutamine-proline rich linkers.
  • the preferred linker between the anti-N17 Adnectin and HIV fusion peptide inhibitor are flexible glycine-serine rich linkers.
  • amino acid sequences of anti-N17 Adnectin - HIV fusion peptide inhibitor Combinectin of the invention include but are not limited to those listed in Table 4 below.
  • Table 4 also lists the antiviral EC50 values for each anti-N17 Adnectin-HIV fusion peptide inhibitor Combinectin.
  • the anti-N17 Adnectin - HIV fusion peptide inhibitor Combinectin or fusion proteins thereof comprise an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the non-linker regions of any one of SEQ ID NOs: 410-428.
  • the anti-N17 Adnectin - HIV fusion peptide inhibitor Combinectin or fusion proteins thereof comprise an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the non-linker regions of any one of SEQ ID NOs: 410-428, excluding any N-terminus extended region.
  • anti-N17 Adnectin - HIV fusion peptide inhibitor N17 Adnectin - HIV fusion peptide inhibitor
  • Combinectin comprises an anti-N17 Adnectin comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the BC loop, DE loop and FG loop regions of SEQ ID NOs: 410-428.
  • the anti-N17 Adnectin - HIV fusion peptide inhibitor Combinectin comprises a HIV fusion peptide inhibitor comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the HIV fusion peptide inhibitor of SEQ ID NOs: 410-428.
  • Combinectin of the invention include but are not limited to the following sequences: Combinectin 3137 (SEQ ID NO: 3)
  • Combinectin 3151 (SEQ ID NO: 5)
  • Combinectin 3202 (SEQ ID NO: 9)
  • the anti-CD4 Adnectin sequences are underlined.
  • the anti-N17 Adnectin sequences are double underlined.
  • the HIV fusion peptide inhibitor sequences are underlined in bold.
  • the linker sequences are italicized.
  • the Combinectin or fusion proteins thereof comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 3, 5, 7 and 9.
  • the Combinectin or fusion proteins thereof comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the non- linker regions of any one of SEQ ID NOs: 3, 5, 7 and 9.
  • the Combinectin comprises an anti-CD4 Adnectin comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the CD loop and FG loop regions of SEQ ID NOs: 3, 5, 7 and 9.
  • the Combinectin comprises an anti-N17 Adnectin comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the BC loop, DE loop and FG loop regions of SEQ ID NOs: 3, 5, 7 and 9.
  • the Combinectin comprises a HIV fusion peptide inhibitor comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the HIV fusion peptide inhibitor of SEQ ID NOs: 3, 5, 7 and 9.
  • the application provides for an anti-CD4 moiety, an anti-gp41 moiety, a HIV fusion peptide inhibitor and combinations thereof further comprising a pharmacokinetic (PK) moiety.
  • PK pharmacokinetic
  • Improved pharmacokinetics may be assessed according to the perceived therapeutic need. Often it is desirable to increase bioavailability and/or increase the time between doses, possibly by increasing the time that a protein remains available in the serum after dosing. In some instances, it is desirable to improve the continuity of the serum concentration of the protein over time (e.g. , decrease the difference in serum concentration of the protein shortly after administration and shortly before the next administration).
  • the Combinectin of the invention may be attached to a moiety that reduces the clearance rate of the polypeptide in a mammal (e.g. , mouse, rat, or human) by at least two-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40- fold, at least 50-fold, at least 60-fold, at least 70-fold, at least 80-fold, at least 90-fold, at least 100-fold relative to the unmodified Combinectin.
  • Other measures of improved pharmacokinetics may include serum half-life, which is often divided into an alpha phase and a beta phase. Either or both phases may be improved significantly by addition of an appropriate moiety.
  • the PK moiety may increase the serum half-life of the polypeptide by more than 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 120%, 150%, 200%, 400%, 600%, 800%, 1000% or more relative to the Combinectin alone.
  • Moieties that slow clearance of a protein from the blood include polyoxyalkylene moieties (e.g. , polyethylene glycol), sugars (e.g., sialic acid), and well-tolerated protein moieties (e.g., Fc and fragments and variants thereof, transferrin, or serum albumin).
  • the Combinectin of the invention may also be fused to albumin or a fragment (portion) or variant of albumin as described in U.S.
  • PK moieties that can be used in the invention include those described in Kontermann et al, (Current Opinion in Biotechnology, 22:868-876 (2011)), herein incorporated by reference.
  • Such PK moieties include, but are not limited to, human serum albumin fusions, human serum albumin conjugates, human serum albumin binders (e.g. , Adnectin PKE, AlbudAb, ABD), XTEN fusions, PAS fusions (i.e. , recombinant PEG mimetics based on the three amino acids proline, alanine, and serine), carbohydrate conjugates (e.g. , hydroxy ethyl starch (HES)), glycosylation, polysialic acid conjugates, and fatty acid conjugates.
  • human serum albumin fusions e.g. , human serum albumin conjugates, human serum albumin binders (e.g. , Adnectin PKE, AlbudAb, ABD), X
  • the invention provides a Combinectin fused to a PK moiety that is a polymeric sugar.
  • the PK moiety is a polyethylene glycol moiety or an Fc region.
  • the PK moiety is a serum albumin binding protein such as those described in U.S. Publication Nos.
  • the PK moiety is human serum albumin. In some embodiments, the PK moiety is transferrin.
  • the Fc fusion-Combinectin of the invention include the sequences shown in 3137 (SEQ ID NO: 4) and 3151 (SEQ ID NO: 6) of FIG. 2.
  • the Fc fusion-Combinectin or fusion proteins thereof comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 4 and 6. In some embodiments, the Fc fusion-Combinectin or fusion proteins thereof comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the non- linker regions of any one of SEQ ID NOs: 4 and 6.
  • the Fc fusion-Combinectin comprises an anti-CD4 Adnectin comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the CD loop and FG loop regions of SEQ ID NOs: 4 and 6.
  • the Fc fusion-Combinectin comprises an anti-N17
  • Adnectin comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the BC loop, DE loop and FG loop regions of SEQ ID NOs: 4 and 6.
  • the Fc fusion-Combinectin comprises a fusion peptide inhibitor comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the HIV fusion peptide inhibitor of SEQ ID NOs: 4 and 6.
  • the HSA fusion-Combinectin of the invention include the sequences shown in 3191 (SEQ ID NO: 8) and 3202 (SEQ ID NO: 10) of FIG. 2.
  • the HSA fusion -Combinectin or fusion proteins thereof comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 8 and 10.
  • the HSA fusion-Combinectin or fusion proteins thereof comprises an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the non-linker regions of any one of SEQ ID NOs: 8 and 10.
  • the HSA fusion-Combinectin comprises an anti-CD4 Adnectin comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the CD loop and FG loop regions of SEQ ID NOs: 8 and 10.
  • the HSA fusion-Combinectin comprises an anti-N17 Adnectin comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the BC loop, DE loop and FG loop regions of SEQ ID NOs: 8 and 10.
  • the HSA fusion-Combinectin comprises a fusion peptide inhibitor comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to the HIV fusion peptide inhibitor of SEQ ID NOs: 8 and 10.
  • the anti-CD4 moiety, anti-gp41 moiety, HIV fusion peptide inhibitor and combinations thereof comprises polyethylene glycol (PEG).
  • PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler et al, Polymer Synthesis, Vol. 3, pp. 138-161, Academic Press, New York).
  • PEG polyethylene glycol molecule
  • X 0(CH 2 CH20)n-iCH2CH 2 OH
  • n 20 to 2300 and X is H or a terminal modification, e.g., a Ci-4 alkyl.
  • PEG can contain further chemical groups which are necessary for binding reactions, which result from the chemical synthesis of the molecule; or which act as a spacer for optimal distance of parts of the molecule.
  • such a PEG can consist of one or more PEG side-chains which are linked together. PEGs with more than one PEG chain are called multiarmed or branched PEGs. Branched PEGs are described in, for example, European Published Application No. 473084A and U.S. Patent No. 5,932,462.
  • One or more PEG molecules may be attached at different positions on the protein, and such attachment may be achieved by reaction with amines, thiols or other suitable reactive groups.
  • the amine moiety may be, for example, a primary amine found at the N- terminus of a polypeptide or an amine group present in an amino acid, such as lysine or arginine.
  • the PEG moiety is attached at a position on the polypeptide selected from the group consisting of: a) the N-terminus; b) between the N- terminus and the most N-terminal beta strand or beta-like strand; c) a loop or strand residue positioned on a face of the polypeptide opposite the target-binding site; d) between the C-terminus and the most C-terminal beta strand or beta-like strand; e) within a linker sequence connecting two binding domains, and f) at the C-terminus.
  • PEGylation may be achieved by site-directed PEGylation, wherein a suitable reactive group is introduced into the protein to create a site where PEGylation
  • the protein is modified to introduce a cysteine residue at a desired position, permitting site-directed PEGylation on the cysteine.
  • Mutations may be introduced into a protein coding sequence to generate cysteine residues. This might be achieved, for example, by mutating one or more amino acid residues to cysteine.
  • Preferred amino acids for mutating to a cysteine residue include serine, threonine, alanine and other hydrophilic residues.
  • the residue to be mutated to cysteine is a surface-exposed residue. Algorithms are well-known in the art for predicting surface accessibility of residues based on primary sequence or a protein.
  • surface residues may be predicted by comparing the amino acid sequences of binding polypeptides, given that the crystal structure of the framework, based on which binding polypeptides are designed and evolved, has been solved (see Himanen et al, Nature, 414:933-938 (2001)) and thus the surface-exposed residues identified.
  • PEGylation of cysteine residues may be carried out using, for example, PEG-maleimide, PEG-vinylsulfone, PEG-iodoacetamide, or PEG-orthopyridyl disulfide.
  • the PEG is typically activated with a suitable activating group appropriate for coupling to a desired site on the polypeptide.
  • PEGylation methods are well-known in the art and further described in Zalipsky, S. et al, "Use of Functionalized Poly(Ethylene Glycols) for Modification of Polypeptides" in Harris, J.M., Polyethylene Glycol
  • PEG may vary widely in molecular weight and may be branched or linear.
  • the weight-average molecular weight of PEG is from about 100 Daltons to about 150,000 Daltons.
  • Exemplary weight-average molecular weights for PEG include about 20,000 Daltons, about 40,000 Daltons, about 60,000 Daltons and about 80,000 Daltons. In certain embodiments, the molecular weight of PEG is 40,000 Daltons.
  • Branched versions of PEG having a total molecular weight of any of the foregoing can also be used.
  • the PEG has two branches.
  • the PEG has four branches.
  • the PEG is a bis-PEG (NOF Corporation, DE-200MA), to which two Adnectins are conjugated.
  • the PEGylated anti-CD4 moiety, anti-gp41 moiety, HIV fusion peptide inhibitor and combinations thereof will preferably retain at least about 25%, 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified anti-CD4 moiety, anti-gp41 moiety, Adnectin or
  • biological activity refers to its ability to bind to CD4 or gp41, as assessed by Kd, k 0 n, or k 0 s.
  • the PEGylated anti-CD4 moiety, anti-gp41 moiety, Adnectin or Combinectin thereof shows an increase in binding to CD4 or gp41 relative to unPEGylated anti-CD4 moiety, anti-gp41 moiety, Adnectin or Combinectin.
  • the peptide of the invention is fused to an immunoglobulin Fc domain, or a fragment or variant thereof.
  • a "functional Fc region” is an Fc domain or fragment thereof which retains the ability to bind FcRn.
  • a functional Fc region binds to FcRn, but does not possess effector functions. The ability of the Fc region or fragment thereof to bind to FcRn can be determined by standard binding assays known in the art.
  • the Fc region or fragment thereof binds to FcRn and possesses at least one "effector function" of a native Fc region.
  • effector functions include Clq binding; complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor; BCR), etc.
  • Such effector functions generally require the Fc region to be combined with a binding domain (e.g. , an anti-CD4 or ant-N-17 Adnectin) and can be assessed using various assays known in the art for evaluating such antibody effector functions.
  • a “native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature.
  • a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification.
  • the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g. , from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
  • the variant Fc region herein will preferably possess at least about 80% sequence identity with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and most preferably at least about 90% sequence identity therewith, more preferably at least about 95% sequence identity therewith.
  • the Fc domain is derived from an IgGl subclass, however, other subclasses (e.g., IgG2, IgG3, and IgG4) may also be used. Shown below is the sequence of a human IgGl immunoglobulin Fc domain:
  • the core hinge sequence is underlined, and the CH2 and CH3 regions are in regular text. It should be understood that the C-terminal glycine and lysine are optional in the Combinectin of the invention.
  • the fusion may be formed by attaching an Adnectin of the invention to either end of the Fc molecule, i.e. , Fc-Adnectin or Adnectin-Fc arrangements.
  • the Fc and Adnectin are fused via a linker.
  • the Fc region used in the Adnectin fusion comprises the hinge region of an Fc molecule.
  • the "hinge” region comprises the core hinge residues spanning positions 1-16 of SEQ ID NO: 11 (DKTHTCPPCPAPELLG; SEQ ID NO: 12) of the IgGl Fc region.
  • the Adnectin-Fc fusion adopts a multimeric structure (e.g., dimer) owing, in part, to the cysteine residues at positions 6 and 9 of SEQ ID NO: 11 within the hinge region.
  • an Adnectin-Fc fusion may have the following configurations: 1) Adnectin-hinge-Fc or 2) hinge-Fc- Adnectin. Therefore, any Adnectin of the present invention can be fused to an Fc region comprising a hinge sequence according to these configurations.
  • a linker may be used to join the Adnectin to the hinge-Fc moiety, for example, an exemplary fusion protein may have the configuration Adnectin-linker-hinge-Fc or hinge-Fc-linker-Adnectin.
  • a leader sequence may be placed at the N-terminus of the fusion polypeptide.
  • a leader sequence may be added to the N-terminus of the fusion molecule. If the fusion is produced in E. coli, the fusion sequence will be preceded by a methionine.
  • the invention provides an Adnectin comprising fibronectin type III domains that binds CD4 or the nl7 domain of gp41.
  • an Adnectin comprising fibronectin type III domains that binds CD4 or the nl7 domain of gp41.
  • One way to rapidly make and test Fn3 domains with specific binding properties is the nucleic acid-protein fusion technology.
  • This disclosure utilizes the in vitro expression and tagging technology, termed 'PROfusion' which exploits nucleic acid-protein fusions (RNA- and DNA-protein fusions) to identify novel polypeptides and amino acid motifs that are important for binding to proteins.
  • Nucleic acid-protein fusion technology is a technology that covalently couples a protein to its encoding genetic information.
  • Nucleic acids encoding any of the various proteins or polypeptides disclosed herein may be synthesized chemically. Codon usage may be selected so as to improve expression in a cell. Such codon usage will depend on the cell type selected. Specialized codon usage patterns have been developed for E. coli and other bacteria, as well as mammalian cells, plant cells, yeast cells and insect cells. See, for example, Mayfield et al., Proc. Natl. Acad. Sci. USA, 100(2):438-442 (Jan. 21, 2003); Sinclair et al., Protein Expr. Purif, 26(I):96-105 (Oct. 2002); Connell, N.D., Curr. Opin.
  • the DNA encoding the polypeptide is operably linked to suitable transcriptional or translational regulatory elements derived from mammalian, viral, or insect genes.
  • suitable transcriptional or translational regulatory elements include a transcriptional promoter, an optional operator sequence to control transcription, a sequence encoding suitable mRNA ribosomal binding site, and sequences that control the termination of transcription and translation.
  • the ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants is additionally incorporated.
  • the proteins described herein may be produced recombinantly not only directly, but also as a fusion polypeptide with a heterologous polypeptide, which is preferably a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
  • a heterologous polypeptide which is preferably a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
  • the heterologous signal sequence selected preferably is one that is recognized and processed ⁇ i.e. , cleaved by a signal peptidase) by the host cell.
  • the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase, 1 pp, or heat-stable enterotoxin II leaders.
  • the native signal sequence may be substituted by, e.g. , a yeast invertase leader, a factor leader (including Saccharomyces and Kluyveromyces alpha- factor leaders), or acid phosphatase leader, the C. albicans glucoamylase leader, or the signal sequence described in U.S. Patent No. 5,631,144.
  • mammalian signal sequences as well as viral secretory leaders for example, the herpes simplex gD signal, are available.
  • the DNA for such precursor regions may be ligated in reading frame to DNA encoding the protein.
  • Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells. Generally, in cloning vectors this sequence is one that enables the vector to replicate independently of the host
  • chromosomal DNA includes origins of replication or autonomously replicating sequences. Such sequences are well known for a variety of bacteria, yeast, and viruses.
  • the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, the 2 micron plasmid origin is suitable for yeast, and various viral origins (SV40, polyoma, adenovirus, VSV or BPV) are useful for cloning vectors in mammalian cells.
  • the origin of replication component is not needed for mammalian expression vectors (the SV40 origin may typically be used only because it contains the early promoter).
  • Selection genes may contain a selection gene, also termed a selectable marker.
  • Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g. , ampicillin, neomycin, methotrexate, or tracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media, e.g., the gene encoding D-alanine racemase for Bacilli.
  • Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to the nucleic acid encoding the protein of the invention, e.g. , a fibronectin-based scaffold protein.
  • Promoters suitable for use with prokaryotic hosts include the phoA promoter, beta-lactamase and lactose promoter systems, alkaline phosphatase, a tryptophan (trp) promoter system, and hybrid promoters such as the tan promoter.
  • trp tryptophan
  • other known bacterial promoters are suitable.
  • Promoters for use in bacterial systems also will contain a Shine-Dalgarno (S.D.) sequence operably linked to the DNA encoding the protein of the invention.
  • Promoter sequences are known for eukaryotes. Virtually all eukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated. Another sequence found 70 to 80 bases upstream from the start of transcription of many genes is a CNCAAT region where N may be any nucleotide. At the 3' end of most eukaryotic genes is an AATAAA sequence that may be the signal for addition of the poly A tail to the 3' end of the coding sequence. All of these sequences are suitably inserted into eukaryotic expression vectors.
  • suitable promoting sequences for use with yeast hosts include the promoters for 3-phosphogly cerate kinase or other glycolytic enzymes, such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphogly cerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase.
  • 3-phosphogly cerate kinase or other glycolytic enzymes such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphogly cerate mutase, pyruvate
  • Transcription from vectors in mammalian host cells can be controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and most preferably Simian Virus 40 (SV40), from heterologous mammalian promoters, e.g. , the actin promoter or an immunoglobulin promoter, from heat-shock promoters, provided such promoters are compatible with the host cell systems.
  • viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and most preferably Simian Virus 40 (
  • Enhancer sequences are now known from mammalian genes (globin, elastase, albumin, a- fetoprotein, and insulin). Typically, however, one will use an enhancer from a eukaryotic cell virus. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
  • the enhancer may be spliced into the vector at a position 5 Or 3' to the peptide-encoding sequence, but is preferably located at a site 5' from the promoter.
  • Expression vectors used in eukaryotic host cells will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5' and, occasionally 3', untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of mRNA encoding the protein of the invention.
  • One useful transcription termination component is the bovine growth hormone polyadenylation region. See WO 94/11026 and the expression vector disclosed therein.
  • the recombinant DNA can also include any type of protein tag sequence that may be useful for purifying the protein.
  • protein tags include, but are not limited to, a histidine tag, a FLAG tag, a myc tag, an HA tag, or a GST tag.
  • Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts can be found in Cloning Vectors: A Laboratory Manual, Elsevier, New York (1985), the relevant disclosure of which is hereby incorporated by reference.
  • the expression construct is introduced into the host cell using a method appropriate to the host cell, as will be apparent to one of skill in the art.
  • a variety of methods for introducing nucleic acids into host cells are known in the art, including, but not limited to, electroporation; transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (where the vector is an infectious agent).
  • Suitable host cells include prokaryotes, yeast, mammalian cells, or bacterial cells.
  • Suitable bacteria include gram negative or gram positive organisms, for example, E. coli or Bacillus spp. Yeast, preferably from the Saccharomyces species, such as S. cerevisiae, may also be used for production of polypeptides.
  • Saccharomyces species such as S. cerevisiae
  • Various mammalian or insect cell culture systems can also be employed to express recombinant proteins. Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow et al. ⁇ Bio/Technology, 6:47 (1988)).
  • suitable mammalian host cell lines include endothelial cells, COS-7 monkey kidney cells, CV-1, L cells, CI 27, 3T3, Chinese hamster ovary (CHO), human embryonic kidney cells, HeLa, 293, 293T, and BHK cell lines.
  • Purified polypeptides are prepared by culturing suitable host/vector systems to express the recombinant proteins. For many applications, the small size of many of the polypeptides disclosed herein would make expression in E. coli as the preferred method for expression. The protein is then purified from culture media or cell extracts.
  • the present invention is also directed to cell lines that express a Combinectin or fusion protein thereof. Creation and isolation of cell lines producing a Combinectin can be accomplished using standard techniques known in the art, such as those described herein.
  • Host cells are transformed with the herein-described expression or cloning vectors for protein production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
  • the host cells used for high- throughput protein production (HTPP) and mid-scale production were those from the HMS 174-bacterial strain.
  • the host cells used to produce the proteins of this invention may be cultured in a variety of media.
  • Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium ((MEM), (Sigma), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma)) are suitable for culturing the host cells.
  • MEM Minimal Essential Medium
  • RPMI-1640 Sigma
  • DMEM Dulbecco's Modified Eagle's Medium
  • 4,767,704, 4,657,866, 4,927,762, 4,560,655, 5,122,469, 6,048,728, 5,672,502, or U.S. Patent No. RE 30,985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as Gentamycin drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
  • the culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
  • Proteins disclosed herein can also be produced using cell-free translation systems.
  • the nucleic acids encoding the polypeptide must be modified to allow in vitro transcription to produce mRNA and to allow cell-free translation of the mRNA in the particular cell-free system being utilized (eukaryotic such as a mammalian or yeast cell-free translation system or prokaryotic such as a bacterial cell-free translation system.
  • Proteins of the invention can also be produced by chemical synthesis (e.g. , by the methods described in Solid Phase Peptide Synthesis, Second Edition, The Pierce
  • proteins of the present invention can be purified by isolation/purification methods for proteins generally known in the field of protein chemistry. Non-limiting examples include extraction, recrystallization, salting out (e.g. , with ammonium sulfate or sodium sulfate), centrifugation, dialysis, ultrafiltration, adsorption chromatography, ion exchange chromatography, hydrophobic chromatography, normal phase chromatography, reversed-phase chromatography, get filtration, gel permeation chromatography, affinity chromatography, electrophoresis, countercurrent distribution or any combinations of these.
  • polypeptides may be exchanged into different buffers and/or concentrated by any of a variety of methods known to the art, including, but not limited to, filtration and dialysis.
  • the purified polypeptide is preferably at least 85% pure, or preferably at least 95% pure, and most preferably at least 98% pure. Regardless of the exact numerical value of the purity, the polypeptide is sufficiently pure for use as a pharmaceutical product.
  • Binding of the protein of the invention to a target molecule may be assessed in terms of equilibrium constants (e.g., dissociation, Kd) and in terms of kinetic constants (e.g. , on-rate constant, k 0 n and off-rate constant, k 0 s).
  • the protein of the invention will generally bind to a target molecule with aKd of less than 500 nM, 100 nM, 10 nM, 1 nM, 500 pM, 200 pM, or 100 pM, although higher Kd values may be tolerated where the k 0 s is sufficiently low or the k 0 n, is sufficiently high.
  • Proteins that bind CD4 or gp41 can be identified using various in vitro assays.
  • the assays are high-throughput assays that allow for screening multiple candidates simultaneously.
  • biomolecular interactions can be monitored in real time with the BIACORE® system, which uses SPR to detect changes in the resonance angle of light at the surface of a thin gold film on a glass support due to changes in the refractive index of the surface up to 300 nm away.
  • BIACORE® analysis generates association rate constants, dissociation rate constants, equilibrium dissociation constants, and affinity constants. Binding affinity is obtained by assessing the association and dissociation rate constants using a BIACORE® surface plasmon resonance system (Biacore, Inc.).
  • a biosensor chip is activated for covalent coupling of the target.
  • the target is then diluted and injected over the chip to obtain a signal in response units of immobilized material. Since the signal in resonance units (RU) is proportional to the mass of immobilized material, this represents a range of immobilized target densities on the matrix.
  • Association and dissociation data are fit simultaneously in a global analysis to solve the net rate expression for a 1 : 1 bimolecular interaction, yielding best fit values for k 0 n, k 0 s and Rmax (maximal response at saturation).
  • Equilibrium dissociation constants for binding, Kd's are calculated from SPR measurements as k 0 s/k 0 n.
  • the Combinectin of the invention exhibit a Kd of ⁇ or less.
  • the Kd is ⁇ ⁇ or less. More preferably, the Kd is InM or less.
  • the Combinectin of the invention exhibit an ICso of 5 nM or less, 4 nM or less, 3 nM or less, 2.5 nM or less, 2 nM or less, 1.5 nM or less, 1 nM or less, 0.5 nM or less, 0.2 nM or less, or 0.1 nM or less.
  • the IC50 is 1.5 nM or less. More preferably, the IC50 is 0.5 nM or less.
  • the assays described herein above are exemplary, and that any method known in the art for determining the binding affinity between proteins (e.g. , fluorescence based-transfer (FRET), enzyme-linked immunosorbent assay, and competitive binding assays (e.g. , radioimmunoassays)) can be used to assess the binding affinities of the Combinectin of the invention.
  • FRET fluorescence based-transfer
  • enzyme-linked immunosorbent assay e.g. , enzyme-linked immunosorbent assay
  • competitive binding assays e.g. , radioimmunoassays
  • ELISA assays were utilized for identifying Adnectins that bind to CD4 or gp41, with affinities determined by BIACORE® SPR.
  • FACS assays were also used to determine the EC50 of binding of the CD4 Adnectin (alone and as part of the full Combinectin) to CD4 as presented naturally on T-cell surfaces. Peptide affinities were measured by BIACORE® SPR.
  • the range of binding affinities (by SPR) for CD4 Adnectins to CD4 was 0.3 nM to 140 nM; the range for N17 Adnectins binding to artificial gp41 -based targets was 0.5 nM to 40 nM; the range for peptide binding was 0.2 nM to 70 nM.
  • SPR-based affinities for the Combinectin of the invention and for the individual components thereof are shown in Table 5 below. Table 5
  • the present invention provides Combinectins useful for the treatment of HIV. Accordingly, in certain embodiments the invention provides methods for attenuating or inhibiting HIV fusion in a subject comprising administering an effective amount of the Combinectin of the invention to a subject.
  • the subject is a human.
  • the Combinectin of the invention is pharmaceutically acceptable to a mammal, in particular a human.
  • a "pharmaceutically acceptable" polypeptide refers to a polypeptide that is administered to an animal without significant adverse medical consequences.
  • the Combinectin of the present invention will be administered to a subject in combination (concurrently or separately) with an agent known in the art to be useful for the particular disorder or disease being treated.
  • the target patient population for Combinectin therapy is one that is not amenable to standard therapy for the disease being treated due to, e.g. , age, pre-existing conditions, genetic makeup, and/or co-morbidities.
  • the Combinectin of the invention can serve as an alternative to existing therapies that are associated with substantial side effects or safety concerns.
  • the target patient population for Combinectin therapy is comprised of uninfected individuals at high risk of infection, due to lifestyle or other aggravating factors.
  • the Combinectin is used to protect these individuals from getting infected by HIV (pre-exposure prophylaxis).
  • the present invention further provides pharmaceutical compositions comprising a Combinectin or fusion proteins thereof described herein, wherein the composition is essentially endotoxin free, or at least contain no more than acceptable levels of endotoxins as determined by the appropriate regulatory agency (e.g., FDA).
  • FDA regulatory agency
  • compositions of the present invention can be in the form of a pill, tablet, capsule, liquid, or sustained release tablet for oral administration; a liquid for intravenous, subcutaneous or parenteral administration; or a gel, lotion, ointment, cream, or a polymer or other sustained release vehicle for local administration, or an atomizable suspension suitable for inhaled or intranasal administration.
  • compositions for parenteral administration may, for example, contain excipients, sterile water, saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or hydrogenated
  • Nanoparticulate compositions e.g. , biodegradable
  • nanoparticles solid lipid nanoparticles, liposomes
  • Other potentially useful parenteral delivery systems include ethylene-vinyl acetate copolymer particles, osmotic pumps, implantable infusion systems, and liposomes.
  • concentration of the compound in the composition varies depending upon a number of factors, including the dosage of the drug to be administered, and the route of administration.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride;
  • benzalkonium chloride benzethonium chloride
  • phenol butyl or benzyl alcohol
  • alkyl parabens such as methyl or propyl paraben
  • catechol resorcinol
  • cyclohexanol 3- pentanol
  • m-cresol low molecular weight (less than about 10 residues) polypeptides
  • proteins such as serum albumin, gelatin, or immunoglobulins
  • hydrophilic polymers such as polyvinylpyrrolidone
  • amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine
  • monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrans chelating agents such as EDTA
  • sugars such as sucrose, mannitol, trehalose or sorbitol
  • salt-forming counter-ions such as sodium
  • metal complexes e.g.
  • the active ingredients may also be entrapped in a microcapsule prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsule and poly-(methylmethacylate) microcapsule, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the proteins of the invention, which matrices are in the form of shaped articles, e.g. , films, or microcapsule. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Patent No.
  • copolymers of L-glutamic acid and y ethyl-L- glutamate non-degradable ethylene-vinyl acetate
  • degradable lactic acid-gly colic acid copolymers such as the LUPRON DEPOT® (injectable microspheres composed of lactic acid-gly colic acid copolymer and leuprolide acetate)
  • poly-D-(-)-3-hydroxybutyric acid While polymers such as ethylene-vinyl acetate and lactic acid-gly colic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
  • encapsulated proteins of the invention may remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37 °C, resulting in a loss of biological activity and possible changes in immunogenicity.
  • Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S— S bond formation through thio-disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
  • compositions of the present invention for oral use include tablets containing the active ingredient(s) in a mixture with non-toxic pharmaceutically acceptable excipients.
  • excipients may be, for example, inert diluents or fillers (e.g. , sucrose and sorbitol), lubricating agents, glidants, and anti-adhesives (e.g. , magnesium stearate, zinc stearate, stearic acid, silicas, hydrogenated vegetable oils, or talc).
  • Compositions for oral use may also be provided as chewable tablets, or as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium.
  • compositions to be used for in vivo administration typically must be sterile. This may be accomplished by filtration through sterile filtration membranes. Where the composition is lyophilized, sterilization using this method may be conducted either prior to or following lyophilization and reconstitution.
  • the composition for parenteral administration may be stored in lyophilized form or in solution.
  • parenteral compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic inj ection needle.
  • the pharmaceutical composition may be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or a dehydrated or lyophilized powder.
  • Such formulations may be stored either in a ready-to-use form or in a form (e.g. , lyophilized) requiring reconstitution prior to administration.
  • compositions herein may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
  • a pharmaceutical composition comprising a Combinectin or fusion protein thereof of the present invention can be administered to a subject with HIV using standard administration techniques including oral, parenteral, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository administration.
  • administration of the Combinectins of the invention is parenteral.
  • parenteral as used herein includes intravenous, intramuscular, subcutaneous, rectal, vaginal, or intraperitoneal administration. Peripheral systemic delivery by intravenous or intraperitoneal or subcutaneous injection is preferred.
  • a therapeutically effective dose refers to a dose that produces the therapeutic effects for which it is administered.
  • An effective amount of a pharmaceutical composition to be employed therapeutically will depend, for example, upon the therapeutic context and objectives.
  • One skilled in the art will appreciate that the appropriate dosage levels for treatment will thus vary depending, in part, upon the molecule delivered, the indication for which the binding agent molecule is being used, the route of administration, and the size (body weight, body surface or organ size) and condition (the age and general health) of the patient.
  • the therapeutically effective dose can be estimated initially either in cell culture assays or in animal models such as mice, rats, rabbits, dogs, pigs, or monkeys.
  • animal models such as mice, rats, rabbits, dogs, pigs, or monkeys.
  • An animal model may also be used to determine the appropriate concentration range and route of administration. Such information can then be used to determine useful doses and routes for administration in humans.
  • the exact dosage will be determined in light of factors related to the subject requiring treatment, and may be ascertained using standard techniques. Dosage and administration are adjusted to provide sufficient levels of the active compound or to maintain the desired effect. Factors that may be taken into account include the severity of the disease state, the general health of the subject, the age, weight, and gender of the subject, time and frequency of administration, drug combination(s), reaction sensitivities, and response to therapy.
  • the Combinectin of the present invention are administered at about 0.01 mg/kg to about 50 mg/kg per day, preferably about 0.01 mg/kg to about 30 mg/kg per day, most preferably about 0.01 mg/kg to about 20 mg/kg per day.
  • the Combinectin of the present invention are administered at weekly dosages of about 0.01 mg/kg to about 10 mg/kg, more preferably about 0.01 to about 5 mg/kg, most preferably about 0.01 to about 1 mg/kg.
  • the Combinectin of the present invention are administered at weekly dosages of about 0.01 mg/kg to about 10 mg/kg, more preferably about 0.01 to about 5 mg/kg, most preferably about 0.01 to about 1 mg/kg.
  • Combinectin of the invention are administered at about 15 to about lOOmg/week, from about 20 to about 80mg/week, from about 20 to about 60mg/week, or about 20 to about 25 mg/week.
  • compositions are administered until a dosage is reached that achieves the desired effect.
  • the composition may therefore be administered as a single dose or as multiple doses (at the same or different
  • the Combinectin may be given daily (e.g. , once, twice, three times, or four times daily) or less frequently (e.g. , once every other day, once or twice weekly, or monthly).
  • adjustments for age as well as the body weight, general health, sex, diet, time of administration, drug interaction, and the severity of the disease may be necessary, and will be ascertainable with routine experimentation by those skilled in the art.
  • the Combinectin is suitably administered to the patient at one time or over a series of treatments.
  • a Combinectin or a fusion thereof, and one or more additional therapeutic agents may occur as described above for therapeutic applications.
  • Suitable pharmaceutically acceptable carriers, diluents, and excipients for co-administration will be understood by the skilled artisan to depend on the identity of the particular therapeutic agent being administered.
  • the Combinectin of the invention can be provided in a kit, a packaged combination of reagents in predetermined amounts with instructions for use in the therapeutic or diagnostic methods of the invention.
  • an article of manufacture containing materials useful for the treatment or prevention of the disorders or conditions described above comprises a container and a label.
  • Suitable containers include, for example, bottles, vials, syringes, and test tubes.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container holds a composition of the invention which is effective for treating HIV and may have a sterile access port (for example, the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • the active agent in the composition is a Combinectin of the invention.
  • the label on, or associated with, the container indicates that the composition is used for treating HIV.
  • the article of manufacture may further comprise a second container comprising a pharmaceutically - acceptable buffer, such as phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use. Incorporation by Reference
  • Harvest is performed using a centrifuge.
  • MICROFLUIDIZER® followed by clarification by centrifugation or tangential flow filtration. Lysate is processed immediately or frozen for later use.
  • DNA is transfected into appropriate mammalian cells.
  • DNA is transfected into appropriate mammalian cells.
  • MT-2 cells were propagated in RPMI 1640 medium supplemented with 10% heat-inactivated fetal bovine serum (FBS), 10 mM HEPES buffer pH 7.55, and 2 mM L-glutamine.
  • FBS heat-inactivated fetal bovine serum
  • HEK 293T cells were propagated in DMEM media supplemented with 10% heat-inactivated FBS, 10 mM HEPES buffer pH 7.55 and 2 mM L-glutamine.
  • NL-Rluc virus in which a section of the nef gene from the proviral clone of NL4-3 was replaced with the Renilla luciferase gene, was constructed at Bristol-Myers Squibb.
  • the replication-competent virus was harvested 3 days after transfection of HEK 293T cells with the modified pNL- Rluc proviral clone. Transfections were performed using Lipofectamine Plus (Invitrogen, Carlsbad, CA), according to manufacturer's instruction. Virus was titered in MT-2 cells using luciferase enzyme activity as a biomarker.
  • NL-Rluc virus used to infect MT-2 cells a multiplicity of 0.01 for 1 hour before adding to the peptides in 96-well plates. Peptides were serially diluted three-fold and 11 concentrations were plated in triplicate. After 4-5 days of incubation, cells were processed and quantitated for virus growth by the amount of expressed luciferase. Luciferase was quantitated using the Dual Luciferase kit from Promega (Madison, WI), with modifications to the manufacturer's protocol.
  • Fc-Combinectin fusions were captured via the protein PRD828 (BMS) that specifically binds the peptide component of Combinectins and detected using a Goat anti-Human IgG Fc-HRP conjugated pAb (Pierce #31413).
  • HSA-Combinectin fusions were captured via PRD828 and detected using a goat pAb against HSA (Bethyl, TX #A80-229A) that was ruthenium labeled. Sample concentrations were calculated from a standard curve using a 5-parameter logarithmic fit. Non-compartmental analyses were performed using Phoenix
  • WINNONLIN® 6.3 (Pharsight Corporation, Mountain View, CA) using a plasma model and linear up/log down calculation method.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Virology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • AIDS & HIV (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Communicable Diseases (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Immunology (AREA)
PCT/US2016/027424 2015-04-24 2016-04-14 Polypeptides targeting hiv fusion Ceased WO2016171980A1 (en)

Priority Applications (20)

Application Number Priority Date Filing Date Title
EA201792269A EA035332B1 (ru) 2015-04-24 2016-04-14 Полипептиды, нацеленные на слияние вич
KR1020177033985A KR20170138558A (ko) 2015-04-24 2016-04-14 Hiv 융합을 표적으로 하는 폴리펩티드
BR112017022790-8A BR112017022790A2 (pt) 2015-04-24 2016-04-14 polipeptídeo, composição farmacêutica, e, método para tratamento de hiv.
EP21176464.2A EP3985020A1 (en) 2015-04-24 2016-04-14 Polypeptides targeting hiv fusion
AU2016252008A AU2016252008B2 (en) 2015-04-24 2016-04-14 Polypeptides targeting HIV fusion
ES16718817T ES2884267T3 (es) 2015-04-24 2016-04-14 Polipéptidos dirigidos a la fusión con el vih
JP2017555557A JP6894846B2 (ja) 2015-04-24 2016-04-14 Hiv融合体を標的とするポリペプチド
MX2017013687A MX2017013687A (es) 2015-04-24 2016-04-14 Polipeptidos dirigidos a la fusion de vih.
CN201680036930.XA CN107922474A (zh) 2015-04-24 2016-04-14 靶向hiv融合的多肽
SG11201708441RA SG11201708441RA (en) 2015-04-24 2016-04-14 Polypeptides targeting hiv fusion
CR20170482A CR20170482A (es) 2015-04-24 2016-04-14 Polipéptidos dirigidos a la fusión de vih
HK18102882.7A HK1243432A1 (zh) 2015-04-24 2016-04-14 靶向hiv融合物之多肽
EP16718817.6A EP3286212B1 (en) 2015-04-24 2016-04-14 Polypeptides targeting hiv fusion
CA2983276A CA2983276A1 (en) 2015-04-24 2016-04-14 Polypeptides targeting hiv fusion
US15/568,830 US10407490B2 (en) 2015-04-24 2016-04-14 Polypeptides targeting HIV fusion
IL255122A IL255122A0 (en) 2015-04-24 2017-10-18 Polypeptides targeting hiv fusion
PH12017501914A PH12017501914A1 (en) 2015-04-24 2017-10-19 Polypeptides targeting hiv fusion
CONC2017/0011583A CO2017011583A2 (es) 2015-04-24 2017-11-14 Polipéptidos dirigidos a la fusión de vih
US16/533,941 US11155602B2 (en) 2015-04-24 2019-08-07 Polypeptides targeting HIV fusion
AU2019226255A AU2019226255A1 (en) 2015-04-24 2019-09-06 Polypeptides targeting hiv fusion

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201562152271P 2015-04-24 2015-04-24
US62/152,271 2015-04-24
US201562257474P 2015-11-19 2015-11-19
US62/257,474 2015-11-19

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US15/568,830 A-371-Of-International US10407490B2 (en) 2015-04-24 2016-04-14 Polypeptides targeting HIV fusion
EP21176464.2A Previously-Filed-Application EP3985020A1 (en) 2015-04-24 2016-04-14 Polypeptides targeting hiv fusion
US16/533,941 Division US11155602B2 (en) 2015-04-24 2019-08-07 Polypeptides targeting HIV fusion

Publications (1)

Publication Number Publication Date
WO2016171980A1 true WO2016171980A1 (en) 2016-10-27

Family

ID=55809237

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/027424 Ceased WO2016171980A1 (en) 2015-04-24 2016-04-14 Polypeptides targeting hiv fusion

Country Status (25)

Country Link
US (2) US10407490B2 (cg-RX-API-DMAC7.html)
EP (2) EP3286212B1 (cg-RX-API-DMAC7.html)
JP (3) JP6894846B2 (cg-RX-API-DMAC7.html)
KR (1) KR20170138558A (cg-RX-API-DMAC7.html)
CN (1) CN107922474A (cg-RX-API-DMAC7.html)
AU (2) AU2016252008B2 (cg-RX-API-DMAC7.html)
BR (1) BR112017022790A2 (cg-RX-API-DMAC7.html)
CA (1) CA2983276A1 (cg-RX-API-DMAC7.html)
CL (1) CL2017002687A1 (cg-RX-API-DMAC7.html)
CO (1) CO2017011583A2 (cg-RX-API-DMAC7.html)
CR (1) CR20170482A (cg-RX-API-DMAC7.html)
DO (1) DOP2017000246A (cg-RX-API-DMAC7.html)
EA (1) EA035332B1 (cg-RX-API-DMAC7.html)
ES (1) ES2884267T3 (cg-RX-API-DMAC7.html)
HK (1) HK1243432A1 (cg-RX-API-DMAC7.html)
IL (1) IL255122A0 (cg-RX-API-DMAC7.html)
MA (2) MA56222A (cg-RX-API-DMAC7.html)
MX (1) MX2017013687A (cg-RX-API-DMAC7.html)
PE (1) PE20180162A1 (cg-RX-API-DMAC7.html)
PH (1) PH12017501914A1 (cg-RX-API-DMAC7.html)
PT (1) PT3286212T (cg-RX-API-DMAC7.html)
SG (1) SG11201708441RA (cg-RX-API-DMAC7.html)
TW (1) TW201643185A (cg-RX-API-DMAC7.html)
UY (1) UY36650A (cg-RX-API-DMAC7.html)
WO (1) WO2016171980A1 (cg-RX-API-DMAC7.html)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN106755100A (zh) * 2017-02-20 2017-05-31 李因传 可控性hiv‑1基因组靶向编辑系统和其靶向载运系统
WO2019123262A1 (en) 2017-12-18 2019-06-27 VIIV Healthcare UK (No.5) Limited Antigen binding polypeptides
WO2021081515A3 (en) * 2019-10-25 2021-06-24 Cidara Therapeutics, Inc. Compositions and methods for the treatment of human immunodeficiency virus
EP3835308A4 (en) * 2018-08-09 2021-11-24 Fapon Biotech Inc. SYNTHETIC PEPTIDE FOR THE DETECTION OF HIV-1

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3230492A1 (en) * 2021-08-30 2023-03-09 Kanglin Biotechnology (Hangzhou) Co., Ltd. Gene sequence construct for gene therapy for hiv infection

Citations (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
USRE30985E (en) 1978-01-01 1982-06-29 Serum-free cell culture media
US4560655A (en) 1982-12-16 1985-12-24 Immunex Corporation Serum-free cell culture medium and process for making same
US4657866A (en) 1982-12-21 1987-04-14 Sudhir Kumar Serum-free, synthetic, completely chemically defined tissue culture media
US4767704A (en) 1983-10-07 1988-08-30 Columbia University In The City Of New York Protein-free culture medium
US4927762A (en) 1986-04-01 1990-05-22 Cell Enterprises, Inc. Cell culture medium with antioxidant
EP0473084A2 (en) 1990-08-28 1992-03-04 Sumitomo Pharmaceuticals Company, Limited Polyethylene glycol derivatives, their modified peptides, methods for producing them and use of the modified peptides
US5122469A (en) 1990-10-03 1992-06-16 Genentech, Inc. Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US5631144A (en) 1989-04-28 1997-05-20 Transgene S.A. Application of novel DNA fragments as a coding sequence for a signal peptide for the secretion of mature proteins by recombinant yeast, expression cassettes, transformed yeast and corresponding process for the preparation of proteins
US5672502A (en) 1985-06-28 1997-09-30 Celltech Therapeutics Limited Animal cell culture
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
US6048728A (en) 1988-09-23 2000-04-11 Chiron Corporation Cell culture medium for enhanced cell growth, culture longevity, and product expression
US6207446B1 (en) 1997-01-21 2001-03-27 The General Hospital Corporation Selection of proteins using RNA-protein fusions
US6261804B1 (en) 1997-01-21 2001-07-17 The General Hospital Corporation Selection of proteins using RNA-protein fusions
WO2002004523A2 (en) 2000-07-11 2002-01-17 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US6818418B1 (en) 1998-12-10 2004-11-16 Compound Therapeutics, Inc. Protein scaffolds for antibody mimics and other binding proteins
US20050287153A1 (en) 2002-06-28 2005-12-29 Genentech, Inc. Serum albumin binding peptides for tumor targeting
US20070048282A1 (en) 2004-02-09 2007-03-01 Human Genome Sciences, Inc. Albumin fusion proteins
US20070178082A1 (en) 2002-11-08 2007-08-02 Ablynx N.V. Stabilized single domain antibodies
US20070269422A1 (en) 2006-05-17 2007-11-22 Ablynx N.V. Serum albumin binding proteins with long half-lives
US20090022720A1 (en) * 2007-07-20 2009-01-22 Stephan Fischer Conjugate of an antibody against CD4 and antifusogenic peptides
WO2009083804A2 (en) 2007-12-27 2009-07-09 Novartis Ag Improved fibronectin-based binding molecules and their use
WO2009133208A1 (en) 2008-05-02 2009-11-05 Novartis Ag Improved fibronectin-based binding molecules and uses thereof
US7696320B2 (en) 2004-08-24 2010-04-13 Domantis Limited Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor
WO2011077093A1 (en) * 2009-12-22 2011-06-30 Aarhus Universitet Bivalent molecules for hiv entry inhibition
WO2011130354A1 (en) * 2010-04-13 2011-10-20 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind pcsk9
WO2014206336A1 (en) * 2013-06-28 2014-12-31 Fudan University A hiv-1 fusion inhibitor with long half-life

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2265701A (en) * 1999-12-16 2001-06-25 Tanox, Inc. Anti-hiv-1 conjugates for treatment of hiv disease
AU2003299085B2 (en) * 2002-09-27 2008-04-10 Tanox, Inc. Synergistic compositions for the prevention and treatment of acquired immunodeficiency syndrome
ES2705714T3 (es) 2008-10-31 2019-03-26 Janssen Biotech Inc Métodos y usos de dominio de Fibronectina tipo III basado en estructuras de composiciones
GB0920944D0 (en) * 2009-11-30 2010-01-13 Biotest Ag Agents for treating disease
TW201138808A (en) * 2010-05-03 2011-11-16 Bristol Myers Squibb Co Serum albumin binding molecules
CN102939538A (zh) * 2010-05-07 2013-02-20 霍夫曼-拉罗奇有限公司 用于离体检测细胞的诊断方法
CN103380143B (zh) 2010-12-22 2016-01-06 百时美施贵宝公司 结合il-23的基于纤连蛋白的支架结构域蛋白质
WO2012159164A1 (en) 2011-05-23 2012-11-29 Phylogica Limited Method of determining, identifying or isolating cell-penetrating peptides
JP6440496B2 (ja) 2011-09-27 2018-12-19 ヤンセン バイオテツク,インコーポレーテツド 選択的結合表面を有するフィブロネクチンiii型反復ベースのタンパク質スカフォールド
EP2951206A2 (en) * 2013-02-01 2015-12-09 Bristol-Myers Squibb Company Fibronectin based scaffold proteins
EP2968587A2 (en) * 2013-03-13 2016-01-20 Bristol-Myers Squibb Company Fibronectin based scaffold domains linked to serum albumin or a moiety binding thereto

Patent Citations (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
USRE30985E (en) 1978-01-01 1982-06-29 Serum-free cell culture media
US4560655A (en) 1982-12-16 1985-12-24 Immunex Corporation Serum-free cell culture medium and process for making same
US4657866A (en) 1982-12-21 1987-04-14 Sudhir Kumar Serum-free, synthetic, completely chemically defined tissue culture media
US4767704A (en) 1983-10-07 1988-08-30 Columbia University In The City Of New York Protein-free culture medium
US5672502A (en) 1985-06-28 1997-09-30 Celltech Therapeutics Limited Animal cell culture
US4927762A (en) 1986-04-01 1990-05-22 Cell Enterprises, Inc. Cell culture medium with antioxidant
US6048728A (en) 1988-09-23 2000-04-11 Chiron Corporation Cell culture medium for enhanced cell growth, culture longevity, and product expression
US5631144A (en) 1989-04-28 1997-05-20 Transgene S.A. Application of novel DNA fragments as a coding sequence for a signal peptide for the secretion of mature proteins by recombinant yeast, expression cassettes, transformed yeast and corresponding process for the preparation of proteins
EP0473084A2 (en) 1990-08-28 1992-03-04 Sumitomo Pharmaceuticals Company, Limited Polyethylene glycol derivatives, their modified peptides, methods for producing them and use of the modified peptides
US5122469A (en) 1990-10-03 1992-06-16 Genentech, Inc. Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
US6261804B1 (en) 1997-01-21 2001-07-17 The General Hospital Corporation Selection of proteins using RNA-protein fusions
US6258558B1 (en) 1997-01-21 2001-07-10 The General Hospital Corporation Method for selection of proteins using RNA-protein fusions
US6207446B1 (en) 1997-01-21 2001-03-27 The General Hospital Corporation Selection of proteins using RNA-protein fusions
US6281344B1 (en) 1997-01-21 2001-08-28 The General Hospital Corporation Nucleic acid-protein fusion molecules and libraries
US6518018B1 (en) 1997-01-21 2003-02-11 The General Hospital Corporation RNA-antibody fusions and their selection
US6214553B1 (en) 1997-01-21 2001-04-10 Massachusetts General Hospital Libraries of protein encoding RNA-protein fusions
US6818418B1 (en) 1998-12-10 2004-11-16 Compound Therapeutics, Inc. Protein scaffolds for antibody mimics and other binding proteins
WO2002004523A2 (en) 2000-07-11 2002-01-17 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US20050287153A1 (en) 2002-06-28 2005-12-29 Genentech, Inc. Serum albumin binding peptides for tumor targeting
US20070178082A1 (en) 2002-11-08 2007-08-02 Ablynx N.V. Stabilized single domain antibodies
US20070048282A1 (en) 2004-02-09 2007-03-01 Human Genome Sciences, Inc. Albumin fusion proteins
US7696320B2 (en) 2004-08-24 2010-04-13 Domantis Limited Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor
US20070269422A1 (en) 2006-05-17 2007-11-22 Ablynx N.V. Serum albumin binding proteins with long half-lives
US20090022720A1 (en) * 2007-07-20 2009-01-22 Stephan Fischer Conjugate of an antibody against CD4 and antifusogenic peptides
WO2009083804A2 (en) 2007-12-27 2009-07-09 Novartis Ag Improved fibronectin-based binding molecules and their use
WO2009133208A1 (en) 2008-05-02 2009-11-05 Novartis Ag Improved fibronectin-based binding molecules and uses thereof
WO2011077093A1 (en) * 2009-12-22 2011-06-30 Aarhus Universitet Bivalent molecules for hiv entry inhibition
WO2011130354A1 (en) * 2010-04-13 2011-10-20 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind pcsk9
WO2014206336A1 (en) * 2013-06-28 2014-12-31 Fudan University A hiv-1 fusion inhibitor with long half-life

Non-Patent Citations (40)

* Cited by examiner, † Cited by third party
Title
"Cloning Vectors: A Laboratory Manual", 1985, ELSEVIER
"Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT WILLIAMS & WILKINS
"Solid Phase Peptide Synthesis", 1984, THE PIERCE CHEMICAL CO.
AUGUSTO ET AL., J. ANTIMICROB. CHEMOTHER., vol. 69, 2014, pages 1286
AUSUBEL, F. ET AL.: "Current Protocols in Molecular Biology", 1987, GREEN PUBLISHING AND WILEY-INTERSCIENCE
BARITES ET AL., ANAL. BIOCHEM., vol. 102, 1980, pages 255
BATORI ET AL., PROTEIN ENG, vol. 15, no. 12, December 2002 (2002-12-01), pages 1015 - 1020
BRUNO ET AL., J. ANTIMICROB. CHEMOTHER., vol. 65, 2010, pages 1839
CONNELL, N.D., CURR. OPIN. BIOTECHNOL., vol. 12, no. 5, October 2001 (2001-10-01), pages 446 - 449
CROOKS, G.E. ET AL.: "WebLogo: A sequence logo generator", GENOME RESEARCH, vol. 14, 2004, pages 1188 - 1190, XP002408756, DOI: doi:10.1101/gr.849004
GIBALDI, M. ET AL.: "Pharmacokinetics", 1982, MARCEL DEKKER
HAM ET AL., METH. ENZYMOL., vol. 58, 1979, pages 44
HAQQANI AIMAN A ET AL: "Entry inhibitors and their use in the treatment of HIV-1 infection", ANTIVIRAL RESEARCH, ELSEVIER BV, NL, vol. 98, no. 2, 28 March 2013 (2013-03-28), pages 158 - 170, XP028531684, ISSN: 0166-3542, DOI: 10.1016/J.ANTIVIRAL.2013.03.017 *
HAQQANI ET AL., ANTIVIRAL RES., vol. 98, 2013, pages 158
HIMANEN ET AL., NATURE, vol. 414, 2001, pages 933 - 938
INGALLINELA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 106, 2009, pages 5801
JACOBSON ET AL., ANTIMICROB. AGENTS CHEMOTHER.,, vol. 53, 2009, pages 450
JACOBSON ET AL., J. INFECT. DIS., vol. 201, 2010, pages 1481
KENNETH, A. ET AL.: "Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists"
KOIDE ET AL., BIOCHEMISTRY, vol. 40, no. 34, 28 August 2001 (2001-08-28), pages 10326 - 10333
KONTERMANN ET AL., CURRENT OPINION IN BIOTECHNOLOGY, vol. 22, 2011, pages 868 - 876
KOPETZKI ET AL., VIROL. J., vol. 5, 2008, pages 56
KURZ ET AL., MOLECULES, vol. 5, 2000, pages 1259 - 1264
LUCKOW ET AL., BIOLTECHNOLOGY, vol. 6, 1988, pages 47
MAKRIDES ET AL., MICROBIOL. REV, vol. 60, no. 3, September 1996 (1996-09-01), pages 512 - 538
MAYFIELD ET AL., PROC. NATL. ACAD. SCI. USA, vol. 100, no. 2, 21 January 2003 (2003-01-21), pages 438 - 442
OETTE, M. ET AL.: "Primary HIV Drug Resistance and Efficacy of First-Line Antiretroviral Therapy Guided by Resistance Testing", J. ACQ. IMM. DEF. SYND., vol. 41, no. 5, 2006, pages 573 - 581
OSOL, A.: "Remington's Pharmaceutical Sciences", 1980
PETERS ET AL., PHARMACOKINETIC ANALYSIS: A PRACTICAL APPROACH, 1996
ROBERTS ET AL., PROC. NATL. ACAD. SCI., vol. 94, 1997, pages 12297 - 12302
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", vol. 1-3, 1989, COLD SPRING HARBOR LABORATORY PRESS
SANDLER ET AL.: "Polymer Synthesis", vol. 3, ACADEMIC PRESS, pages: 138 - 161
SCHNEIDER, T.D. ET AL.: "Sequence Logos: A New Way to Display Consensus Sequences", NUCLEIC ACIDS RES., vol. 18, 1990, pages 6097 - 6100, XP000608250
SHARP ET AL., YEAST, vol. 7, no. 7, October 1991 (1991-10-01), pages 657 - 678
SINCLAIR ET AL., PROTEIN EXPR. PURIF., vol. 26, no. I, October 2002 (2002-10-01), pages 96 - 105
SUN ET AL., J. ACQUIR. IMMUNE DEFIC. SYNDR., vol. 66, 2014, pages 473
TENORIO, CURR. HIV/AIDS REP., vol. 8, 2011, pages 1
YANIV, NATURE, vol. 297, 1982, pages 17 - 18
ZALIPSKY, ADVANCED DRUG REVIEWS, vol. 16, 1995, pages 157 - 182
ZALIPSKY, S. ET AL.: "Polyethylene Glycol Chemistry: Biotechnical and Biomedical Applications", 1992, PLENUS PRESS, article "Use of Functionalized Poly(Ethylene Glycols) for Modification of Polypeptides"

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN106755100A (zh) * 2017-02-20 2017-05-31 李因传 可控性hiv‑1基因组靶向编辑系统和其靶向载运系统
WO2019123262A1 (en) 2017-12-18 2019-06-27 VIIV Healthcare UK (No.5) Limited Antigen binding polypeptides
JP2021507717A (ja) * 2017-12-18 2021-02-25 ビーブ、ヘルスケア、ユーケー、(ナンバー5)、リミテッドViiv Healthcare Uk (No.5) Limited 抗原結合性ポリペプチド
EP3835308A4 (en) * 2018-08-09 2021-11-24 Fapon Biotech Inc. SYNTHETIC PEPTIDE FOR THE DETECTION OF HIV-1
US12158469B2 (en) 2018-08-09 2024-12-03 Fapon Biotech Inc. Synthetic peptide for detecting HIV-1
WO2021081515A3 (en) * 2019-10-25 2021-06-24 Cidara Therapeutics, Inc. Compositions and methods for the treatment of human immunodeficiency virus

Also Published As

Publication number Publication date
MA56222A (fr) 2022-04-20
KR20170138558A (ko) 2017-12-15
IL255122A0 (en) 2017-12-31
JP7465378B2 (ja) 2024-04-10
DOP2017000246A (es) 2018-01-31
EP3286212A1 (en) 2018-02-28
PT3286212T (pt) 2021-08-24
CR20170482A (es) 2018-03-07
EA201792269A1 (ru) 2018-04-30
TW201643185A (zh) 2016-12-16
CA2983276A1 (en) 2016-10-27
MA41943A (fr) 2018-02-28
AU2019226255A1 (en) 2019-09-26
SG11201708441RA (en) 2017-11-29
JP2018516247A (ja) 2018-06-21
CL2017002687A1 (es) 2018-04-20
EP3985020A1 (en) 2022-04-20
MX2017013687A (es) 2018-07-06
PE20180162A1 (es) 2018-01-18
ES2884267T3 (es) 2021-12-10
JP6894846B2 (ja) 2021-06-30
EP3286212B1 (en) 2021-06-02
JP2023055875A (ja) 2023-04-18
US20190359688A1 (en) 2019-11-28
US11155602B2 (en) 2021-10-26
EA035332B1 (ru) 2020-05-28
AU2016252008B2 (en) 2019-06-13
AU2016252008A1 (en) 2017-11-09
HK1243432A1 (zh) 2018-07-13
BR112017022790A2 (pt) 2018-07-17
PH12017501914A1 (en) 2018-03-05
CO2017011583A2 (es) 2018-04-19
UY36650A (es) 2016-11-30
US20180111980A1 (en) 2018-04-26
CN107922474A (zh) 2018-04-17
JP2021035951A (ja) 2021-03-04
US10407490B2 (en) 2019-09-10

Similar Documents

Publication Publication Date Title
US11155602B2 (en) Polypeptides targeting HIV fusion
DK2697257T3 (en) FC FUSION PROTEINS INCLUDING UNKNOWN LINKERS OR EVENTS
EP3564258B1 (en) Fibronectin based scaffold domain proteins that bind to myostatin
US9562089B2 (en) Fibronectin based scaffold proteins having improved stability
DK2443137T3 (en) NOVEL chemokine-binding peptides capable of impeding the sequence for immunity, inflammation and cancer
EP2536757A1 (en) Fibronectin based scaffold domain proteins that bind il-23
Meng et al. Design and biological evaluation of m-xylene Thioether-stapled short helical peptides targeting the HIV-1 gp41 Hexameric coiled–coil fusion complex
US20250129161A1 (en) HIV Specific Binding Molecules and Uses Thereof
US20240239877A1 (en) Antigen binding polypeptides
US12103971B2 (en) HIV specific binding molecules
CN118510536A (zh) 松弛素-2融合蛋白类似物及其使用方法
Egerer et al. The Prevention of HIV Infection with Viral Entry Inhibitors

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16718817

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 11201708441R

Country of ref document: SG

ENP Entry into the national phase

Ref document number: 2983276

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 255122

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 12017501914

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 002311-2017

Country of ref document: PE

ENP Entry into the national phase

Ref document number: 2017555557

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: CR2017-000482

Country of ref document: CR

Ref document number: MX/A/2017/013687

Country of ref document: MX

Ref document number: 15568830

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017022790

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2016252008

Country of ref document: AU

Date of ref document: 20160414

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201792269

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: NC2017/0011583

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: DZP2017000649

Country of ref document: DZ

ENP Entry into the national phase

Ref document number: 20177033985

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: A201710112

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 112017022790

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20171023