WO2016090312A1 - Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof - Google Patents

Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof Download PDF

Info

Publication number
WO2016090312A1
WO2016090312A1 PCT/US2015/064102 US2015064102W WO2016090312A1 WO 2016090312 A1 WO2016090312 A1 WO 2016090312A1 US 2015064102 W US2015064102 W US 2015064102W WO 2016090312 A1 WO2016090312 A1 WO 2016090312A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acids
set forth
sequence set
chain variable
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/064102
Other languages
English (en)
French (fr)
Inventor
Renier J. BRENTJENS
Eric L. SMITH
Cheng Liu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Memorial Sloan Kettering Cancer Center
Eureka Therapeutics Inc
Original Assignee
Memorial Sloan Kettering Cancer Center
Eureka Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to MX2017007242A priority Critical patent/MX385156B/es
Priority to IL310130A priority patent/IL310130A/en
Priority to JP2017529741A priority patent/JP6919091B2/ja
Priority to ES15865633T priority patent/ES2899779T3/es
Priority to SI201531772T priority patent/SI3227339T1/sl
Priority to NZ732574A priority patent/NZ732574B2/en
Priority to MYPI2017000855A priority patent/MY192065A/en
Priority to BR112017011920-0A priority patent/BR112017011920B1/pt
Priority to DK15865633.0T priority patent/DK3227339T3/da
Priority to KR1020177018389A priority patent/KR102612367B1/ko
Priority to LTEPPCT/US2015/064102T priority patent/LT3227339T/lt
Priority to SG11201704547RA priority patent/SG11201704547RA/en
Priority to IL252621A priority patent/IL252621B2/en
Priority to EP21201788.3A priority patent/EP4015534A1/en
Priority to CN202410434671.2A priority patent/CN118271463A/zh
Priority to CA2969864A priority patent/CA2969864A1/en
Priority to AU2015357518A priority patent/AU2015357518B2/en
Priority to HRP20211978TT priority patent/HRP20211978T1/hr
Priority to RU2017123551A priority patent/RU2762359C2/ru
Application filed by Memorial Sloan Kettering Cancer Center, Eureka Therapeutics Inc filed Critical Memorial Sloan Kettering Cancer Center
Priority to CN202111119531.9A priority patent/CN113968912B/zh
Priority to CN201580075557.4A priority patent/CN107428829B/zh
Priority to RS20211596A priority patent/RS62870B1/sr
Priority to PL15865633T priority patent/PL3227339T3/pl
Priority to EP15865633.0A priority patent/EP3227339B1/en
Priority to SM20220040T priority patent/SMT202200040T1/it
Publication of WO2016090312A1 publication Critical patent/WO2016090312A1/en
Priority to US15/613,800 priority patent/US10633426B2/en
Priority to SA517381665A priority patent/SA517381665B1/ar
Priority to PH12017501044A priority patent/PH12017501044A1/en
Anticipated expiration legal-status Critical
Priority to US16/798,059 priority patent/US11820806B2/en
Priority to US16/798,104 priority patent/US11866478B2/en
Priority to US16/798,151 priority patent/US10906956B2/en
Priority to AU2022200052A priority patent/AU2022200052A1/en
Priority to CY20221100105T priority patent/CY1125008T1/el
Priority to US18/517,766 priority patent/US20240294599A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/15Cells of the myeloid line, e.g. granulocytes, basophils, eosinophils, neutrophils, leucocytes, monocytes, macrophages or mast cells; Myeloid precursor cells; Antigen-presenting cells, e.g. dendritic cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001129Molecules with a "CD" designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4256Tumor associated carbohydrates
    • A61K40/4257Mucins, e.g. MUC-1
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/7056Lectin superfamily, e.g. CD23, CD72
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/283Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3061Blood cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1205Phosphotransferases with an alcohol group as acceptor (2.7.1), e.g. protein kinases
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5156Animal cells expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/74Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/10041Use of virus, viral particle or viral elements as a vector
    • C12N2740/10043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/13011Gammaretrovirus, e.g. murine leukeamia virus
    • C12N2740/13041Use of virus, viral particle or viral elements as a vector
    • C12N2740/13043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00Vectors comprising a special translation-regulating system
    • C12N2840/20Vectors comprising a special translation-regulating system translation of more than one cistron
    • C12N2840/203Vectors comprising a special translation-regulating system translation of more than one cistron having an IRES

Definitions

  • the presently disclosed subject matter provides for methods and compositions for treating cancer. It relates to chimeric antigen receptors (CARs) that specifically target a G-protein coupled receptor (e.g. , a G-protein coupled receptor family C group 5 member D (GPRC5D)), immunoresponsive cells comprising such CARs, and methods of using such cells for treating cancer (e.g., multiple myeloma).
  • CARs chimeric antigen receptors
  • GPRC5D G-protein coupled receptor family C group 5 member D
  • T cells and other immune cells may be modified to target tumor antigens through the introduction of genetic material coding for artificial or synthetic receptors for antigen, termed Chimeric Antigen Receptors (CARs), specific to selected antigens.
  • CARs Chimeric Antigen Receptors
  • MM Multiple myeloma
  • GvM immuno-therapeutic graft versus myeloma
  • a potentially curative T cell effect may be achieved with minimal toxicity through autologous adoptive T cell therapy.
  • Myeloma may be an ideal disease to test adoptive T cell therapy.
  • allogeneic transplants demonstrate that the T cell can be a curative treatment, even with minimal or no concomitant chemotherapy such as after non- myeloablative transplants or post-transplantation donor lymphocyte infusions.
  • conditioning chemotherapy possibly through the mechanism of depleting regulatory T cells (Tregs), enhances the efficacy of adoptive T cell therapy, 5 ' 13 as such, the immediate post-autologous transplant period could be an optimal time to administer T cells, and myeloma is one of the few diseases where autologous stem cell transplantation is the standard of care.
  • the immunomodulatory drug lenalidomide may improve CAR based therapy, as has been shown in mice, 14 and lenalidomide is commonly used to treat MM.
  • adoptive T cell therapy works best in bone marrow predominant disease such as ALL, 7 ' 8 when compared to solid tumors or extra-medullary CLL, 5 and similar to ALL, myeloma is a disease of the bone marrow.
  • CD19 expression is seen in only 2% of myeloma patients. 15 Furthermore, unlike CD19, the common extracellular immunophenotypic markers in myeloma (CD138, CD38, and CD56) are all co- expressed on other essential cell types, and we predict CARs to any of these targets would lead to unacceptable "off tumor, on target" toxicity which can be fatal even in targets where antibodies are well tolerated, as was the case with a HER2 targeted CAR.
  • the presently disclosed subject matter generally provides chimeric antigen receptors (CARs) that specifically target a G-protein coupled receptor, immunoresponsive cells comprising such CARs, and uses of these CARs and immunoresponsive cells for treating multiple myeloma.
  • CARs chimeric antigen receptors
  • the CAR comprises an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, where the extracellular antigen- binding domain specifically binds to a G-protein coupled receptor.
  • the G-protein coupled receptor is a G-protein coupled receptor family C group 5 member D (GPRC5D).
  • the extracellular antigen- binding domain specifically binds to GPRC5D with a binding affinity (K D ) of from about 1 x 10 ⁇ 9 M to about 3 x 10 ⁇ 6 M.
  • the extracellular antigen -binding domain is a single-chain variable fragment (scFv).
  • the extracellular antigen-binding domain is a murine scFv. In certain embodiments, the extracellular antigen-binding domain is a human scFv. In certain embodiments, the extracellular antigen-binding domain is a Fab, which is optionally crosslinked. In certain embodiments, the extracellular binding domain is a F(ab) 2. In certain embodiments, any of the foregoing molecules can be comprised in a fusion protein with a heterologous sequence to form the extracellular antigen-binding domain.
  • the extracellular antigen-binding domain comprises a heavy chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93, 302, 314,
  • the extracellular antigen-binding domain comprises a light chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS:2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, 94, 303, 315,
  • the extracellular antigen-binding domain comprises
  • a heavy chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93, 302, 314, 326, 338, 350, 362, 374, and 386; and (b) a light chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 9
  • the extracellular antigen-binding domain comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53,
  • the extracellular antigen-binding domain comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54,
  • the extracellular antigen-binding domain comprises (a) a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93, 302, 314, 326, 338, 350, 362, 374, and 386, and conservative modifications thereof, and (b) a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, 94, 303, 315, 327, 339, 351, 363, 375, and 387, and conservative modifications thereof.
  • the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having a sequence selected from the group consisting of: SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93, 302, 314, 326, 338, 350, 362, 374, and 386.
  • the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having a sequence selected from the group consisting of: SEQ ID NOS:2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, 94, 303, 315, 327, 339, 351, 363, 375, and 387.
  • the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:53.
  • the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57.
  • the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61. In certain embodiments, the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65. In certain embodiments, the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:54. In certain embodiments, the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58.
  • the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62. In certain embodiments, the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66. In certain embodiments, the extracellular antigen-binding domain comprises a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:70.
  • the extracellular antigen-binding domain comprises (a) a heavy chain variable region comprising amino acids having a sequence set forth in SEQ ID NO: l, and a light chain variable region comprising amino acids having a sequence set forth in SEQ ID NO:2; (b) a heavy chain variable region comprising amino acids having a sequence set forth in SEQ ID NO:5, and a light chain variable region comprising amino acids having a sequence set forth in SEQ ID NO:6; (c) a heavy chain variable region comprising amino acids having a sequence set forth in SEQ ID NO:9, and a light chain variable region comprising amino acids having a sequence set forth in SEQ ID NO: 10; (d) a heavy chain variable region comprising amino acids having a sequence set forth in SEQ ID NO: 13, and a light chain variable region comprising amino acids having a sequence set forth in SEQ ID NO: 14; (e) a heavy chain variable region comprising amino acids having a sequence set forth in SEQ ID NO: 17, and a light chain variable region
  • the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:53; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:54. In certain embodiments, the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58. In certain embodiments, the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62.
  • the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66. In yet another embodiment, the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:69; and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:70.
  • the extracellular antigen-binding domain comprises both of said heavy and light chains, optionally with a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the extracellular antigen- binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the extracellular antigen-binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the extracellular antigen-binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:53 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:54, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the extracellular antigen-binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the extracellular antigen-binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the extracellular antigen-binding domain comprises (i) a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:69 and (ii) a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:70, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the extracellular antigen-binding domain comprises
  • a heavy chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 126, 132, 138, 144, 150, 156, 162, 168, 174, 180, 186, 192, 198, 204, 210, 216, 222, 228, 234, 240, 246, 252, 258, 264, 306, 318, 330, 342, 354, 366, 378, and 390; and (b) a light chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 129, 135, 141, 147, 153, 159, 165, 171, 177, 183, 189, 195, 201, 207, 213, 219, 225, 231, 237, 243, 249, 255, 261, 267, 309, 321, 333, 345, 357, 369, 381, and 393.
  • the heavy chain variable region CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, 185, 191, 197, 203, 209, 215, 221, 227, 233, 239, 245, 251, 257, 263, 305, 317, 329, 341, 353, 365, 377, and 389, and conservative modifications thereof; and (b) the light chain variable region CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 128, 134, 140, 146, 152, 158, 164, 170, 176, 182, 188, 194, 200, 206, 212, 218, 224, 230, 236, 242, 248, 254, 260, 266, 308, 320, 332, 344, 356, 368, 380, and 392, and conservative modifications thereof.
  • the heavy chain variable region CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, 226, 232, 238, 244, 250, 256, 262, 304, 316, 328, 340, 352, 364, 376, and 388, and conservative modifications thereof; and (b) the light chain variable region CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, 187, 193, 199, 205, 211, 217, 223, 229, 235, 241, 247, 253, 259, 265, 307, 319, 331, 343, 355, 367, 379, and 391, and conservative modifications thereof.
  • the extracellular antigen-binding domain comprises: (a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, 226, 232, 238, 244, 250, 256, 262, 304, 316, 328, 340, 352, 364, 376, and 388; (b) a heavy chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, 185, 191, 197, 203, 209, 215, 221, 227, 233, 239, 245, 251, 257, 263, 305, 317, 329, 341, 353, 365, 377, and 389; (c) a heavy
  • the extracellular antigen-binding domain comprises
  • a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 124 or conservative modifications thereof; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 125 or conservative modifications thereof; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 126 or conservative modifications thereof;
  • a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 130 or conservative modifications thereof; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 131 or conservative modifications thereof; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 132 or conservative modifications thereof;
  • a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 136 or conservative modifications thereof; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 137 or conservative
  • the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 202; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 203; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 204.
  • the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 208; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210.
  • the extracellular antigen -binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 214; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216.
  • the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 220; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222.
  • the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 226; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227; and a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228.
  • the extracellular antigen-binding domain comprises: (a) a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 127 or conservative modifications thereof; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 129 or conservative modifications thereof; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 130 or conservative modifications thereof; (b) a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 133 or conservative modifications thereof; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 134 or conservative modifications thereof; and a light chain variable region CDR3 comprising SEQ ID NO: 135 or conservative modifications thereof; (c) a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 139 or conservative modifications thereof; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:
  • the extracellular antigen -binding domain comprises: a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 205; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:206; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 207.
  • the extracellular antigen -binding domain comprises: a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:212; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213.
  • the extracellular antigen -binding domain comprises: a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 217; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:218; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219.
  • the extracellular antigen-binding domain comprises: a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 223; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:224; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225.
  • the extracellular antigen-binding domain comprises: a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 229; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:230; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231.
  • the extracellular antigen-binding domain comprises: (a) a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 124; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 125; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 126; a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 127; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 128; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 129; (b) a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 130; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 131; a heavy chain variable region CDR3 comprising amino acids having the sequence set
  • the extracellular antigen-binding domain comprises: a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 202; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 203; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 204; a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 205; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:206; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 207.
  • the extracellular antigen-binding domain comprises: a heavy chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 208; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210; a light chain variable region CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:212; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213.
  • the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 214; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216; a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 217; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:218; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219.
  • the extracellular antigen-binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 220; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222; a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 223; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:224; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225.
  • the extracellular antigen- binding domain comprises: a heavy chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 226; a heavy chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227; a heavy chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228; a light chain variable region CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 229; a light chain variable region CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:230; and a light chain variable region CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231.
  • the human scFv comprises a heavy chain variable region, a light chain variable region, a linker peptide between the heavy chain variable region and the light chain variable region, and an His-tag and an HA-tag.
  • the amino acid sequence of the His-tag and HA-tag comprises the amino acid sequence of SEQ ID NO:275,which is provided below:
  • SEQ ID NO: 275 The nucloetide sequence encoding SEQ ID NO: 275 is SEQ ID NO: 276, which is provided below:
  • the GPRC5D comprises the amino acid sequence set forth in SEQ ID NO:97.
  • the extracellular antigen-binding domain binds to one, two, three or four epitope region selected from the group consisting of an epitope region in N-terminal region comprising amino acids 1-27 of SEQ ID NO:97, an epitope region in ECLl region comprising amino acids 85-93 of SEQ ID NO:97, an epitope region in ECL2 region comprising amino acids 145-167 of SEQ ID NO:97, and an epitope region in ECL3 region comprising amino acids 226- 239 of SEQ ID NO:97.
  • the extracellular antigen-binding domain binds to an epitope region comprising amino acids 16-23 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 15-23 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 16-25 of SEQ ID NO:97. In certain embodiments, the extracellular antigen- binding domain binds to an epitope region comprising amino acids 10-17 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 5-17 of SEQ ID NO:97.
  • the extracellular antigen-binding domain binds to an epitope region comprising amino acids 85-95 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 157-164 of SEQ ID NO:97. In certain embodiments, the extracellular antigen- binding domain binds to an epitope region comprising amino acids 157-167 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 230-237 of SEQ ID NO:97.
  • the extracellular antigen-binding domain binds to an epitope region comprising amino acids 229-237 of SEQ ID NO:97. In certain embodiments, the extracellular antigen-binding domain binds to an epitope region comprising amino acids 230-243 of SEQ ID NO:97. In certain embodiments, the extracellular antigen- binding domain binds to an epitope region comprising amino acids 227-237 of SEQ ID NO:97.
  • the extracellular antigen-binding domain binds to one, two, or three epitope region selected from the group consisting of an epitope region comprising amino acids 16-25 of SEQ ID NO:97, an epitope region comprising amino acids 157-164 of SEQ ID NO:97, and an epitope region comprising amino acids 229-237 of SEQ ID NO:97.
  • the extracellular antigen- binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 208, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 212, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213.
  • the extracellular antigen-binding domain binds to one, two, or three epitope region selected from the group consisting of an epitope region comprising amino acids 5-17 of SEQ ID NO:97, an epitope region comprising amino acids 85-95 of SEQ ID NO:97, and an epitope region comprising amino acids 157-164 of SEQ ID NO:97.
  • the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 214, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 217, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 218 and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219.
  • the extracellular antigen-binding domain binds to one or two epitope region selected from the group consisting of an epitope region comprising amino acids 15-23 of SEQ ID NO:97, and an epitope region comprising amino acids 230-243 of SEQ ID NO:97.
  • the extracellular antigen- binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 220, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 223, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 224, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225.
  • the extracellular antigen-binding domain binds to one, two, or three epitope region selected from the group consisting of an epitope region comprising amino acids 10-17 of SEQ ID NO:97, an epitope region comprising amino acids 157-167 of SEQ ID NO:97, and an epitope region comprising amino acids 227-237 of SEQ ID NO:97.
  • the extracellular antigen- binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:69 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:70.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 226, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 229, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 230, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231.
  • the extracellular antigen-binding domain is covalently joined to a transmembrane domain.
  • the extracellular antigen-binding domain can comprise a signal peptide that is covalently joined to the 5' terminus of the extracellular antigen-binding domain.
  • the transmembrane domain of the CAR comprises a CD8 polypeptide, a CD28 polypeptide, a CD3 ⁇ polypeptide, a CD4 polypeptide, a 4- IBB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a CTLA-4 polypeptide, a PD-1 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof.
  • the transmembrane domain comprises a CD8 polypeptide.
  • the transmembrane domain comprises a CD28 polypeptide.
  • the intracellular domain comprises a CD3 ⁇ polypeptide.
  • the intracellular domain further comprises at least one signaling region.
  • the at least one signaling region comprises a CD28 polypeptide, a 4- IBB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP- 10 polypeptide, a PD-1 polypeptide, a CTLA-4 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof.
  • the signaling region is a co-stimulatory signaling region.
  • the co-stimulatory signaling region comprises a CD28 polypeptide, a 4- IBB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP- 10 polypeptide, or a combination thereof.
  • the at least one co-stimulatory signaling region comprises a CD28 polypeptide.
  • the at least one co-stimulatory signaling region comprises a 4- IBB polypeptide.
  • the transmembrane domain comprises a CD28 polypeptide
  • the intracellular domain comprises a CD3 ⁇ polypeptide
  • the co-stimulatory signaling domain comprises a CD28 polypeptide.
  • the CAR is recombinantly expressed.
  • the CAR can be expressed from a vector.
  • the vector is a ⁇ -retroviral rector.
  • the presently disclosed subject matter also provides isolated immunoresponsive cells comprising the above-described CARs.
  • the isolated immunoresponsive cell is transduced with the CAR, for example, the CAR is constitutively expressed on the surface of the immunoresponsive cell.
  • the isolated immunoresponsive cell is further transduced with at least one co- stimulatory ligand such that the immunoresponsive cell expresses the at least one co- stimulatory ligand.
  • the at least one co-stimulatory ligand is selected from the group consisting of 4-1BBL, CD80, CD86, CD70, OX40L, CD48, TNFRSF14, and combinations thereof.
  • the isolated immunoresponsive cell is further transduced with at least one cytokine such that the immunoresponsive cell secrets the at least one cytokine.
  • the at least cytokine is selected from the group consisting of IL-2, IL-3, IL-6, IL-7, IL-11, IL-12, IL-15, IL-17, IL-21, and combinations thereof.
  • the isolated immunoresponsive cell is selected from the group consisting of a T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a human embryonic stem cell, a lymphoid progenitor cell, a T cell-precursor cell, and a pluripotent stem cell from which lymphoid cells may be differentiated.
  • the immunoresponsive cell is a T cell.
  • nucleic acid molecules encoding the presently disclosed CARs, vectors comprising the nucleic acid molecules, and host cells expressing such nucleic acid molecules.
  • the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:397. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:398. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:399. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:400.
  • the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:401. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:402. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:403. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:406. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:407. In certain embodiments, the nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:408.
  • the vector is a ⁇ -retroviral vector.
  • the host cell is a T cell.
  • the presently disclosed subject matter provides methods of using the above-described immunoresponsive cell for reducing tumor burden in a subject.
  • the presently disclosed subject matter provides methods of treating reducing tumor burden in a subject, where the method comprises administering an effective amount of the presently disclosed immunoresponsive cell to the subject, thereby inducing tumor cell death in the subject.
  • the method reduces the number of the number of tumor cells.
  • the method reduces tumor size.
  • the method eradicates the tumor in the subject.
  • the subject is a human.
  • the immunoresponsive cell is a T cell.
  • the tumor is multiple myeloma or Waldenstrom's Macroglobulinemia.
  • the tumor is multiple myeloma.
  • the presently disclosed subject matter provides methods of using the above-described immunoresponsive cell for increasing or lengthening survival of a subject having neoplasia.
  • the presently disclosed subject matter provides methods of increasing or lengthening survival of a subject having neoplasia, where the method comprises administering an effective amount of the presently disclosed immunoresponsive cell to the subject, thereby increasing or lengthening survival of the subject.
  • the neoplasia is multiple myeloma or Waldenstrom's Macroglobulinemia.
  • the neoplasia is multiple myeloma.
  • the method reduces or eradicates tumor burden in the subject.
  • the presently disclosed subject matter also provides methods for producing an immunoresponsive cell that binds to a G-protein coupled receptor.
  • the method comprises introducing into the immunoresponsive cell a nucleic acid sequence that encodes a chimeric antigen receptor (CAR), which comprises an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, wherein the extracellular antigen-binding domain specifically binds to a G-protein coupled receptor.
  • the G-protein coupled receptor is a G-protein coupled receptor family C group 5 member D (GPRC5D).
  • the extracellular antigen-binding domain is an scFv.
  • the presently disclosed subject matter further provides pharmaceutical compositions comprising an effective amount of the presently disclosed immunoresponsive cells and a pharmaceutically acceptable excipient.
  • the pharmaceutical compositions are for treating a neoplasia.
  • the neoplasia is multiple myeloma or Waldenstrom's Macroglobulinemia.
  • the neoplasia is multiple myeloma.
  • kits for treating a neoplasia comprising the presently disclosed immunoresponsive cells.
  • the kit further include written instructions for using the immunoresponsive cell for treating a neoplasia.
  • the neoplasia is multiple myeloma or Waldenstrom's Macroglobulinemia.
  • the neoplasia is multiple myeloma.
  • Figure 1 shows a chimeric antigen receptor targeting a G-protein coupled receptor in accordance with one non-limiting embodiment of the presently disclosed subject matter.
  • Figure 2 depicts the human GPRC5D expression in normal tissues and human cancer cell lines.
  • Figure 3 depicts the expression of the presently disclosed GPRC5D CAR on human T cells.
  • Figure 4 depicts the killing activity of the presently disclosed GPRC5D for 3T3 cells overexpressing GPRC5D.
  • Figure 5 depicts the killing activity of the presently disclosed GPRC5D for a human multiple myeloma cell line.
  • Figure 6 shows a chimeric antigen receptor targeting GPRC5D in accordance with one non-limiting embodiment of the presently disclosed subject matter.
  • Figure 7 depicts a nucleic acid molecule that encodes a GPRC5D-targeted CAR in accordance with one non-limiting embodiment of the presently disclosed subject matter.
  • Figure 8 depicts a nucleic acid molecule that encodes a GPRC5D-targeted CAR in accordance with one non-limiting embodiment of the presently disclosed subject matter.
  • Figure 9 depicts a nucleic acid molecule that encodes a GPRC5D-targeted CAR in accordance with one non-limiting embodiment of the presently disclosed subject matter.
  • Figure 10 depicts the cytotoxicity of GPRC5D targeted CAR T cells for human multiple myeloma cell lines.
  • Figure 11 depicts induction of cytokine secretion of GPRC5D targeted CAR T cells.
  • Figure 12 depicts anti-tumor activity of GPRC5D targeted CAR T cells.
  • Figures 13A and 13B depict the killing activity of GPRC5D targeted CAR T cells.
  • A Shows the percent of GFP + tumor line at time 0.
  • B Shows the killing the percent of GFP + tumor line at time 36 hours.
  • FIG 14 illustrates the CLIPS technology.
  • the CLIPS reaction takes place between bromo groups of the CLIPS scaffold and thiol sidechains of cysteines. The reaction is fast and specific under mild conditions.
  • native protein sequences are transformed into CLIPS constructs with a range of structures. From left to right: two different single T2 loops, T3 double loop, conjugated T2+T3 loops, stabilized beta sheet, and stabilized alpha helix (Timmerman et al., J. Mol. Recognit. 2007; 20: 283-29).
  • Figure 15 illustrates combinatorial clips library screening.
  • the target protein (left) containing a discontinuous conformational epitope is converted into a matrix library (middle).
  • Combinatorial peptides are synthesized on a proprietary minicard and chemically converted into spatially defined CLIPS constructs (right).
  • Figure 16 depicts T3 looped CLIPSTM construct.
  • Figures 17A-17D illustrates heat map technology.
  • A Table of combined peptides, with two sub-sequences indicated as "Loop 1" and "Loop 2".
  • B Data from A displayed as a matrix.
  • C Color bar indication of the heat map representation.
  • D Heat map visualization of data from A.
  • Figure 18 shows intensity profiles recorded for ET 150-2. Lines are drawn from the starting residue to the ending residue of a single peptide on the height at which the signal for that peptide is recorded.
  • Figure 19 shows heatmap analysis of data recorded for ET 150-5 under high stringency conditions.
  • Figure 20 shows intensity profiles recorded for ET150-18.
  • Figure 21 shows intensity profiles recorded for ET150-8.
  • Figure 22 depicts schematic drawing of GPCR containing seven transmembrane helices (TM) and 3 extracellular regions (ECLs). With colored arrows binding sites for each antibody is depicted.
  • TM transmembrane helices
  • ECLs extracellular regions
  • Figure 23 depicts scatterplot analysis of all data recorded for each sample. On the diagonal is the statistical data distribution.
  • Figure 24 depicts FACS analysis of anti-GPRC5D antibodies.
  • Figure 25 depicts FACS analysis of anti-GPRC5D antibodies.
  • Figure 26 depicts a nucleic acid molecule that encodes a GPRC5D-targeted CAR in accordance with one non-limiting embodiment of the presently disclosed subject matter.
  • Figure 27 depicts a nucleic acid molecule that encodes a GPRC5D-targeted CAR in accordance with one non-limiting embodiment of the presently disclosed subject matter.
  • the presently disclosed subject matter generally provides chimeric antigen receptors (CARs) targeting a G-protein coupled receptor (e.g. , a G-protein coupled receptor family C group 5 member D (GPRC5D)).
  • CARs chimeric antigen receptors
  • a G-protein coupled receptor e.g. , a G-protein coupled receptor family C group 5 member D (GPRC5D)
  • the CAR comprises an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, where the extracellular antigen-binding domain specifically binds to a G-protein coupled receptor.
  • the presently disclosed subject matter also provides immunoresponsive cells (e.g., T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a human embryonic stem cell, a lymphoid progenitor cell, a T cell-precursor cell, and a pluripotent stem cell from which lymphoid cells may be differentiated) expressing the CARs targeting a G- protein coupled receptor, and methods of using such immunoresponsive cells for treating cancer, e.g., multiple myeloma.
  • immunoresponsive cells e.g., T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a human embryonic stem cell, a lymphoid progenitor cell, a T cell-precursor cell, and a pluripotent stem cell from which lymphoid cells may be differentiated
  • the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 3 or more than 3 standard deviations, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value.
  • a cell population refers to a group of at least two cells expressing similar or different phenotypes.
  • a cell population can include at least about 10, at least about 100, at least about 200, at least about 300, at least about 400, at least about 500, at least about 600, at least about 700, at least about 800, at least about 900, at least about 1000 cells expressing similar or different phenotypes.
  • the term “antibody” means not only intact antibody molecules, but also fragments of antibody molecules that retain immunogen-binding ability. Such fragments are also well known in the art and are regularly employed both in vitro and in vivo. Accordingly, as used herein, the term “antibody” means not only intact immunoglobulin molecules but also the well-known active fragments F(ab') 2 , and Fab. F(ab') 2 , and Fab fragments that lack the Fe fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody (Wahl et al., J. Nucl. Med. 24:316-325 (1983).
  • the antibodies of the invention comprise whole native antibodies, bispecific antibodies; chimeric antibodies; Fab, Fab', single chain V region fragments (scFv), fusion polypeptides, and unconventional antibodies.
  • single-chain variable fragment or "scFv” is a fusion protein of the variable regions of the heavy (V H ) and light chains (V L ) of an immunoglobulin (e.g., mouse or human) covalently linked to form a V H -VL heterodimer.
  • V H variable regions of the heavy
  • V L light chains
  • an immunoglobulin e.g., mouse or human
  • the heavy (V H ) and light chains (V L ) are either joined directly or joined by a peptide-encoding linker (e.g., 10, 15, 20, 25 amino acids), which connects the N- terminus of the V H with the C-terminus of the V L , or the C-terminus of the V H with the N-terminus of the V L -
  • the linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility.
  • the linker can link the heavy chain variable region and the light chain variable region of the extracellular antigen-binding domain.
  • Non-limiting examples of linkers are disclosed in Shen et al., Anal. Chem. 80(6): 1910-1917 (2008) and WO 2014/087010, the contents of which are hereby incorporated by reference in their entireties.
  • the linker is a G4S linker.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO: 897 as provided below.
  • nucleic acid sequence encoding the amino acid sequence of SEQ ID NO:284 is set forth in SEQ ID NO:285, which is provided below:
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98 as provided below.
  • nucleic acid sequence encoding the amino acid sequence of SEQ ID NO:98 is set forth in SEQ ID NO:99, which is provided below:
  • Single chain Fv polypeptide antibodies can be expressed from a nucleic acid comprising V H - and V L -encoding sequences as described by Huston, et al. (Proc. Nat. Acad. Sci. USA, 85:5879-5883, 1988). See, also, U.S. Patent Nos. 5,091,513, 5,132,405 and 4,956,778; and U.S. Patent Publication Nos. 20050196754 and 20050196754.
  • Antagonistic scFvs having inhibitory activity have been described (see, e.g., Zhao et al., Hyrbidoma (Larchmt) 2008 27(6):455-51; Peter et al., J Cachexia Sarcopenia Muscle 2012 August 12; Shieh et al., J Imunol2009 183(4):2277-85; Giomarelli et al., Thromb Haemost 2007 97(6):955-63; Fife eta., J Clin Invst 2006 116(8):2252-61; Brocks et al., Immunotechnology 1997 3(3): 173-84; Moosmayer et al., Ther Immunol 1995 2(10:31-40).
  • F(ab) refers to a fragment of an antibody structure that binds to an antigen but is monovalent and does not have a Fc portion, for example, an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g., a heavy (H) chain constant region; Fc region that does not bind to an antigen).
  • an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g., a heavy (H) chain constant region; Fc region that does not bind to an antigen).
  • F(ab')2 refers to an antibody fragment generated by pepsin digestion of whole IgG antibodies, wherein this fragment has two antigen binding (ab') (bivalent) regions, wherein each (ab') region comprises two separate amino acid chains, a part of a H chain and a light (L) chain linked by an S-S bond for binding an antigen and where the remaining H chain portions are linked together.
  • a "F(ab')2" fragment can be split into two individual Fab' fragments.
  • vector refers to any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences into cells.
  • vector includes cloning and expression vehicles, as well as viral vectors and plasmid vectors.
  • expression vector refers to a recombinant nucleic acid sequence, i.e. recombinant DNA molecule, containing a desired coding sequence and appropriate nucleic acid sequences necessary for the expression of the operably linked coding sequence in a particular host organism.
  • Nucleic acid sequences necessary for expression in prokaryotes usually include a promoter, an operator (optional), and a ribosome binding site, often along with other sequences.
  • Eukaryotic cells are known to utilize promoters, enhancers, and termination and polyadenylation signals.
  • CDRs are defined as the complementarity determining region amino acid sequences of an antibody which are the hypervariable regions of immunoglobulin heavy and light chains. See, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 4th U. S. Department of Health and Human Services, National Institutes of Health (1987). Generally, antibodies comprise three heavy chain and three light chain CDRs or CDR regions in the variable region. CDRs provide the majority of contact residues for the binding of the antibody to the antigen or epitope. In certain embodiments, the CDRs regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
  • affinity is meant a measure of binding strength. Without being bound to theory, affinity depends on the closeness of stereochemical fit between antibody combining sites and antigen determinants, on the size of the area of contact between them, and on the distribution of charged and hydrophobic groups. Affinity also includes the term “avidity,” which refers to the strength of the antigen- antibody bond after formation of reversible complexes. Methods for calculating the affinity of an antibody for an antigen are known in the art, comprising use of binding experiments to calculate affinity. Antibody activity in functional assays (e.g., flow cytometry assay) is also reflective of antibody affinity. Antibodies and affinities can be phenotypically characterized and compared using functional assays (e.g., flow cytometry assay).
  • Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double- stranded nucleic acid molecule. By “hybridize” is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency. (See, e.g., Wahl, G. M. and S. L. Berger (1987) Methods Enzymol. 152:399; Kimmel, A. R. (1987) Methods Enzymol. 152:507).
  • stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
  • Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
  • Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C.
  • Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art.
  • concentration of detergent e.g., sodium dodecyl sulfate (SDS)
  • SDS sodium dodecyl sulfate
  • Various levels of stringency are accomplished by combining these various conditions as needed.
  • hybridization will occur at 30° C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS.
  • hybridization will occur at 37° C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 ⁇ g/ml denatured salmon sperm DNA (ssDNA).
  • hybridization will occur at 42° C in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 ⁇ g/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
  • wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
  • stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
  • Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C.
  • wash steps will occur at 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42° C. in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art. Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196: 180, 1977); Grunstein and Rogness (Proc. Natl.
  • substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
  • a reference amino acid sequence for example, any one of the amino acid sequences described herein
  • nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
  • such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
  • Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
  • sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs.
  • sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs.
  • Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
  • analog refers to a structurally related polypeptide or nucleic acid molecule having the function of a reference polypeptide or nucleic acid molecule.
  • the term "ligand” refers to a molecule that binds to a receptor.
  • the ligand binds a receptor on another cell, allowing for cell-to-cell recognition and/or interaction.
  • disease refers to any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ. Examples of diseases include neoplasia or pathogen infection of cell.
  • an “effective amount” refers to an amount sufficient to have a therapeutic effect.
  • an “effective amount” is an amount sufficient to arrest, ameliorate, or inhibit the continued proliferation, growth, or metastasis (e.g., invasion, or migration) of a neoplasia.
  • heterologous nucleic acid molecule or polypeptide refers to a nucleic acid molecule (e.g., a cDNA, DNA or RNA molecule) or polypeptide that is not normally present in a cell or sample obtained from a cell.
  • This nucleic acid may be from another organism, or it may be, for example, an mRNA molecule that is not normally expressed in a cell or sample.
  • the term “immunoresponsive cell” refers to a cell that functions in an immune response or a progenitor, or progeny thereof.
  • the term “modulate” refers positively or negatively alter. Exemplary modulations include an about 1%, about 2%, about 5%, about 10%, about 25%, about 50%, about 75%, or about 100% change.
  • the term "increase” refers to alter positively by at least about 5%, including, but not limited to, alter positively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
  • the term “reduce” refers to alter negatively by at least about 5% including, but not limited to, alter negatively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
  • isolated cell refers to a cell that is separated from the molecular and/or cellular components that naturally accompany the cell.
  • the term “isolated,” “purified,” or “biologically pure” refers to material that is free to varying degrees from components which normally accompany it as found in its native state. “Isolate” denotes a degree of separation from original source or surroundings. “Purify” denotes a degree of separation that is higher than isolation.
  • a “purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
  • Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography.
  • the term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel.
  • modifications for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
  • secreted is meant a polypeptide that is released from a cell via the secretory pathway through the endoplasmic reticulum, Golgi apparatus, and as a vesicle that transiently fuses at the cell plasma membrane, releasing the proteins outside of the cell.
  • the term “specifically binds” or “specifically binds to” or “specifically target” is meant a polypeptide or fragment thereof that recognizes and binds a biological molecule of interest (e.g., a polypeptide), but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which naturally includes a polypeptide of the invention.
  • treating refers to clinical intervention in an attempt to alter the disease course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology.
  • Therapeutic effects of treatment include, without limitation, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastases, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
  • a treatment can prevent deterioration due to a disorder in an affected or diagnosed subject or a subject suspected of having the disorder, but also a treatment may prevent the onset of the disorder or a symptom of the disorder in a subject at risk for the disorder or suspected of having the disorder.
  • the term "subject” refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, rodents, and the like (e.g., which is to be the recipient of a particular treatment, or from whom cells are harvested).
  • G protein-coupled receptors also known as seven-transmembrane domain receptors, 7TM receptors, heptahelical receptors, serpentine receptor, and G protein-linked receptors, constitute a large protein family of receptors that sense molecules outside the cell and activate inside signal transduction pathways and, ultimately, cellular responses.
  • GPCRs can be categorized into six classes based on sequence homology and functional similarity: Class A (Rhodopsin-like), Class B (Secretin receptor family), Class C (Metabotropic glutamate/pheromone), Class D (Fungal mating pheromone receptors), Class E (Cyclic AMP receptors), and Class F (Frizzled/Smoothened).
  • the GRPs are Class C GRPs.
  • the Class C GRP is a G-protein coupled receptor family C group 5 member D.
  • G-protein coupled receptor family C group 5 member D is an orphan receptor with no known ligand or function in humans. It is a member of a family of retinoic acid- inducible G-protein-coupled receptors. It is overexpressed in multiple myeloma (MM) cells and is not expressed or expressed in a significantly lower level in any other cell type, benign or malignant, as shown in Figure 2.
  • MM myeloma
  • 2- 4 It has been shown that higher mRNA expression correlates with worse overall survival. 1 Surface staining of Bone marrow aspirates from patients with MM demonstrate plasma cell specific staining. 4 To the knowledge of the inventors, this is the first time GPRC5D has been targeted by any therapeutic. Additionally, to the knowledge of the inventors, this is the first time a CAR targeting any G-protein coupled receptor has been generated.
  • GPRC5D is human GPRC5D having the amino acid sequence set forth in SEQ ID NO:97, or fragments thereof.
  • SEQ ID NO:97 is provided below:
  • the N-terminal region of human GPRC5D has amino acids 1-27 of SEQ ID NO:
  • the extracellular loop 1 (ECL1) region of human GPRC5D has amino acids 85-93 of SEQ ID NO:97.
  • the extracellular loop 2 (ECL2) region of human GPRC5D has amino acids 145-167 of SEQ ID NO:97.
  • the extracellular loop 3 (ECL3) region of human GPRC5D has amino acids 226-239 of SEQ ID NO:97.
  • Chimeric antigen receptors are engineered receptors, which graft or confer a specificity of interest onto an immune effector cell.
  • CARs can be used to graft the specificity of a monoclonal antibody onto a T cell; with transfer of their coding sequence facilitated by retroviral vectors.
  • First generation CARs are typically composed of an extracellular antigen binding domain (e.g., a single-chain variable fragments (scFv)) fused to a transmembrane domain, fused to cytoplasmic/intracellular domain of the T cell receptor chain.
  • scFv single-chain variable fragments
  • First generation CARs typically have the intracellular domain from the CD3 ⁇ - chain, which is the primary transmitter of signals from endogenous TCRs.
  • “First generation” CARs can provide de novo antigen recognition and cause activation of both CD4 + and CD8 + T cells through their CD3 ⁇ chain signaling domain in a single fusion molecule, independent of HLA-mediated antigen presentation.
  • “Second generation” CARs add intracellular domains from various co- stimulatory molecules ⁇ e.g., CD28, 4- IBB, ICOS, OX40) to the cytoplasmic tail of the CAR to provide additional signals to the T cell.
  • "Second generation” CARs comprise those that provide both co- stimulation (e.g., CD28 or 4- IBB) and activation ⁇ 3 ⁇ ).
  • Preclinical studies have indicated that "Second Generation” CARs can improve the anti-tumor activity of T cells. For example, robust efficacy of "Second Generation” CAR modified T cells was demonstrated in clinical trials targeting the CD 19 molecule in patients with chronic lymphoblastic leukemia (CLL) and acute lymphoblastic leukemia (ALL).
  • “Third generation” CARs comprise those that provide multiple co-stimulation (e.g., CD28 and 4- IBB) and activation (CD3Q.
  • the CARs comprise an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, where the extracellular antigen-binding domain binds to a G-protein coupled receptor.
  • the G-protein coupled receptor is a GPRC5D.
  • the extracellular antigen-binding domain is a scFv.
  • the extracellular antigen-binding domain is a Fab, which is optionally crosslinked.
  • the extracellular binding domain is a F(ab) 2.
  • any of the foregoing molecules may be comprised in a fusion protein with a heterologous sequence to form the extracellular antigen-binding domain.
  • the extracellular antigen-binding domain of a presently disclsoed CAR has a high binding specificity as well as high binding affinity to the G-protein coupled receptor ⁇ e.g., GPRC5D).
  • the extracellular antigen-binding domain of the CAR (embodied, for example, in a scFv or an analog thereof) binds to GPRC5D with a dissociation constant (K D ) of about 3 x 10 "6 M or less.
  • the K D is about 1 x 10 "6 M or less, about 1 x 10 "7 M or less, about 1 x 10 "8 M or less, or about 1 x 10 "9 M or less, about 1 x 10 "10 M or less, or about 1 x 10 "11 M or less.
  • K D is about 1 x 10 " M or less.
  • the K D is from about 1 x 10 "11 M to about 3 x 10 "6 M, such as from about 1 x 10 "11 M to about 1 x 10 "10 M, from about 1 x 10 "10 M to about 1 x 10 "9 M, from about 1 x 10 "9 M to about 1 x 10 "8 M, from about 1 x 10 "8 M to about 1 x 10 "7 M, or from about 1 x 10 "7 M to about 1 x 10 "6 M, or from about 1 x 10 "6 M to about 3 x 10 "6 M.
  • the K D is from about 1 x 10 "11 M to about 3 x 10 "6 M, such as from about 1 x 10 "11 M to about 1 x 10 "10 M, from about 1 x 10 "10 M to about 1 x 10 "9 M, from about 1 x 10 "9 M to about 1 x 10 "8 M, from about 1 x 10 "8 M to about 1 x
  • the KD is from about 1 x 10 " M to about 1 x 10 " M. In certain embodiments, the KD is from about 1 x 10 "9 M to about 1.5 x 10 "9 M. In certain embodiments, the K D is about 1.2 x 10 "9 M. In certain embodiments, the K D is from about 4 x 10 "9 M to about 5 x 10 "9 M. In certain embodiments, the K D is about 5 x 10 "9 M. In certain embodiments, the KD is about 4.8 x 10 "9 M. In certain embodiments, the KD is from about 8 x 10 "9 M to about 9 x 10 "9 M. In certain embodiments, the KD is about 8 x 10 "9 M. In certain embodiments, the K D is about 8.1 x 10 "9 M
  • Binding of the extracellular antigen-binding domain (embodiment, for example, in an scFv or an analog thereof) of a presently disclosed CAR to a G-protein coupled receptor (e.g. , GPRC5D) can be confirmed by, for example, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), FACS analysis, bioassay (e.g. , growth inhibition), or Western Blot assay.
  • ELISA enzyme-linked immunosorbent assay
  • RIA radioimmunoassay
  • FACS analysis e.g. , FACS analysis
  • bioassay e.g. , growth inhibition
  • Western Blot assay Each of these assays generally detect the presence of protein-antibody complexes of particular interest by employing a labeled reagent (e.g. , an antibody, or a scFv) specific for the complex of interest.
  • a labeled reagent e.g
  • the scFv can be radioactively labeled and used in a radioimmunoassay (RIA) (see, for example, Weintraub, B., Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques, The Endocrine Society, March, 1986, which is incorporated by reference herein).
  • the radioactive isotope can be detected by such means as the use of a ⁇ counter or a scintillation counter or by autoradiography.
  • the GPRC5D-targeted extracellular antigen-binding domain is labeled with a fluorescent marker.
  • Non-limiting examples of fluorescent markers include green fluorescent protein (GFP), blue fluorescent protein (e.g., EBFP, EBFP2, Azurite, and mKalamal), cyan fluorescent protein (e.g., ECFP, Cerulean, and CyPet), and yellow fluorescent protein (e.g., YFP, Citrine, Venus, and YPet).
  • GFP green fluorescent protein
  • blue fluorescent protein e.g., EBFP, EBFP2, Azurite, and mKalamal
  • cyan fluorescent protein e.g., ECFP, Cerulean, and CyPet
  • yellow fluorescent protein e.g., YFP, Citrine, Venus, and YPet.
  • the GPRC5D-targeted human scFv is labeled with GFP.
  • the extracellular antigen-binding domain of a presently disclosed CAR comprises a single-chain variable fragment (scFv).
  • the extracellular antigen-binding domain of a presently disclosed CAR comprises a human scFv that specifically binds to human GPRC5D.
  • the extracellular antigen-binding domain of a presently disclosed CAR comprises a murine scFv that specifically binds to human GPRC5D.
  • the scFv are identified by screening scFv phage library with cells (e.g., 3T3 cells) that express GPRC5D.
  • the extracellular antigen-binding domain (e.g., scFv) comprises a heavy chain variable region comprising amino acids having a sequence selected from the group consisting of: SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, and 93.
  • nucleic acid sequences encoding the amino acid sequence of SEQ ID NOS: l, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, and 93 are 3, 7, 11, 15, 19, 23, 27, 31, 35, 39, 43, 47, 51, 55, 59, 63, 67, 71, 75, 79, 83, 87, 91, and 95, respectively.
  • the extracellular antigen-binding domain (e.g., scFv) comprises a light chain variable region comprising amino acids having a sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, and 94.
  • the nucleic acid sequences encoding the amino acid sequence of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, and 94 are 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 68, 72, 76, 80, 84, 88, 92, and 96, respectively.
  • the sequences of SEQ ID NOS: 1-96 are described in the following Tables 1-24.
  • the extracellular antigen-binding domain comprises heavy and light chain variable regions comprising amino acid sequences that are homologous to the amino acid sequences described herein and as disclosed in Tables 1-24.
  • the extracellular antigen- binding domain comprises a heavy chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93
  • the extracellular antigen-binding domain comprises a light chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, 66, 70, 74, 78, 82, 86, 90, 94, 303, 315, 327, 339, 351, 363, 375, and 387.
  • the extracellular antigen-binding domain comprises (a) a heavy chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 69, 73, 77, 81, 85, 89, 93, 302, 314, 326, 338, 350, 362, 374, and 386; and (b) a light chain variable region comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%,
  • the presently disclosed subject matter further provides extracellular antigen- binding domains (e.g. , scFv) that comprise heavy chain variable region and light chain variable region CDRs, e.g. , CDRls, CDR2s and CDR3s, as disclosed herein in Tables 1-24.
  • the CDR regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
  • the presently disclosed subject matter further provides extracellular antigen-binding domains (e.g. , scFv) that comprise conservative modifications of the antibody sequences disclosed herein.
  • an extracellular antigen-binding domains of the presently disclosed subject matter comprises a heavy chain variable region comprising CDR1, CDR2 and CDR3 sequences and a light chain variable region comprising CDR1, CDR2 and CDR3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences disclosed herein, or conservative modifications thereof, and wherein the extracellular antigen-binding domains retain the desired functional properties.
  • the presently disclosed subject matter provides an extracellular antigen-binding domain (e.g.
  • scFv comprising a heavy chain variable region
  • the heavy chain variable region comprises: (a) a CDRl comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, 226, 232, 238, 244, 250, 256, 262, 304, 316, 328, 340, 352, 364, 376, and 388, and conservative modifications thereof; (b) a CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, 185, 191, 197, 203, 209, 215, 221, 227, 233, 239, 245, 251, 257, 263, 305, 317, 329, 341, 353, 365, 377
  • the extracellular antigen-binding domain comprises a light chain variable region, wherein the light chain variable region comprises: (a) a CDRl comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, 187, 193, 199, 205, 211, 217, 223, 229, 235, 241, 247, 253, 259, 265, 307, 319, 331, 343, 355, 367, 379, and 391, and conservative modifications thereof; (b) a CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 128, 134, 140, 146, 152, 158, 164, 170, 176, 182, 188, 194, 200, 206, 212, 218, 224, 230, 236, 242, 248, 254, 260, 266, 308, 320, 33
  • the presently disclosed subject matter provides an extracellular antigen- binding domain (e.g. , scFv) comprising a heavy chain variable region comprising CDRl, CDR2, and CDR3 sequences and a light chain variable region comprising CDRl, CDR2, and CDR3 sequences, wherein: (a) the heavy chain variable region CDR3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 126, 132, 138, 144, 150, 156, 162, 168, 174, 180, 186, 192, 198, 204, 210, 216, 222, 228, 234, 240, 246, 252, 258, 264, 306, 318, 330, 342, 354, 366, 378, and 390, and conservative modifications thereof; and (b) the light chain variable region CDR3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 129, 135, 141, 147, 153, 159, 165, 171, 177, 183
  • the heavy chain variable region CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, 185, 191, 197, 203, 209, 215, 221, 227, 233, 239, 245, 251, 257, 263, 305, 317, 329, 341, 353, 365, 377, and 389, and conservative modifications thereof; and (b) the light chain variable region CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 128, 134, 140, 146, 152, 158, 164, 170, 176, 182, 188, 194, 200, 206, 212, 218, 224, 230, 236, 242, 248, 254, 260, 266, 308, 320, 332, 344, 356, 368, 380, and 392, and conservative modifications thereof; wherein the extracellular antigen-binding domain specifically binds
  • the heavy chain variable region CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, 190, 196, 202, 208, 214, 220, 226, 232, 238, 244, 250, 256, 262, 304, 316, 328, 340, 352, 364, 376, and 388, and conservative modifications thereof; and (b) the light chain variable region CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, 187, 193, 199, 205, 211, 217, 223, 229, 235, 241, 247, 253, 259, 265, 307, 319, 331, 343, 355, 367, 379, and 391, and conservative modifications thereof; wherein the extracellular antigen-binding domain
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 100 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 153 scFv (also referred to as "ET150-3 scFv").
  • GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
  • ET150- 153 scFv also referred to as "ET150-3 scFv”
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: l and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:2, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 1.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: l, as shown in Table 1.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: l, as shown in Table 1.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:2, as shown in Table 1.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:2, as shown in Table 1.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 1 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:2, as shown in Table 1.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 124 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 125 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 126 or conservative modifications thereof, as shown in Table 1.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 127 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 128 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 129 or conservative modifications thereof, as shown in Table 1.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 124 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 125 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 126 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 127 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 128 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 129 or conservative modifications thereof, as shown in Table 1.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 124, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 125, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 126, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 127, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 128, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 129.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 101 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 166 scFv (also referred to as "ET150-16 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:5 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:6, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 2.
  • the extracellular antigen-binding domain is a human scFv.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:5, as shown in Table 2.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:5, as shown in Table 2.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:6, as shown in Table 2.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:6, as shown in Table 2. In certain embodiments, the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:5 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:6, as shown in Table 2.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 130 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 131 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 132 or conservative modifications thereof, as shown in Table 2.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 133 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 134 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 135 or conservative modifications thereof, as shown in Table 2.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 130 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 131 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 132 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 133 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 134 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 135 or conservative modifications thereof, as shown in Table 2.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 130, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 131, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 132, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 133, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 134, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 135.
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 102 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 170 scFv (also referred to as "ET150-20 scFv").
  • GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
  • ET150- 170 scFv also referred to as "ET150-20 scFv”
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:9 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 10, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 3.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:9, as shown in Table 3.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:9, as shown in Table 3.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 10, as shown in Table 3.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO: 10, as shown in Table 3.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:9 and a V L comprising amino acids having the sequence set forth in SEQ ID NO: 10, as shown in Table 3.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 136 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 137 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 138 or conservative modifications thereof, as shown in Table 3.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 139 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 140 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 141 or conservative modifications thereof, as shown in Table 3.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 136 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 137 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 138 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 139 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 140 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 141 or conservative modifications thereof, as shown in Table 3.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 136, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 137, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 138, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 139, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 140, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 141.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 103 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 171 scFv (also referred to as "ET150-21 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 13 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 14, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 4.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 13, as shown in Table 4.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 13, as shown in Table 4.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 14, as shown in Table 4.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO: 14, as shown in Table 4.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 13 and a V L comprising amino acids having the sequence set forth in SEQ ID NO: 14, as shown in Table 4.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 142 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 143 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 144 or conservative modifications thereof, as shown in Table 4.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 145 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 146 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 147 or conservative modifications thereof, as shown in Table 4.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 142 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 143 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 144 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 145 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 146 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 147 or conservative modifications thereof, as shown in Table 4.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 142, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 143, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 144, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 145, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 146, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 147.
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 104 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 175 scFv (also referred to as "ET150-25 scFv").
  • GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
  • ET150- 175 scFv also referred to as "ET150-25 scFv”
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 17 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 18, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 5.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 17, as shown in Table 5.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 17, as shown in Table 5.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 18, as shown in Table 5.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO: 18, as shown in Table 5.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 17 and a V L comprising amino acids having the sequence set forth in SEQ ID NO: 18, as shown in Table 5.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 148 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 149 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth inO SEQ ID NO: 150 or conservative modifications thereof, as shown in Table 5.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 151 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 152 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 153 or conservative modifications thereof, as shown in Table 5.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 148 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 149 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 150 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 151 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 152 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 153 or conservative modifications thereof, as shown in Table 5.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 148, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 149, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 150, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 151, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 152, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 153.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 105 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 154 scFv (also referred to as "ET150-4 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:21 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:22, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 6.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:21, as shown in Table 6.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:21, as shown in Table 6.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:22, as shown in Table 6.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:22, as shown in Table 6.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:21 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:22, as shown in Table 6.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 154 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 155 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 156 or conservative modifications thereof, as shown in Table 6.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 157 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 158 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 159 or conservative modifications thereof, as shown in Table 6.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 154 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 155 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 156 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 157 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 158 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 159 or conservative modifications thereof, as shown in Table 6.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 154, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 155, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 156, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 157, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 158, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 159.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • V H AYTFTDYY [SEQ ID INPKSGRT [SEQ ID ARVYGYSRWSGFD
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 106 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 156 scFv (also referred to as "ET150-6 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:25 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:26, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 7.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:25, as shown in Table 7.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:25, as shown in Table 7.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:26, as shown in Table7.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:26, as shown in Table 7.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:25 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:26, as shown in Table 7.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 160 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 161 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 162 or conservative modifications thereof, as shown in Table 7.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 163 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 164 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 165 or conservative modifications thereof, as shown in Table 7.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 160 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 161 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 162 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 163 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 164 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 165 or conservative modifications thereof, as shown in Table 7.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 160, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 161, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 162, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 163, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 164, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 165.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • ID NO:160 ID NO: 161] YDR [SEQ ID NO: 162]
  • VYYCARGHKVYKSHPTGGYDRWGQGTLVTVSS [SEQ ID NO: 106]
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 107 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 157 scFv (also referred to as "ET150-7 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:29 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:30, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 8.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:29, as shown in Table 8.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:29, as shown in Table 8.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:30, as shown in Table 8.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:30, as shown in Table 8.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:29 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:30, as shown in Table 8.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 166 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 167 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 168 or conservative modifications thereof, as shown in Table 8.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 169 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 170 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 171 or conservative modifications thereof, as shown in Table 8.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 166 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 167 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 168 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 169 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 170 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 171 or conservative modifications thereof, as shown in Table 8.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 166, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 167, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 168, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 169, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 170, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 171.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 108 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 159 scFv (also referred to as "ET150-9 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:33 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:34, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 9.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:33, as shown in Table 9.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:33, as shown in Table 9.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:34, as shown in Table 9.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:34, as shown in Table 9.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:33 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:34, as shown in Table 9.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 172 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 173 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 174 or conservative modifications thereof, as shown in Table 9.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 175 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 176 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 177 or conservative modifications thereof, as shown in Table 9.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 172 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 173 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 174 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 175 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 176 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 177 or conservative modifications thereof, as shown in Table 9.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 172, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 173, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 174 a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 175, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 176, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 177.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 109 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 160 scFv (also referred to as "ET150-10 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:37 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:38, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 10.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:37, as shown in Table 10.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:37, as shown in Table 10.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:38, as shown in Table 10.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:38, as shown in Table 10.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:37 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:38, as shown in Table 10.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 178 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 179 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 180 or conservative modifications thereof, as shown in Table 10.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 181 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 182 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 183 or conservative modifications thereof, as shown in Table 10.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 178 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 179 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 180 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 181 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 182 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 183 or conservative modifications thereof, as shown in Table 10.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 178, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 179, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 180, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 181, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 182, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 183.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 110 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 161 scFv (also referred to as "ET150-11 scFv").
  • GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
  • ET150- 161 scFv also referred to as "ET150-11 scFv”
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:41 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:42, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 11.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:41, as shown in Table 11.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:41, as shown in Table 11.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:42, as shown in Table 11.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:42, as shown in Table 11.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:41 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:42, as shown in Table 11.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 184 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 185 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 186 or conservative modifications thereof, as shown in Table 11.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 187 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 188 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 189 or conservative modifications thereof, as shown in Table 11.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 184 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 185 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 186 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 187 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 188 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 189 or conservative modifications thereof, as shown in Table 11.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 184, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 185, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 186, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 187, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 188, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 189.
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 111 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 162 scFv (also referred to as "ET150-12 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:45 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:46, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 12.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:45, as shown in Table 12.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:45, as shown in Table 12.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:46, as shown in Table 12.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:46, as shown in Table 12.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:45 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:46, as shown in Table 12.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 190 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 191 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 192 or conservative modifications thereof, as shown in Table 12.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 193 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 194 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 195 or conservative modifications thereof, as shown in Table 12.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 190 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 191 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 192 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 193 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 194 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 195 or conservative modifications thereof, as shown in Table 12.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 190, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 191, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 192, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 193, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 194, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 195.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 112 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 163 scFv (also referred to as "ET150-13 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:49 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:50, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 13.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:49, as shown in Table 13.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:49, as shown in Table 13.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:50, as shown in Table 13.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:50, as shown in Table 13.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:49 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:50, as shown in Table 13.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 196 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 197 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 198 or conservative modifications thereof, as shown in Table 13.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 199 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:200 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:201 or conservative modifications thereof, as shown in Table 13.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 196 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 197 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 198 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 199 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:200 or conservative modifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:201 or conservative modifications thereof, as shown in Table 13.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 196, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 197, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 198 a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 199, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:200, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:201.
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 113 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 151 scFv (also referred to as "ET150-1 scFv").
  • the extracellular antigen-binding domain comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:53 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:54, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 14.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:53, as shown in Table 14.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:53, as shown in Table 14.
  • the extracellular antigen- binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:54, as shown in Table 14.
  • the extracellular antigen -binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:54, as shown in Table 14.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:53 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:54, as shown in Table 14.
  • the extracellular antigen- binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:202 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:203 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 204 or conservative modifications thereof, as shown in Table 14.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 205 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 206 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 207 or conservative modifications thereof, as shown in Table 14.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 202 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 203 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 204 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 205 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 206 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 207 or conservative modifications thereof, as shown in Table 14.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 202, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 203, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 204, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 205, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 206, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 207.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • V H GFTFSSYA [SEQ ID ISGRGRST [SEQ ID ARYYHAGAFDL
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 114 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 152 scFv (also referred to as "ET150-2 scFv").
  • GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
  • ET150- 152 scFv also referred to as "ET150-2 scFv”
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 15.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:57, as shown in Table 15.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:57, as shown in Table 15.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:58, as shown in Table 15.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:58, as shown in Table 15.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:57 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:58, as shown in Table 15.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:208 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210 or conservative modifications thereof, as shown in Table 15.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 212 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213 or conservative modifications thereof, as shown in Table 15.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 208 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 212 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213 or conservative modifications thereof, as shown in Table 15.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 208, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 209, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 210, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 211, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 212, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 213.
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 115 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 155 scFv (also referred to as "ET150-5 scFv").
  • GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
  • ET150- 155 scFv also referred to as "ET150-5 scFv”
  • the extracellular antigen-binding domain is a scFV, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 16.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:61, as shown in Table 16.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:61, as shown in Table 16.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:62, as shown in Table 16.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:62, as shown in Table 16.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:61 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:62, as shown in Table 16.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:214 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216 or conservative modifications thereof, as shown in Table 16.
  • the extracellular antigen- binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 217 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 218 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219 or conservative modifications thereof, as shown in Table 16.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 214 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 217 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 218 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219 or conservative modifications thereof, as shown in Table 16.
  • the extracellular antigen- binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 214, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 215, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 216, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 217, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 218 and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 219.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 116 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 158 scFv (also referred to as "ET150-8 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 17.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:65, as shown in Table 17.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:65, as shown in Table 17.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:66, as shown in Table 17.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:66, as shown in Table 17.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:65 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:66, as shown in Table 17.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:220 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222 or conservative modifications thereof, as shown in Table 17.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 223 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 224 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225 or conservative modifications thereof, as shown in Table 17.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 220 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 223 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 224 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225 or conservative modifications thereof, as shown in Table 17.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 220, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 221, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 222, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 223, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 224, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 225.
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 117 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 168 scFv (also referred to as "ET150-18 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:69 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:70, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 18.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:69, as shown in Table 18.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:69, as shown in Table 18.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:70, as shown in Table 18.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:70, as shown in Table 18.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:69 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:70, as shown in Table 18.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:226 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228 or conservative modifications thereof, as shown in Table 18.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 229 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 230 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231 or conservative modifications thereof, as shown in Table 18.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 226 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 229 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 230 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231 or conservative modifications thereof, as shown in Table 18.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 226, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 227, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 228, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 229, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 230, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 231.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 118 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 164 scFv (also referred to as "ET150-14 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:73 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:74, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 19.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:73, as shown in Table 19.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:73, as shown in Table 19.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:74, as shown in Table 19.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:74, as shown in Table 19.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:73 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:74, as shown in Table 19.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:232 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 233 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 234 or conservative modifications thereof, as shown in Table 19.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 235 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 236 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 237 or conservative modifications thereof, as shown in Table 19.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 232 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 233 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 234 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 235 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 236 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 237 or conservative modifications thereof, as shown in Table 19.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 232, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 233, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 234, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 235, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 236, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 237.
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 119 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 165 scFv (also referred to as "ET150-15 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:77 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:78, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 20.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:77, as shown in Table 20.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:77, as shown in Table 20.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:78, as shown in Table 20.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:78, as shown in Table 20.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:77 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:78, as shown in Table 20.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:238 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 239 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 240 or conservative modifications thereof, as shown in Table 20.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 241 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 242 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 243 or conservative modifications thereof, as shown in Table 20.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 238 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 239 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 240 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 241 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 242 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 243 or conservative modifications thereof, as shown in Table 20.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 238, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 239, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 240, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 241, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 242, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 243.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 120 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 167 scFv (also referred to as "ET150-17 scFv").
  • GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
  • ET150- 167 scFv also referred to as "ET150-17 scFv”
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:81 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 82, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 21.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:81, as shown in Table 21.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:81, as shown in Table 21.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 82, as shown in Table 21.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:82, as shown in Table 21.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 81 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:82, as shown in Table 21.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:244 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 245 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 246 or conservative modifications thereof, as shown in Table 21.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 247 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 248 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 249 or conservative modifications thereof, as shown in Table 21.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 244 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 245 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 246 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 247 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 248 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 249 or conservative modifications thereof, as shown in Table 21.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 244, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 245, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 246, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 247, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 248, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 249.
  • Table 21
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 121 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 169 scFv (also referred to as "ET150-19 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 85 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 86, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 22.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:85, as shown in Table 22.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:85, as shown in Table 22.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 86, as shown in Table 22.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:86, as shown in Table 22.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 85 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:86, as shown in Table 22.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:250 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 251 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 252 or conservative modifications thereof, as shown in Table 22.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 253 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 254 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 255 or conservative modifications thereof, as shown in Table 22.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 250 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 251 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 252 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 253 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 254 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 255 or conservative modifications thereof, as shown in Table 22.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 250, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 251, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 252, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 253, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 254, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 255.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 122 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 172 scFv (also referred to as "ET150-22 scFv").
  • GPRC5D polypeptide e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof
  • ET150- 172 scFv also referred to as "ET150-22 scFv”
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO: 89 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:90, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 23.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO: 89, as shown in Table 23.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 89, as shown in Table 23.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:90, as shown in Table 23.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:90, as shown in Table 23.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO: 89 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:90, as shown in Table 23.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:256 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 257 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 258 or conservative modifications thereof, as shown in Table 23.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 259 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 260 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 261 or conservative modifications thereof, as shown in Table 23.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 256 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 257 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 258 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 259 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 260 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 261 or conservative modifications thereof, as shown in Table 23.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 256, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 257, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 258, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 259, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 260, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 261.
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 123 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 173 scFv (also referred to as "ET150-23 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:93 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:94, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 24.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:93, as shown in Table 24.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:93, as shown in Table 24.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:94, as shown in Table 24.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:94, as shown in Table 24.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:93 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:94, as shown in Table 24.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:262 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 263 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 264 or conservative modifications thereof, as shown in Table 24.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 265 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 266 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 267 or conservative modifications thereof, as shown in Table 24.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 262 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 263 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 264 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 265 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 266 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 267 or conservative modifications thereof, as shown in Table 24.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 262, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 263, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 264, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 265 f, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 266, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 267.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • ID NO: 262 NO: 263] ID NO: 264]
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 301 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 024 scFv (also referred to as "ET150-174 scFv").
  • ET150- 024 scFv also referred to as "ET150-174 scFv”
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:302 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:303, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 25.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:302, as shown in Table 25.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:302, as shown in Table 25.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:303, as shown in Table 25.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:303, as shown in Table 25.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:302 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:303, as shown in Table 25.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:304 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:305 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:306 or conservative modifications thereof, as shown in Table 25.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO:307 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:308 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:309 or conservative modifications thereof, as shown in Table 25.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 304 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 305 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 306 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 307 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 308 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 309 or conservative modifications thereof, as shown in Table 25.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 304, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 305, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 306, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 307, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 308, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 309.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • ID NO: 304 ID NO: 305] NO: 306]
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 313 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 026 scFv (also referred to as "ET150- 176 scFv").
  • ET150- 026 scFv also referred to as "ET150- 176 scFv”
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:314 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:315, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 26.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81 %, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:314 as shown in Table 26.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:314, as shown in Table 26.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:315, as shown in Table 26.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:315, as shown in Table 26.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:314 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:315 as shown in Table 26.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:316 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:317 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:318 or conservative modifications thereof, as shown in Table 26.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO:319 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:320 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:321 or conservative modifications thereof, as shown in Table 26.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 316 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 317 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 318 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 319 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 320 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 321 or conservative modifications thereof, as shown in Table 26.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 316, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 317, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 318, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 319, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 320, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 321.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • V H GFTFSNYA [SEQ ID rfNSGRST [SEQ ID ARVTHRRYGSTFDS
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 325 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 028 scFv (also referred to as "ET150-178 scFv").
  • ET150- 028 scFv also referred to as "ET150-178 scFv”
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:326 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:327, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 27.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:325 as shown in Table 27.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:325, as shown in Table 27.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:326, as shown in Table 27.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:326, as shown in Table 27.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:325 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:327 as shown in Table 27.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:328 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:329 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:330 or conservative modifications thereof, as shown in Table 27.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO:331 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:332 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:333 or conservative modifications thereof, as shown in Table 27.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 328 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 329 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 330 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 331 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 332 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 333 or conservative modifications thereof, as shown in Table 27.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 328, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 329, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 330, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 331, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 332, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 333.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • V L SSNIGGNT [SEQ ID NO: AAWDASRQGV
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 337 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 029 scFv (also referred to as "ET150- 179 scFv").
  • ET150- 029 scFv also referred to as "ET150- 179 scFv”
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:338 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:339, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 28.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:338 as shown in Table 28.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:338, as shown in Table 28.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:339, as shown in Table 28.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:339, as shown in Table 28.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:338 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:339 as shown in Table 28.
  • the extracellular antigen -binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:340 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:341 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:342 or conservative modifications thereof, as shown in Table 28.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO:343 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:344 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:345 or conservative modifications thereof, as shown in Table 28.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 340 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 341 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 342 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 343 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 344 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 345 or conservative modifications thereof, as shown in Table 28.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 340, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 341, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 342, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 343, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 344, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 345.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • V H GFTFSSYA [SEQ ID ISGSGGST [SEQ ID ARKYQDV [SEQ ID NO: 1]
  • the extracellular antigen-binding domain is a scFv, which comprises the amino acid sequence of SEQ ID NO: 349 and specifically binds to a GPRC5D polypeptide (e.g., a GPRC5D polypeptide having the amino acid sequence SEQ ID NO:97, or fragments thereof), which scFv is designated as ET150- 030 scFv (also referred to as "ET150-180 scFv").
  • the extracellular antigen-binding domain is a scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:350 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:351, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region.
  • the linker comprises amino acids having the sequence set forth in SEQ ID NO:98.
  • the extracellular antigen-binding domain is a scFv-Fc fusion protein or full length human IgG with V H and V L regions or CDRs selected from Table 29.
  • the extracellular antigen-binding domain comprises a V H comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:350 as shown in Table 29.
  • the extracellular antigen-binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:350, as shown in Table 29.
  • the extracellular antigen-binding domain comprises a V L comprising an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to the amino acid sequence set forth in SEQ ID NO:351, as shown in Table 29.
  • the extracellular antigen-binding domain comprises a V L comprising amino acids having the sequence set forth in SEQ ID NO:351, as shown in Table 29.
  • the extracellular antigen- binding domain comprises a V H comprising amino acids having the sequence set forth in SEQ ID NO:350 and a V L comprising amino acids having the sequence set forth in SEQ ID NO:351 as shown in Table 29.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO:352 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:353 or conservative modifications thereof, and a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:354 or conservative modifications thereof, as shown in Table 29.
  • the extracellular antigen-binding domain comprises a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO:355 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:356 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:357 or conservative modifications thereof, as shown in Table 29.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 352 or conservative modifications thereof, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 353 or conservative modifications thereof, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 354 or conservative modifications thereof, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 355 or conservative modifications thereof, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 356 or conservativemodifications thereof, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 357 or conservative modifications thereof, as shown in Table 29.
  • the extracellular antigen-binding domain comprises a V H CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 352, a V H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 353, a V H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 354, a V L CDRl comprising amino acids having the sequence set forth in SEQ ID NO: 355, a V L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 356, and a V L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 357.
  • Antigen A GPRC5D polypeptide having the amino acid sequence of SEQ ID NO: 1
  • V H GFSFSGTA SEQ ISSTGRST [SEQ ID ARPVSSMTLSIQSDG

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Zoology (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Wood Science & Technology (AREA)
  • Hematology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Virology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2015/064102 2014-12-05 2015-12-04 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof Ceased WO2016090312A1 (en)

Priority Applications (34)

Application Number Priority Date Filing Date Title
RU2017123551A RU2762359C2 (ru) 2014-12-05 2015-12-04 Химерные антигенные рецепторы, нацеленные на рецептор, связанный с g-белками, и их применение
JP2017529741A JP6919091B2 (ja) 2014-12-05 2015-12-04 Gタンパク質共役受容体を標的化するキメラ抗原受容体およびその使用
ES15865633T ES2899779T3 (es) 2014-12-05 2015-12-04 Receptores antigénicos quiméricos dirigidos a receptor acoplado a proteína G y usos de los mismos
SI201531772T SI3227339T1 (sl) 2014-12-05 2015-12-04 Himerni antigenski receptorji, ki ciljajo na receptor, povezan z G-proteinom, in njihova uporaba
NZ732574A NZ732574B2 (en) 2015-12-04 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof
MYPI2017000855A MY192065A (en) 2014-12-05 2015-12-04 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof
BR112017011920-0A BR112017011920B1 (pt) 2014-12-05 2015-12-04 Receptores de antígeno quimérico que direcionam receptor acoplado à proteína g, molécula de ácido nucleico, vetor, método in vitro ou ex vivo, composição farmacêutica, kit e usos dos mesmos
DK15865633.0T DK3227339T3 (da) 2014-12-05 2015-12-04 Kimæriske antigenreceptorer rettet mod g-protein-koblet receptor og anvendelser deraf
CN202111119531.9A CN113968912B (zh) 2014-12-05 2015-12-04 靶向g-蛋白偶联受体的嵌合抗原受体及其用途
LTEPPCT/US2015/064102T LT3227339T (lt) 2014-12-05 2015-12-04 Chimeriniai antigeno receptoriai, nukreipti į receptorių su prijungtu g baltymu ir jų naudojimo būdai
SG11201704547RA SG11201704547RA (en) 2014-12-05 2015-12-04 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof
IL252621A IL252621B2 (en) 2014-12-05 2015-12-04 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof
EP21201788.3A EP4015534A1 (en) 2014-12-05 2015-12-04 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof
CN202410434671.2A CN118271463A (zh) 2014-12-05 2015-12-04 靶向g-蛋白偶联受体的嵌合抗原受体及其用途
CA2969864A CA2969864A1 (en) 2014-12-05 2015-12-04 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof
AU2015357518A AU2015357518B2 (en) 2014-12-05 2015-12-04 Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof
HRP20211978TT HRP20211978T1 (hr) 2014-12-05 2015-12-04 Kimerični antigenski receptori koji ciljaju receptor spojen na g-protein i njihove uporabe
MX2017007242A MX385156B (es) 2014-12-05 2015-12-04 Receptores de antígeno quimérico que se dirigen al receptor acoplado a la proteína g y sus usos.
IL310130A IL310130A (en) 2014-12-05 2015-12-04 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof
KR1020177018389A KR102612367B1 (ko) 2014-12-05 2015-12-04 G-단백질 커플화 수용체를 표적화하는 키메라 항원 수용체 및 그의 용도
CN201580075557.4A CN107428829B (zh) 2014-12-05 2015-12-04 靶向g-蛋白偶联受体的嵌合抗原受体及其用途
RS20211596A RS62870B1 (sr) 2014-12-05 2015-12-04 Himerni antigenski receptori sa ciljanim delovanjem na receptore spregnute sa g-proteinom i njihove upotrebe
PL15865633T PL3227339T3 (pl) 2014-12-05 2015-12-04 Chimeryczne receptory antygenowe ukierunkowane na receptory sprzężone białka g oraz ich zastosowania
EP15865633.0A EP3227339B1 (en) 2014-12-05 2015-12-04 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof
SM20220040T SMT202200040T1 (it) 2014-12-05 2015-12-04 Recettori chimerici per l'antigene che bersagliano un recettore accoppiato a proteina g e loro usi
US15/613,800 US10633426B2 (en) 2014-12-05 2017-06-05 Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof
SA517381665A SA517381665B1 (ar) 2014-12-05 2017-06-05 مستقبلات مولد ضد خيمري تستهدف مستقبل مقترن ببروتين واستخداماتها g
PH12017501044A PH12017501044A1 (en) 2014-12-05 2017-06-05 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof
US16/798,059 US11820806B2 (en) 2014-12-05 2020-02-21 Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof
US16/798,104 US11866478B2 (en) 2014-12-05 2020-02-21 Nucleic acid molecules encoding chimeric antigen receptors targeting G-protein coupled receptor
US16/798,151 US10906956B2 (en) 2014-12-05 2020-02-21 Methods of treatments using chimeric antigen receptors targeting G-protein coupled receptor
AU2022200052A AU2022200052A1 (en) 2014-12-05 2022-01-06 Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof
CY20221100105T CY1125008T1 (el) 2014-12-05 2022-02-07 Χιμαιρικοι υποδοχεις αντιγονων που στοχευουν συζευγμενους με πρωτεϊνη g yποδοχεις και χρησεις αυτων
US18/517,766 US20240294599A1 (en) 2014-12-05 2023-11-22 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462088286P 2014-12-05 2014-12-05
US62/088,286 2014-12-05

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/613,800 Continuation US10633426B2 (en) 2014-12-05 2017-06-05 Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof

Publications (1)

Publication Number Publication Date
WO2016090312A1 true WO2016090312A1 (en) 2016-06-09

Family

ID=56092565

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/064102 Ceased WO2016090312A1 (en) 2014-12-05 2015-12-04 Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof

Country Status (26)

Country Link
US (5) US10633426B2 (https=)
EP (2) EP4015534A1 (https=)
JP (4) JP6919091B2 (https=)
KR (1) KR102612367B1 (https=)
CN (4) CN113968912B (https=)
AU (2) AU2015357518B2 (https=)
CA (1) CA2969864A1 (https=)
CY (1) CY1125008T1 (https=)
DK (1) DK3227339T3 (https=)
ES (1) ES2899779T3 (https=)
HR (1) HRP20211978T1 (https=)
HU (1) HUE057777T2 (https=)
IL (2) IL310130A (https=)
LT (1) LT3227339T (https=)
MX (2) MX385156B (https=)
MY (1) MY192065A (https=)
PH (1) PH12017501044A1 (https=)
PL (1) PL3227339T3 (https=)
PT (1) PT3227339T (https=)
RS (1) RS62870B1 (https=)
RU (1) RU2762359C2 (https=)
SA (1) SA517381665B1 (https=)
SG (2) SG10202007326QA (https=)
SI (1) SI3227339T1 (https=)
SM (1) SMT202200040T1 (https=)
WO (1) WO2016090312A1 (https=)

Cited By (76)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018147245A1 (ja) * 2017-02-07 2018-08-16 第一三共株式会社 抗gprc5d抗体及び該抗体を含む分子
EP3227324A4 (en) * 2014-12-05 2018-08-29 Memorial Sloan Kettering Cancer Center Antibodies targeting g-protein coupled receptor and methods of use
WO2018200583A1 (en) 2017-04-26 2018-11-01 Eureka Therapeutics, Inc. Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
WO2019032929A1 (en) 2017-08-09 2019-02-14 Juno Therapeutics, Inc. METHODS AND COMPOSITIONS FOR PREPARING GENETICALLY MODIFIED CELLS
WO2019032927A1 (en) 2017-08-09 2019-02-14 Juno Therapeutics, Inc. METHODS FOR PRODUCING GENETICALLY MODIFIED CELL COMPOSITIONS AND COMPOSITIONS THEREOF
US10208285B2 (en) 2016-10-07 2019-02-19 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
WO2019051335A1 (en) 2017-09-07 2019-03-14 Juno Therapeutics, Inc. METHODS OF IDENTIFYING CELLULAR CHARACTERISTICS RELATED TO RESPONSES ASSOCIATED WITH CELL THERAPY
WO2019089855A1 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Process for generating therapeutic compositions of engineered cells
WO2019089848A1 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Methods associated with tumor burden for assessing response to a cell therapy
WO2019089858A2 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Methods of assessing or monitoring a response to a cell therapy
WO2019090004A1 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Process for producing a t cell composition
WO2019099483A1 (en) * 2017-11-14 2019-05-23 Memorial Sloan-Kettering Cancer Center Il-36 secreting immunoresponsive cells and uses thereof
WO2019109053A1 (en) 2017-12-01 2019-06-06 Juno Therapeutics, Inc. Methods for dosing and for modulation of genetically engineered cells
WO2019113556A1 (en) 2017-12-08 2019-06-13 Juno Therapeutics, Inc. Serum-free media formulation for culturing cells and methods of use thereof
WO2019113559A2 (en) 2017-12-08 2019-06-13 Juno Therapeutics, Inc. Phenotypic markers for cell therapy and related methods
WO2019113557A1 (en) 2017-12-08 2019-06-13 Juno Therapeutics, Inc. Process for producing a composition of engineered t cells
US10358473B2 (en) 2015-05-18 2019-07-23 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
WO2019191704A1 (en) * 2018-03-30 2019-10-03 Eureka Therapeutics, Inc. Constructs targeting cd22 and uses thereof
WO2019220368A1 (en) * 2018-05-16 2019-11-21 Janssen Biotech, Inc. Bcma/cd3 and gprdc5d/cd3 bispecific antibodies for use in cancer therapy
WO2020033927A2 (en) 2018-08-09 2020-02-13 Juno Therapeutics, Inc. Processes for generating engineered cells and compositions thereof
WO2020033916A1 (en) 2018-08-09 2020-02-13 Juno Therapeutics, Inc. Methods for assessing integrated nucleic acids
WO2020092854A2 (en) 2018-11-01 2020-05-07 Juno Therapeutics, Inc. Chimeric antigen receptors specific for g protein-coupled receptor class c group 5 member d (gprc5d)
WO2020089343A1 (en) 2018-10-31 2020-05-07 Juno Therapeutics Gmbh Methods for selection and stimulation of cells and apparatus for same
RU2721582C1 (ru) * 2016-08-05 2020-05-20 И-Байолоджикс Инк. Антитела против лиганда-1 запрограммированной смерти (PD-L1) и их применение
WO2020113194A2 (en) 2018-11-30 2020-06-04 Juno Therapeutics, Inc. Methods for treatment using adoptive cell therapy
WO2020148677A1 (en) * 2019-01-18 2020-07-23 Janssen Biotech, Inc. Gprc5d chimeric antigen receptors and cells expressing the same
WO2020223571A1 (en) 2019-05-01 2020-11-05 Juno Therapeutics, Inc. Cells expressing a chimeric receptor from a modified cd247 locus, related polynucleotides and methods
WO2020223535A1 (en) 2019-05-01 2020-11-05 Juno Therapeutics, Inc. Cells expressing a recombinant receptor from a modified tgfbr2 locus, related polynucleotides and methods
WO2020252218A1 (en) 2019-06-12 2020-12-17 Juno Therapeutics, Inc. Combination therapy of a cell-mediated cytotoxic therapy and an inhibitor of a prosurvival bcl2 family protein
WO2021035194A1 (en) 2019-08-22 2021-02-25 Juno Therapeutics, Inc. Combination therapy of a t cell therapy and an enhancer of zeste homolog 2 (ezh2) inhibitor and related methods
WO2021084050A1 (en) 2019-10-30 2021-05-06 Juno Therapeutics Gmbh Cell selection and/or stimulation devices and methods of use
US11066475B2 (en) 2017-11-01 2021-07-20 Juno Therapeutics, Inc. Chimeric antigen receptors specific for B-cell maturation antigen and encoding polynucleotides
WO2021154887A1 (en) 2020-01-28 2021-08-05 Juno Therapeutics, Inc. Methods for t cell transduction
US11130796B2 (en) 2017-01-05 2021-09-28 Kahr Medical Ltd. SIRPalpha-41BBL fusion protein and methods of use thereof
WO2021231657A1 (en) 2020-05-13 2021-11-18 Juno Therapeutics, Inc. Methods of identifying features associated with clinical response and uses thereof
WO2021260186A1 (en) 2020-06-26 2021-12-30 Juno Therapeutics Gmbh Engineered t cells conditionally expressing a recombinant receptor, related polynucleotides and methods
US11242376B2 (en) 2016-08-02 2022-02-08 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US11299530B2 (en) 2017-01-05 2022-04-12 Kahr Medical Ltd. SIRP alpha-CD70 fusion protein and methods of use thereof
WO2022098787A1 (en) 2020-11-04 2022-05-12 Juno Therapeutics, Inc. Cells expressing a chimeric receptor from a modified invariant cd3 immunoglobulin superfamily chain locus and related polynucleotides and methods
WO2022148370A1 (en) * 2021-01-05 2022-07-14 Lanova Medicines Development Co., Ltd. Anti-gprc5d monoclonal antibodies and uses thereof
WO2022187406A1 (en) 2021-03-03 2022-09-09 Juno Therapeutics, Inc. Combination of a t cell therapy and a dgk inhibitor
WO2022204071A1 (en) 2021-03-22 2022-09-29 Juno Therapeutics, Inc. Method to assess potency of viral vector particles
WO2022204070A1 (en) 2021-03-22 2022-09-29 Juno Therapeutics, Inc. Methods of determining potency of a therapeutic cell composition
WO2022234009A2 (en) 2021-05-06 2022-11-10 Juno Therapeutics Gmbh Methods for stimulating and transducing t cells
US11566060B2 (en) 2017-01-05 2023-01-31 Kahr Medical Ltd. PD1-CD70 fusion protein and methods of use thereof
US11623961B2 (en) 2017-11-01 2023-04-11 Juno Therapeutics, Inc. Antibodies and chimeric antigen receptors specific for B-cell maturation antigen
WO2023079494A1 (en) 2021-11-03 2023-05-11 Janssen Biotech, Inc. Corticosteriod reduction in treatment with anti-cd38 antibodies
US11702458B2 (en) 2017-01-05 2023-07-18 Kahr Medical Ltd. PD1-41BBL fusion protein and methods of use thereof
WO2023147515A1 (en) 2022-01-28 2023-08-03 Juno Therapeutics, Inc. Methods of manufacturing cellular compositions
WO2023213969A1 (en) 2022-05-05 2023-11-09 Juno Therapeutics Gmbh Viral-binding protein and related reagents, articles, and methods of use
WO2023220655A1 (en) 2022-05-11 2023-11-16 Celgene Corporation Methods to overcome drug resistance by re-sensitizing cancer cells to treatment with a prior therapy via treatment with a t cell therapy
US11820806B2 (en) 2014-12-05 2023-11-21 Memorial Sloan-Kettering Cancer Center Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof
WO2023230581A1 (en) 2022-05-25 2023-11-30 Celgene Corporation Methods of manufacturing t cell therapies
US11851491B2 (en) 2016-11-22 2023-12-26 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
WO2024007020A1 (en) 2022-06-30 2024-01-04 Indapta Therapeutics, Inc. Combination of engineered natural killer (nk) cells and antibody therapy and related methods
US11883432B2 (en) 2020-12-18 2024-01-30 Century Therapeutics, Inc. Chimeric antigen receptor system with adaptable receptor specificity
WO2024031091A2 (en) 2022-08-05 2024-02-08 Juno Therapeutics, Inc. Chimeric antigen receptors specific for gprc5d and bcma
WO2024054944A1 (en) 2022-09-08 2024-03-14 Juno Therapeutics, Inc. Combination of a t cell therapy and continuous or intermittent dgk inhibitor dosing
WO2024100604A1 (en) 2022-11-09 2024-05-16 Juno Therapeutics Gmbh Methods for manufacturing engineered immune cells
WO2024161021A1 (en) 2023-02-03 2024-08-08 Juno Therapeutics Gmbh Methods for non-viral manufacturing of engineered immune cells
WO2024220588A1 (en) 2023-04-18 2024-10-24 Juno Therapeutics, Inc. Cytotoxicity assay for assessing potency of therapeutic cell compositions
US12134638B2 (en) 2018-07-11 2024-11-05 Kahr Medical Ltd. SIRPalpha-4-1BBL variant fusion protein and methods of use thereof
WO2024243365A2 (en) 2023-05-23 2024-11-28 Juno Therapeutics, Inc. Activation markers of t cells and method for assessing t cell activation
EP4520346A1 (en) * 2023-09-06 2025-03-12 Gyncentrum Sp. z o.o. Cells, methods and systems for use in the treatment of a cancer with dual-car-t
WO2025059362A1 (en) 2023-09-13 2025-03-20 Juno Therapeutics, Inc. Combination therapies with a cell therapy expressing a gprc5d-targeting car and related methods and uses
US12269859B2 (en) 2016-12-02 2025-04-08 Angeles Therapeutics, Inc. Synthetic immune receptors and methods of use thereof
WO2025076472A1 (en) 2023-10-06 2025-04-10 Juno Therapeutics, Inc. Combination therapies with a cell therapy expressing a gprc5d-targeting car and related methods and uses
US12286466B2 (en) 2018-07-11 2025-04-29 Kahr Medical Ltd. PD1-4-1BBL variant fusion protein and methods of use thereof
WO2025147545A1 (en) 2024-01-03 2025-07-10 Juno Therapeutics, Inc. Lipid nanoparticles for delivery of nucleic acids and related methods and uses
US12473345B2 (en) 2018-11-01 2025-11-18 Juno Therapeutics, Inc. Methods for treatment using chimeric antigen receptors specific for B-cell maturation antigen
US12528878B2 (en) 2016-06-28 2026-01-20 Umc Utrecht Holding B.V. Treatment of IgE-mediated diseases with antibodies that specifically bind CD38
US12528856B2 (en) 2019-08-30 2026-01-20 Allogene Therapeutics, Inc. Chimeric cytokine receptors comprising TGF β binding domains
WO2026020055A2 (en) 2024-07-18 2026-01-22 Juno Therapeutics, Inc. Methods for assessing exosomes in a cell composition and related uses
WO2026025092A1 (en) 2024-07-26 2026-01-29 Juno Therapeutics, Inc. Synthetic promoters for t cell expression
US12570749B2 (en) 2019-12-06 2026-03-10 Juno Therapeutics, Inc. Anti-idiotypic antibodies to GPRC5D-targeted binding domains and related compositions and methods
EP4665759A4 (en) * 2023-03-22 2026-04-08 Biofront Therapeutics Beijing Co Ltd GPRC5D-BINDING NANOBODIES AND THEIR USES

Families Citing this family (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020081988A1 (en) * 2018-10-19 2020-04-23 Memorial Sloan-Kettering Cancer Center Chimeric antigen receptor targeting sialyl lewis a and uses thereof
US10980836B1 (en) 2019-12-11 2021-04-20 Myeloid Therapeutics, Inc. Therapeutic cell compositions and methods of manufacturing and use thereof
TW202204397A (zh) 2020-04-10 2022-02-01 美商亞得捷歐治療公司 對冠狀病毒s蛋白質具特異性之化合物及其用途
EP4308133A4 (en) 2021-03-17 2025-01-22 Myeloid Therapeutics, Inc. MANIPULATED CHIMERIC FUSION PROTEIN COMPOSITIONS AND METHODS OF USE THEREOF
JP2024513446A (ja) * 2021-04-07 2024-03-25 エルジー・ケム・リミテッド Gucy2c結合ポリペプチドおよびその用途
WO2022247756A1 (zh) * 2021-05-23 2022-12-01 上海邦耀生物科技有限公司 靶向gprc5d的嵌合抗原受体及其用途
US20240384001A1 (en) 2021-08-30 2024-11-21 Oricell Therapeutics Co., Ltd. Anti-gprc5d antigen binding protein and use thereof
WO2023134718A1 (zh) 2022-01-14 2023-07-20 原启生物科技(上海)有限责任公司 靶向gprc5d的嵌合抗原受体及其用途
EP4471065A4 (en) 2022-01-29 2025-11-26 Carsgen Life Sciences Co Ltd GPRC5D ANTIBODY AND ITS USE
US20250382586A1 (en) 2022-05-17 2025-12-18 Umoja Biopharma, Inc. Manufacturing viral particles
WO2023240282A1 (en) 2022-06-10 2023-12-14 Umoja Biopharma, Inc. Engineered stem cells and uses thereof
US20250177530A1 (en) * 2022-06-24 2025-06-05 University Of Pittsburgh - Of The Commonwealth System Of Higher Education Molecules that bind to enpp1 polypeptides
CN116003598B (zh) 2022-08-30 2024-04-26 苏州缔码生物科技有限公司 靶向人gprc5d的重组人源化单克隆抗体及其应用
WO2024097992A2 (en) 2022-11-04 2024-05-10 Umoja Biopharma, Inc. Particles displaying adhesion-molecule fusions
WO2024102954A1 (en) 2022-11-10 2024-05-16 Massachusetts Institute Of Technology Activation induced clipping system (aics)
CN117229407B (zh) * 2023-11-14 2024-02-20 成都优赛诺生物科技有限公司 一种靶向gprc5d的单域抗体、嵌合抗原受体及其应用
WO2025129084A1 (en) 2023-12-13 2025-06-19 Umoja Biopharma, Inc. Engineered induced stem cell derived myeloid cells and methods of differentiating and using same
WO2025231174A1 (en) 2024-04-30 2025-11-06 Umoja Biopharma, Inc. Manufacturing viral particles
WO2025231408A2 (en) 2024-05-03 2025-11-06 Janssen Biotech, Inc. Methods for treating multiple myeloma with car-t cells and bispecific antibodies
WO2025231372A2 (en) 2024-05-03 2025-11-06 Janssen Biotech, Inc. Methods for treating multiple myeloma with car-t cells and bispecific antibodies
WO2025235604A1 (en) 2024-05-08 2025-11-13 Umoja Biopharma, Inc. Fusion protein for use as immune cell engager

Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4956778A (en) 1987-07-02 1990-09-11 Mitsubishi Denki Kabushiki Kaisha Constant speed holding device
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
US20050196754A1 (en) 2000-03-31 2005-09-08 Drmanac Radoje T. Novel nucleic acids and polypeptides
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
US8389282B2 (en) 2007-03-30 2013-03-05 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
WO2014087010A1 (en) 2012-12-07 2014-06-12 Ablynx N.V. IMPROVED POLYPEPTIDES DIRECTED AGAINST IgE
WO2014127261A1 (en) * 2013-02-15 2014-08-21 The Regents Of The University Of California Chimeric antigen receptor and methods of use thereof
US20140322183A1 (en) * 2013-03-15 2014-10-30 The Trustees Of The University Of Pennsylvania Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
WO2014191128A1 (en) 2013-05-29 2014-12-04 Cellectis Methods for engineering t cells for immunotherapy by using rna-guided cas nuclease system

Family Cites Families (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2001268427B2 (en) 2000-06-16 2007-03-29 Glaxosmithkline Intellectual Property Limited Antibodies that immunospecifically bind to blys
EP1463523A4 (en) 2001-08-20 2005-08-10 Genentech Inc PROTEIN AND NUCLEIC ACID OF THE GENDER INDUCED BY GPCR-LIKE RETINIC ACID 1
EP1468694A1 (en) * 2001-12-27 2004-10-20 Sumitomo Pharmaceuticals Company, Limited Remedies for anorexia or lifestyle-related diseases and method of screening the same
US20040110139A1 (en) * 2002-12-10 2004-06-10 Isis Pharmaceuticals Inc. Modulation of G protein-coupled receptor 3 expression
CA2510315C (en) 2002-12-20 2014-01-28 Abbvie Biotherapeutics Inc. Antibodies against gpr64 and uses thereof
WO2004072117A2 (en) 2003-02-13 2004-08-26 Pharmacia Corporation Antibodies to c-met for the treatment of cancers
WO2005019258A2 (en) 2003-08-11 2005-03-03 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
RS53984B1 (sr) * 2003-12-10 2015-10-30 E. R. Squibb & Sons L.L.C. Ip-10 antitela i njihove upotrebe
US20050266008A1 (en) * 2004-03-29 2005-12-01 Medarex, Inc. Human anti-IRTA-5 antibodies
TW200815474A (en) 2006-08-03 2008-04-01 Astrazeneca Ab Antibodies alphaVbeta6 and uses thereof
US9512236B2 (en) 2006-12-19 2016-12-06 Ablynx N.V. Amino acid sequences directed against GPCRS and polypeptides comprising the same for the treatment of GPCR-related diseases and disorders
CA2699394C (en) 2007-09-17 2020-03-24 The Regents Of The University Of California Internalizing human monoclonal antibodies targeting prostate cancer cells in situ
US7947807B2 (en) 2007-10-15 2011-05-24 The Board Of Trustees Of The Leland Stanford Junior University Method for obtaining G protein-coupled receptor (GPCR) diffraction-quality crystals employing a monoclonal antibody that binds to the third intracellular loop (IL3)
BRPI0819210A2 (pt) * 2007-10-25 2015-06-23 Trellis Bioscience Inc Anticorpos de proteína g anti-rsv
PT2242773T (pt) 2008-02-11 2017-09-15 Cure Tech Ltd Anticorpos monoclonais para o tratamento de tumores
US9217032B2 (en) 2010-01-08 2015-12-22 Les Laboratoires Servier Methods for treating colorectal cancer
ES2739711T3 (es) 2010-07-22 2020-02-03 John W Schrader Anticuerpo de protección cruzada contra la infección por el virus de la gripe
PH12013501201A1 (en) 2010-12-09 2013-07-29 Univ Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer
US9833476B2 (en) * 2011-08-31 2017-12-05 The Trustees Of Dartmouth College NKP30 receptor targeted therapeutics
CN103483452B (zh) * 2012-06-12 2021-08-13 上海细胞治疗集团有限公司 双信号独立的嵌合抗原受体及其用途
JO3519B1 (ar) 2013-01-25 2020-07-05 Amgen Inc تركيبات أجسام مضادة لأجل cdh19 و cd3
EP3593812A3 (en) 2014-03-15 2020-05-27 Novartis AG Treatment of cancer using chimeric antigen receptor
BR112016030740A2 (pt) 2014-07-01 2018-02-20 Pfizer Inc. diacorpos heterodiméricos biespecíficos e seus usos
WO2016014530A1 (en) 2014-07-21 2016-01-28 Novartis Ag Combinations of low, immune enhancing. doses of mtor inhibitors and cars
EP3227324A4 (en) 2014-12-05 2018-08-29 Memorial Sloan Kettering Cancer Center Antibodies targeting g-protein coupled receptor and methods of use
SI3227339T1 (sl) 2014-12-05 2022-02-28 Memorial Sloan-Kettering Cancer Center Himerni antigenski receptorji, ki ciljajo na receptor, povezan z G-proteinom, in njihova uporaba
EP3842450A1 (en) 2015-10-23 2021-06-30 Eureka Therapeutics, Inc. Antibody/t-cell receptor chimeric constructs and uses thereof
KR20180089497A (ko) 2015-12-04 2018-08-08 메모리얼 슬로안-케터링 캔서 센터 Fc 수용체-유사 5를 표적화하는 항체 및 사용 방법
WO2017172981A2 (en) 2016-03-29 2017-10-05 University Of Southern California Chimeric antigen receptors targeting cancer
CA3018253A1 (en) 2016-03-31 2017-10-05 University Of Southern California A highly sensitive and specific luciferase based reporter assay for antigen detection
CN108239144B (zh) 2018-01-26 2021-05-25 重庆精准生物技术有限公司 改造的铰链及其在构建car骨架中的应用
MA54079A (fr) 2018-11-01 2021-09-08 Juno Therapeutics Inc Récepteurs antigéniques chimériques spécifiques du gprc5d (élément d du groupe 5 de classe c des récepteurs couplés à la protéine g)

Patent Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US4956778A (en) 1987-07-02 1990-09-11 Mitsubishi Denki Kabushiki Kaisha Constant speed holding device
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
US20050196754A1 (en) 2000-03-31 2005-09-08 Drmanac Radoje T. Novel nucleic acids and polypeptides
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
US8389282B2 (en) 2007-03-30 2013-03-05 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
WO2014087010A1 (en) 2012-12-07 2014-06-12 Ablynx N.V. IMPROVED POLYPEPTIDES DIRECTED AGAINST IgE
WO2014127261A1 (en) * 2013-02-15 2014-08-21 The Regents Of The University Of California Chimeric antigen receptor and methods of use thereof
US20140322183A1 (en) * 2013-03-15 2014-10-30 The Trustees Of The University Of Pennsylvania Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
WO2014191128A1 (en) 2013-05-29 2014-12-04 Cellectis Methods for engineering t cells for immunotherapy by using rna-guided cas nuclease system

Non-Patent Citations (100)

* Cited by examiner, † Cited by third party
Title
"NCBI", Database accession no. NP_036224
"REMINGTON'S PHARMACEUTICAL SCIENCE", 1985
"UniProtKB", Database accession no. P18627.5
ANDERSON, SCIENCE, vol. 226, 1984, pages 401 - 409
ATAMANIUK, J. ET AL.: "Overexpression of G protein-coupled receptor 5D in the bone marrow is associated with poor prognosis in patients with multiple myeloma", EUROPEAN JOURNAL OF CLINICAL INVESTIGATION, vol. 42, 2012, pages 953 - 960, XP055408192, DOI: 10.1111/j.1365-2362.2012.02679.x
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 2001, WILEY INTERSCIENCE
AUSUBEL, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1987
BAM, R. ET AL.: "GPRC5D Is a Cell Surface Plasma Cell Marker Whose Expression Is High In Myeloma Cells and Reduced Following Coculture With Osteoclasts", BLOOD, vol. 122, 2013, pages 3099
BATAILLE, R. ET AL.: "The phenotype of normal, reactive and malignant plasma cells. Identification of ''many and multiple myelomas'' and of new targets for myeloma therapy", HAEMATOLOGICA, vol. 91, 2006, pages 1234 - 1240, XP002444357
BENTONDAVIS, SCIENCE, vol. 196, 1977, pages 180
BLOOMER ET AL., JOURNAL OF VIROLOGY, vol. 71, 1997, pages 6641 - 6649
BOYD, K.D. ET AL.: "The clinical impact and molecular biology of del(17p) in multiple myeloma treated with conventional or thalidomide-based therapy", GENES, CHROMOSOMES & CANCER, vol. 50, 2011, pages 765 - 774
BREGNI ET AL., BLOOD, vol. 80, 1992, pages 1418 - 1422
BRENTJENS, R.J. ET AL.: "CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute lymphoblastic leukemia", SCIENCE TRANSLATIONAL MEDICINE, vol. 5, 2013, pages 177 - 138
BRENTJENS, R.J. ET AL.: "Eradication of systemic B-cell tumors by genetically targeted human T lymphocytes co-stimulated by CD80 and interleukin-15", NATURE MEDICINE, vol. 9, 2003, pages 279 - 286, XP002799040, DOI: 10.1038/nm827
BRENTJENS, R.J. ET AL.: "Genetically targeted T cells eradicate systemic acute lymphoblastic leukemia xenografts", CLIN.CANCER RES., vol. 13, 2007, pages 5426 - 5435, XP055204921, DOI: 10.1158/1078-0432.CCR-07-0674
BRENTJENS, R.J. ET AL.: "Safety and persistence of adoptively transferred autologous CD19-targeted T cells in patients with relapsed or chemotherapy refractory B-cell leukemias", BLOOD, vol. 118, 2011, pages 4817 - 4828, XP055169039, DOI: 10.1182/blood-2011-04-348540
BRIGHAM ET AL., AM. J. MED. SCI., vol. 298, 1989, pages 278
BROCKS ET AL., IMMUNOTECHNOLOGY, vol. 3, no. 3, 1997, pages 173 - 84
CAYOUETTE ET AL., HUMAN GENE THERAPY, vol. 8, 1997, pages 423 - 430
COHEN, Y.GUTWEIN, O.GARACH-JEHOSHUA, O.BAR-HAIM, A.KORNBERG, A: "GPRC5D is a promising marker for monitoring the tumor load and to target multiple myeloma cells", HEMATOLOGY (AMSTERDAM, NETHERLANDS), vol. 18, 2013, pages 348 - 351, XP009195526, DOI: 10.1179/1607845413Y.0000000079
COLIGAN, CURRENT PROTOCOLS IN IMMUNOLOGY, 1991
CORNETTA ET AL., NUCLEIC ACID RESEARCH
DANOS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 6460 - 6464
DAVILA, M.L. ET AL.: "Efficacy and Toxicity Management of 19-28z CAR T Cell Therapy in B Cell Acute Lymphoblastic Leukemia", SCIENCE TRANSLATIONAL MEDICINE, vol. 6, 2014, pages 224 - 225
DUDLEY, M.E. ET AL.: "Adoptive cell therapy for patients with metastatic melanoma: evaluation of intensive myeloablative chemoradiation preparative regimens", J CLIN ONCOL, vol. 26, 2008, pages 5233 - 5239, XP009117624, DOI: 10.1200/JCO.2008.16.5449
DUPONT, J. ET AL., CANCER RES, vol. 65, 2005, pages 5417 - 5427
EGLITIS ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 608 - 614
FEIGNER ET AL., PROC. NAT'L. ACAD. SCI. U.S.A., vol. 84, 1987, pages 7413
FIFE, J CLIN INVST, vol. 116, no. 8, 2006, pages 2252 - 61
FRESHNEY, ANIMAL CELL CULTURE, 1987
FRIEDMAN, SCIENCE, vol. 244, 1989, pages 1275 - 1281
FRIGYESI, I. ET AL.: "Robust isolation of malignant plasma cells in multiple myeloma", BLOOD, vol. 123, 2014, pages 1336 - 1340
GADE, T.P. ET AL.: "Targeted elimination of prostate cancer by genetically directed human T lymphocytes", CANCER RES., vol. 65, 2005, pages 9080 - 9088
GAHRTON, G. ET AL.: "Allogeneic bone marrow transplantation in multiple myeloma. European Group for Bone Marrow Transplantation", THE NEW ENGLAND JOURNAL OF MEDICINE, vol. 325, 1991, pages 1267 - 1273
GIOMARELLI ET AL., THROMB HAEMOST, vol. 97, no. 6, 2007, pages 955 - 63
GONG, M.C. ET AL.: "Cancer patient T cells genetically targeted to prostate-specific membrane antigen specifically lyse prostate cancer cells and release cytokines in response to prostate-specific membrane antigen", NEOPLASIA, vol. 1, 1999, pages 123 - 127, XP055348359, DOI: 10.1038/sj.neo.7900018
GRUNSTEINROGNESS, PROC. NATL. ACAD. SCI., USA, vol. 72, 1975, pages 3961
HO ET AL., BIOCHIM BIOPHYS ACTA, vol. 1638, no. 3, 2003, pages 257 - 66
HOLLYMAN, D. ET AL.: "Manufacturing validation of biologically functional T cells targeted to CD19 antigen for autologous adoptive cell therapy", J IMMUNOTHER, vol. 32, 2009, pages 169 - 180, XP055389370, DOI: 10.1097/CJI.0b013e318194a6e8
HUGHES ET AL., J. CLIN. INVEST., vol. 89, 1992, pages 1817
HUNDER, N.N. ET AL.: "Treatment of metastatic melanoma with autologous CD4+ T cells against NY-ESO-1", N.ENGL.J.MED., vol. 358, 2008, pages 2698 - 2703, XP055187197, DOI: 10.1056/NEJMoa0800251
HUSTON ET AL., PROC. NAT. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
JOHNSON, CHEST, vol. 107, 1995, pages 77S - 83S
KERSHAW, M.H. ET AL.: "Gene-engineered T cells as a superior adjuvant therapy for metastatic cancer", J IMMUNOL, vol. 173, 2004, pages 2143 - 2150, XP002533910
KIDO ET AL., CURRENT EYE RESEARCH, vol. 15, 1996, pages 833 - 844
KIMMEL, A. R., METHODS ENZYMOL., vol. 152, 1987, pages 507
KRAUSE, A. ET AL.: "Antigen-dependent CD28 signaling selectively enhances survival and proliferation in genetically modified activated human primary T lymphocytes", J EXP MED, vol. 188, 1998, pages 619 - 626, XP001240431, DOI: 10.1084/jem.188.4.619
LE GAL LA SALLE ET AL., SCIENCE, vol. 259, 1993, pages 988 - 990
LEDBETTER ET AL., CRIT REV IMMUNO1, vol. 17, no. 5-6, 1997, pages 427 - 55
LYDDANE, C. ET AL.: "Cutting Edge: CD28 controls dominant regulatory T cell activity during active immunization", J.IMMUNOL., vol. 176, 2006, pages 3306 - 3310
MAHER, J.BRENTJENS, R.J.GUNSET, G.RIVIERE, I.SADELAIN, M.: "Human T-lymphocyte cytotoxicity and proliferation directed by a single chimeric TCRzeta /CD28 receptor", NAT.BIOTECHNOL., vol. 20, 2002, pages 70 - 75, XP002588277
MILLER ET AL., BIOTECHNOLOGY, vol. 7, 1989, pages 980 - 990
MILLER ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 431 - 437
MILLER ET AL., MOL. CELL. BIOL., vol. 6, 1986, pages 2895 - 2902
MILLER, HUMAN GENE THERAPY, vol. 15-14, pages 1990
MILLERCALOS, GENE TRANSFER VECTORS FOR MAMMALIAN CELLS, 1987
MIYOSHI ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 94, 1997, pages 10319
MOEN, BLOOD CELLS, vol. 17, 1991, pages 407 - 416
MOLECULAR BIOLOGY, vol. 36, 1987, pages 311 - 322
MOOSMAYER ET AL., THER IMMUNOL, vol. 2, no. 10, 1995, pages 31 - 40
MORGAN, R.A. ET AL., SCIENCE, vol. 314, 2006, pages 126 - 129
MORGAN, R.A. ET AL.: "Case report of a serious adverse event following the administration of T cells transduced with a chimeric antigen receptor recognizing ERBB2", MOLECULAR THERAPY : THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 18, 2010, pages 843 - 851, XP055023624, DOI: 10.1038/mt.2010.24
MULLIS, PCR: THE POLYMERASE CHAIN REACTION, 1994
NALDINI ET AL., SCIENCE, vol. 272, 1996, pages 263 - 267
OLIGONUCLEOTIDE SYNTHESIS, 1984
ONO ET AL., NEUROSCIENCE LETTERS, vol. 17, 1990, pages 259
PANELLI, M.C. ET AL., J IMMUNOL, vol. 164, 2000, pages 4382 - 4392
PAPANICOLAOU, G.A. ET AL., BLOOD, vol. 102, 2003, pages 2498 - 2505
PEGRAM, H.J. ET AL.: "Tumor-targeted T cells modified to secrete IL-12 eradicate systemic tumors without need for prior conditioning", BLOOD, vol. 119, 2012, pages 4133 - 4141, XP055109416, DOI: 10.1182/blood-2011-12-400044
PETER ET AL., J BIOI CHERN, vol. 25278, no. 38, 2003, pages 36740 - 7
PETER ET AL., J CACHEXIA SARCOPENIA MUSCLE, 12 August 2012 (2012-08-12)
POSTHUMUS ET AL., J. VIROLOGY, vol. 64, 1990, pages 3304 - 3309
RIVIERE, I.SADELAIN, M.BRENTJENS, R.J.: "Novel strategies for cancer therapy: the potential of genetically modified T lymphocytes", CURR HEMATOL REP, vol. 3, 2004, pages 290 - 297
ROSENBERG ET AL., N. ENGL. J. MED, vol. 323, 1990, pages 370
ROSENBERG, S.A.RESTIFO, N.P.YANG, J.C.MORGAN, R.A.DUDLEY, M.E: "Adoptive cell transfer: a clinical path to effective cancer immunotherapy", NAT.REV.CANCER, vol. 8, 2008, pages 299 - 308, XP002571413, DOI: 10.1038/nrc2355
SABRINA BERTILACCIO, M.T. ET AL.: "Low-Dose Lenalidomide Improves CAR-Based Immunotherapy In CLL By Reverting T-Cell Defects In Vivo", BLOOD, vol. 122, 2013, pages 4171
SADELAIN, M. ET AL., NAT REV CANCER, vol. 3, 2003, pages 35 - 45
SADELAIN, M.BRENTJENS, R.RIVIERE, I.: "The basic principles of chimeric antigen receptor design", CANCER DISCOVERY, vol. 3, 2013, pages 388 - 398, XP055287277, DOI: 10.1158/2159-8290.CD-12-0548
SADELAIN, M.BRENTJENS, R.RIVIERE, I.: "The promise and potential pitfalls of chimeric antigen receptors", CURR OPIN IMMUNOL, 2009
SAMBROOK ET AL.: "Seventh Training Course on Radioligand Assay Techniques", March 1986, COLD SPRING HARBOR LABORATORY PRESS, article "Principles of Radioimmunoassays"
SAMBROOKFRITSCHMANIATIS: "Molecular Cloning: A Laboratory Manual", 1989, CSH PRESS
SHARP, THE LANCET, vol. 337, 1991, pages 1277 - 1278
SHAUGHNESSY, J.D., JR. ET AL.: "A validated gene expression model of high-risk multiple myeloma is defined by deregulated expression of genes mapping to chromosome 1", BLOOD, vol. 109, 2007, pages 2276 - 2284, XP086507984, DOI: 10.1182/blood-2006-07-038430
SHEN ET AL., ANAL. CHEM., vol. 80, no. 6, 2008, pages 1910 - 1917
SHIEH ET AL., J IMUNOL, vol. 183, no. 4, 2009, pages 2277 - 85
SIEGEL, R.NAISHADHAM, D.JEMAL, A: "Cancer statistics", CA: A CANCER JOURNAL FOR CLINICIANS, vol. 63, 2013, pages 11 - 30
STAUBINGER ET AL., METHODS IN ENZYMOLOGY, vol. 101, 1983, pages 512
STEPHAN, M.T. ET AL.: "T cell-encoded CD80 and 4-1BBL induce auto- and transco-stimulation, resulting in potent tumor rejection", NAT.MED., vol. 13, 2007, pages 1440 - 1449
TIMMERMAN ET AL., J. MOL. RECOGNIT, vol. 20, 2007, pages 283 - 29
TOLSTOSHEV ET AL., CURRENT OPINION IN BIOTECHNOLOGY, vol. 1, 1990, pages 55 - 61
WAHL ET AL., J. NUCL. MED., vol. 24, 1983, pages 316 - 325
WAHL, G. M.S. L. BERGER, METHODS ENZYMOL, vol. 152, 1987, pages 399
WEIR: "Handbook of Experimental Immunology", 1996, article "Methods in Enzymology"
WOLFF ET AL., SCIENCE, vol. 247, 1990, pages 1465
WU ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 263, 1988, pages 14621
WU ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 264, 1989, pages 16985
XIE ET AL., NAT BIOTECH, vol. 15, no. 8, 1997, pages 768 - 71
XU ET AL., EXP. HEMAT., vol. 22, 1994, pages 223 - 230
ZHAO ET AL., HYRBIDOMA (LARCHMT, vol. 27, no. 6, 2008, pages 455 - 51

Cited By (125)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11866478B2 (en) 2014-12-05 2024-01-09 Memorial Sloan-Kettering Cancer Center Nucleic acid molecules encoding chimeric antigen receptors targeting G-protein coupled receptor
EP3227324A4 (en) * 2014-12-05 2018-08-29 Memorial Sloan Kettering Cancer Center Antibodies targeting g-protein coupled receptor and methods of use
US11566071B2 (en) 2014-12-05 2023-01-31 Memorial Sloan Kettering Cancer Center Nucleic acid molecules encoding anti-GPRC5D antibodies
US11820806B2 (en) 2014-12-05 2023-11-21 Memorial Sloan-Kettering Cancer Center Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof
US11965012B2 (en) 2015-05-18 2024-04-23 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US10358474B2 (en) 2015-05-18 2019-07-23 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US11028142B2 (en) 2015-05-18 2021-06-08 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US10442849B2 (en) 2015-05-18 2019-10-15 Tcr2 Therabeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US10358473B2 (en) 2015-05-18 2019-07-23 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US12528878B2 (en) 2016-06-28 2026-01-20 Umc Utrecht Holding B.V. Treatment of IgE-mediated diseases with antibodies that specifically bind CD38
US11242376B2 (en) 2016-08-02 2022-02-08 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US10919966B2 (en) 2016-08-05 2021-02-16 Y-Biologics Inc. Antibody to programmed death-ligand 1 (PD-L1) and use thereof
RU2721582C1 (ru) * 2016-08-05 2020-05-20 И-Байолоджикс Инк. Антитела против лиганда-1 запрограммированной смерти (PD-L1) и их применение
US11085021B2 (en) 2016-10-07 2021-08-10 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US10208285B2 (en) 2016-10-07 2019-02-19 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US11377638B2 (en) 2016-10-07 2022-07-05 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US11851491B2 (en) 2016-11-22 2023-12-26 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US12269859B2 (en) 2016-12-02 2025-04-08 Angeles Therapeutics, Inc. Synthetic immune receptors and methods of use thereof
US12331098B2 (en) 2017-01-05 2025-06-17 Kahr Medical Ltd. SIRPalpha-41BBL fusion protein and methods of use thereof
US11566060B2 (en) 2017-01-05 2023-01-31 Kahr Medical Ltd. PD1-CD70 fusion protein and methods of use thereof
US11897937B2 (en) 2017-01-05 2024-02-13 Kahr Medical Ltd. SIRPalpha-41BBL fusion protein and methods of use thereof
US11702458B2 (en) 2017-01-05 2023-07-18 Kahr Medical Ltd. PD1-41BBL fusion protein and methods of use thereof
US11299530B2 (en) 2017-01-05 2022-04-12 Kahr Medical Ltd. SIRP alpha-CD70 fusion protein and methods of use thereof
US11130796B2 (en) 2017-01-05 2021-09-28 Kahr Medical Ltd. SIRPalpha-41BBL fusion protein and methods of use thereof
WO2018147245A1 (ja) * 2017-02-07 2018-08-16 第一三共株式会社 抗gprc5d抗体及び該抗体を含む分子
EP3581651A4 (en) * 2017-02-07 2021-05-12 Daiichi Sankyo Company, Limited ANTI-GPRC5D ANTIBODY AND MOLECULE WITH IT
US11613573B2 (en) 2017-04-26 2023-03-28 Eureka Therapeutics, Inc. Chimeric antibody/T-cell receptor constructs and uses thereof
WO2018200583A1 (en) 2017-04-26 2018-11-01 Eureka Therapeutics, Inc. Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
US11965021B2 (en) 2017-04-26 2024-04-23 Eureka Therapeutics, Inc. Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
US10822413B2 (en) 2017-04-26 2020-11-03 Eureka Therapeutics, Inc. Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
US12215348B2 (en) 2017-08-09 2025-02-04 Juno Therapeutics, Inc. Methods for producing genetically engineered cell compositions and related compositions
US11851678B2 (en) 2017-08-09 2023-12-26 Juno Therapeutics, Inc. Methods for producing genetically engineered cell compositions and related compositions
WO2019032929A1 (en) 2017-08-09 2019-02-14 Juno Therapeutics, Inc. METHODS AND COMPOSITIONS FOR PREPARING GENETICALLY MODIFIED CELLS
WO2019032927A1 (en) 2017-08-09 2019-02-14 Juno Therapeutics, Inc. METHODS FOR PRODUCING GENETICALLY MODIFIED CELL COMPOSITIONS AND COMPOSITIONS THEREOF
EP4516896A2 (en) 2017-08-09 2025-03-05 Juno Therapeutics, Inc. Methods and compositions for preparing genetically engineered cells
WO2019051335A1 (en) 2017-09-07 2019-03-14 Juno Therapeutics, Inc. METHODS OF IDENTIFYING CELLULAR CHARACTERISTICS RELATED TO RESPONSES ASSOCIATED WITH CELL THERAPY
US12168027B2 (en) 2017-11-01 2024-12-17 Juno Therapeutics, Inc. Methods associated with tumor burden for assessing response to a cell therapy
US12258580B2 (en) 2017-11-01 2025-03-25 Juno Therapeutics, Inc. Process for generating therapeutic compositions of engineered cells
US11066475B2 (en) 2017-11-01 2021-07-20 Juno Therapeutics, Inc. Chimeric antigen receptors specific for B-cell maturation antigen and encoding polynucleotides
WO2019089855A1 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Process for generating therapeutic compositions of engineered cells
WO2019089848A1 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Methods associated with tumor burden for assessing response to a cell therapy
WO2019089858A2 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Methods of assessing or monitoring a response to a cell therapy
WO2019090004A1 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Process for producing a t cell composition
US12428486B2 (en) 2017-11-01 2025-09-30 Juno Therapeutics, Inc. Chimeric antigen receptors specific for B-cell maturation antigen and encoding polynucleotides
US12031975B2 (en) 2017-11-01 2024-07-09 Juno Therapeutics, Inc. Methods of assessing or monitoring a response to a cell therapy
US11623961B2 (en) 2017-11-01 2023-04-11 Juno Therapeutics, Inc. Antibodies and chimeric antigen receptors specific for B-cell maturation antigen
US11564946B2 (en) 2017-11-01 2023-01-31 Juno Therapeutics, Inc. Methods associated with tumor burden for assessing response to a cell therapy
EP4512823A2 (en) 2017-11-01 2025-02-26 Juno Therapeutics, Inc. Process for generating therapeutic compositions of engineered cells
US11766474B2 (en) 2017-11-14 2023-09-26 Memorial Sloan-Kettering Cancer Center IL-36 secreting immunoresponsive cells and uses thereof
US12544440B2 (en) 2017-11-14 2026-02-10 Memorial Sloan-Kettering Cancer Center IL-36 secreting immunoresponsive cells and uses thereof
WO2019099483A1 (en) * 2017-11-14 2019-05-23 Memorial Sloan-Kettering Cancer Center Il-36 secreting immunoresponsive cells and uses thereof
WO2019109053A1 (en) 2017-12-01 2019-06-06 Juno Therapeutics, Inc. Methods for dosing and for modulation of genetically engineered cells
WO2019113559A2 (en) 2017-12-08 2019-06-13 Juno Therapeutics, Inc. Phenotypic markers for cell therapy and related methods
WO2019113557A1 (en) 2017-12-08 2019-06-13 Juno Therapeutics, Inc. Process for producing a composition of engineered t cells
WO2019113556A1 (en) 2017-12-08 2019-06-13 Juno Therapeutics, Inc. Serum-free media formulation for culturing cells and methods of use thereof
US12161670B2 (en) 2017-12-08 2024-12-10 Juno Therapeutics, Inc. Phenotypic markers for cell therapy and related methods
US12553024B2 (en) 2017-12-08 2026-02-17 Juno Therapeutics, Inc. Serum-free media formulation for culturing cells and methods of use thereof
US12577285B2 (en) 2017-12-08 2026-03-17 Juno Therapeutics, Inc. Process for producing a composition of engineered T cells
US11827672B2 (en) 2018-03-30 2023-11-28 Eureka Therapeutics, Inc. Constructs trageting CD22 and uses thereof
WO2019191704A1 (en) * 2018-03-30 2019-10-03 Eureka Therapeutics, Inc. Constructs targeting cd22 and uses thereof
EP3774919A4 (en) * 2018-03-30 2021-12-29 Eureka Therapeutics, Inc. Constructs targeting cd22 and uses thereof
US12065500B2 (en) 2018-05-16 2024-08-20 Janssen Biotech, Inc. Methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics
WO2019220368A1 (en) * 2018-05-16 2019-11-21 Janssen Biotech, Inc. Bcma/cd3 and gprdc5d/cd3 bispecific antibodies for use in cancer therapy
US12012461B2 (en) 2018-05-16 2024-06-18 Janssen Biotech, Inc. Methods of treating cancers and enhancing efficacy of T cell redirecting therapeutics
EP3793606A4 (en) * 2018-05-16 2022-08-31 Janssen Biotech, Inc. METHODS OF TREATMENT OF CANCER AND ENHANCEMENT OF THE EFFECTIVENESS OF T-CELL REFERRING THERAPEUTICS
TWI899054B (zh) * 2018-05-16 2025-10-01 美商健生生物科技公司 治療癌症及增強t細胞重定向治療劑之功效的方法(一)
US12134638B2 (en) 2018-07-11 2024-11-05 Kahr Medical Ltd. SIRPalpha-4-1BBL variant fusion protein and methods of use thereof
US12286466B2 (en) 2018-07-11 2025-04-29 Kahr Medical Ltd. PD1-4-1BBL variant fusion protein and methods of use thereof
US12516099B2 (en) 2018-08-09 2026-01-06 Juno Therapeutics, Inc. Processes for generating engineered cells and compositions thereof
WO2020033916A1 (en) 2018-08-09 2020-02-13 Juno Therapeutics, Inc. Methods for assessing integrated nucleic acids
WO2020033927A2 (en) 2018-08-09 2020-02-13 Juno Therapeutics, Inc. Processes for generating engineered cells and compositions thereof
WO2020089343A1 (en) 2018-10-31 2020-05-07 Juno Therapeutics Gmbh Methods for selection and stimulation of cells and apparatus for same
US12522660B2 (en) 2018-10-31 2026-01-13 C3S2 Gmbh Methods for selection and stimulation of cells and apparatus for same
WO2020092854A2 (en) 2018-11-01 2020-05-07 Juno Therapeutics, Inc. Chimeric antigen receptors specific for g protein-coupled receptor class c group 5 member d (gprc5d)
WO2020092854A3 (en) * 2018-11-01 2020-07-02 Juno Therapeutics, Inc. Chimeric antigen receptors specific for g protein-coupled receptor class c group 5 member d (gprc5d)
US12473345B2 (en) 2018-11-01 2025-11-18 Juno Therapeutics, Inc. Methods for treatment using chimeric antigen receptors specific for B-cell maturation antigen
EP4427810A2 (en) 2018-11-30 2024-09-11 Juno Therapeutics, Inc. Methods for treatment using adoptive cell therapy
WO2020113194A2 (en) 2018-11-30 2020-06-04 Juno Therapeutics, Inc. Methods for treatment using adoptive cell therapy
JP7303314B2 (ja) 2019-01-18 2023-07-04 ヤンセン バイオテツク,インコーポレーテツド Gprc5dキメラ抗原受容体及びそれを発現する細胞
US12077592B2 (en) 2019-01-18 2024-09-03 Janssen Biotech, Inc. GPRC5D chimeric antigen receptors and cells expressing the same
WO2020148677A1 (en) * 2019-01-18 2020-07-23 Janssen Biotech, Inc. Gprc5d chimeric antigen receptors and cells expressing the same
JP2022518708A (ja) * 2019-01-18 2022-03-16 ヤンセン バイオテツク,インコーポレーテツド Gprc5dキメラ抗原受容体及びそれを発現する細胞
IL284744B1 (en) * 2019-01-18 2025-10-01 Janssen Biotech Inc Chimeric antigen receptors gprc5d and cells expressing them
JP7605912B2 (ja) 2019-01-18 2024-12-24 ヤンセン バイオテツク,インコーポレーテツド Gprc5dキメラ抗原受容体及びそれを発現する細胞
IL284744B2 (en) * 2019-01-18 2026-02-01 Janssen Biotech Inc Chimeric antigen receptors gprc5d and cells expressing them
CN113597433A (zh) * 2019-01-18 2021-11-02 詹森生物科技公司 Gprc5d嵌合抗原受体以及表达这些受体的细胞
JP2023130380A (ja) * 2019-01-18 2023-09-20 ヤンセン バイオテツク,インコーポレーテツド Gprc5dキメラ抗原受容体及びそれを発現する細胞
TWI851650B (zh) * 2019-01-18 2024-08-11 美商健生生物科技公司 Gprc5d嵌合抗原受體及表現其之細胞
WO2020223535A1 (en) 2019-05-01 2020-11-05 Juno Therapeutics, Inc. Cells expressing a recombinant receptor from a modified tgfbr2 locus, related polynucleotides and methods
US12435120B2 (en) 2019-05-01 2025-10-07 Juno Therapeutics, Inc. Cells expressing a chimeric receptor from a modified CD247 locus, related polynucleotides and methods
WO2020223571A1 (en) 2019-05-01 2020-11-05 Juno Therapeutics, Inc. Cells expressing a chimeric receptor from a modified cd247 locus, related polynucleotides and methods
WO2020252218A1 (en) 2019-06-12 2020-12-17 Juno Therapeutics, Inc. Combination therapy of a cell-mediated cytotoxic therapy and an inhibitor of a prosurvival bcl2 family protein
WO2021035194A1 (en) 2019-08-22 2021-02-25 Juno Therapeutics, Inc. Combination therapy of a t cell therapy and an enhancer of zeste homolog 2 (ezh2) inhibitor and related methods
US12528856B2 (en) 2019-08-30 2026-01-20 Allogene Therapeutics, Inc. Chimeric cytokine receptors comprising TGF β binding domains
WO2021084050A1 (en) 2019-10-30 2021-05-06 Juno Therapeutics Gmbh Cell selection and/or stimulation devices and methods of use
US12570749B2 (en) 2019-12-06 2026-03-10 Juno Therapeutics, Inc. Anti-idiotypic antibodies to GPRC5D-targeted binding domains and related compositions and methods
WO2021154887A1 (en) 2020-01-28 2021-08-05 Juno Therapeutics, Inc. Methods for t cell transduction
WO2021231657A1 (en) 2020-05-13 2021-11-18 Juno Therapeutics, Inc. Methods of identifying features associated with clinical response and uses thereof
WO2021260186A1 (en) 2020-06-26 2021-12-30 Juno Therapeutics Gmbh Engineered t cells conditionally expressing a recombinant receptor, related polynucleotides and methods
WO2022098787A1 (en) 2020-11-04 2022-05-12 Juno Therapeutics, Inc. Cells expressing a chimeric receptor from a modified invariant cd3 immunoglobulin superfamily chain locus and related polynucleotides and methods
US11883432B2 (en) 2020-12-18 2024-01-30 Century Therapeutics, Inc. Chimeric antigen receptor system with adaptable receptor specificity
WO2022148370A1 (en) * 2021-01-05 2022-07-14 Lanova Medicines Development Co., Ltd. Anti-gprc5d monoclonal antibodies and uses thereof
WO2022187406A1 (en) 2021-03-03 2022-09-09 Juno Therapeutics, Inc. Combination of a t cell therapy and a dgk inhibitor
WO2022204071A1 (en) 2021-03-22 2022-09-29 Juno Therapeutics, Inc. Method to assess potency of viral vector particles
WO2022204070A1 (en) 2021-03-22 2022-09-29 Juno Therapeutics, Inc. Methods of determining potency of a therapeutic cell composition
WO2022234009A2 (en) 2021-05-06 2022-11-10 Juno Therapeutics Gmbh Methods for stimulating and transducing t cells
WO2023079494A1 (en) 2021-11-03 2023-05-11 Janssen Biotech, Inc. Corticosteriod reduction in treatment with anti-cd38 antibodies
WO2023147515A1 (en) 2022-01-28 2023-08-03 Juno Therapeutics, Inc. Methods of manufacturing cellular compositions
WO2023213969A1 (en) 2022-05-05 2023-11-09 Juno Therapeutics Gmbh Viral-binding protein and related reagents, articles, and methods of use
WO2023220655A1 (en) 2022-05-11 2023-11-16 Celgene Corporation Methods to overcome drug resistance by re-sensitizing cancer cells to treatment with a prior therapy via treatment with a t cell therapy
WO2023230581A1 (en) 2022-05-25 2023-11-30 Celgene Corporation Methods of manufacturing t cell therapies
WO2024007020A1 (en) 2022-06-30 2024-01-04 Indapta Therapeutics, Inc. Combination of engineered natural killer (nk) cells and antibody therapy and related methods
WO2024031091A2 (en) 2022-08-05 2024-02-08 Juno Therapeutics, Inc. Chimeric antigen receptors specific for gprc5d and bcma
WO2024054944A1 (en) 2022-09-08 2024-03-14 Juno Therapeutics, Inc. Combination of a t cell therapy and continuous or intermittent dgk inhibitor dosing
WO2024100604A1 (en) 2022-11-09 2024-05-16 Juno Therapeutics Gmbh Methods for manufacturing engineered immune cells
WO2024161021A1 (en) 2023-02-03 2024-08-08 Juno Therapeutics Gmbh Methods for non-viral manufacturing of engineered immune cells
EP4665759A4 (en) * 2023-03-22 2026-04-08 Biofront Therapeutics Beijing Co Ltd GPRC5D-BINDING NANOBODIES AND THEIR USES
WO2024220588A1 (en) 2023-04-18 2024-10-24 Juno Therapeutics, Inc. Cytotoxicity assay for assessing potency of therapeutic cell compositions
WO2024243365A2 (en) 2023-05-23 2024-11-28 Juno Therapeutics, Inc. Activation markers of t cells and method for assessing t cell activation
EP4520346A1 (en) * 2023-09-06 2025-03-12 Gyncentrum Sp. z o.o. Cells, methods and systems for use in the treatment of a cancer with dual-car-t
WO2025059362A1 (en) 2023-09-13 2025-03-20 Juno Therapeutics, Inc. Combination therapies with a cell therapy expressing a gprc5d-targeting car and related methods and uses
WO2025076472A1 (en) 2023-10-06 2025-04-10 Juno Therapeutics, Inc. Combination therapies with a cell therapy expressing a gprc5d-targeting car and related methods and uses
WO2025147545A1 (en) 2024-01-03 2025-07-10 Juno Therapeutics, Inc. Lipid nanoparticles for delivery of nucleic acids and related methods and uses
WO2026020055A2 (en) 2024-07-18 2026-01-22 Juno Therapeutics, Inc. Methods for assessing exosomes in a cell composition and related uses
WO2026025092A1 (en) 2024-07-26 2026-01-29 Juno Therapeutics, Inc. Synthetic promoters for t cell expression

Also Published As

Publication number Publication date
PT3227339T (pt) 2022-01-14
RU2762359C2 (ru) 2021-12-20
NZ732574A (en) 2023-11-24
EP4015534A1 (en) 2022-06-22
US11820806B2 (en) 2023-11-21
IL252621B2 (en) 2024-06-01
US20200270326A1 (en) 2020-08-27
US20240294599A1 (en) 2024-09-05
US11866478B2 (en) 2024-01-09
JP2021040652A (ja) 2021-03-18
CY1125008T1 (el) 2022-07-22
JP2023091037A (ja) 2023-06-29
PH12017501044A1 (en) 2018-03-05
CN113968912B (zh) 2025-05-16
MX385156B (es) 2025-03-14
JP6919091B2 (ja) 2021-08-18
IL252621B1 (en) 2024-02-01
US10633426B2 (en) 2020-04-28
EP3227339A4 (en) 2018-08-08
MX2017007242A (es) 2018-01-25
IL310130A (en) 2024-03-01
US20180118803A1 (en) 2018-05-03
SA517381665B1 (ar) 2022-01-24
LT3227339T (lt) 2022-01-10
HUE057777T2 (hu) 2022-06-28
US10906956B2 (en) 2021-02-02
EP3227339B1 (en) 2021-11-10
IL252621A0 (en) 2017-07-31
HRP20211978T1 (hr) 2022-04-01
CN113968912A (zh) 2022-01-25
CN107428829B (zh) 2021-10-15
SI3227339T1 (sl) 2022-02-28
AU2015357518A1 (en) 2017-06-29
US20200270328A1 (en) 2020-08-27
RS62870B1 (sr) 2022-02-28
KR20170109537A (ko) 2017-09-29
DK3227339T3 (da) 2022-01-10
MX2021008798A (es) 2021-08-24
MY192065A (en) 2022-07-25
CA2969864A1 (en) 2016-06-09
JP2017537629A (ja) 2017-12-21
SG10202007326QA (en) 2020-08-28
BR112017011920A2 (en) 2018-02-27
ES2899779T3 (es) 2022-03-14
SG11201704547RA (en) 2017-07-28
AU2022200052A1 (en) 2022-02-03
PL3227339T3 (pl) 2022-02-21
JP2025181929A (ja) 2025-12-11
AU2015357518B2 (en) 2021-10-07
EP3227339A1 (en) 2017-10-11
US20200270327A1 (en) 2020-08-27
CN118271463A (zh) 2024-07-02
RU2017123551A3 (https=) 2019-07-17
RU2017123551A (ru) 2019-01-14
KR102612367B1 (ko) 2023-12-12
CN113683711A (zh) 2021-11-23
CN107428829A (zh) 2017-12-01
SMT202200040T1 (it) 2022-03-21

Similar Documents

Publication Publication Date Title
US20240294599A1 (en) Chimeric antigen receptors targeting g-protein coupled receptor and uses thereof
US20240335475A1 (en) Methods of using chimeric antigen receptors targeting b-cell maturation antigen and uses thereof
US12139538B2 (en) Chimeric antigen receptors targeting Fc receptor-like 5 and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15865633

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 252621

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2017529741

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2969864

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 122021001154

Country of ref document: BR

Ref document number: 11201704547R

Country of ref document: SG

Ref document number: MX/A/2017/007242

Country of ref document: MX

Ref document number: 12017501044

Country of ref document: PH

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017011920

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2015357518

Country of ref document: AU

Date of ref document: 20151204

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015865633

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20177018389

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017123551

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112017011920

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170605

WWE Wipo information: entry into national phase

Ref document number: 521421487

Country of ref document: SA

Ref document number: 517381665

Country of ref document: SA

WWW Wipo information: withdrawn in national office

Ref document number: 310130

Country of ref document: IL