WO2016036794A1 - Conjugates comprising cell-binding agents and cytotoxic agents - Google Patents

Conjugates comprising cell-binding agents and cytotoxic agents Download PDF

Info

Publication number
WO2016036794A1
WO2016036794A1 PCT/US2015/048044 US2015048044W WO2016036794A1 WO 2016036794 A1 WO2016036794 A1 WO 2016036794A1 US 2015048044 W US2015048044 W US 2015048044W WO 2016036794 A1 WO2016036794 A1 WO 2016036794A1
Authority
WO
WIPO (PCT)
Prior art keywords
ala
antibody
conjugate
antigen
optionally substituted
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/048044
Other languages
English (en)
French (fr)
Inventor
Luke B. HARRIS
Daniel Tavares
Lingyun Rui
Nathan Elliott Fishkin
Manami Shizuka
Michael Louis Miller
Ravi V.J. Chari
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Immunogen Inc
Original Assignee
Immunogen Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2015312075A priority Critical patent/AU2015312075A1/en
Priority to SG11201701565PA priority patent/SG11201701565PA/en
Priority to KR1020247005372A priority patent/KR20240027148A/ko
Priority to EP15766288.3A priority patent/EP3188733B1/en
Priority to JP2017512760A priority patent/JP2017529837A/ja
Priority to KR1020237007792A priority patent/KR102638901B1/ko
Priority to RU2017110068A priority patent/RU2017110068A/ru
Priority to CN201580059534.4A priority patent/CN107580604A/zh
Application filed by Immunogen Inc filed Critical Immunogen Inc
Priority to CA2957964A priority patent/CA2957964A1/en
Priority to KR1020177009020A priority patent/KR102508023B1/ko
Publication of WO2016036794A1 publication Critical patent/WO2016036794A1/en
Priority to IL250711A priority patent/IL250711A0/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/551Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
    • A61K31/55131,4-Benzodiazepines, e.g. diazepam or clozapine
    • A61K31/55171,4-Benzodiazepines, e.g. diazepam or clozapine condensed with five-membered rings having nitrogen as a ring hetero atom, e.g. imidazobenzodiazepines, triazolam
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68033Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68035Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a pyrrolobenzodiazepine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/515Complete light chain, i.e. VL + CL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]

Definitions

  • ADC Antibody-drug conjugates
  • cell binding agent-drug conjugates are emerging as a powerful class of anti-tumor agents with efficacy across a range of cancers.
  • Cell binding agent-drug conjugates are commonly composed of three distinct elements: a cell-binding agent (e.g. , an antibody); a linker; and a cytotoxic moiety.
  • the cytotoxic drug moiety is covalently attached to lysines on the antibody, resulting in conjugates that are heterogeneous mixtures of ADCs bearing varying numbers of drugs attached at different positions on the antibody molecule.
  • the 2-hydroxyethylamine moiety of a N-terminal serine residue on a cell binding agent can be selectively oxidized to an aldehyde group without over-oxidation of the antibody.
  • the resulting antibody having an aldehyde group allows site- specific conjugation with a cytotoxic drug having an aldehyde reactive group or through a linker compound having an aldehyde reactive group.
  • the resulting antibody-drug conjugates surprisingly retain antigen binding affinity similar to the unconjugated antibody, despite the fact that the conjugation site is located at the N-terminus of the antibody.
  • the resulting conjugates unexpectedly exhibit high potency despite having a drug load of only two molecules linked per antibody and are better tolerated as compared to lysine-linked conjugates.
  • the cell binding agent such as an antibody
  • oxime linkage is highly stable in vivo.
  • the present invention provides a cell-binding agent-cytotoxic agent conjugate represented by the following structural formula: or a pharmaceutically acceptable salt thereof, wherein:
  • CBA is a cell-binding agent covalently linked to the JCB' group
  • JCB' is a moiety formed by reacting an aldehyde group on the CBA and an aldehyde reactive group connected to the group L, wherein the aldehyde group is derived from oxidation of a 2-hydroxyethylamine moiety represented by the following structural formula:
  • 2-hydroxyethylamine moiety being part of a serine, threonine, hydroxylysine, 4-hydroxyornithine or 2,4-diamino-5-hydroxy valeric acid residue;
  • L is a spacer or a bond
  • J D ' is a linking moiety connecting the cytotoxic agent D with the group L or absent when L is a bond;
  • D is a cytotoxic agent covalently linked to L through the linking moiety Jo'or to CBA through J C B' when L is a bond;
  • w 1, 2, 3 or 4.
  • the present invention also provides a recombinant antibody heavy chain (HC), light chain (LC), or an antigen-binding portion thereof, comprising a heterologous signal peptide having an amino acid sequence of SEQ ID NO: 1.
  • the present invention further provides a recombinant antibody heavy chain (HC), light chain (LC), or an antigen-binding portion thereof, comprising a Ser or Thr residue immediately C-terminal to the last residue of the signal peptide of the heavy chain (HC), light chain (LC), or antigen-binding portion thereof.
  • the present invention also includes a polynucleotide encoding the recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof described herein and a method of producing a recombinant antibody heavy chain (HC), light chain (LC), or an antigen-binding portion thereof described herein.
  • the present invention is directed to a method of preparing a cell- binding agent-cytotoxic agent conjugate, comprising the steps of:
  • cytotoxic agent (iii) a cytotoxic agent followed by the addition of a linker compound having an aldehyde reactive group and a reactive group that can form a covalent bond with the cytotoxic agent to form the cell-binding agent-cytotoxic agent conjugate.
  • linker compound having an aldehyde reactive group and a reactive group that can form a covalent bond with the cytotoxic agent to form the cell-binding agent-cytotoxic agent conjugate.
  • L D ', L D ", and L D ' " is represented by the following formula:
  • P is an amino acid residue or a peptide containing between 2 to 20 amino acid residues
  • R a and R b are independently -H, (Ci-C 3 )alkyl or a charged substituent or an ionizable group Q;
  • r and r' are independently an integer from 1 to 6;
  • the double line— between N and C represents a single bond or a double bond, provided that when it is a double bond X is absent and Y is -H, or a linear or branched alkyl having 1 to 4 carbon atoms, and when it is a single bond, X is -H or an amine protecting moiety;
  • Y is a leaving group selected from -OR, -OCOR', -OCOOR', -OCONR'R", -NR'R", -NR'COR", -NR'NR'R", an optionally substituted 5- or 6-membered nitrogen-containing heterocycle (e.g., piperidine, tetrahydropyrrole, pyrazole, morpholine, etc.
  • an optionally substituted 5- or 6-membered nitrogen-containing heterocycle e.g., piperidine, tetrahydropyrrole, pyrazole, morpholine, etc.
  • R for each occurrence, is independently selected from the group consisting of -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , an optionally substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms independently selected from O, S, N and P;
  • R' and R" are each independently selected from -H, -OH, -OR, -NHR, -NR 2 , -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , and an optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms independently selected from O, S, N and P;
  • R c is -H or an optionally substituted linear or branched alkyl having 1 to 4 carbon atoms;
  • n is an integer from 1 to 24;
  • X' is selected from -H, an amine-protecting group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , an optionally substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, and an optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms independently selected from O, S, N and P;
  • Y' is selected from -H, an oxo group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, an optionally substituted 6- to 18-membered aryl, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, an optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms;
  • R 6 is -H, -R, -OR, -SR, -NR'R" , -N0 2 , or halogen;
  • R5 and R 9 are each independently -H or an optionally substituted linear or branched alkyl having 1 to 10 carbon atoms;
  • JCB is an aldehyde reactive group.
  • composition comprising a conjugate of formula (I) or a cytotoxic compound of formulas (D18')-(D23') or a
  • the pharmaceutical composition can further include a second therapeutic (e.g. , chemotherapeutic) agent.
  • a second therapeutic e.g. , chemotherapeutic
  • the present invention also includes a method of inhibiting abnormal cell growth or treating a proliferative disorder, a destructive bone disorder, an autoimmune disorder, a graft versus host disease, a transplant rejection, an immune deficiency, an inflammatory diseases, an infectious disease, a viral disease, a fibrotic disease, a neurodegenerative disorder, pancreatitis, or a kidney disease in a mammal (e.g. , human), comprising administering to said mammal a therapeutically effective amount of a conjugate formula (I) or, a cytotoxic compound represented of formulas (D18')-(D23') or a pharmaceutically acceptable salt thereof.
  • a conjugate formula (I) or, a cytotoxic compound represented of formulas (D18')-(D23') or a pharmaceutically acceptable salt thereof comprising administering to said mammal a therapeutically effective amount of a conjugate formula (I) or, a cytotoxic compound represented of formulas (D18')-(D23'
  • the method described above further comprises administering to said mammal sequentially or consecutively a second therapeutic (e.g., chemotherapeutic) agent.
  • a second therapeutic e.g., chemotherapeutic
  • Figure 1 shows Scheme 1 for synthesizing the huMOV19-NTS#2-Linkerl -Compound A ADC using engineered N-terminal Ser-containing humanized monoclonal antibody huMOV19-NTS#2.
  • Figure 2 is Q-ToF Mass Spectrometry (MS) data of intact huMOV19-NTS#2- Linkerl -Compound A. It is apparent that the reaction product is a homogeneous ADC with two incorporated Compound A molecules per antibody.
  • Figure 3 shows Scheme 2 for synthesizing the huMOV19-NTS#2-aminooxy-acetyl- MayNMA ADC using engineered N-terminal Ser-containing humanized monoclonal antibody huMOV19-NTS#2.
  • Figure 4 is Q-ToF Mass Spectrometry (MS) data of intact huMOV19-NTS#2- aminooxy-acetyl- MayNMA. It is apparent that the reaction product is a homogeneous ADC with two incorporated MayNMA molecules per antibody.
  • Figure 5 shows Scheme 3 for synthesizing the Antibody (such as huMOV19-NTS#l)- Linkerl -Compound A ADC using engineered N-terminal Ser-containing humanized monoclonal antibody (e.g. , huMOV19-NTS#l).
  • Figure 6 shows Q-ToF Mass Spectrometry (MS) data of intact huMOV19-NTS#l- Linkerl -Compound A.
  • Figure 7A demonstrates that N-terminal Ser-specific conjugation does not noticeably affect antibody binding to antigen.
  • huMOV19-NTS#2- MayNMA or SeriMab- May
  • huMOV19-NTS#2-Compound A or SeriMab-sDGN462
  • ADCs comprising the humanized IgG monoclonal antibody huMOV19, linked through an engineered N-terminal Ser residue to Maytansinoid and cytotoxic Compound A (or sulfonated DGN462
  • T47D i.e. , the FRa antigen on the surface
  • ADCs or the control antibody or the FACS buffer control
  • FACS detection of FITC-conjugated Goat Anti-Human-IgG-Fcy secondary antibody bound to any ADC (or control Ab) on T47D surface was measured by FACS detection of FITC-conjugated Goat Anti-Human-IgG-Fcy secondary antibody bound to any ADC (or control Ab) on T47D surface.
  • Figure 7B shows FACS binding data for huMOV19-NTS#2-Linkerl-Comopund A to T47D cells expressing the FRa- antigen.
  • Both lysine-loaded huMOV19-sSPDB-Compound A and N-terminal modified huMOV19-NTS#2-Linkerl -Compound A have comparable cell binding, which is also similar to that of unconjugated native huMOV19 and engineered huMOV19-NTS#2 (see EC 50 values in the table).
  • FIG 8A shows that N-terminal Ser-specific modification or conjugation does not noticeably affect antibody binding to antigen.
  • wildtype anti-FRa antibody huMOV19 its N-terminal Ser modified version huMOV19- NTS#2 ("SeriMab"), and their respective conjugates to maytansinoid -
  • Ab-SMCC-DMl wildtype huMOV19 linked through Lys residues to DM1 via SMCC linkers
  • SeriMab- May huMOV19-NTS#2 linked through the engineered N-terminal Ser to maytansinoid
  • FIG. 8B shows that N-terminal Ser-specific modification or conjugation does not noticeably affect antibody binding to antigen.
  • wildtype anti-FRa antibody huMOV19, its N-terminal Ser modified version huMOV19- NTS#2 (“SeriMab”) and its conjugate to the cytotoxic Compound A (SeriMab-sDGN462) all have essentially the same binding affinity to the FRa-bearing T47D cells, as measured by FACS.
  • Figure 9 A shows the result of cytotoxic evaluation of the ADC conjugate MOV 19- NTS#2-Linkerl -Compound A on the KB cervical cancer cell line.
  • the data shows that the subject site-specific N-terminal Ser linked SERIMab-Compound A conjugate is about 3-fold more potent than the lysine-conjugated sSPDB-Compound A on the basis of antibody concentration, and about 5-fold more potent based on Compound A concentration.
  • Both conjugates have identical antigen-independent activity, since potency for the two tested conjugates, in the presence of 1 ⁇ unconjugated huMOV19 to block antigen binding sites on the KB cells, are nearly identical.
  • FIG. 9B shows the result of cytotoxic evaluation of the ADC conjugate SeriMab- May on KB cervical cancer cell line.
  • the data shows that SeriMab- May conjugate has the same potency as the lysine-conjugate Ab-SMCC-DMl with higher DAR (cytotoxic compound to antibody ratio).
  • Figures 10 and 11 show exemplary cytotoxic compounds that can be used in preparing the conjugates of the present invention.
  • Figures 12A-12D show exemplary schemes for preparing the conjugates of the present invention.
  • Figure 13 shows the in vivo efficacy for huMOV19-NTS#2-Linkerl -Compound A conjugate in NCTH2110 bearing SCID mice.
  • Figure 14A shows the structure of SeriMab- sDGN462 conjugate with a disulfide linker. Dotted lines indicate the location of cleavage sites which lead to the observed target cell catabolites.
  • Figure 14B shows scheme for incubation, purification, and isolation of catabolites from SeriMab-sDGN462 conjugate formed in KB cervical cancer cells in vitro. The four catabolites identified by LC-MS are shown along with the calculated and observed m/z ratios.
  • Figure 15A shows the structure of SeriMab-May conjugate with a non-cleavable linker. Dotted lines indicate the location of cleavage sites which lead to the observed target cell catabolites.
  • Figure 15B shows scheme for incubation, purification, and isolation of catabolites from SeriMab- May conjugate formed in KB cervical cancer cells in vitro. The two catabolites identified by LC-MS are shown along with the calculated and observed m/z ratios.
  • Figure 16 shows the results of bystander killing assay for SeriMab-sDGN462 and the corresponding Lys-linked conjugated Ab-sSPDB-sDGN462.
  • Figure 17 shows an exemplary scheme for synthesizing the huCD123-sD8 conjugate using engineered N-terminal Ser-containing humanized monoclonal antibody.
  • Figure 18 shows an exemplary scheme for synthesizing the huCD123-6-SeriMab-sDl conjugate bearing a Linker 1 residue.
  • Figure 19 shows an exemplary scheme for synthesizing the huMOV19NTS2S3- SeriMab-DGN462 or -sDGN462 conjugate with 4 DAR (huMovl9NTS2S3-SeriMab- sDGN462), which bears a Linker 1 residue.
  • Figure 20 shows Q-ToF Mass Spectrometry (MS) data of huMOV19NTS2S3- SeriMab-sDGN462 conjugate with 4 DAR (huMovl9NTS2S3-SeriMab-sDGN462).
  • FIG. 21A shows an exemplary scheme for synthesizing the huMOV19NTS2S3- SeriMab- MayNMA conjugate with 4 DAR.
  • Figure 21B shows Q-ToF Mass Spectrometry (MS) data of the Ser-linked huMOV19-SeriMab- MayNMA conjugate with 4 DAR.
  • MS Mass Spectrometry
  • FIGS 22A-22C show that SeriMab of huCD123-6 (huCD123-6Rvl.lS2-SeriMab- D8, filled black circle) is at least as active as the lysine-linked conjugate (huCD123-6Rvl.l- D2, filled downward black triangle) of the same antibody in AML cell lines SHI-1 (FIG. 22A) and HNT-34 (FIG. 22B), as well as the CML cell line MOLM-1 (FIG. 22C).
  • the dotted curves connecting open data points in each figure represent activity of the respective conjugates (i.e., open circle for huCD123-6Rvl.lS2-SeriMab-D8, and open downward triangle for huCD123-6Rvl. l-D2) in the presence of blocking concentration (500 nM) of the unconjugated huCD 123-6 antibody.
  • the dotted curves connecting open data points in each figure represent activity of the respective conjugates (i.e., open circle for huCD123-6Rvl.lS2-SeriMab-D8, and open downward triangle for huCD123-6Rvl. l-D2) in the presence of blocking concentration (500 nM) of the unconjugated huCD 123-6 antibody.
  • blocking concentration 500 nM
  • FIG. 23 shows N-terminal Ser- specific modification or conjugation does not noticeably affect antibody binding to antigen.
  • Wild-type anti-FRa huMOV19 antibody, its N-terminal Ser modified version huMOV19-NTS2 ("huMOV19-SeriMab antibody”) and its conjugate to the cytotoxic compound D8 (huMOV19-SeriMab-D8) all have essentially the same binding affinity to the FRa-bearing T47D cells, as measured by FACS.
  • Figure 24 shows that huCD123-6Gv4.7S3-SeriMab-sDl conjugate (see Figure 18) shows similar potency as the huCD123-6Gv4.7S2(or S3)-SeriMab-D8 conjugate in EOL-1 cells. Results for the Lys-linked huCD123-6Gv4.7S3-sSPDB-Dl and huCD123-6Gv4.7S3- D2 conjugates are also shown.
  • Figure 25 shows Ser- linked DGN462 compound with huCD123 antibody has 3-fold higher antigen- specific potency against EOL-1 cells than lysine linked version with higher DAR.
  • FIGS 26A-26C show that SeriMab-D8 (huMOV19-NTS#2-SeriMab-D8) conjugate has comparable antigen- specific potency and target binding as the lysine conjugate
  • Figure 27 shows the results of bystander killing assay for huMOV19-SeriMab-D8 and the corresponding Lys-linked conjugated huMOV19-D2.
  • Figure 28 shows in vivo stability of the oxime linkage in huMOV19-NTS#2- aminooxy-acetyl- MayNMA conjugate.
  • Figure 29 shows individual body weight percent change of female CD-I mice treated with 100 ⁇ g/kg or 150 ⁇ g/kg of lysine-linked huMOV19-D2 conjugate or 200 ⁇ g/kg huMOV19-SeriMab-D8.
  • Figure 30 shows an exemplary scheme for synthesizing the conjugate of the present invention.
  • Figures 31A and 3 IB shown exemplary schemes for synthesizing the conjugate of the present invention.
  • Linear or branched alkyl refers to a saturated linear or branched- chain monovalent hydrocarbon radical of one to twenty carbon atoms.
  • alkyl include, but are not limited to, methyl, ethyl, 1 -propyl, 2-propyl, 1 -butyl, 2-methyl-l -propyl, - CH 2 CH(CH 3 ) 2 ), 2-butyl, 2-methyl-2-propyl, 1-pentyl, 2-pentyl 3-pentyl, 2-methyl-2-butyl, 3- methyl-2-butyl, 3-methyl-l -butyl, 2-methyl-l -butyl, 1-hexyl), 2-hexyl, 3-hexyl, 2-methyl-2- pentyl, 3-methyl-2-pentyl, 4-methyl-2-pentyl, 3-methyl-3-pentyl, 2-methyl-3-pentyl, 2,3- dimethyl-2-butyl, 3,3-di
  • the alkenyl has two to ten carbon atoms. More preferably, the alkyl has two to four carbon atoms.
  • Linear or branched alkynyl refers to a linear or branched monovalent
  • hydrocarbon radical of two to twenty carbon atoms with at least one site of unsaturation i.e., a carbon-carbon, triple bond.
  • examples include, but are not limited to, ethynyl, propynyl, 1- butynyl, 2-butynyl, 1-pentynyl, 2-pentynyl, 3-pentynyl, hexynyl, and the like.
  • the alkynyl has two to ten carbon atoms. More preferably, the alkynyl has two to four carbon atoms.
  • carrier refers to a monovalent non-aromatic, saturated or partially unsaturated ring having 3 to 12 carbon atoms as a monocyclic ring or 7 to 12 carbon atoms as a bicyclic ring.
  • Bicyclic carbocycles having 7 to 12 atoms can be arranged, for example, as a bicyclo [4,5], [5,5], [5,6], or [6,6] system, and bicyclic carbocycles having 9 or 10 ring atoms can be arranged as a bicyclo [5,6] or [6,6] system, or as bridged systems such as bicyclo[2.2.1]heptane, bicyclo[2.2.2]octane and bicyclo[3.2.2]nonane.
  • monocyclic carbocycles include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, 1-cyclopent-l-enyl, l-cyclopent-2-enyl, l-cyclopent-3- enyl, cyclohexyl, 1-cyclohex-l-enyl, l-cyclohex-2-enyl, l-cyclohex-3-enyl, cyclohexadienyl, cycloheptyl, cyclooctyl, cyclononyl, cyclodecyl, cycloundecyl, cyclododecyl, and the like.
  • cyclic alkyl and “cycloalkyl” can be used interchangeably. They refer to a monovalent saturated carbocyclic ring radical. Preferably, the cyclic alkyl is 3 to 7 membered monocyclic ring radical. More preferably, the cyclic alkyl is cyclohexyl.
  • cyclic alkenyl refers to a carbocyclic ring radical having at least one double bond in the ring structure.
  • cyclic alkynyl refers to a carbocyclic ring radical having at least one triple bond in the ring structure.
  • Aryl means a monovalent aromatic hydrocarbon radical of 6-18 carbon atoms derived by the removal of one hydrogen atom from a single carbon atom of a parent aromatic ring system. Some aryl groups are represented in the exemplary structures as "Ar.” Aryl includes bicyclic radicals comprising an aromatic ring fused to a saturated, partially unsaturated ring, or aromatic carbocyclic or heterocyclic ring.
  • Typical aryl groups include, but are not limited to, radicals derived from benzene (phenyl), substituted benzenes, naphthalene, anthracene, indenyl, indanyl, 1,2-dihydronapthalene, 1,2,3,4-tetrahydronapthyl, and the like.
  • aryl is phenyl group.
  • heterocycle refers to a saturated or a partially unsaturated (i.e., having one or more double and/or triple bonds within the ring) carbocyclic radical of 3 to 18 ring atoms in which at least one ring atom is a heteroatom selected from nitrogen, oxygen, phosphorus, and sulfur, the remaining ring atoms being C, where one or more ring atoms is optionally substituted independently with one or more substituents described below.
  • a heterocycle may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms and 1 to 4 heteroatoms selected from N, O, P, and S) or a bicycle having 7 to 10 ring members (4 to 9 carbon atoms and 1 to 6 heteroatoms selected from N, O, P, and S), for example: a bicyclo [4,5], [5,5], [5,6], or [6,6] system.
  • Heterocycles are described in Paquette, Leo A.; "Principles of Modern Heterocyclic Chemistry" (W. A.
  • Heterocyclyl also includes radicals where heterocycle radicals are fused with a saturated, partially unsaturated ring, or aromatic carbocyclic or heterocyclic ring.
  • heterocyclic rings include, but are not limited to, pyrrolidinyl, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothienyl, tetrahydropyranyl, dihydropyranyl, tetrahydrothiopyranyl, piperidino, morpholino, thiomorpholino, thioxanyl, piperazinyl, homopiperazinyl, azetidinyl, oxetanyl, thietanyl, homopiperidinyl, oxepanyl, thiepanyl, oxazepinyl, diazepinyl, thiazepinyl, 2-pyrrolinyl, 3-pyrrolinyl, indolinyl, 2H-pyranyl, 4H- pyranyl, dioxanyl, 1,3-dioxolanyl, pyrazolinyl, dithianyl, dithiola
  • Spiro moieties are also included within the scope of this definition.
  • heteroaryl refers to a monovalent aromatic radical of 5- or 6-membered rings, and includes fused ring systems (at least one of which is aromatic) of 5- 18 atoms, containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur.
  • heteroaryl groups are pyridinyl (including, for example, 2- hydroxypyridinyl), imidazolyl, imidazopyridinyl, pyrimidinyl (including, for example, 4- hydroxypyrimidinyl), pyrazolyl, triazolyl, pyrazinyl, tetrazolyl, furyl, thienyl, isoxazolyl, thiazolyl, oxazolyl, isothiazolyl, pyrrolyl, quinolinyl, isoquinolinyl, indolyl, benzimidazolyl, benzofuranyl, cinnolinyl, indazolyl, indolizinyl, phthalazinyl, pyridazinyl, triazinyl, isoindolyl, pteridinyl, purinyl, oxadiazolyl, triazolyl, thiadiazolyl, furazanyl
  • the heterocycle or heteroaryl groups may be carbon (carbon-linked) or nitrogen (nitrogen-linked) attached where such is possible.
  • carbon bonded heterocycles or heteroaryls are bonded at position 2, 3, 4, 5, or 6 of a pyridine, position 3, 4, 5, or 6 of a pyridazine, position 2, 4, 5, or 6 of a pyrimidine, position 2, 3, 5, or 6 of a pyrazine, position 2, 3, 4, or 5 of a furan, tetrahydrofuran, thiofuran, thiophene, pyrrole or tetrahydropyrrole, position 2, 4, or 5 of an oxazole, imidazole or thiazole, position 3, 4, or 5 of an isoxazole, pyrazole, or isothiazole, position 2 or 3 of an aziridine, position 2, 3, or 4 of an azetidine, position 2, 3, 4, 5, 6, 7, or 8 of a quinoline or position 1, 3, 4,
  • nitrogen bonded heterocycles or heteroaryls are bonded at position 1 of an aziridine, azetidine, pyrrole, pyrrolidine, 2-pyrroline, 3- pyrroline, imidazole, imidazolidine, 2-imidazoline, 3-imidazoline, pyrazole, pyrazoline, 2- pyrazoline, 3-pyrazoline, piperidine, piperazine, indole, indoline, IH-indazole, position 2 of a isoindole, or isoindoline, position 4 of a morpholine, and position 9 of a carbazole, or O- carboline.
  • heteroatoms present in heteroaryl or heterocyclcyl include the oxidized forms such as NO, SO, and S0 2 .
  • halo or halogen refers to F, CI, Br or I.
  • alkyl, alkenyl, alkynyl, cyclic alkyl, cyclic alkenyl, cyclic alkynyl, carbocyclyl, aryl, heterocyclyl and heteroaryl described above can be optionally substituted with one more (e.g. , 2, 3, 4, 5, 6 or more) substituents.
  • a substituent is described as being "substituted," a non-hydrogen substituent is in the place of a hydrogen substituent on a carbon, oxygen, sulfur or nitrogen of the substituent.
  • a substituted alkyl substituent is an alkyl substituent wherein at least one non-hydrogen substituent is in the place of a hydrogen substituent on the alkyl substituent.
  • monofluoroalkyl is alkyl substituted with a fluoro substituent
  • difluoroalkyl is alkyl substituted with two fluoro substituents. It should be recognized that if there is more than one substitution on a substituent, each non-hydrogen substituent may be identical or different (unless otherwise stated).
  • a substituent is described as being “optionally substituted,” the substituent may be either (1) not substituted, or (2) substituted. If a carbon of a substituent is described as being optionally substituted with one or more of a list of substituents, one or more of the hydrogens on the carbon (to the extent there are any) may separately and/or together be replaced with an independently selected optional substituent. If a nitrogen of a substituent is described as being optionally substituted with one or more of a list of substituents, one or more of the hydrogens on the nitrogen (to the extent there are any) may each be replaced with an independently selected optional substituent.
  • One exemplary substituent may be depicted as - NR'R", wherein R' and R" together with the nitrogen atom to which they are attached, may form a heterocyclic ring.
  • the heterocyclic ring formed from R' and R' ' together with the nitrogen atom to which they are attached may be partially or fully saturated.
  • the heterocyclic ring consists of 3 to 7 atoms.
  • the heterocyclic ring is selected from the group consisting of pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, isoxazolyl, pyridyl and thiazolyl.
  • a group of substituents are collectively described as being optionally substituted by one or more of a list of substituents, the group may include: (1) unsubstitutable substituents, (2) substitutable substituents that are not substituted by the optional substituents, and/or (3) substitutable substituents that are substituted by one or more of the optional substituents.
  • a substituent is described as being optionally substituted with up to a particular number of non-hydrogen substituents, that substituent may be either (1) not substituted; or (2) substituted by up to that particular number of non-hydrogen substituents or by up to the maximum number of substitutable positions on the substituent, whichever is less.
  • a substituent is described as a heteroaryl optionally substituted with up to 3 non- hydrogen substituents, then any heteroaryl with less than 3 substitutable positions would be optionally substituted by up to only as many non-hydrogen substituents as the heteroaryl has substitutable positions.
  • R are each independently selected from H, linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit (-OCH 2 CH 2 ) n -R 104 , wherein n is an integer from 1 to 24, an aryl having from 6 to 10 carbon atoms, a heterocyclic ring having from 3 to 10 carbon atoms and a heteroaryl having 5 to 10 carbon atoms; and R 104 is H or a linear or branched alkyl having 1 to 4 carbon atoms, wherein the alkyl, alkenyl, alkynyl, aryl, heteroaryl and heterocyclcyl in the groups represented by R 100 , R 101 , R 102 , R 103 and R 104 are optionally substituted with one or more (e.g.
  • substituents independently selected from halogen, -OH, -CN, -N0 2 and unsubstituted linear or branched alkyl having 1 to 4 carbon atoms.
  • substituents for the optionally substituted alkyl, alkenyl, alkynyl, cyclic alkyl, cyclic alkenyl, cyclic alkynyl, carbocyclyl, aryl, heterocyclyl and heteroaryl described above include halogen, -CN, -NR 102 R 103 , -CF 3 , -OR 101 , aryl, heteroaryl, heterocycycl, -SR 101 , -SOR 101 , -S0 2 R 101 and -SO 3 M.
  • cytotoxic compound or "cytotoxic compound,” “cytotoxic dimer” and “cytotoxic dimer compound” are used interchangeably. They are intended to include compounds for which a structure or formula or any derivative thereof has been disclosed in the present invention or a structure or formula or any derivative thereof that has been incorporated by reference.
  • the term also includes, stereoisomers, geometric isomers, tautomers, solvates, metabolites, salts (e.g. , pharmaceutically acceptable salts) and prodrugs, and prodrug salts of a compound of all the formulae disclosed in the present invention.
  • the term also includes any solvates, hydrates, and polymorphs of any of the foregoing.
  • stereoisomers geometric isomers
  • tautomers solvates
  • metabolites e.g. , pharmaceutically acceptable salts
  • CBA cell binding agent
  • Immunoconjugates can also be defined by the generic formula in reverse order: C-L-A.
  • linkable to a cell binding agent refers to the compounds described herein or derivates thereof comprising at least one linking group or a precursor thereof suitable to bond these compounds or derivatives thereof to a cell binding agent.
  • precursor of a given group refers to any group which may lead to that group by any deprotection, a chemical modification, or a coupling reaction.
  • the term "linked to a cell binding agent” refers to a conjugate molecule comprising at least one of the cytotoxic agent compounds or cytotoxic agent-linker compounds described herein (e.g. , compounds of formulas (D1')-(D29') and cytotoxic agent-linker compounds of formula (II)), or derivative thereof bound to a cell binding agent via a suitable linking group or a precursor thereof.
  • stereoisomer refers to compounds which have identical chemical constitution and connectivity, but different orientations of their atoms in space that cannot be interconverted by rotation about single bonds.
  • Diastereomer refers to a stereoisomer with two or more centers of chirality and whose molecules are not mirror images of one another. Diastereomers have different physical properties, e.g. melting points, boiling points, spectral properties, and reactivities. Mixtures of diastereomers may separate under high resolution analytical procedures such as crystallization, electrophoresis and chromatography. [79] “Enantiomers” refer to two stereoisomers of a compound which are non- superimposable mirror images of one another.
  • optically active compounds i.e., they have the ability to rotate the plane of plane-polarized light.
  • the prefixes D and L, or R and S are used to denote the absolute configuration of the molecule about its chiral center(s).
  • the prefixes d and I or (+) and (-) are employed to designate the sign of rotation of plane-polarized light by the compound, with (-) or 1 meaning that the compound is levorotatory.
  • a compound prefixed with (+) or d is dextrorotatory. For a given chemical structure, these stereoisomers are identical except that they are mirror images of one another.
  • a specific stereoisomer may also be referred to as an enantiomer, and a mixture of such isomers is often called an enantiomeric mixture.
  • a 50:50 mixture of enantiomers is referred to as a racemic mixture or a racemate, which may occur where there has been no stereoselection or stereospecificity in a chemical reaction or process.
  • the terms “racemic mixture” and “racemate” refer to an equimolar mixture of two enantiomeric species, devoid of optical activity.
  • tautomer or "tautomeric form” refers to structural isomers of different energies which are interconvertible via a low energy barrier.
  • proton tautomers also known as prototropic tautomers
  • Valence tautomers include
  • prodrug refers to a precursor or derivative form of a compound of the invention that is capable of being enzymatically or hydrolytically activated or converted into the more active parent form. See, e.g., Wilman, "Prodrugs in Cancer Chemotherapy,” Biochemical Society Transactions, 14:375-382, 615th Meeting Harbor (1986); and Stella et al., "Prodrugs: A Chemical Approach to Targeted Drug
  • the prodrugs of this invention include, but are not limited to, ester-containing prodrugs, phosphate-containing prodrugs, thiophosphate-containing prodrugs, sulfate- containing prodrugs, peptide-containing prodrugs, D-amino acid-modified prodrugs, glycosylated prodrugs, ⁇ -lactam-containing prodrugs, optionally substituted
  • cytotoxic drugs that can be derivatized into a prodrug form for use in this invention include, but are not limited to, compounds of the invention and chemotherapeutic agents such as described above.
  • prodrug is also meant to include a derivative of a compound that can hydrolyze, oxidize, or otherwise react under biological conditions (in vitro or in vivo) to provide a compound of this invention. Prodrugs may only become active upon such reaction under biological conditions, or they may have activity in their unreacted forms.
  • prodrugs contemplated in this invention include, but are not limited to, analogs or derivatives of compounds of any one of the formulae disclosed herein that comprise biohydrolyzable moieties such as biohydrolyzable amides, biohydrolyzable esters, biohydrolyzable carbamates, biohydrolyzable carbonates, biohydrolyzable ureides, and biohydrolyzable phosphate analogues.
  • Other examples of prodrugs include derivatives of compounds of any one of the formulae disclosed herein that comprise -NO, -N0 2 , -ONO, or -ON0 2 moieties.
  • Prodrugs can typically be prepared using well-known methods, such as those described by Burger's Medicinal Chemistry and Drug Discovery (1995) 172-178, 949-982 (Manfred E. Wolff ed., 5th ed.); see also Goodman and Gilman's, The Pharmacological basis of
  • prodrug of the invention includes compounds (with or without any linker groups) and conjugates of the invention comprising an adduct formed between an imine bond of the compounds / conjugates and an imine reactive reagent.
  • a prodrug of the invention may contain one or both forms of prodrugs described herein (e.g., containing an adduct formed between an imine bond of the compounds / conjugates and an imine reactive reagent, and/or containing a Y leaving group when X is -H).
  • imine reactive reagent refers to a reagent that is capable of reacting with an imine group.
  • imine reactive reagent includes, but is not limited to, sulfites (H 2 S0 3 , H 2 S0 2 or a salt of HS0 3 " , S0 3 2" or HS0 2 " formed with a cation), metabisulfite (H 2 S 2 O 5 or a salt of S 2 O 5 " formed with a cation), mono, di, tri, and tetra- thiophosphates (PO3SH3, PO 2 S 2 H 3 , POS3H3, PS 4 H3 or a salt of P0 3 S 3" , P0 2 S 2 3" , POS 3 3” or PS 4 3 ⁇ formed with a cation), thio phosphate esters ((R i O) 2 PS(OR i ), R'SH, R'SOH, R'SC ⁇ H, R'SO S H), various amine
  • R k C( 0)NHOH or a salt formed with a cation
  • hydrazide R k CONHNH 2
  • formaldehyde sulfoxylate HOCH 2 S0 2 H or a salt of HOCH 2 S0 2 " formed with a cation, such as HOCH 2 S0 2 " Na +
  • glycated nucleotide such as GDP-mannose
  • fludarabine or a mixture thereof
  • R 1 and R 1 are each independently a linear or branched alkyl having 1 to 10 carbon atoms and are substituted with at least one substituent selected from -N(R J ) 2 , -CO 2 H, -SO 3 H, and -PO 3 H
  • R 1 and R 1 can be further optionally substituted with a substituent for an alkyl described herein
  • R j is a linear or branched alkyl having 1 to 6 carbon atoms
  • R k is a linear, branched or cyclic
  • the cation is a monovalent cation, such as Na + or K + .
  • the imine reactive reagent is selected from sulfites, hydroxyl amine, urea and hydrazine. More preferably, the imine reactive reagent is NaHS0 3 or KHSO 3 .
  • biohydrolyzable amide means an amide, ester, carbamate, carbonate, ureide, or phosphate analogue, respectively, that either: 1) does not destroy the biological activity of the compound and confers upon that compound advantageous properties in vivo, such as uptake, duration of action, or onset of action; or 2) is itself biologically inactive but is converted in vivo to a biologically active compound.
  • biohydrolyzable amides include, but are not limited to, lower alkyl amides, a- amino acid amides, alkoxyacyl amides, and alkylaminoalkylcarbonyl amides.
  • biohydrolyzable esters include, but are not limited to, lower alkyl esters, alkoxyacyloxy esters, alkyl acylamino alkyl esters, and choline esters.
  • biohydrolyzable carbamates include, but are not limited to, lower alkylamines, substituted ethylenediamines, amino acids, hydroxyalkylamines, heterocyclic and heteroaromatic amines, and polyether amines.
  • Particularly favored prodrugs and prodrug salts are those that increase the bioavailability of the compounds of this invention when such compounds are administered to a mammal.
  • Exemplary salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucuronate, saccharate, formate, benzoate, glutamate, methanesulfonate "mesylate,” ethanesulfonate, benzenesulfonate, p-toluenesulfonate, pamoate (i.e.
  • a pharmaceutically acceptable salt may involve the inclusion of another molecule such as an acetate ion, a succinate ion or other counter ion.
  • the counter ion may be any organic or inorganic moiety that stabilizes the charge on the parent compound.
  • a pharmaceutically acceptable salt may have more than one charged atom in its structure.
  • a pharmaceutically acceptable salt can have one or more charged atoms and/or one or more counter ion.
  • the desired pharmaceutically acceptable salt may be prepared by any suitable method available in the art, for example, treatment of the free base with an inorganic acid, such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, methanesulfonic acid, phosphoric acid and the like, or with an organic acid, such as acetic acid, maleic acid, succinic acid, mandelic acid, fumaric acid, malonic acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid, a pyranosidyl acid, such as glucuronic acid or galacturonic acid, an alpha hydroxy acid, such as citric acid or tartaric acid, an amino acid, such as aspartic acid or glutamic acid, an aromatic acid, such as benzoic acid or cinnamic acid, a sulfonic acid, such as p-toluenesulfonic acid or ethanesul
  • an inorganic acid such as hydrochloric
  • the desired pharmaceutically acceptable salt may be prepared by any suitable method, for example, treatment of the free acid with an inorganic or organic base, such as an amine (primary, secondary or tertiary), an alkali metal hydroxide or alkaline earth metal hydroxide, or the like.
  • an inorganic or organic base such as an amine (primary, secondary or tertiary), an alkali metal hydroxide or alkaline earth metal hydroxide, or the like.
  • suitable salts include, but are not limited to, organic salts derived from amino acids, such as glycine and arginine, ammonia, primary, secondary, and tertiary amines, and cyclic amines, such as piperidine, morpholine and piperazine, and inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
  • amino acids such as glycine and arginine
  • ammonia such as glycine and arginine
  • primary, secondary, and tertiary amines such as piperidine, morpholine and piperazine
  • inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
  • solvate means a compound which further includes a stoichiometric or non- stoichiometric amount of solvent such as water, isopropanol, acetone, ethanol, methanol, DMSO, ethyl acetate, acetic acid, and ethanolamine dichloromethane, 2- propanol, or the like, bound by non-covalent intermolecular forces.
  • Solvates or hydrates of the compounds are readily prepared by addition of at least one molar equivalent of a hydroxylic solvent such as methanol, ethanol, 1-propanol, 2-propanol or water to the compound to result in solvation or hydration of the imine moiety.
  • abnormal cell growth and “proliferative disorder” are used interchangeably in this application.
  • abnormal cell growth refers to cell growth that is independent of normal regulatory
  • tumor cells tumors
  • mutated tyrosine kinase or overexpression of a receptor tyrosine kinase tumor cells
  • benign and malignant cells of other proliferative diseases in which aberrant tyrosine kinase activation occurs tumor cells that proliferate by expressing a mutated tyrosine kinase or overexpression of a receptor tyrosine kinase
  • benign and malignant cells of other proliferative diseases in which aberrant tyrosine kinase activation occurs any tumors that proliferate by receptor tyrosine kinases
  • any tumors that proliferate by aberrant serine/threonine kinase activation and (5) benign and malignant cells of other proliferative diseases in which aberrant serine/threonine kinase activation occurs.
  • cancer and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
  • a “tumor” comprises one or more cancerous cells, and/or benign or pre-cancerous cells.
  • a “therapeutic agent” encompasses both a biological agent such as an antibody, a peptide, a protein, an enzyme or a chemotherapeutic agent.
  • a "chemotherapeutic agent” is a chemical compound useful in the treatment of cancer.
  • a “metabolite” is a product produced through metabolism in the body of a specified compound, a derivative thereof, or a conjugate thereof, or salt thereof. Metabolites of a compound, a derivative thereof, or a conjugate thereof, may be identified using routine techniques known in the art and their activities determined using tests such as those described herein. Such products may result for example from the oxidation, hydroxylation, reduction, hydrolysis, amidation, deamidation, esterification, deesterification, enzymatic cleavage, and the like, of the administered compound.
  • the invention includes metabolites of compounds, a derivative thereof, or a conjugate thereof, of the invention, including compounds, a derivative thereof, or a conjugate thereof, produced by a process comprising contacting a compound, a derivative thereof, or a conjugate thereof, of this invention with a mammal for a period of time sufficient to yield a metabolic product thereof.
  • composition indicates that the substance or composition must be compatible chemically and/or toxicologically, with the other ingredients comprising a formulation, and/or the mammal being treated therewith.
  • protecting group refers to a substituent that is commonly employed to block or protect a particular functionality while reacting other functional groups on the compound, a derivative thereof, or a conjugate thereof.
  • an "amine-protecting group” or an “amino-protecting moiety” is a substituent attached to an amino group that blocks or protects the amino functionality in the compound.
  • Such groups are well known in the art (see for example P. Wuts and T. Greene, 2007, Protective Groups in Organic Synthesis, Chapter 7, J.
  • carbamates such as methyl and ethyl carbamate, FMOC, substituted ethyl carbamates, carbamates cleaved by l,6-P-elimination (also termed "self immolative"), ureas, amides, peptides, alkyl and aryl derivatives.
  • Suitable amino-protecting groups include acetyl, trifluoroacetyl, t-butoxycarbonyl (BOC), benzyloxycarbonyl (CBZ) and 9- fluorenylmethylenoxycarbonyl (Fmoc).
  • leaving group refers to an group of charged or uncharged moiety that departs during a substitution or displacement.
  • leaving groups include, but not limited to, halogens, esters, alkoxy, hydroxyl, tosylates, triflates, mesylates, nitriles, azide, carbamate, disulfides, thioesters, thioethers and diazonium compounds.
  • bifunctional crosslinking agent refers to modifying agents that possess two reactive groups; one of which is capable of reacting with a cell binding agent while the other one reacts with the cytotoxic compound to link the two moieties together.
  • bifunctional crosslinkers are well known in the art (see, for example, Isalm and Dent in Bioconjugation, chapter 5, p218- 363, Groves Dictionaries Inc. New York, 1999).
  • SMCC N-succinimidyl-4-(N- maleimidomethyl)-cyclohexane-l-carboxylate
  • SIAB N-succinimidyl-4-(iodoacetyl)-aminobenzoate
  • Other bifunctional crosslinking agents that introduce maleimido groups or haloacetyl groups on to a cell binding agent are well known in the art (see US Patent Applications
  • BMDB bis-maleimidohexane
  • BMH bis-maleimidoethane
  • BMOE bis-maleimidoethane
  • sulfo-SIAB sulfosuccinimidyl(4-iodo- acetyl)aminobenzoate
  • sulfo-SIAB m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester
  • sulfo-GMBS N-(y-maleimidobutryloxy)sulfosuccinimde ester
  • sulfo-GMBS ⁇ -( ⁇ - maleimidocaproyloxy)sulfosuccimido ester
  • sulfo-EMCS ⁇ -( ⁇ - maleimidoundecanoyloxy)s
  • Heterobifunctional crosslinking agents are bifunctional crosslinking agents having two different reactive groups. Heterobifunctional crosslinking agents containing both an amine-reactive iV-hydroxysuccinimide group (NHS group) and a carbonyl-reactive hydrazine group can also be used to link the cytotoxic compounds described herein with a cell-binding agent (e.g., antibody). Examples of such commercially available heterobifunctional crosslinking agents include succinimidyl 6-hydrazinonicotinamide acetone hydrazone (SANH), succinimidyl 4-hydrazidoterephthalate hydrochloride (SHTH) and succinimidyl hydrazinium nicotinate hydrochloride (SHNH). Conjugates bearing an acid-labile linkage can also be prepared using a hydrazine-bearing benzodiazepine derivative of the present invention. Examples of bifunctional crosslinking agents that can be used include
  • succinimidyl-p-formyl benzoate (SFB) and succinimidyl-p-formylphenoxyacetate (SFPA).
  • SFB succinimidyl-p-formyl benzoate
  • SFPA succinimidyl-p-formylphenoxyacetate
  • Bifunctional crosslinking agents that enable the linkage of cell binding agent with cytotoxic compounds via disulfide bonds are known in the art and include N-succinimidyl-3- (2-pyridyldithio)propionate (SPDP), N-succinimidyl-4-(2-pyridyldithio)pentanoate (SPP), N- succinimidyl-4-(2-pyridyldithio)butanoate (SPDB), N-succinimidyl-4-(2-pyridyldithio)2- sulfo butanoate (sulfo-SPDB) to introduce dithiopyridy
  • crosslinking agents that can be used to introduce disulfide groups are known in the art and are disclosed in U.S. Patents 6,913,748, 6,716,821 and US Patent Publications 20090274713 and 20100129314, all of which are incorporated herein by reference.
  • crosslinking agents such as 2-iminothiolane, homocysteine thiolactone or S-acetylsuccinic anhydride that introduce thiol groups can also be used.
  • a "linker,” “linker moiety,” or “linking group” as defined herein refers to a moiety that connects two groups, such as a cell binding agent and a cytotoxic compound, together. Typically, the linker is substantially inert under conditions for which the two groups it is connecting are linked.
  • a bifunctional crosslinking agent may comprise two reactive groups, one at each ends of a linker moiety, such that one reactive group can be first reacted with the cytotoxic compound to provide a compound bearing the linker moiety and a second reactive group, which can then react with a cell binding agent.
  • one end of the bifunctional crosslinking agent can be first reacted with the cell binding agent to provide a cell binding agent bearing a linker moiety and a second reactive group, which can then react with a cytotoxic compound.
  • the linking moiety may contain a chemical bond that allows for the release of the cytotoxic moiety at a particular site. Suitable chemical bonds are well known in the art and include disulfide bonds, thioether bonds, acid labile bonds, photolabile bonds, peptidase labile bonds and esterase labile bonds (see for example US Patents
  • linkers that can be used in the present invention include non-cleavable linkers, such as those described in are described in detail in U.S. publication number 20050169933, or charged linkers or hydrophilic linkers and are described in US 2009/0274713, US
  • the term "cation" refers to an ion with positive charge.
  • the cation can be monovalent (e.g., Na + , K + , etc.), bi-valent (e.g. , Ca 2+ , Mg 2+ , etc.) or multi-valent (e.g. , Al 3+ etc.).
  • the cation is monovalent.
  • terapéuticaally effective amount means that amount of active compound or conjugate that elicits the desired biological response in a subject. Such response includes alleviation of the symptoms of the disease or disorder being treated, prevention, inhibition or a delay in the recurrence of symptom of the disease or of the disease itself, an increase in the longevity of the subject compared with the absence of the treatment, or prevention, inhibition or delay in the progression of symptom of the disease or of the disease itself. Determination of the effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein. Toxicity and therapeutic efficacy of compound I can be determined by standard pharmaceutical procedures in cell cultures and in experimental animals.
  • the effective amount of compound or conjugate of the present invention or other therapeutic agent to be administered to a subject will depend on the stage, category and status of the multiple myeloma and characteristics of the subject, such as general health, age, sex, body weight and drug tolerance.
  • the effective amount of compound or conjugate of the present invention or other therapeutic agent to be administered will also depend on administration route and dosage form. Dosage amount and interval can be adjusted individually to provide plasma levels of the active compound that are sufficient to maintain desired therapeutic effects.
  • humanized antibody refers to forms of non-human (e.g. , murine) antibodies that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non-human (e.g. , murine) sequences.
  • humanized antibodies are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a non-human species (e.g. , mouse, rat, rabbit, hamster) that have the desired specificity, affinity, and capability (Jones et al, Nature 321 :522-525, 1986; Riechmann et al, Nature 332:323-327, 1988;
  • the immunoglobulin are replaced with the corresponding residues in an antibody from a non- human species that has the desired specificity, affinity, and capability.
  • the humanized antibody can be further modified by the substitution of additional residues either in the F v framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
  • the humanized antibody will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
  • the humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (F c ), typically that of a human immunoglobulin.
  • F c immunoglobulin constant region or domain
  • Examples of methods used to generate humanized antibodies are described in U.S. Pats. 5,225,539 and 5,639,641, Roguska et al, Proc. Natl. Acad. Sci. USA 91(3):969- 973, 1994; and Roguska et al, Protein Eng. 9(10):895-904, 1996 (all incorporated herein by reference).
  • a "humanized antibody” is a resurfaced antibody.
  • a "humanized antibody” is a CDR-grafted antibody.
  • the present invention provides cell-binding agent-cytotoxic agent conjugates comprising a cell-binding agent described herein covalently linked to one or more molecules of the cytotoxic agent of the present invention via a variety of linkers, including, but not limited to, disulfide linkers, thioether linkers, amide bonded linkers, acid-labile linkers, and esterase-labile linkers.
  • linkers including, but not limited to, disulfide linkers, thioether linkers, amide bonded linkers, acid-labile linkers, and esterase-labile linkers.
  • the present invention provides a cell-binding agent-cytotoxic agent conjugate of structural formula (I):
  • CBA is a cell-binding agent covalently linked to the JCB' group
  • JCB' is a moiety formed by reacting an aldehyde group on the CBA and an aldehyde reactive group connected to the group L, wherein the aldehyde is derived from oxidation of a 2-hydroxyethylamine moiety represented by the following structural formula:
  • 2-hydroxyethylamine moiety being part of a serine, threonine, hydroxylysine, 4-hydroxyornithine or 2,4-diamino-5-hydroxy valeric acid residue;
  • L is a spacer or a bond
  • JD' is a linking moiety connecting the cytotoxic agent D with the group L;
  • D is a cytotoxic agent covalently linked to L through the linking moiety J D ' or to CBA through J C B' when L is a bond; and w is 1, 2, 3 or 4.
  • aldehyde reactive group can be used in the present invention.
  • exemplary aldehyde reactive groups include, but are not limited to, those described in R.C. Larock,
  • the aldehyde reactive group is a hydrazine, a hydrazide or a hydroxylamine.
  • the aldehyde reactive group is selected from:
  • X a is CH 2 , O or NCH 3 ;
  • U' is NH, O, S or CH 2 ;
  • U is H or an electron
  • Z Z' donating group is each independently -OH, -SH or -NH 2 ; R and R are each independently H or an alkyl (preferably -Me); R z " is H or an alkyl; and X c is N or CH. More
  • J C B' is represented by one of the following structural formulas:
  • X A is CH 2 , O or NCH 3 ;
  • U' is NH, O, S or CH 2 ;
  • U is H or an electron donating group;
  • XM and XM' are each independen -0-, -S- or -NH-; R and R are each independently H or an alkyl (preferably -Me); and R " is H or an alkyl; sl is the site covalently linked to the cell-binding agent; and s2 is the site covalently linked to the group
  • s3 is the site covalently linked to the group JCB' ;
  • s4 is the site covalently linked to the group D;
  • R 9 is H or an optionally substituted alkyl; p and p' are each independently an integer from 1 to 10;
  • Q is H, a charged substituent or an ionizable group
  • Rai , Ra2, Ra3, R a 4, for each occurrence, are independently H or an optionally substituted alkyl
  • ql and rl are each independently an integer from 0 to 10, provided that ql and rl are not both 0; and the remaining variables are as described above in the first embodiment or the 1 st specific embodiment or any more specific embodiments described therein.
  • Q is i) H; ii) -S0 3 H, -Z'-S0 3 H, -OP0 3 H 2 , -Z'-OP0 3 H 2 , -P0 3 H 2 , - Z'-P0 3 H 2 , -C0 2 H, -Z'-C0 2 H, -NRnRi 2 , or -Z'-NRnRi 2 , or a pharmaceutically acceptable salt thereof; or, iii) -N + Ri 4 Ri 5 Ri 6 X or -Z'-N + Ri 4 RisRi 6 X ; Z' is an optionally substituted alkylene, an optionally substituted cycloalkylene or an optionally substituted phenylene; Ri 4 to Ri 6 are each independently an optionally substituted alkyl; X " is a pharmaceutically acceptable anion; and the remaining variables are as described above in the 2 nd specific embodiment. More specifically, Q is -S0 3 H or
  • Z al is absent; Z a2 is and the remaining variables are as described above in any embodiments of the 2 nd specific
  • R 9 is H.
  • Z al and Z ⁇ are both absent; and the remaining variables are as described above in any embodiments of the 2 nd specific embodiment.
  • R al , R ⁇ , R ⁇ and R a4 are all -H; q and r are each
  • s3 is the site covalently linked to the group J CB ' group
  • s4 is the site covalently linked to the group D;
  • Z i and Z 2 are each independently absent, -S0 2 NRg-, -NRgS0 2 -,
  • R 9 is H or an optionally substituted alkyl
  • P is [XX] 1 - 10 , in which each XX is a residue of an independently selected amino acid, or P is -(NR m -CH 2 CH 2 ) s -;
  • s is an integer from 1 to 5;
  • R m is H, or alkyl optionally substituted with a charged substituent or an ionizable group
  • Rbi, 3 ⁇ 4 2 , 3 ⁇ 4 3 , Rb4, Rb5 and Rb 6 are each independently H or an optionally substituted alkyl;
  • nl and nl are independently an integer from 0 to 10; and the remaining variables are as described above in the first embodiment or the 1 st specific embodiment or any more specific embodiments described therein.
  • Z bl and Z b2 are both absent, or one of Z bl and Z b2 is absent and the other is -CH 2 - O- or -0-CH 2 -;
  • nl is an integer from 1 to 6; and the remaining variables are as described above in the first embodiment or the 1 st specific embodiment or any more specific embodiments described therein. More specifically, RM and R b2 are both H.
  • nl and ml are each independently an integer from 1 to 6; and the remaining variables are as described above in the first embodiment or the 1 st specific embodiment or any more specific embodiments described therein.
  • ZM and Z b2 are both absent.
  • ZM is -CH 2 -0-; and Z b2 is absent.
  • ZM is and Z b2 is -0-CH 2 - or absent.
  • R 9 is-H.
  • P is a peptide cleavable by a protease. More specifically, P is a peptide cleavable by a protease expressed in tumor tissue. In yet another more specific embodiment, P is a peptide cleavable by a lysosomal protease.
  • P is selected from the group consisting of: Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe- Cit, Leu-Cit, Lle-Cit, Trp, Cit, Phe-Ala, Phe-N -tosyl-Arg, Phe-N -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val-Ala-Val, Ala-Leu-Ala-Leu (SEQ ID NO: 17), ⁇ -Ala-Leu- Ala-Leu (SEQ ID NO: 18), Gly-Phe-Leu-Gly (SEQ ID NO: 19), Val-Arg, Arg-Val, Arg-Arg, Val-D-Cit, Val-D-Cit, Val-D-
  • P is Gly-Gly-Gly, Ala- Ala- Ala, d- Ala- Ala- Ala, Ala-d-Ala-Ala, Ala-Val-Ala, Gly-Gly or Ala- Ala.
  • s3 is the site covalently linked to the group J CB ' ;
  • s4 is the site covalently linked to the group D;
  • p and p' are independently an integer from 1 to 1000;
  • the site covalently linked to the cytotoxic agent D, s2' is the site covalently linked to the group A';
  • a and A' are each independently an optionally substituted alkylene, an optionally substituted alkenylene, an optionally substituted alkynylene, an optionally substituted cycloalkylene, an optionally substituted cycloalkenylene or an optionally substituted cycloalkynylene;
  • Q' is -Zi'-P'-Z ⁇ -
  • P and P' are each independently absent, an optionally substituted alkylene, -(CH 2 - CH 2 -0) j -, -(0-CH 2 -CH 2 ) j -, or [XX]i_i 0 , in which each XX is a residue of an independently selected amino acid;
  • j is an integer between 1 and 500;
  • k is 0 or 1 ;
  • L is -(CR 5 R 6 )v-, -(CR 7 R 8 ) q -N(R g )-(CR 9 R 10 ) r -, -(CR 7 R 8 ) q -C(R a )(R g )-(CR 9 R 10 ) r or -(CRiiRi 2 ) s -N(R g )-(CRi 3 Ri4)t-N(R g ')-(CRi 5 Ri6)u-,;
  • R g and R g ' are each independently -(CRi 7 Ris) p -Z-V;
  • p is an integer between 1 and 5;
  • V is H, a charged substituent or an ionizable group
  • R h and R h ' are independently H or an optionally substituted alkyl
  • R 5 to Rig are independently H or an optionally substituted alkyl; q, r, s, t, u and v are each independently an integer between 0 and 10; and the remaining variables are as described above in the first embodiment or the I s specific embodiment or any more specific embodiments described therein.
  • Ri9 to R 22 are independently H or an optionally substituted alkyl; m and n are each independently 0 to 10; and the remaining variables are as described above in the first embodiment or the 1 st specific embodiment. More specifically, R 19 to R 22 are each H; R 5 and R 6 are each H; R 7 to Rio are each H; and Rn to Ri 6 are each H.
  • P and P' for each occurrence, are independently [XX] 1-10. More specifically, P and P', for each occurrence, are independently [XX] 2 _ 5 ; and the remaining variables are as described above.
  • P and P' are each a peptide cleavable by a protease.
  • P and P' are each a peptide cleavable by a protease expressed in tumor tissue.
  • P and P' are each a peptide cleavable by a lysosomal protease.
  • P and P' are each selected from the group consisting of: Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Lle- Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val-Ala-Val, Ala-Leu-Ala-Leu (SEQ ID NO: 17), ⁇ -Ala-Leu-Ala-Leu (SEQ ID NO: 18), Gly-Phe-Leu-Gly (SEQ ID NO: 19), Val-Arg, Arg- Val, Arg-Arg, Val-D-C
  • P and P' are each Gly- Gly-Gly, Ala- Ala- Ala, D- Ala-Ala-Ala, Ala-D- Ala-Ala, Ala-Val-Ala, or ⁇ -Ala-Gly-Gly-Gly.
  • [XX] in any embodiments described above, for each occurrence, is the residue of an independently selected amino acid selected from: a naturally occurring amino acid, a synthetic amino acid, an amino acid analog, or an amino acid mimetic that functions in a manner similar to the naturally occurring amino acids.
  • [XX] in any embodiments described above, for each occurrence, is the residue of an independently selected amino acid selected from the group consisting of: Histidine, Alanine, Isoleucine, Arginine, Leucine, Asparagine, Lysine, Aspartic acid, Methionine, Cysteine, Phenylalanine, Glutamic acid, Threonine, Glutamine,
  • D is a maytansinoid; and the remaining variables are as described above in the first embodiment or the 1 st , 2 nd , 3 rd or 4 fl embodiment or any more specific embodiments describe therein.
  • D is a maytansinoid represented by the following structural formula:
  • R M , R M ⁇ and R M ' ⁇ for each occurrence, are independently H or an optionally substituted alkyl
  • Ri', R 2 ', R 3 ' and R 4 ' for each occurrence, are independently H, an optionally substituted an optionally substituted alkyl, an optionally substituted alkenyl, an optionally substituted cycloalkyl, an optionally substituted heterocyclyl, an optionally substituted aryl, or an optionally substituted heteroaryl;
  • i is an integer between 0 and 15;
  • s5 is the site covalently linked to the group J D ';
  • D is represented by the following structural formula:
  • D is a represented by the following structural formula:
  • R M , and R M ", for each occurrence, are independently H or an optionally substituted alkyl; s5 is the site covalently linked to the group J D '; and -L-J D '- are as described above in the first embodiment, or the 3 rd specific embodiment or any more specific embodiments described therein.
  • D is represented by the following structural formula:
  • D is a benzodiazepine compound; and the remaining variables are as described above in the first embodiment or the 1 st , 2 nd , 3 rd or 4 th embodiment or any more specific embodiments describe therein.
  • exemplary benzodiazepine compounds include, but are not limited those described in US Patent Nos. 8,765,740, 8,426,402, US2014/0088089, WO2011/130613, WO2011/130616, WO2010/091150, and
  • D is a benzodiazepine compound represented by the following structural formula:
  • Y is selected from -H, -OR, -OCOR', -SR, -NR'R," -S0 3 M, -S0 2 M or -OS0 3 M, wherein M is -H or a cation such as Na + or K + ;
  • R is -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms or a PEG group -(CH 2 CH 2 0) n -R c , wherein n is an integer from 1 to 24, and R c is a linear or branched alkyl having 1 to 4 carbon atoms;
  • R' and R" are the same or different, and are selected from -H, -OH, -OR, -NRR g , - COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, an optionally substituted aryl having from 6 to 18 carbon atoms, an optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms selected from O, S, N and P, a PEG group -(CH 2 CH 2 0) n -R c , wherein n is an integer from 1 to 24, preferably n is 2, 4 or 8; and R g is -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms or a PEG group -(CH 2 CH 2 0) n -R c ;
  • X' is selected from the group consisting of -H, -OH, a substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, phenyl, and an amine-protecting group;
  • Y' is selected from the group consisting of -H, an oxo group, a substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms;
  • a and A' are selected from -O- and -S-;
  • R x is absent or selected from a linear, branched or cyclic alkyl having 1 to 10 carbon atoms;
  • R e is -H, a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms or -(CH 2 -CH 2 -0) n -R k , wherein R k is a -H, a linear, branched cyclic alkyl having 1 to 6 carbon atoms, optionally bearing a secondary amino (e.g.
  • R 101 and R 102 are each independently a linear, branched, or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms;
  • G is selected from -CH- or -N-;
  • X" and X'" are the same or different, and are independently selected
  • Y" and Y'" are the same or different, and are independently selected
  • Z" and Z' are the same or different, and are independently selected
  • n' is selected from 0, 1, 2 and 3;
  • R 7 ' and R 8 ' are the same or different, and are each independently selected
  • R 9 ' is independently selected from -H, an optionally substituted linear, branched or cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(OCH 2 CH 2 ) N -;
  • Ar and Ar' are each independently absent, or represent an aryl group
  • R C is absent or selected from linear or branched alkyl, alkenyl or alkynyl having 1 to 5 carbon atoms.
  • D is represented by the following structural formula:
  • R A " and R B " are the same or different, and are selected from -H and -Me; and the remaining variables are as described above.
  • M is -H or a pharmaceutically acceptable cation (e.g., Na + );
  • X' and Y' are both -H;
  • a and A' are both -0-;
  • R 6 is -OMe
  • R x is a linear or branched alkyl having 1 to 6 carbon atoms.
  • D is represented by the following structural formula:
  • Y is -H or -SO 3 M
  • M is H + or a cation. Even more specifically, Y is -SO 3 M, and M is H + , Na + or K + .
  • P is an amino acid residue or a peptide containing between 2 to 20 amino acid residues
  • R a and R b are independently -H, (Ci-C 3 )alkyl or a charged substituent or an ionizable group Q;
  • r and r' are independently an integer from 1 to 6;
  • Y is a leaving group selected from -OR, -OCOR', -OCOOR', -OCONR'R", -NR'R", -NR'COR", -NR'NR'R", an optionally substituted 5- or 6-membered nitrogen-containing heterocycle (e.g., piperidine, tetrahydropyrrole, pyrazole, morpholine, etc.
  • an optionally substituted 5- or 6-membered nitrogen-containing heterocycle e.g., piperidine, tetrahydropyrrole, pyrazole, morpholine, etc.
  • P' is an amino acid residue or a polypeptide containing between 2 to 20 amino acid residue
  • R for each occurrence, is independently selected from the group consisting of -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , an optionally substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms independently selected from O, S, N and P;
  • R' and R" are each independently selected from -H, -OH, -OR, -NHR, -NR 2 , -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , and an optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms independently selected from O, S, N and P;
  • R c is -H or an optionally substituted linear or branched alkyl having 1 to 4 carbon atoms;
  • n is an integer from 1 to 24;
  • X' is selected from -H, an amine-protecting group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH 2 CH 2 0) n -R c , an optionally substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, and an optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms independently selected from O, S, N and P;
  • Y' is selected from -H, an oxo group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, an optionally substituted 6- to 18-membered aryl, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, an optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms;
  • R 6 is -H, -R, -OR, -SR, -NR'R", -N0 2 , or halogen;
  • R5 and R 9 are each independently -H or an optionally substituted linear or branched alkyl having 1 to 10 carbon atoms; and the remaining variables are as described above in the first embodiment or the 1 st specific embodiment or any more specific embodiments described therein.
  • L' is represented by formula (A) and L" and L'" are both -H.
  • Ri, R 2 , R 3 , R4, Ri', R 2 ', R 3 ' and R 4 ' are all -H;
  • R 6 is -OMe
  • X' and Y' are both -H; A and A' are -0-; and
  • M is H + , Na + or K + ; and the remaining variables are as described above in the 7 th specific embodiment or any more specific embodiments described above.
  • R a and R b are both H; and the remaining variables are as described above in the 7 th specific embodiment or any more specific embodiments described above.
  • R 5 and Rg are each independently H or Me; and the remaining variables are as described above in the 7 th specific embodiment or any more specific embodiments described above. More specifically, R5 and R 9 are both H.
  • P is a peptide containing 2 to 10 amino acid residues; and the remaining variables are as described above in the 7 th specific embodiment or any more specific embodiments described above. More specifically, P is a peptide containing 2 to 5 amino acid residues.
  • P is elected from Gly-Gly-Gly, Ala-Val, Val-Ala, Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Lle-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 -nitro-Arg, Phe-Phe- Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu- Ala-Leu, He- Ala-Leu, Val- Ala-Val, Ala-Leu- Ala- Leu (SEQ ID NO: 17), ⁇ -Ala-Leu-Ala-Leu (SEQ ID NO: 18) and Gly-Phe-Leu-Gly (SEQ ID NO: 19), Val-Arg, Arg-Val, Arg-Arg, Val-D-Cit, Val-D-L
  • Y is H or -S0 3 M and M is H + , Na + or K + .
  • the CBA in the conjugates of any one of the embodiments described above, such as the first embodiment or the 1 t to 8 th specific embodiments or any more specific embodiments described therein, may be any cell-binding agents described herein, such as those described in the second embodiment below.
  • the conjugates of any one of the embodiments described above, such as the first embodiment or the 1 st to 8 th specific embodiments or any more specific embodiments described therein may comprise 1-4 cytotoxic agent molecules bound per cell-binding agent (e.g. , antibody) molecule.
  • the conjugates may comprise 2 or 4 cytotoxic agent molecules per cell-binding agent molecule. The number of cytotoxic agent molecules bound per cell-binding agent (e.g.
  • antibody molecule
  • the number of cytotoxic agent molecule bound per cell-binding agent (e.g. , antibody) molecule can be determined by mass spectrometry.
  • the present invention further provides a composition comprising the conjugates of any one of the embodiments described above, such as the first embodiment or the 1 st to 8 th specific embodiments or any more specific embodiments described therein.
  • at least about 50%, 60%, 70%, 80%, 90%, 95%, 99%, 99.5%, 99.9% or more of the conjugates in the composition have 2 or 4 cytotoxic agents covalently linked to each CBA.
  • no more than about 20%, 15%, 10% , 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5% or 0.1% of the conjugates have only 1 cytotoxic agent covalently linked to each CBA.
  • the invention provides a cell-binding agent (CBA) for preparing the cell-binding agent-cytotoxic agent conjugates described herein.
  • CBA may be a protein (e.g. , a protein found in nature, or an engineered or recombinant protein), such as an antibody, an antigen-binding portion thereof (which may include an antibody derivative), or an antibody mimetic protein.
  • the N-terminus of such proteinaceous CBA may comprise a 2-hydroxyethylamine moiety that may be part of a serine, threonine,
  • the 2- hydroxyethylamine moiety can be oxidized using the methods of the invention to become an aldehyde group, which can then react with an aldehyde reactive group to form the subject conjugates.
  • the invention also provides certain engineered proteinaceous CBA, such as engineered antibody, antigen-binding portion thereof (or antibody derivative), or antibody mimetic protein, which may have a Ser or Thr as the N-terminal residue, as opposed to a non-Ser, non-Thr natural sequence of such antibody, antigen-binding portion thereof (or antibody derivative), or antibody mimetic protein.
  • engineered proteinaceous CBA such as engineered antibody, antigen-binding portion thereof (or antibody derivative), or antibody mimetic protein, which may have a Ser or Thr as the N-terminal residue, as opposed to a non-Ser, non-Thr natural sequence of such antibody, antigen-binding portion thereof (or antibody derivative), or antibody mimetic protein.
  • the N-terminal Ser / Thr can be added by inserting a Ser / Thr codon immediately after a signal peptide sequence.
  • signal peptide sequence may be the natural signal peptide for the antibody, antigen-binding portion thereof (or antibody derivative), or antibody mimetic protein, or may be a heterologous signal peptide fused N-terminal to the mature processed sequence of the antibody, antigen-binding portion thereof (or antibody derivative), or antibody mimetic protein.
  • mature processed sequence e.g. , of recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof
  • mature processed sequence refers to the processed sequence of certain secreted proteins - such as the recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof - which secreted proteins are synthesized with an N- terminal signal peptide (either a naturally occurring one, or a heterologous one fused N- terminal using recombinant technology).
  • N- terminal signal peptide either a naturally occurring one, or a heterologous one fused N- terminal using recombinant technology
  • SEQ ID NOs: 1 and 6 may be used as such natural or heterologous signal peptides. Additional sequence changes to the N-terminal residues in the mature processed sequence of the antibody, antigen-binding portion thereof (or antibody derivative), or antibody mimetic protein may be present, so long as the N-terminal residue, after signal peptide cleavage, is Ser/Thr.
  • the N-terminal Ser / Thr can be added by using a specific signal peptide sequence obtained from the light chain signal peptide of a murine anti-FOLRl antibody FR1- 2.1 (produced by the hybridoma deposited with the ATCC on April 16, 2013 and having ATCC deposit no. PTA- 120197), which signal peptide is represented by SEQ ID NO: 1. It was surprisingly found that this signal peptide sequence is uniquely processed to leave behind its last Ser as the N-terminal residue of the mature processed sequence of the protein.
  • another aspect of the invention further provides a modified CBA (e.g., a modified antibody, antigen-binding portion thereof (or antibody derivative), or antibody mimetic protein) in which its N-terminal Ser/Thr has been oxidized to an aldehyde group.
  • the aldehyde is derived from the oxidation of N-terminal Ser/Thr on the heavy chain of an antibody or an antigen-binding portion thereof. The oxidation can be done using any of the methods of the invention described herein.
  • Such modified CBA can react with a linker bearing an aldehyde reactive group (such as those described herein) to form the conjugates of the invention.
  • the invention also provides a method of making a conjugate of the invention described herein, using a modified CBA of the invention (e.g. , an antibody, antigen-binding portion thereof (or antibody derivative), or antibody mimetic protein).
  • a modified CBA of the invention e.g. , an antibody, antigen-binding portion thereof (or antibody derivative), or antibody mimetic protein.
  • the invention further provides a polynucleotide encoding any of the engineered CBA (e.g. , an antibody, antigen- binding portion thereof (or antibody derivative), or antibody mimetic protein) that produces a mature processed sequence of the CBA with an N-terminal Ser/Thr.
  • the aldehyde group is located at the N-terminus of the proteinaceous CBA (e.g., antibody or antigen-binding portion thereof).
  • the N- terminal aldehyde group can be derived from oxidation of an N-terminal serine or threonine.
  • the N-terminal serine or threonine may be naturally existing in the proteinaceous CBA (e.g. , antibody or antigen-binding portion thereof).
  • the antibody or antigen-binding portion thereof may comprise a light chain sequence of SEQ ID NO: 3, or a light chain sequence derived from the same mouse germ line sequence that encodes the signal peptide of SEQ ID NO: 1.
  • the antibody or antigen-binding portion thereof is a chimeric, humanized, or human antibody or antigen- binding portion thereof of a murine antibody or antigen-binding portion thereof comprising a light chain sequence of SEQ ID NO: 3, or a light chain sequence derived from the same mouse germ line sequence that encodes the signal peptide of SEQ ID NO: 1.
  • the antibody or antigen-binding portion thereof may comprise a light chain sequence derived from the murine IGKV6-32*01 sequence (i.e. , S IVMTQTPKFLLVS AGDRVT I TCKAS Q SVSNDVAWYQQKP GQ SPKLL I YYASNRYTGVPDRF TGS GYGTDF TF T I S TVQAEDLAVYFCQQDY S SP , SEQ ID NO: 20).
  • the antibody or antigen-binding portion thereof is a chimeric, humanized, or human antibody or antigen- binding portion thereof of a murine antibody or antigen-binding portion thereof comprising a light chain sequence derived from the murine IGKV6-32*01 sequence of SEQ ID NO: 20.
  • the antibody or antigen-binding portion thereof may comprise a light chain sequence derived from any one of the human Lambda V3 family of V gene sequences listed below (i.e. , SEQ ID NOs: 21-41).
  • the antibody or antigen- binding portion thereof is a chimeric, humanized, or human antibody or antigen-binding portion thereof of a murine antibody or antigen-binding portion thereof comprising a light chain sequence derived from any one of the human Lambda V3 family of V gene sequences listed below.
  • the humanized antibody or antigen-binding portion thereof may be resurfaced or CDR grafted antibody or antigen-binding portion thereof.
  • the N-terminal serine or threonine may be engineered into the proteinaceous CBA (e.g., antibody or antigen-binding portion thereof).
  • the antibody or antibody-binding portion thereof may be any one of the recombinant antibody of the invention described herein (see below).
  • the N-terminal aldehyde group is located on one or both heavy chains of the antibody or antigen-binding portion thereof, or on one or both light chains of the antibody or antigen-binding portion thereof, or a combination thereof.
  • the CBA is an antibody or an antigen-binding portion thereof.
  • the antigen-binding portion may be Fab, F(ab) 2 , F(ab'), F(ab') 2 , F(ab') 3 , Fd, Fv, disulfide linked Fv, dAb or sdAb (or nanobody), CDR, scFv, (scFv) 2 , di-scFv, bi-scFv, tascFv (tandem scFv), AVIBODY (e.g., diabody, triabody, tetrabody), T- cell engager (BiTE), scFv-Fc, Fcab, mAb2, small modular immunopharmaceutical (SMIP), Genmab / unibody or duobody, V-NAR domain, IgNAR, minibody, IgGACH2, DVD-Ig, probody, intrabody,
  • the CBA is an antibody mimetic, such as a DARPin, a Centyrin, an affibody, an affilin, an affitin, an anticalin, an avimer, a Fynomer, a Kunitz domain peptide, a monobody (or adnectin), a tribody, or a nanofitin.
  • the CBA is a DARPin.
  • the CBA is a Centyrin.
  • the CBA is a monobody or adnectin.
  • the CBA is a dual receptor retargeting (DART) molecule (P. A. Moore et al, Blood, 2011; 117(17):4542-4551; Veri MC et al, Arthritis Rheum., 2010 Mar 30;
  • the invention provides a recombinant antibody heavy chain (HC), light chain (LC), or an antigen-binding portion thereof, comprising a heterologous signal peptide having an amino acid sequence of SEQ ID NO: 1.
  • SEQ ID NO: 1 the light chain signal peptide of antibody FRl-2.1
  • SEQ ID NO: 1 the light chain signal peptide of antibody FRl-2.1
  • the signal peptide of SEQ ID NO: 1 can be recombinantly fused to a heterologous polypeptide (e.g. , recombinant antibody heavy chain (HC), light chain (LC), or an antigen-binding portion thereof), and used in a general approach to produce polypeptides having an N-terminal Ser.
  • the heterologous signal peptide is fused to the N-terminus of the mature processed sequence of the recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof.
  • the heterologous signal peptide is fused to the 2 nd amino acid residue of the N-terminus of the mature processed sequence of the recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof.
  • the processed polypeptide does not have one extra amino acid residue due to the N-terminal Ser from SEQ ID NO: 1.
  • the heterologous signal peptide is fused to the any residue (e.g.
  • N-terminal portion of the mature processed sequence of the recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof, resulting in "deletion" of one or more N-terminal residues, so long as the binding ability of the antibody or antigen-binding portion thereof is not substantially affected.
  • one or more additional residues can be added after the N-terminal Ser, so long as the N-terminal residue is a Ser, such as the Ser from the last residue of SEQ ID NO: 1.
  • the invention provides a recombinant antibody heavy chain (HC), light chain (LC), or an antigen-binding portion thereof, comprising a Ser or Thr residue immediately C-terminal to the last residue of the (natural) signal peptide of the heavy chain (HC), light chain (LC), or antigen-binding portion thereof.
  • HC heavy chain
  • LC light chain
  • antigen-binding portion thereof comprising a Ser or Thr residue immediately C-terminal to the last residue of the (natural) signal peptide of the heavy chain (HC), light chain (LC), or antigen-binding portion thereof.
  • This can be accomplished by inserting a codon for Ser or Thr immediately after the coding sequence for the natural signal peptide.
  • a Ser residue can be inserted immediately after the natural signal peptide sequence of the monoclonal antibody huMovl9 light chain or heavy chain, to create the sequence MGWS C I I LFLVATATGVH S S (SEQ ID NO: 42). After natural processing (cleavage
  • the Ser or Thr residue may be immediately N- terminal to the first residue of the mature processed sequence of the recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof.
  • the Ser or Thr residue replaces one or more N-terminal amino acid residue(s) of the mature processed sequence of the recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof.
  • additional amino acid residues can be added, deleted, or replaced, so long as the 1st residue of the resulting polypeptide after signal peptide processing is Ser/Thr.
  • Exemplary recombinant antibody heavy chain (HC), light chain (LC), or an antigen- binding portion thereof may have a sequence of: SEQ ID NOs: 10 or 14. Others may include those comprising SEQ ID NO: 42.
  • Yet another aspect of the invention provide a recombinant antibody comprising a mature processed sequence of the heavy chain, light chain, or antigen-binding portion thereof, derived from any one of the subject recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof described herein.
  • the recombinant antibody may be or may comprise an Fab, F(ab) 2 , F(ab'), F(ab') 2 , F(ab') 3 , Fd, Fv, disulfide linked Fv, dAb or sdAb (or nanobody), CDR, scFv, (scFv) 2 , di-scFv, bi-scFv, tascFv (tandem scFv), AVIBODY (e.g., diabody, triabody, tetrabody), T-cell engager (BiTE), scFv-Fc, Fcab, mAb2, small modular immu- nopharmaceutical (SMIP), Genmab / unibody or duobody, V-NAR domain, IgNAR, minibody, IgGACH2, DVD-Ig, probody, intrabody, or a multispecificity antibody.
  • the scFv disulfide linked
  • the recombinant antibody may comprise 1, 2, 3, or 4 of the mature processed sequence of the heavy chain, light chain, or antigen-binding portion thereof, each derived from any one of the subject recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof described herein.
  • the recombinant antibody may be a heterodimeric antibody comprising a first heavy chain polypeptide and a second heavy chain polypeptide, wherein the Fc region of the first heavy chain polypeptide and the Fc region of the second heavy chain polypeptide meet at an interface, and the interface of the Fc region of the second heavy chain polypeptide comprises a protuberance which is positionable in a cavity in the interface of the Fc region of the first heavy chain polypeptide.
  • the knob-into-hole technology to promote specific pairing of heavy chains in the bi- specific antibody may be further improved based on, for example, the CrossMab technology of Genentech / Roche, e.g. , by swapping CHI and Kappa constant regions to further reduce or eliminate light chain mis-pairing.
  • LC heterodimers such as Zymeworks AZYMETRICTM heterodimeric IgGi light chain platform technology that fully complements multiple other biologies approaches, including common light chain, domain antibody, and single chain formats, in the development of fully bi-specific antibodies.
  • the Fc region of the second heavy chain polypeptide has been altered from a template/original polypeptide to encode the protuberance, or the Fc region of the first heavy chain polypeptide has been altered from a template/original polypeptide to encode the cavity, or both.
  • the protuberance and the cavity each comprises a naturally occurring amino acid residue.
  • the Fc region of the second heavy chain polypeptide comprising the protuberance is generated by replacing an original residue from the interface of a template/original polypeptide with an import residue having a larger side chain volume than the original residue.
  • the Fc region of the second heavy chain polypeptide comprising the protuberance is generated by a method comprising a step wherein nucleic acids encoding an original residue from the interface of said polypeptide is replaced with nucleic acids encoding an import residue having a larger side chain volume than the original.
  • Yet another aspect of the invention provides a modified antibody oxidized from an antibody having an N-terminal Ser or Thr on a mature processed sequence of the heavy chain, light chain, or antigen-binding portion thereof, wherein the N-terminal Ser or Thr has been oxidized to an aldehyde group in the modified antibody.
  • the antibody is derived from a recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof comprising: (1) a
  • heterologous signal peptide having an amino acid sequence of SEQ ID NO: 1 ; (2) a Ser or Thr residue immediately N-terminal to the first residue of the mature processed sequence of the recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof; or (3) a Ser or Thr residue replacing one or more N-terminal amino acid residue(s) of the mature processed sequence of the recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof.
  • the antibody is a murine antibody or antigen-binding portion thereof comprising a light chain sequence of SEQ ID NO: 3.
  • the antibody is a chimeric, humanized, or human antibody or antigen-binding portion thereof of a murine antibody or antigen-binding portion thereof comprising a light chain sequence of SEQ ID NO: 3.
  • the humanized antibody or antigen- binding portion thereof may be resurfaced or CDR grafted antibody or antigen-binding portion thereof.
  • Another aspect of the invention provides a polynucleotide encoding a subject recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof described herein.
  • the polynucleotide is codon-optimized for expression in a mammalian expression system.
  • Another aspect of the invention provides a method of producing a subject
  • HC recombinant antibody heavy chain
  • LC light chain
  • antigen-binding portion thereof the method comprising expressing the subject polynucleotide described herein in an expression system, such as a mammalian expression system.
  • CBA cell-binding agent
  • the CBA may include peptides and non-peptides.
  • the N- terminal residue can be engineered using any of the recombinant methods described herein, e.g., by using a heterologous signal peptide of SEQ ID NO: 1, or by inserting a Ser/Thr codon to code for the N-terminal residue.
  • the appropriate cell-binding agent is a matter of choice that partly depends upon the particular cell population that is to be targeted, but in many (but not all) cases, humanized monoclonal antibodies are a good choice if an appropriate one is available.
  • the monoclonal antibody MY9 is a murine IgGi antibody that binds specifically to the CD33 Antigen (J.D. Griffin et ah, Leukemia Res., 8:521 (1984)), and can be used if the target cells express CD33 as in the disease of acute myelogenous leukemia (AML).
  • the cell-binding agent is not a protein.
  • the cell binding agent may be a vitamin that binds to a vitamin receptor, such as a cell- surface receptor.
  • vitamin A binds to retinol-binding protein (RBP) to form a complex, which complex in turn binds the STRA6 receptor with high affinity and increases vitamin A in-take.
  • RBP retinol-binding protein
  • folic acid / folate / vitamin B 9 binds the cell-surface folate receptor (FR), for example, FRa, with high affinity.
  • Folic acid or antibodies that bind to FRa can be used to target the folate receptor expressed on ovarian and other tumors, including solid tumors that over-express FRa, including non-small cell lung cancer (NSCLC).
  • NSCLC non-small cell lung cancer
  • vitamin D and its analog bind to vitamin D receptor.
  • the cell-binding agent is a protein or a polypeptide, or a compound comprising a protein or polypeptide, including antibody, non-antibody protein, or polypeptide.
  • GM-CSF a ligand / growth factor which binds to myeloid cells
  • IL-2 which binds to activated T-cells can be used for prevention of transplant graft rejection, for therapy and prevention of graft-versus-host disease, and for treatment of acute T-cell leukemia.
  • MSH which binds to melanocytes, can be used for the treatment of melanoma, as can antibodies directed towards melanomas.
  • Epidermal growth factor can be used to target squamous cancers, such as lung and head and neck.
  • Somatostatin can be used to target neuroblastomas and other tumor types.
  • Estrogen or estrogen analogues
  • Androgen or androgen analogues
  • the cell-binding agent can be a lymphokine, a hormone, a growth factor, a colony stimulating factor, or a nutrient-transport molecule.
  • the cell-binding agent is an antibody mimetic, such as an ankyrin repeat protein, a Centyrin, or an adnectin / monobody.
  • the cell-binding agent is an antibody, a single chain antibody, an antibody fragment that specifically binds to the target cell, a monoclonal antibody, a single chain monoclonal antibody, a monoclonal antibody fragment (or "antigen-binding portion") that specifically binds to a target cell, a chimeric antibody, a chimeric antibody fragment (or "antigen-binding portion") that specifically binds to the target cell, a domain antibody (e.g. , sdAb), or a domain antibody fragment that specifically binds to the target cell.
  • the cell-binding agent is a humanized antibody, a humanized single chain antibody, or a humanized antibody fragment (or "antigen-binding portion").
  • the cell-binding agent is an anti-CD33 antibody or fragement thereof, such as the antibodies or fragements thereof described in U.S. Patent Nos. 7,557,189, 7,342, 110, 8,119,787 and 8,337,855 and WO2004/043344, herein incorporated by reference.
  • the humanized antibody is huMy9-6 or another related antibody, which is described in U.S. Pat. Nos. 7,342, 110 and 7,557, 189.
  • the anti-CD33 antibody is huMy9-6 antibody.
  • double underlined sequences represent the variable regions (i.e., heavy chain variable region or HCVR, and light chain variable region or LCVR) of the heavy or light chain sequences, while bold sequences represent the CDR regions (i.e., from N- terminal to C-terminal, CDR1, CDR2, and CDR3, respectively, of the heavy chain or light chain sequences).
  • the anti-CD33 antibody comprises an immunoglobulin heavy chain region having the amino acid sequence of
  • the anti-CD33 antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 43, and/or the light chain CDR1-CDR3 of SEQ ID NO: 44, and preferably specifically binds CD33.
  • the anti-CD33 antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 43, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 44, and preferably specifically binds CD33.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the humanized antibody is an anti-folate receptor antibody described herein.
  • the antibody is an anti-folate receptor antibody described in U.S. Patent No. 8,577,966). More specifically, the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds a human folate receptor 1.
  • human folate receptor 1 The terms "human folate receptor 1,"
  • FOLR1, or “folate receptor alpha (FR-a)", as used herein, refers to any native human FOLR1, unless otherwise indicated. Thus, all of these terms can refer to either a protein or nucleic acid sequence as indicated herein.
  • F0LR1 encompasses "full-length,” unprocessed FOLR1 as well as any form of FOLR1 that results from processing within the cell.
  • the FOLR1 antibody comprises: (a) a heavy chain CDRl comprising GYFMN (SEQ ID NO: 45); a heavy chain CDR2 comprising RIHP YDGDTF YNQXaa i FXaa 2 Xaa 3 (SEQ ID NO: 46); and a heavy chain CDR3 comprising YDGSRAMDY (SEQ ID NO: 47); and (b) a light chain CDRl comprising KASQSVSFAGTSLMH (SEQ ID NO: 48); a light chain CDR2 comprising RASNLEA (SEQ ID NO: 49); and a light chain CDR3 comprising QQSREYPYT (SEQ ID NO: 50); wherein Xaai is selected from K, Q, H, and R; Xaa 2 is selected from Q, H, N, and R; and Xaa 3 is selected from G, E, T, S, A, and V.
  • the heavy chain CDR2 sequence comprises RIHPYDGDTFYN
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1 comprising the heavy chain having the amino acid sequence of
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof encoded by the plasmid DNA deposited with the ATCC on April 7, 2010 and having ATCC deposit nos. PTA-10772 and PTA-10773 or PTA-10774.
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1 comprising the light chain having the amino acid sequence of
  • DrVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRASN LEAGVPDRFSGSGSKTDFTLNISPVEAEDAATYYCQQSREYPYTFGGGTKLEIKRTV AAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 53); or DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRASN LEAGVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEIKRTV AAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD SKDSTYSLSSTLTLSKA
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1 comprising the heavy chain having the amino acid sequence of SEQ ID NO: 52, and the light chain having the amino acid sequence of SEQ ID NO: 53 or SEQ ID NO: 54.
  • the antibody comprises the heavy chain having the amino acid sequence of SEQ ID NO: 52 and the light chain having the amino acid sequence of SEQ ID NO: 54 (hu FOLR1).
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof encoded by the plasmid DNA deposited with the ATCC on April 7, 2010 and having ATCC deposit nos. PTA- 10772 and PTA- 10773 or 10774.
  • the anti-folate receptor antibody is a humanized antibody or antigen binding fragment thereof that specifically binds the human folate receptor 1, and comprising a heavy chain variable domain at least about 90%, 95%, 99% or 100% identical to
  • the anti-folated receptor antibody is huMovl9 or M9346A (see, for example, U.S. Patent No. 8,709,432, U.S. Patent No. 8,557,966, and
  • the humanized antibody is an anti-CD37 antibody (e.g., anti- CD37-3) described in U.S. Patent No. 8,765,917.
  • the cell-binding agent is an anti-CD37 antibody or an antibody fragment thereof, such as those described in US Patent No. 8,765,917 and WO 2011/112978 , herein incorporated by reference.
  • the anti-CD37 antibody is huCD37-3 antibody.
  • the anti-CD37 antibody comprises an immunoglobulin light chain region having the amino acid sequence of
  • TYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 58) and an immunoglobulin heavy chain region having the amino acid sequence of
  • the anti-CD37 antibody comprises an immunoglobulin light chain region having the amino acid sequcence set forth in SEQ ID NO: 58 and an
  • immunoglobulin heavy chain region having the amino acid sequcence set forth in SEQ ID NO: 59.
  • the anti-CD37 antibody comprises an immunoglobulin light chain region having the amino acid sequcence set forth in SEQ ID NO: 58 and an immunoglobulin heavy chain region having the amino acid sequcence set forth in SEQ ID NO: 60.
  • the anti-CD37 antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 59 or 60, and/or the light chain CDR1-CDR3 of SEQ ID NO: 58, and preferably specifically binds CD37.
  • the anti-CD37 antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 59 or 60, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 58, and preferably specifically binds CD37.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the anti-CD37 antibody comprises an immunoglobulin light chain region having the amino acid sequence of
  • TYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 61) and an immunoglobulin heavy chain region having the amino acid sequence of
  • the anti-CD37 antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 62, and/or the light chain CDR1-CDR3 of SEQ ID NO: 61, and preferably specifically binds CD37.
  • the anti-CD37 antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 62, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 61, and preferably specifically binds CD37.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the anti-CD37 antibody is huCD37-50 antibody.
  • the humanized antibody is an anti-EGFR antibody described in U.S. Patent No. 8,790,649.
  • the antibody is an anti-EGFR antibody.
  • the anti-EGFR antibody is a non-antagonist antibody, including, for example, the antibodies described in WO2012058592, herein incorporated by reference.
  • the anti-EGFR antibody is a non-functional antibody, for example, humanized ML66 or EGFR-8. More specifically, the anti-EGFR antibody is huML66. The teachings of all these applications are incorporated herein by reference in its entirety.
  • the anti-EGFR antibody comprising the heavy chain having the amino acid sequence of SEQ ID NO: 63, and the light chain having the amino acid sequence of SEQ ID NO: 64.
  • the anti-EGFR antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 63, and/or the light chain CDR1-CDR3 of SEQ ID NO: 64, and preferably specifically binds EGFR.
  • the anti-EGFR antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 63, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 64, and preferably specifically binds EGFR.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the anti-EGFR antibody are antibodies described in
  • the anti-EGFR antibody is huEGFR-7R antiboby.
  • the anti-EGFR antibody comprises an immunoglobulin heavy chain region having the amino acid sequence of
  • the anti-EGFR antibody comprises an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 65 and an immunoglobulin light chain region having the amino acid sequence set forth in SEQ ID NO: 66.
  • the anti-EGFR antibody comprises an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 65 and an
  • immunoglobulin light chain region having the amino acid sequence set forth in SEQ ID NO: 67.
  • the anti-EGFR antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 65, and/or the light chain CDR1-CDR3 of SEQ ID NO: 66 or 67, and preferably specifically binds EGFR.
  • the anti-EGFR antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 65, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 66 or 67, and preferably specifically binds EGFR.
  • the cell-binding agent is an anti-CD19 antibody, such as those described in U.S. Patent No. 8,435,528 and WO2004/ 103272, hereinin incorporated by reference.
  • the anti-CD 19 antibody comprises an immunoglobulin heavy chain region having the amino acid sequence of
  • the anti-CD 19 antibody is huB4 antibody.
  • the anti-CD 19 antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 68, and/or the light chain CDR1-CDR3 of SEQ ID NO: 69, and preferably specifically binds CD 19.
  • the anti-CD 19 antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 68, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 69, and preferably specifically binds CD19.
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the cell-binding agent is an anti-Mucl antibody, such as those described in U.S. Patent No. 7,834,155, WO 2005/009369 and WO 2007/024222, herein incorporated by reference.
  • the anti-Mucl antibody comprises an immunoglobulin heavy chain region having the amino acid sequence of
  • the anti-Mucl antibody is huDS6 antibody.
  • the anti-Mucl antibody comprises the heavy chain CDR1-CDR3 of SEQ ID NO: 70, and/or the light chain CDR1-CDR3 of SEQ ID NO: 71, and preferably specifically binds Mucl .
  • the anti-Mucl antibody comprises a heavy chain variable region (HCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 70, and/or a light chain variable region (LCVR) sequence at least about 90%, 95%, 97%, 99%, or 100% identical to SEQ ID NO: 71, and preferably specifically binds Mucl .
  • HCVR heavy chain variable region
  • LCVR light chain variable region
  • the cell-binding agent is a resurfaced antibody, a resurfaced single chain antibody, a resurfaced antibody fragment (or "antigen-binding portion"), or a bispecific antibody.
  • the cell-binding agent is a minibody, an avibody, a diabody, a tribody, a tetrabody, a nanobody, a probody, a domain antibody, or an unibody.
  • an exemplary cell binding agent may include an antibody, a single chain antibody, an antibody fragment that specifically binds to the target cell, a monoclonal antibody, a single chain monoclonal antibody, a monoclonal antibody fragment that specifically binds to a target cell, a chimeric antibody, a chimeric antibody fragment that specifically binds to the target cell, a bispecific antibody, a domain antibody, a domain antibody fragment that specifically binds to the target cell, an interferon, a lymphokine (e.g., IL-2, IL-3, IL-4, and IL-6), a hormone (e.g.
  • a lymphokine e.g., IL-2, IL-3, IL-4, and IL-6
  • a hormone e.g.
  • a steroid hormone e.g., androgen and estrogen
  • a vitamin e.g. , folate
  • a growth factor e.g. , EGF, TGF-alpha, FGF, VEGF
  • a colony stimulating factor e.g., transferrin; see O'Keefe et al. (1985) J. Biol. Chem. 260:932-937, incorporated herein by reference
  • a Centyrin a protein scaffold based on a consensus sequence of fibronectin type III (FN3) repeats; see U.S. Patent
  • an Ankyrin Repeat Protein e.g., a designed ankyrin repeat protein, known as DARPin; see U.S. Patent Publication Nos. 2004/0132028, 2009/0082274, 2011/0118146, and 2011/0224100, incorporated herein by reference, and also see C. Zahnd et al., Cancer Res. (2010) 70: 1595-1605; Zahnd et al, J. Biol. Chem. (2006) 281(46):35167-35175; and Binz, H.K., Amstutz, P.
  • DARPin an ankyrin Repeat Protein
  • WO 2007/062466 incorporated herein by reference
  • an Adnectin a fibronectin domain scaffold protein; see US Patent Publication Nos. 2007/0082365; 2008/0139791, incorporated herein by reference
  • Avibody including diabodies, triabodies, and tetrabodies; see U.S. Publication Nos. 2008/0152586 and 2012/0171115
  • other cell-binding molecules or substances see U.S. Publication Nos. 2008/0152586 and 2012/0171115
  • the cell-binding agent may be a ligand that binds to a moiety on the target cell, such as a cell- surface receptor.
  • the ligand may be a growth factor or a fragment thereof that binds to a growth factor receptor; or may be a cytokine or a fragment thereof that binds to a cytokine receptor.
  • the growth factor receptor or cytokine receptor is a cell-surface receptor.
  • the CBA may bind to a ligand on the target cell, such as a cell- surface ligand, including cell- surface receptors.
  • Specific exemplary antigens or ligands may include renin; a growth hormone (e.g., human growth hormone and bovine growth hormone); a growth hormone releasing factor; a parathyroid hormone; a thyroid stimulating hormone; a lipoprotein; alpha- 1- antitrypsin; insulin A-chain; insulin B-chain; proinsulin; a follicle stimulating hormone; calcitonin; a luteinizing hormone; glucagon; a clotting factor (e.g., factor vmc, factor IX, tissue factor, and von Willebrands factor); an anti-clotting factor (e.g., Protein C); an atrial natriuretic factor; a lung surfactant; a plasminogen activator (e.g., a urokinase, a human urine or tissue-type plasminogen activator); bombesin; a thrombin; hemopoietic growth factor; tumor necrosis factor- alpha and -
  • vascular endothelial growth factor a receptor for hormones or growth factors; protein A or D; a rheumatoid factor; a neurotrophic factor(e.g. , bone-derived neurotrophic factor, neurotrophin-3, -4, -5, or -6), a nerve growth factor (e.g. , NGF- ⁇ ); a platelet-derived growth factor; a fibroblast growth factor (e.g. , aFGF and bFGF); fibroblast growth factor receptor 2; an epidermal growth factor; a transforming growth factor (e.g.
  • TGF-alpha TGF- ⁇ , TGF- 2, TGF- 3, TGF- 4, and TGF- 5
  • insulin-like growth factor-I and -II des(l-3)-IGF-I (brain IGF-I); an insulin-like growth factor binding protein
  • melanotransferrin EpCAM; GD3; FLT3; PSMA; PSCA; MUC1 ; MUC16; STEAP; CEA; TENB2; an EphA receptor; an EphB receptor; a folate receptor; FOLR1 ; mesothelin; cripto; an alpha v beta 6 ; integrins; VEGF; VEGFR; EGFR; transferrin receptor; IRTA1 ; IRTA2; IRTA3; IRTA4; IRTA5; CD proteins (e.g.
  • erythropoietin an osteoinductive factor
  • an immunotoxin a bone morphogenetic protein
  • an interferon e.g. , interferon- alpha, -beta, and -gamma
  • a colony stimulating factor e.g., M-CSF, GM-CSF, and G-CSF
  • interleukins e.g., IL- 1 to IL- 10
  • a superoxide dismutase a T-cell receptor
  • a surface membrane protein a decay accelerating factor
  • a viral antigen s e.g.
  • a portion of the HIV envelope a transport protein, a homing receptor; an addressin; a regulatory protein; an integrin (e.g. , CD1 la, CDl lb, CDl lc, CD18, an ICAM, VLA-4, and VCAM;) a tumor associated antigen (e.g. , HER2, HER3 and HER4 receptor); endoglin; c-Met; c-kit; 1GF1R; PSGR; NGEP; PSMA; PSCA; TMEFF2; LGR5; B7H4; and fragments of any of the above-listed polypeptides.
  • an integrin e.g. , CD1 la, CDl lb, CDl lc, CD18, an ICAM, VLA-4, and VCAM
  • a tumor associated antigen e.g. , HER2, HER3 and HER4 receptor
  • endoglin c-Met; c-kit; 1GF1R; PSGR; NGEP
  • the term "antibody” includes immunoglobulin (Ig) molecules.
  • the antibody is a full-length antibody that comprises four polypeptide chains, namely two heavy chains (HC) and two light chains (LC) inter-connected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable region (HCVR or VH) and a heavy chain constant region (CH).
  • the heavy chain constant region is comprised of three domains, CHI, CH2, and CH3.
  • Each light chain is comprised of a light chain variable region (LCVR or VL) and a light chain constant region, which is comprised of one domain, CL.
  • VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs). Interspersed with such regions are the more conserved framework regions (FRs).
  • CDRs complementarity determining regions
  • FRs framework regions
  • Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy- terminus in the following order: FRl, CDRl, FR2, CDR2, FR3, CDR3, and FR4.
  • the antibody is IgG, IgA, IgE, IgD, or IgM. In certain embodiments, the antibody is IgGl, IgG2, IgG3, or IgG4; or IgAl or IgA2.
  • the cell-binding agent is an "antigen-binding portion" of a monoclonal antibody, sharing sequences critical for antigen-binding with an antibody (such as huMy9-6 or its related antibodies described in U.S. Pat. Nos. 7,342,110 and 7,557,189, incorporated herein by reference).
  • antibody fragments include one or more fragments of an antibody that retain the ability to specifically bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by certain fragments of a full- length antibody.
  • binding fragments encompassed within the term "antigen- binding portion" of an antibody include (without limitation): (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains (e.g., an antibody digested by papain yields three fragments: two antigen-binding Fab fragments, and one Fc fragment that does not bind antigen); (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region (e.g.
  • an antibody digested by pepsin yields two fragments: a bivalent antigen-binding F(ab') 2 fragment, and a pFc' fragment that does not bind antigen) and its related F(ab') monovalent unit; (iii) a Fd fragment consisting of the VH and CHI domains (i.e.
  • the antigen-binding portion is a sdAb (single domain antibody).
  • antigen-binding portion also include certain engineered or recombinant derivatives (or "derivative antibodies”) that also include one or more fragments of an antibody that retain the ability to specifically bind to an antigen, in addition to elements or sequences that may not be found in naturally existing antibodies.
  • VL and VH are coded for by separate genes, they can be joined, using standard recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see, e.g., Bird et al. Science 242:423-426, 1988: and Huston et al, Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988).
  • scFv single chain Fv
  • the N-terminum of an scFv may be a VH domain ⁇ i.e., N-VH-VL-C), or a VL domain ⁇ i.e., N-VL-VH-C).
  • Divalent (or bivalent) single-chain variable fragments can be engineered by linking two scFvs. This produces a single peptide chain with two VH and two VL regions, yielding a tandem scFvs (tascFv). More tandem repeats, such as tri-scFv, may be similarly produced by linking three or more scFv in a head-to-tail fashion.
  • scFvs may be linked through linker peptides that are too short (about five amino acids) for the two variable regions to fold together, forcing scFvs to dimerize, and form diabodies (see, e.g., Holliger et al., Proc. Natl. Acad. Sci. USA 90:6444- 6448, 1993; Poljak ei a/., Structure 2: 1121-1123, 1994). Diabodies may be bi-specific or monospecific. Diabodies have been shown to have dissociation constants up to 40-fold lower than corresponding scFvs, i.e., having a much higher affinity to the target.
  • All of these formats can be composed from variable fragments with specificity for two or more different antigens, in which case they are types of bi- or multi- specific antibodies.
  • bispecific tandem di-scFvs are known as bi-specific T-cell engagers (BiTEs).
  • each scFv in the tandem scFv or diabody / triabody / tetrabody may have the same or different binding specificity, and each may independently have an N-terminal VH or N-terminal VL.
  • Single chain Fv scFv
  • Fc moiety such as the human IgG Fc moiety to obtain IgG-like properties, but nevertheless they are still encoded by a single gene.
  • this derivative antibody format is particularly suitable for many research applications.
  • Fcabs are antibody fragments engineered from the Fc constant region of an antibody. Fcabs can be expressed as soluble proteins, or they can be engineered back into a full-length antibody, such as IgG, to create mAb2.
  • a mAb2 is a full-length antibody with an Fcab in place of the normal Fc region. With these additional binding sites, mAb2 bispecific monoclonal antibodies can bind two different targets at the same time.
  • the engineered antibody derivatives have reduced size of the antigen-binding Ig-derived recombinant proteins ("miniaturized" full-size mAbs), produced by removing domains deemed non-essential for function.
  • miniaturized full-size mAbs
  • SMIP Small modular immunopharmaceutical
  • a Small modular immunopharmaceutical, or SMIP is an artificial protein largely built from parts of antibodies (immunoglobulins), and is intended for use as a pharmaceutical drug.
  • SMIPs have similar biological half-life as antibodies, but are smaller than antibodies and hence may have better tissue penetration properties.
  • SMIPs are single-chain proteins that comprise one binding region, one hinge region as a connector, and one effector domain.
  • the binding region comprises a modified single-chain variable fragment (scFv), and the rest of the protein can be constructed from the Fc (such as CH2, and CH3 as the effector domain) and the hinge region of an antibody, such as IgGl.
  • scFv modified single-chain variable fragment
  • genetically modified cells produce SMIPs as antibody-like dimers that are about 30% smaller than real antibodies.
  • FIG. 1 Another example of such engineered miniaturized antibody is "unibody,” in which the hinge region has been removed from IgG4 molecules.
  • IgG4 molecules are unstable and can exchange light-heavy chain heterodimers with one another. Deletion of the hinge region prevents heavy chain-heavy chain pairing entirely, leaving highly specific monovalent light / heavy heterodimers, while retaining the Fc region to ensure stability and half-life in vivo.
  • a single-domain antibody including but not limited to those called
  • the single-domain antibody is engineered from heavy-chain antibodies (hcIgG).
  • the first such sdAb was engineered based on an hcIgG found in camelids, called V H H fragments.
  • the single-domain antibody is engineered from IgNAR ("immunoglobulin new antigen receptor," see below) using a V NAR fragment.
  • Cartilaginous fishes such as shark have such heavy-chain IgNAR antibodies.
  • the sdAb is engineered by splitting the dimeric variable domains from common immunoglobulin G (IgG), such as those from humans or mice, into monomers.
  • IgG immunoglobulin G
  • a nanobody is derived from a heavy chain variable domain.
  • a nanobody is derived from light chain variable domain.
  • the sdAb is obtained by screening libraries of single domain heavy chain sequences (e.g., human single domain HCs) for binders to a target antigen.
  • VNARS single variable new antigen receptor domain antibody fragments
  • VNAR cartilaginous fish
  • IgNARs immunoglobulin new antigen receptor antibodies
  • V NAR cartilaginous fish
  • C NAR constant new antigen receptor
  • a minibody is an engineered antibody fragment comprising an scFv linked to a CH domain, such as the CH3yl (CH3 domain of IgGl) or CH48 (CH4 domain of IgE).
  • a CH domain such as the CH3yl (CH3 domain of IgGl) or CH48 (CH4 domain of IgE).
  • CEA carcinoembryonic antigen
  • the scFv may have a N-terminal VH or VL.
  • the linkage may be a short peptide (e.g., two amino acid linker, such as ValGlu) that results in a non-covalent, hingeless minibody.
  • the linkage may be an IgGl hinge and a GlySer linker peptide that produces a covalent, hinge-minibody.
  • Natural antibodies are mono-specific, but bivalent, in that they express two identical antigen -binding domains.
  • certain engineered antibody derivatives are bi- or multi- specific molecules possess two or more different antigen-binding domains, each with different target specificity.
  • Bispecific antibodies can be generated by fusing two antibody-producing cells, each with distinct specificity. These "quadromas" produced multiple molecular species, as the two distinct light chains and two distinct heavy chains were free to recombine in the quadromas in multiple configurations. Since then, bispecific Fabs, scFvs and full-size mAbs have been generated using a variety of technologies (see above).
  • the dual variable domain immunoglobulin (DVD-Ig) protein is a type of dual- specific IgG that simultaneously target two antigens / epitopes (DiGiammarino et al., Methods Mol Biol. 899: 145-56, 2012).
  • the molecule contains an Fc region and constant regions in a configuration similar to a conventional IgG.
  • the DVD-Ig protein is unique in that each arm of the molecule contains two variable domains (VDs). The VDs within an arm are linked in tandem and can possess different binding specificities.
  • a DuoBody® is a bispecific modified IgGl antibody heterodimer.IgGl hinge region that generally includes (i) a stable hinge region that contains a CPPC sequence and is non- permissive for Fab arm exchange in vivo and (ii) an IgG4-like CH3 domain that is modified to contain F405L and K409R residues, which renders it permissive for Fab arm exchange in vivo. (See, for example, WO2008119353 and WO2011131746).
  • Trispecific antibody derivative molecules can also been generated by, for example, expressing bispecific antibodies with two distinct Fabs and an Fc.
  • a mouse IgG2a anti-Ep-CAM, rat IgG2b anti-CD3 quadroma, called BiUII is thought to permit the co-localization of tumor cells expressing Ep-CAM, T cells expressing CD3, and macrophages expressing FCyRI, thus potentiating the costimulatory and anti-tumor functions of the immune cells.
  • Probodies are fully recombinant, masked monoclonal antibodies that remain inert in healthy tissue, but are activated specifically in the disease microenvironment ⁇ e.g., through protease cleavage by a protease enriched or specific in a disease microenvironment). See Desnoyers et ah, Sci. Transl. Med., 5:207ral44, 2013. Similar masking techniques can be used for any of the antibodies or antigen-binding portions thereof described herein.
  • An intrabody is an antibody that has been modified for intracellular localization, for working within the cell to bind to an intracellular antigen.
  • the intrabody may remain in the cytoplasm, or may have a nuclear localization signal, or may have a KDEL sequence for ER targeting.
  • the intrabody may be a single-chain antibody (scFv), modified immunoglobulin VL domains with hyperstability, selected antibody resistant to the more reducing intracellular environment, or expressed as a fusion protein with maltose binding protein or other stable intracellular proteins.
  • the antigen-binding portions or derivative antibodies of the invention may have substantially the same or identical (1) light chain and/or heavy chain CDR3 regions; (2) light chain and/or heavy chain CDR1, CDR2, and CDR3 regions; or (3) light chain and/or heavy chain regions, compared to an antibody from which they are derived / engineered. Sequences within these regions may contain conservative amino acid substitutions, including
  • the antigen-binding portions or derivative antibodies have a light chain region and/or a heavy chain region that is at least about 90%, 95%, 99% or 100% identical to an antibody from which they are derived / engineered. These antigen-binding portions or derivative antibodies may have substantially the same binding specificity and/or affinity to the target antigen compared to the antibody. In certain embodiments, the 3 ⁇ 4 and/or Rvalues of the antigen-binding portions or derivative antibodies are within 10-fold (either higher or lower), 5-fold (either higher or lower), 3-fold (either higher or lower), or 2-fold (either higher or lower) of an antibody described herein.
  • the antigen-binding portions or derivative antibodies may be derived / engineered from fully human antibodies, humanized antibodies, or chimeric antibodies, and may be produced according to any art-recognized methods.
  • Monoclonal antibody techniques allow for the production of extremely specific cell- binding agents in the form of specific monoclonal antibodies.
  • Particularly well known in the art are techniques for creating monoclonal antibodies produced by immunizing mice, rats, hamsters or any other mammal with the antigen of interest such as the intact target cell, antigens isolated from the target cell, whole virus, attenuated whole virus, and viral proteins such as viral coat proteins.
  • Sensitized human cells can also be used.
  • Another method of creating monoclonal antibodies is the use of phage libraries of scFv (single chain variable region), specifically human scFv (see e.g., Griffiths et al., U.S. Patent Nos.
  • Cell-binding agent can also be peptides derived from phage display (see, for example, Wang et al, Proc. Natl. Acad. Sci. USA (2011) 108(17), 6909-6914) or peptide library techniques (see, for example, Dane et al, Mol. Cancer. Ther. (2009) 8(5): 1312-1318).
  • the CBA of the invention also includes an antibody mimetic, such as a DARPin, an affibody, an affilin, an affitin, an anticalin, an avimer, a Fynomer, a Kunitz domain peptide, a monobody, or a nanofitin.
  • DARPin and "(designed) ankyrin repeat protein” are used interchangeably to refer to certain genetically engineered antibody mimetic proteins typically exhibiting preferential (sometimes specific) target binding.
  • the target may be protein, carbohydrate, or other chemical entities, and the binding affinity can be quite high.
  • the DARPins may be derived from natural ankyrin repeat-containing proteins, and preferably consist of at least three, usually four or five ankyrin repeat motifs (typically about 33 residues in each ankyrin repeat motif) of these proteins.
  • a DARPin contains about four- or five-repeats, and may have a molecular mass of about 14 or 18 kDa, respectively.
  • Libraries of DARPins with randomized potential target interaction residues with diversities of over 10 12 variants can be generated at the DNA level, for use in selecting DARPins that bind desired targets (e.g., acting as receptor agonists or antagonists, inverse agonists, enzyme inhibitors, or simple target protein binders) with picomolar affinity and specificity, using a variety of technologies such as ribosome display or signal recognition particle (SRP) phage display.
  • desired targets e.g., acting as receptor agonists or antagonists, inverse agonists, enzyme inhibitors, or simple target protein binders
  • SRP signal recognition particle
  • Affibody molecules are small proteins engineered to bind to a large number of target proteins or peptides with high affinity, thus imitating monoclonal antibodies.
  • An Affibody consists of three alpha helices with 58 amino acids and has a molar mass of about 6 kDa. They have been shown to withstand high temperatures (90 °C) or acidic and alkaline conditions (pH 2.5 or pH 11), and binders with an affinity of down to sub-nanomolar range have been obtained from naive library selections, and binders with picomolar affinity have been obtained following affinity maturation.
  • affibodies are conjugated to weak electrophiles for binding to targets covalently.
  • Monobodies are genetically engineered antibody mimetic proteins capable of binding to antigens.
  • monobodies consist of 94 amino acids and have a molecular mass of about 10 kDa. They are based on the structure of human fibronectin, more specifically on its tenth extracellular type III domain, which has a structure similar to antibody variable domains, with seven beta sheets forming a barrel and three exposed loops on each side corresponding to the three complementarity determining regions.
  • Monobodies with specificity for different proteins can be tailored by modifying the loops BC (between the second and third beta sheets) and FG (between the sixth and seventh sheets).
  • a tribody is a self-assembly antibody mimetic designed based on the C-terminal coiled-coil region of mouse and human cartilage matrix protein (CMP), which self-assembles into a parallel trimeric complex. It is a highly stable trimeric targeting ligand created by fusing a specific target-binding moiety with the trimerization domain derived from CMP. The resulting fusion proteins can efficiently self-assemble into a well-defined parallel homotrimer with high stability.
  • SPR Surface plasmon resonance
  • a Centyrin is another antibody mimetic that can be obtained using a library built upon the framework of a consensus FN3 domain sequence (Diem et ah, Protein Eng. Des. SeL, 2014). This library employs diversified positions within the C-strand, CD-loop, F-strand and FG-loop of the FN3 domain, and high-affinity Centyrin variants can be selected against specific targets.
  • All methods for introducing N-terminal Ser/Thr and the subsequent oxidation to aldehyde group for reacting with aldehyde reacting groups are applicable for cell-binding agents that are antibodies and that are not antibodies, including, for example, centyrin, Darpin, Avibody, adnectin, antibody fragment, minibody, diabody, tribody, tetrabody, nanobody, probody, duobody, domain body or unibody, etc.
  • huCD 123-6 antibodies are humanized by grafting the 6 CDRs from the heavy and light chains of the murine anti-CD 123 antibody muCD 123-6. In those antibodies, the letter “G” immediately follows the clone designation (i.e., huCD 123-6), which is in turn followed by a version number that designates the origin of the human light chain and heavy chain variable region sequences.
  • huCD123-6Gv4.6 refers to the humanized CD123 antibody based on grafting ("G") the 6 CDR regions from the corresponding muCDR123-6 antibody, onto the human light chain variable region Gv4 and the heavy chain variable region Gv6.
  • - Gv4.7 comprises human light chain variable region Gv4 and heavy chain variable region Gv7.
  • Another class of huCD 123-6 antibodies are humanized by way of resurfacing.
  • the resurfaced antibody having the resurfaced heavy chain sequence huCD123-6rhvl . l and the resurfaced light chain sequence huCD123-6rlvl .O is huCD123-6Rvl . l .
  • NTS#2 or "S2" for short refers to an antibody having an engineered Ser at the N-terminus of heavy chain.
  • S2 variant of the huCD123-6Gv4.7 antibody is designated huCD123-6Gv4.7S2.
  • NTS#3 or "S3” for short refers to an antibody having an engineered Ser at the N-terminus of light chain.
  • the S3 variant of the huCD123- 6Gv4.7 antibody is designated huCD123-6Gv4.7S3.
  • the conjugate name may contain a "SeriMab" designation.
  • huCD123-6Gv4.7S3-SeriMab-D8 refers to conjugate between D8 (see FIG. 17 for D8 or sD8 structure) and the humanized CD123 antibody huCD123-6Gv4.7S3, through the oxidized N-terminal Ser on the light chain.
  • cytotoxic agents used in Examples 23-30, and FIGs. 17, 18, 22A-24, 26A-26C, and 29, such as "D8" and its sulfonated version “sD8" and related "D2,” “Dl” and its sulfonated version “sDl,” may not follow the general formula of drug molecule "D” in the subject conjugates, but the structures of these cytotoxic agents are depicted in the associated figures and text.
  • CYTOTOXIC AGENTS including all protein (e.g., antibody and CDRs, HCVRs, LCVRs, full-length HC and LC sequences thereof) and nucleic acid sequences and the associated SEQ ID NOs, particularly those of CD123-SeriMab having one or more engineered N-terminal Ser/Thr residues, are incorporated herein by reference in its entirety.
  • the present invention provides cytotoxic agents (represented by D') that can be covalently linked to the cell-binding agents described herein to form the conjugates of the present invention.
  • the cytotoxic agent is a maytansinoid. More specifically, the cytotoxic agent D' is represented by the following structural formula:
  • cytotoxic agent D' is represented by the following formula:
  • cytotoxic agent D is represented by the following formula:
  • the cytotoxic agent D' is a maytansinoid compound comprising an aldehyde reactive group, which can be directly linked to the cell-binding agent. More specifically, the maytansinoid compound is represented by the following formula:
  • the cytotoxic agent is a benzodiazepine compound.
  • Exemplary benzodiazepine compounds include, but are not limited those described in US Patent Nos. 8,765,740, 8,426,402, US2014/0088089, WO2011/130613, WO2011/130616, WO2010/091150, and WO2009/016516.
  • the cytotoxic agent D' is a benzodiazepine compound represented by the following structural formula:
  • D' is represented by the following structural formula:
  • the cytotoxic agent D' is a benzodiazepine compound comprising an aldehyde reactive group, which can be directly linked to the cell- binding agent. More specifically, the benzodiazepine compound is represented by the following structural formula:
  • JCB is an aldehyde reactive group as described above in the first embodiment; and the remaining variables are as described above for structural formulas (D18)-(D23) in the 7 th specific embodiment of the first embodiment and any more specific embodiments described therein. pecifically, for formulas (D18')-(D23'), J,
  • L' is represented by formula (A) and L" and L'" are both -H; and remaining variables are as describe in any embodiments above.
  • the double line— between N and C represents a single bond or double bond, provided that when it is a double bond X is absent and Y is -H, and when it is a single bond, X is -H, Y is -OH or -S0 3 M;
  • Ri, R 2 , R 3 , R4, Ri', R 2 ', R 3 ' and R 4 ' are all -H;
  • R 6 is -OMe
  • X' and Y' are both -H;
  • a and A' are -0-; and M is H + , Na + or K + ; and the remaining variables are as described in any embodiments above.
  • R a and R b are both H; and the remaining variables are as described in any embodiments above.
  • R 5 and R 9 are each independently H or Me; and the remaining variables are as described any embodiments above. More specifically, R 5 and Rg are both H.
  • P is a peptide containing 2 to 10 amino acid residues; and the remaining variables are as described in any embodiments above. More specifically, P is a peptide containing 2 to 5 amino acid residues.
  • P is elected from Gly-Gly-Gly, Ala-Val, Val-Ala, Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Lle-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu- Ala-Leu, lie- Ala-Leu, Val-Ala-Val, Ala-Leu- Ala-Leu (SEQ ID NO: 17), ⁇ -Ala-Leu- Ala-Leu (SEQ ID NO: 18) and Gly-Phe-Leu-Gly (SEQ ID NO: 19), Val-Arg, Arg-Val, Arg-Arg, Val-D-Cit, Val-D-Cit,
  • cytotoxic agent D' is represented by the following structural formula:
  • the present invention provides cytotoxic agent- linker compounds having an aldehyde reactive group, which can be covalently linked to the cell- binding agents describe herein.
  • cytotoxic agent-linker compounds are represented by the following formula:
  • JCB is an aldehyde reactive group described in the first embodiment; and the remaining variables are as describe above in the first embodiment or the 2 nd to 6 th specific embodiment of the first embodiment or any more specific embodiments described therein.
  • JCB is a hydrazine, a hydrazide or a hydroxylamine.
  • JCB is selected from:
  • X a is CH 2 , O or NCH 3 ;
  • U' is NH, O, S or CH 2 ;
  • U is H or an electron
  • Z Z' donating group is each independently -OH, -SH or -NH 2 ; R and R are each independently H or an alkyl (preferably -Me); R " is H or an alk l; and X c is N or CH. More
  • aldehyde reactive group ; ; or 109
  • the present invention provides modified cell-binding agents formed by reacting cell-binding agents described herein with a linker compound having an aldehyde reactive group.
  • the modified cell-binding agent is represented by the following formula:
  • J D is a reactive group that can form a covalent bond with the cytotoxic agent D'; and the remaining variables are as described above in the first embodiment or any specific embodiments described therein.
  • J C B' is represented by one of the following structural formulas:
  • X a is CH 2 , O or NCH 3 ;
  • U' is NH, O, S or CH 2 ;
  • U is H or an electron donating group;
  • XM and X b i' are each independentl -0-, -S- or -NH-; R and R are each independently H or an alkyl (preferably -Me); and R " is H or an alkyl; si is the site covalently linked to the cell-binding agent; and s2 is the site covalently linked to the group
  • -L-J D is represented by the following structural formula:
  • J CB ' and J D are as described above in the 2 ND specific embodiment. More specifically, J D is-SH or -SSR d .
  • -L-J D is represented by the following structural formula:
  • CBA can be any cell- binding agents described in the second embodiment.
  • the present invention provides bifunctional crosslinking agents (i.e., linker compounds) having an aldehyde group and a reactive group that can form a covalent bond with the cytotoxic agents described herein.
  • bifunctional crosslinking agents i.e., linker compounds
  • the linker compound is represented by the following formula:
  • linker compound is represented by the following formula:
  • J CB is an aldehyde reactive group described in the first embodiment; and the remaining variables are as described above for structural formula (LI '). More specifically, J D is-SH or -SSR d . Even more specifically, J CB is
  • the bifunctional crosslinking agent is represented by the following structural formula:
  • J D is-SH or -SSR . ven more spec ca y,
  • linker compound is represented by the following structural formula:
  • the bifunctional crosslinking agent is represented by the following structural formula:
  • the bifunctional crosslinking agent is represented by the following structural formula:
  • J D is a maleimide
  • J D is a maleimide.
  • JCB is * H ; ; or
  • the present invention provides methods for preparing the cell-binding agent-cytotoxic agent conjugates described herein.
  • the present invention provides a method of preparing the cell- binding agent-cytotoxic agent conjugates described herein comprising the steps of:
  • a cytotoxic agent followed by the addition of a linker compound having an aldehyde reactive group and a reactive group that can form a covalent bond with the cytotoxic agent to form the cell-binding agent-cytotoxic agent conjugate.
  • the cell binding-agent is an antibody or an antigen binding portion thereof and the method comprises the steps of: (a) oxidizing an 2-hydroxyethylamine moiety of an antibody or an antigen-binding portion thereof with an oxidizing agent to form an oxidized antibody or an oxidized antigen- binding portion thereof having an aldehyde group, wherein the 2-hydroxyethylamine moiety is part of an N-terminal serine, threonine, hydroxylysine, 4-hydroxyornithine or 2,4-diamino-5-hydroxy valeric acid residue; and
  • Ab is an antibody or an antigen binding portion thereof described herein;
  • J CB is an aldehyde reactive group as described above;
  • L is a spacer or a bond as described above;
  • J D ' is a linking moiety connecting cytotoxic agent D with the group L or absent when L is a bond;
  • D is a cytotoxic agent covalently linked to L through the linking moiety J D '; and w is 1, 2, 3 or 4.
  • any cytotoxic agent-linker compounds described in the fourth embodiment above or cytotoxic agent described in the third embodiment can be used.
  • the modified cytotoxic agent-linker compound or a modified cytotoxic agent is generated in situ and reacted with the oxidized antibody or the oxidized antigen-binding portion thereof without purification.
  • the cell binding-agent is an antibody or an antigen binding portion thereof and the method comprises the steps of:
  • any linker compounds described in the sixth embodiment above can be used.
  • the modified cytotoxic agent is generated in situ and not purified before reacting with the modified antibody or the modified antigen-binding portion thereof having a linker bound thereto.
  • the cell binding-agent is an antibody or an antigen binding portion thereof and the method comprises the steps of:
  • any linker compounds described in the sixth embodiment and cytotoxic agent described in the third embodiment can be used.
  • any suitable oxidizing agent can be used in step (a) of the methods described above.
  • the oxidizing agent is a periodate. More specifically, the oxidizing agent is sodium periodate.
  • Excess molar equivalents of the oxidizing agent relative to the cell-binding agent can be used. In certain embodiments, about 2- 100, 5-80, 10-50, 1- 10 or 5- 10 molar equivalents of the oxidizing agent can be used. In certain embodiment, about 10 or about 50 equivalents of the oxidizing agent can be used. When large amount of the oxidizing agent is used, short reaction time is used to avoid over- oxidation. For example, when 50 equivalents of the oxidizing agent is used, the oxidation reaction is carried out for about 5 to about 60 minutes. Alternatively, when 10 equivalents of the oxidizing agent is used, the reaction is carried out for about 30 minutes to about 24 hours. In one embodiment, 5-10 molar equivalents of the oxidizing agent is used and the oxidation reaction is carried out for about 5 to about 60 minutes (e.g. , about 10 to about 30 minutes, about 20 to about 30 minutes).
  • the oxidation reaction does not lead to significant non- targeted oxidation.
  • no signification amount e.g. , less than 20%, less than 10%, less than 5%, less than 3%, less than 2% or less than 1%) of methionine and/or glycans are oxidized during the oxidation process of N-terminal serine to generate the oxidized
  • CD123/IL-3Ra-binding agent having a N-terminal aldehyde group.
  • a catalyst is present in the reaction of step (b) in the methods described above. Any suitable catalyst in the art can be used.
  • the catalyst is an aniline or substituted aniline.
  • Exemplary aniline catalyst include, but are not limited to, aniline, o-phenylenediamine, m-phenylenediamine, 3,5-diaminobenzoic acid, p- phenylenediamine, 2-methyl-p-phenylenediamine, N-methyl-p-phenylenediamine, o- aminophenol, m-aminophenol, p-aminophenol, p-methoxyaniline, 5-methoxy-anthranilic acid, o-aminobenzoid acid, and 4-aminophenethylalcohol.
  • the catalyst is 4-aminophenethylalcohol.
  • the reaction of step (b) is carried out at pH about 5.0 to about 6.5. In certain embodiments, the reaction of step (b) is carried out at pH about 5.0.
  • the compound having an aldehyde reactive group e.g. , cytotoxic agent- linker compound, cytotoxic agent, or the linker compound described herein
  • the oxidized cell- binding agent e.g. , oxidized antibody or oxidized antigen binding portion.
  • the ratio for the compound having an aldehyde reactive group to oxidized cell- binding agent is between about 10: 1 to about 1.1 : 1, between about 5: 1 to about 2: 1. In one embodiment, the ratio is about 4: 1.
  • the cell-binding agent such as the antibody or antigen binding portion thereof, can be obtained by any methods described herein.
  • the present invention provides a method of preparing an antibody-cytotoxic agent conjugate, comprising the steps of:
  • the antibody or antigen-binding portion thereof is obtained by expressing a polynucleotide encoding a recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof comprising: (1) a heterologous signal peptide having an amino acid sequence of SEQ ID NO: 1; (2) a Ser or Thr residue immediately N-terminal to the first residue of the mature processed sequence of the recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof; or (3) a Ser or Thr residue replacing one or more N- terminal amino acid residue(s) of the mature processed sequence of the recombinant antibody heavy chain (HC), light chain (LC), or antigen-binding portion thereof.
  • the antibody or antigen-binding portion thereof comprises a light chain sequence of SEQ ID NO: 3.
  • the antibody or antigen-binding portion thereof is a chimeric, humanized, or human antibody or antigen-binding portion thereof of a murine antibody or antigen-binding portion thereof comprising a light chain sequence of SEQ ID NO: 3.
  • the humanized antibody or antigen- binding portion thereof may be a resurfaced or CDR grafted antibody or antigen-binding portion thereof.
  • the conjugate prepared according to any methods described above can then be purified.
  • the conjugates of the present invention can be purified using tangential flow filtration (TFF), non-adsorptive chromatography, adsorptive chromatography, adsorptive filtration, selective precipitation, high performance liquid chromatography (HPLC), dialysis or any other suitable purification process, as well as combinations thereof.
  • TMF tangential flow filtration
  • HPLC high performance liquid chromatography
  • TFF systems Any suitable TFF systems may be utilized for purification, including a Pellicon type system (Millipore, Billerica, MA), a Sartocon Cassette system (Sartorius AG, Edgewood, NY), and a Centrasette type system (Pall Corp., East Hills, NY).
  • Pellicon type system Millipore, Billerica, MA
  • Sartocon Cassette system Sartorius AG, Edgewood, NY
  • Centrasette type system Pall Corp., East Hills, NY.
  • Any suitable adsorptive chromatography resin may be utilized for purification.
  • Preferred adsorptive chromatography resins include hydroxyapatite chromatography, hydrophobic charge induction chromatography (HCIC), hydrophobic interaction
  • hydroxyapatite resins include ceramic hydroxyapatite (CHT Type I and Type II, Bio-Rad Laboratories, Hercules, CA), HA Ultrogel hydroxyapatite (Pall Corp., East Hills, NY), and ceramic fluoroapatite (CFT Type I and Type II, Bio-Rad
  • HCIC resin An example of a suitable HCIC resin is MEP Hypercel resin (Pall Corp., East Hills, NY).
  • suitable HIC resins include Butyl-Sepharose, Hexyl-Sepaharose, Phenyl-Sepharose, and Octyl Sepharose resins (all from GE Healthcare, Piscataway, NJ), as well as Macro-prep Methyl and Macro-Prep t-Butyl resins (Biorad Laboratories, Hercules, CA).
  • Suitable ion exchange resins include SP- Sepharose, CM-Sepharose, and Q-Sepharose resins (all from GE Healthcare, Piscataway, NJ), and Unosphere S resin (Bio-Rad Laboratories, Hercules, CA).
  • suitable mixed mode ion exchangers include Bakerbond ABx resin (JT Baker, Phillipsburg NJ).
  • IMAC resins examples include Chelating Sepharose resin (GE Healthcare, Piscataway, NJ) and Profinity IMAC resin (Bio-Rad Laboratories, Hercules, CA).
  • suitable dye ligand resins include Blue Sepharose resin (GE Healthcare, Piscataway, NJ) and Affi-gel Blue resin (Bio-Rad Laboratories, Hercules, CA).
  • suitable affinity resins include Protein A Sepharose resin ⁇ e.g., MabSelect, GE Healthcare, Piscataway, NJ), His-Tag metal affinity resins, anti-FLAG affinity resins, and lectin affinity resins, e.g.
  • Lentil Lectin Sepharose resin (GE Healthcare, Piscataway, NJ), where the antibody bears appropriate lectin binding sites.
  • suitable reversed phase resins include C4, C8, and C18 resins (Grace Vydac, Hesperia, CA).
  • any suitable non-adsorptive chromatography resin may be utilized for purification.
  • size-exclusion chromatography can be used for purifying the conjugates of the invention.
  • suitable non-adsorptive chromatography resins include, but are not limited to, SEPHADEXTM G- 10, G-25, G-50, G- 100, SEPHACRYLTM resins (e.g., S-200 and S-300), SUPERDEXTM resins (e.g. , SUPERDEXTM 75 and SUPERDEXTM 200), BIO-GEL® resins (e.g. , P-6, P-10, P-30, P-60, and P- 100), and others known to those of ordinary skill in the art.
  • the conjugate when the cell-binding agent is an epitope-tagged Avibody, the conjugate can be purified using hydroxyl apatite chromatography, size-exclusion
  • affinity chromatography preferably affinity chromatography, more preferably His-tag metal affinity chromatography and anti-FLAG M2 affinity chromatography (see, for example,
  • the conjugate when the cell-binding agent is a centyrin, can be purified using protein A purification, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, size-exclusion chromatography, tangential flow filtration, affinity chromatography, hydroxylapatite chromatography and lectin
  • the conjugate can be purified using HPLC.
  • the conjugate can be purified by using affinity chromatography, more preferably His-tag metal affinity chromatography. See, for example, US Patent Publication Nos. US 2010/0255056, US 2010/0216708 and US 2011/0274623.
  • the conjugate when the cell-binding agent is a DARPin, can be purified by affinity chromatography, size exclusion chromatography, hydroxylapatite chromatography, tangential flow filtration, preferably affinity chromatography, more preferably His-Tag affinity chromatography. See, for example, U.S. Patent Publication Nos. 20040132028, 2009/0082274, 2011/0118146, and 2011/0224100, WO 02/20565 and WO 06/083275. IN VITRO EVALUATION OF CYTOTOXICITY
  • the cytotoxic compounds and cell-binding agent-drug conjugates of the invention can be evaluated for their ability to suppress proliferation of various cancer cell lines in vitro.
  • Cells to be evaluated can be exposed to the compounds or conjugates for 1-5 days and the surviving fractions of cells measured in direct assays by known methods. IC 50 values can then be calculated from the results of the assays.
  • an in vitro cell line sensitivity screen such as the one described by the U.S. National Cancer Institute (see Voskoglou-Nomikos et al., 2003, Clinical Cancer Res. 9: 42227-4239, incorporated herein by reference) can be used as one of the guides to determine the types of cancers that may be sensitive to treatment with the compounds or conjugates of the invention.
  • the present invention includes a composition (e.g. , a pharmaceutical composition) comprising novel benzodiazepine compounds described herein (e.g., indolinobenzodiazepine or oxazolidinobenzodiazepine), derivatives thereof, or conjugates thereof, (and/or solvates, hydrates and/or salts thereof) and a carrier (a pharmaceutically acceptable carrier).
  • a composition e.g., a pharmaceutical composition
  • novel benzodiazepine compounds described herein e.g., indolinobenzodiazepine or oxazolidinobenzodiazepine
  • derivatives thereof or conjugates thereof
  • carrier a pharmaceutically acceptable carrier
  • compositions are useful for inhibiting abnormal cell growth or treating a proliferative disorder in a mammal (e.g. , human).
  • the present compositions are also useful for treating depression, anxiety, stress, phobias, panic, dysphoria, psychiatric disorders, pain, and inflammatory diseases in a mammal (e.g. , human).
  • the present invention includes a method of inhibiting abnormal cell growth or treating a proliferative disorder in a mammal (e.g. , human) comprising administering to said mammal a therapeutically effective amount of novel benzodiazepine compounds described herein (e.g., indolinobenzodiazepine or oxazolidinobenzodiazepine), derivatives thereof, or conjugates thereof, (and/or solvates and salts thereof) or a composition thereof, alone or in combination with a second therapeutic agent.
  • a mammal e.g., human
  • the proliferative disorder is cancer.
  • Cancer can include a hematological cancer or a solid tumor. More specifically, the cancer is leukemia (e.g. , acute myeloid leukemia (AML), acute monocytic leukemia, promyelocytic leukemia, eosinophilic leukemia, acute lymphoblastic leukemia (ALL) such as acute B lymphoblastic leukemia (B- ALL), chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL)) or lymphoma (e.g., non-Hodgkin lymphoma), myelodysplasia syndrome (MDS)juri melanoma, lung cancer (e.g., non-small cell lung cancer (NSCLC)), ovarian cancer, endometrial cancer, peritoneal cancer, pancreatic cancer, breast cancer, prostate cancer, squamous cell carcinoma of the head and neck, and cervical cancer.
  • AML acute myeloid le
  • the present invention also provides methods of treatment comprising administering to a subject in need of treatment an effective amount of any of the conjugates described above.
  • the present invention provides a method for inducing cell death in selected cell populations comprising contacting target cells or tissue containing target cells with an effective amount of a cytotoxic agent comprising any of the cytotoxic compound-cell-binding agents (e.g., indolinobenzodiazepine or oxazolidinobenzodiazepine dimer linked to a cell binding agent) of the present invention, a salt or solvate thereof.
  • the target cells are cells to which the cell-binding agent can bind.
  • Suitable pharmaceutically acceptable carriers, diluents, and excipients are well known and can be determined by those of ordinary skill in the art as the clinical situation warrants.
  • suitable carriers, diluents and/or excipients include: (1) Dulbecco's phosphate buffered saline, pH about 7.4, containing or not containing about 1 mg/mL to 25 mg/mL human serum albumin, (2) 0.9% saline (0.9% w/v NaCl), and (3) 5% (w/v) dextrose; and may also contain an antioxidant such as tryptamine and a stabilizing agent such as Tween 20.
  • the method for inducing cell death in selected cell populations can be practiced in vitro, in vivo, or ex vivo.
  • Examples of in vitro uses include treatments of autologous bone marrow prior to their transplant into the same patient in order to kill diseased or malignant cells; treatments of bone marrow prior to their transplantation in order to kill competent T cells and prevent graft- versus-host-disease (GVHD); treatments of cell cultures in order to kill all cells except for desired variants that do not express the target antigen; or to kill variants that express undesired antigen.
  • GVHD graft- versus-host-disease
  • the conditions of non-clinical in vitro use are readily determined by one of ordinary skill in the art.
  • Examples of clinical ex vivo use are to remove tumor cells or lymphoid cells from bone marrow prior to autologous transplantation in cancer treatment or in treatment of autoimmune disease, or to remove T cells and other lymphoid cells from autologous or allogenic bone marrow or tissue prior to transplant in order to prevent GVHD.
  • Treatment can be carried out as follows. Bone marrow is harvested from the patient or other individual and then incubated in medium containing serum to which is added the cytotoxic agent of the invention, concentrations range from about 10 ⁇ to 1 pM, for about 30 minutes to about 48 hours at about 37°C. The exact conditions of concentration and time of incubation, i.e., the dose, are readily determined by one of ordinary skill in the art.
  • the bone marrow cells After incubation the bone marrow cells are washed with medium containing serum and returned to the patient intravenously according to known methods. In circumstances where the patient receives other treatment such as a course of ablative chemotherapy or total-body irradiation between the time of harvest of the marrow and reinfusion of the treated cells, the treated marrow cells are stored frozen in liquid nitrogen using standard medical equipment.
  • the cytotoxic agent of the invention will be supplied as a solution or a lyophilized powder that are tested for sterility and for endotoxin levels.
  • conjugate administration examples are as follows. Conjugates are given weekly for 4 weeks as an intravenous bolus each week. Bolus doses are given in 50 to 1000 mL of normal saline to which 5 to 10 mL of human serum albumin can be added.
  • Dosages will be 10 ⁇ g to 2000 mg per administration, intravenously (range of 100 ng to 20 mg/kg per day). After four weeks of treatment, the patient can continue to receive treatment on a weekly basis. Specific clinical protocols with regard to route of administration, excipients, diluents, dosages, times, etc., can be determined by one of ordinary skill in the art as the clinical situation warrants.
  • Examples of medical conditions that can be treated according to the in vivo or ex vivo methods of inducing cell death in selected cell populations include malignancy of any type including, for example, cancer; autoimmune diseases, such as systemic lupus, rheumatoid arthritis, and multiple sclerosis; graft rejections, such as renal transplant rejection, liver transplant rejection, lung transplant rejection, cardiac transplant rejection, and bone marrow transplant rejection; graft versus host disease; viral infections, such as CMV infection, HIV infection, AIDS, etc.; and parasite infections, such as giardiasis, amoebiasis, schistosomiasis, and others as determined by one of ordinary skill in the art.
  • malignancy of any type including, for example, cancer; autoimmune diseases, such as systemic lupus, rheumatoid arthritis, and multiple sclerosis; graft rejections, such as renal transplant rejection, liver transplant rejection, lung transplant rejection, cardiac transplant rejection, and bone marrow transplant rejection;
  • PDR Physician's Desk Reference
  • the PDR discloses dosages of the agents that have been used in treatment of various cancers.
  • the dosing regimen and dosages of these aforementioned chemotherapeutic drugs that are therapeutically effective will depend on the particular cancer being treated, the extent of the disease and other factors familiar to the physician of skill in the art and can be determined by the physician.
  • the contents of the PDR are expressly incorporated herein in its entirety by reference.
  • One of skill in the art can review the PDR, using one or more of the following parameters, to determine dosing regimen and dosages of the chemotherapeutic agents and conjugates that can be used in accordance with the teachings of this invention. These parameters include:
  • cytotoxic agents [370]
  • each of the cytotoxic agents described herein can be modified in such a manner that the resulting compound still retains the specificity and/or activity of the starting compound.
  • the skilled artisan will also understand that many of these compounds can be used in place of the cytotoxic agents described herein.
  • the cytotoxic agents of the present invention include analogues and derivatives of the compounds described herein.
  • This N-terminal Ser is the result of signal peptidase utilizing an usual cleavage site in the signal peptide of the IGKV 1-99*01 murine germline sequence (accession number CAB46122; SEQ ID NO: 2) from which the FR1-2.1 light chain is derived. Unlike typical antibody signal peptides that are completely removed upon cleavage during antibody expression, the final serine of the IGKV 1-99* signal peptide (Kabat position -1) remains at the N terminus of the FR1-2.1 light chain.
  • the FR1-2.1 antibody proved to be a useful tool for evaluating the serine oxidation modification methods described herein, and, in addition, the FR1-2.1 signal peptide (Table 1; SEQ ID NO: 1) provides a possible mechanism for generating recombinant antibodies with serines at their light or heavy chain N termini.
  • the use of a native antibody signal peptide to incorporate the N-terminal serine allows for the avoidance of potential negative consequences of antibody engineering, including but not limited to expression problems and cleavage site heterogeneity that could come from non-natural constructs.
  • the light chain sequence was then provided to Blue Heron Biotechnology where it was codon-optimized, synthesized, and cloned into the EcoRI and BsiWI sites of the pAbKZeo mammalian expression plasmid containing the human Kappa constant region sequence.
  • the heavy chain sequence was then codon- optimized, synthesized, and cloned by Blue Heron Biotechnology in frame with the human IgGl constant region at the Hindlll and Apal sites of the pAbGlNeo plasmid.
  • Various combinations of the N-terminal serine addition and N-terminal serine replacement schemes described above are used to generate additional recombinant antibodies with up to 4 N-terminal serines (e.g. , 2 on the heavy chains and 2 on the light chains).
  • recombinant antibodies with serines at both N-termini for a total of 4 N-terminal serines per antibody e.g. , huMovl9LC NTS 3 with huMovl9HC NTS4.
  • These constructs are limited to either 2 (single chain N terminal serines) or 4 (both chains with N terminal serines) incorporation sites but with heterodimeric antibody technologies, such as "Knob in the Hole" mutations (WO 2005/063816 A2, incorporated by reference). Construction of antibodies with either 1 or 3 N terminal serines is also possible.
  • recombinant antibodies can be generated with threonine residues at their N-termini by simply replacing the N terminal residue (Kabat position +1) with a threonine in order to conjugate these antibodies by the methods described herein.
  • the humanized Movl9 light chain (LC) N terminal aspartate is replaced with threonine (huMovl9 LC NTTl, SEQ ID NO: 15) or the humanized Movl9 heavy chain (HC) N-terminal glutamine is replaced with a threonine (huMovl9 HC NTT2, SEQ ID NO: 16).
  • SEQ ID NO: 6 is used as a signal peptide for its natural huMovl9 LC and HC, or as a signal peptide for a heterologous LC or HC, with the modification that a Ser or Thr residue is inserted
  • the chimeric and humanized antibody constructs were transiently produced in suspension-adapted HEK-293T cells, using a modified PEI procedure (Durocher Y, Perret S, & Kamen A High-level and high-throughput recombinant protein production by transient transfection of suspension-growing human 293-EBNA1 cells. Nucleic Acids Res. 2002 Jan 15;30(2):E9) in shake flasks.
  • the PEI transient transfections were performed as previously described (Durocher, supra), except that the HEK-293T cells were grown in Freestyle 293 (Invitrogen), and the culture volume was left undiluted after the addition of the PEI-DNA complexes. Both the adherent and suspension transient transfections were incubated for a week, and then the cleared supernatant was purified by a Protein A column followed by a CM column ion exchange chromatography as described below.
  • Antibodies were purified from cleared cell culture supernatants using standard methods, such as, for example, Protein A or G chromatography (HiTrap Protein A or G HP, 1 mL, Amersham Biosciences). Briefly, supernatant was prepared for chromatography by the addition of 1/10 volume of 1 M Tris/HCl buffer, pH 8.0. The pH-adjusted supernatant was filtered through a 0.22 ⁇ filter membrane and loaded onto column equilibrated with binding buffer (PBS, pH 7.3). The column was washed with binding buffer until a stable baseline was obtained with no absorbance at 280 nm.
  • binding buffer PBS, pH 7.3
  • Antibody was eluted with 0.1 M acetic acid buffer containing 0.15 M NaCl, pH 2.8, using a flow rate of 0.5 mL/min. Fractions of approximately 0.25 mL were collected and neutralized by the addition of 1/10 volume of 1M Tris/HCl, pH 8.0. The peak fraction(s) was dialyzed overnight twice against lx PBS, and sterilized by filtering through a 0.2 ⁇ filter membrane. Purified antibody was quantified by absorbance at A280. [381] Protein A purified fractions were further purified using ion exchange chromatography (IEX) with carboxymethyl (CM) chromatography.
  • IEX ion exchange chromatography
  • CM carboxymethyl
  • samples from protein A purification were buffer exchanged into the start buffer (10 mM potassium phosphate, 10 mM sodium chloride, pH 7.5) and filtered through 0.22 ⁇ filer.
  • the prepared sample was then loaded onto a CM fast flow resin (GE Lifesciences) that was equilibrated with the start buffer at a flow rate of 120 cm/hr. Column size was chosen to have sufficient capacity to bind all the antibody in the sample.
  • the column was then washed with binding buffer until a stable baseline was obtained with no absorbance at 280 nm.
  • Antibody was eluted by initiating a gradient from 10 mM to 500 mM sodium chloride in 20 column volume (CV). Fractions with the UV reading above 50 mAu of the major peak were collected.
  • the purity (the percentage of monomer and soluble high molecular weight aggregates) was assessed with size exclusion chromatography (SEC) on a TSK gel G3000SWXL, 7.8 x 300 mm with a SWXL guard column, 6.0 x 40 mm (Tosoh Bioscience, Montgomeryville, PA) using an Agilent HPLC 1100 system (Agilent, Santa Clara, CA). Fractions with desired purity (>95%) were pooled, buffer exchanged to PBS (pH 7.4) using TFF system, and sterilized by filtering through a 0.2 ⁇ filter membrane. Purified antibody was further tested for its purity by SEC and the IgG concentration was determined by absorbance measurement at 280 nm using an extinction coefficient of 1.47.
  • SEC size exclusion chromatography
  • CHT ceramic hydroxyapatite
  • Type II CHT resin with 40 ⁇ particle size Bio-Rad Laboratories
  • the start buffer for CHT was 20 mM sodium phosphate, pH 7.0 and antibody was eluted with a gradient of 20-160 mM sodium phosphate over 20 CV.
  • huMOV19-NTS#2 antibody engineered with an N-terminal serine on the heavy chain [1], in Scheme 1 as shown in Figure 1; 3mg/mL in PBS, pH7.4) was treated with 5 mM aqueous sodium periodate (50 equivalents, 25°C, 30 minutes). The mixture was then buffer exchanged through a NAP desalting column (Illustra Sephadex G-25 DNA Grade, GE Healthcare) into sodium acetate buffer, pH5.0.
  • the mixture was then buffer exchanged through a NAP desalting column (Illustra Sephadex G-25 DNA Grade, GE Healthcare) into 250 mM Glycine, 10 mM Histidine, 1% sucrose buffer at pH 6.2. Dialysis was performed in the same buffer for 4 hours at 25°C, utilizing Slide-a-Lyzer dialysis cassettes (ThermoScientific 10,000 MWCO).
  • huMovl9-NTS#l antibody engineered with an N-terminal serine on the light chain through a leader peptide sequence [1] in Scheme 3, Figure 5; 3mg/mL in PBS, pH7.4) was treated with 5 mM aqueous sodium periodate (50 molar equivalents) at 25°C for 30 minutes. The mixture was then buffer exchanged through a NAP desalting column (Illustra Sephadex G-25 DNA Grade, GE Healthcare) into sodium acetate buffer, pH5.0.
  • ADC or control antibody e.g. , unconjugated native huMOV19, or M9346A
  • FACS buffer 1% BSA, lx
  • the human breast cancer cell line T47D cells were grown in RPMI- 1640 (Life Technologies) supplemented with heat-inactivated 10% FBS (Life Technologies), 0.1 mg/mL gentamycin (Life Technologies).
  • T47D cells were then resuspended in growth media (see above) to neutralize trypsin, and were counted on a Coulter counter. Cells were then washed twice in cold FACS buffer, centrifuging in between washes at 1200 rpm for 5 min.
  • KB cells bovine epithelial tumor
  • EMEM EMEM
  • FBS heat-inactivated 10% FBS
  • gentamycin 0.1 mg/ml gentamycin

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Rheumatology (AREA)
  • Oncology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Communicable Diseases (AREA)
  • Neurology (AREA)
  • Virology (AREA)
  • Transplantation (AREA)
  • Hematology (AREA)
  • Neurosurgery (AREA)
  • Biomedical Technology (AREA)
  • Dermatology (AREA)
  • Pain & Pain Management (AREA)
  • Urology & Nephrology (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2015/048044 2014-09-03 2015-09-02 Conjugates comprising cell-binding agents and cytotoxic agents Ceased WO2016036794A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
RU2017110068A RU2017110068A (ru) 2014-09-03 2015-09-02 Конъюгаты, содержащие клеточносвязывающие агенты и цитотоксические агенты
KR1020247005372A KR20240027148A (ko) 2014-09-03 2015-09-02 세포-결합제 및 세포독성 약물을 포함하는 콘주게이트
EP15766288.3A EP3188733B1 (en) 2014-09-03 2015-09-02 Conjugates comprising cell-binding agents and cytotoxic agents
JP2017512760A JP2017529837A (ja) 2014-09-03 2015-09-02 細胞結合剤及び細胞毒性剤を含む複合体
KR1020237007792A KR102638901B1 (ko) 2014-09-03 2015-09-02 세포-결합제 및 세포독성 약물을 포함하는 콘주게이트
AU2015312075A AU2015312075A1 (en) 2014-09-03 2015-09-02 Conjugates comprising cell-binding agents and cytotoxic agents
KR1020177009020A KR102508023B1 (ko) 2014-09-03 2015-09-02 세포-결합제 및 세포독성 약물을 포함하는 콘주게이트
CN201580059534.4A CN107580604A (zh) 2014-09-03 2015-09-02 包含细胞结合剂和细胞毒性剂的缀合物
CA2957964A CA2957964A1 (en) 2014-09-03 2015-09-02 Conjugates comprising cell-binding agents and cytotoxic agents
SG11201701565PA SG11201701565PA (en) 2014-09-03 2015-09-02 Conjugates comprising cell-binding agents and cytotoxic agents
IL250711A IL250711A0 (en) 2014-09-03 2017-02-22 Conjugates containing cell-binding agents and cytotoxic agents

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US201462045264P 2014-09-03 2014-09-03
US62/045,264 2014-09-03
US201462086986P 2014-12-03 2014-12-03
US62/086,986 2014-12-03
US201562149379P 2015-04-17 2015-04-17
US62/149,379 2015-04-17
US201562186235P 2015-06-29 2015-06-29
US62/186,235 2015-06-29

Publications (1)

Publication Number Publication Date
WO2016036794A1 true WO2016036794A1 (en) 2016-03-10

Family

ID=54147280

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/048044 Ceased WO2016036794A1 (en) 2014-09-03 2015-09-02 Conjugates comprising cell-binding agents and cytotoxic agents

Country Status (13)

Country Link
US (3) US10988531B2 (https=)
EP (1) EP3188733B1 (https=)
JP (1) JP2017529837A (https=)
KR (3) KR102638901B1 (https=)
CN (1) CN107580604A (https=)
AU (1) AU2015312075A1 (https=)
CA (1) CA2957964A1 (https=)
IL (1) IL250711A0 (https=)
MA (1) MA40415A (https=)
RU (1) RU2017110068A (https=)
SG (2) SG11201701565PA (https=)
TW (1) TW201609152A (https=)
WO (1) WO2016036794A1 (https=)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017004026A1 (en) * 2015-06-29 2017-01-05 Immunogen, Inc. Anti-cd 123 antibodies and conjugates and derivatives thereof
WO2017015495A1 (en) * 2015-07-21 2017-01-26 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
WO2017136693A1 (en) * 2016-02-05 2017-08-10 Millennium Pharmaceuticals, Inc. Gcc-targeted antibody-drug conjugates
EP3188761A4 (en) * 2014-09-02 2018-04-18 ImmunoGen, Inc. Methods for formulating antibody drug conjugate compositions
WO2018085359A1 (en) * 2016-11-02 2018-05-11 Immunogen, Inc. Combination treatment with antibody-drug conjugates and parp inhibitors
WO2018160539A1 (en) * 2017-02-28 2018-09-07 Immunogen, Inc. Maytansinoid derivatives with self-immolative peptide linkers and conjugates thereof
WO2018183494A1 (en) * 2017-03-31 2018-10-04 Immunogen, Inc. Cd19-targeting antibody-drug conjugates
WO2019018892A1 (en) 2017-07-26 2019-01-31 The University Of Queensland COMPOUNDS CONTAINING DISULFIDE BOND AND USES THEREOF
JP2019532019A (ja) * 2016-07-22 2019-11-07 ネクター セラピューティクス オキシム含有リンケージを有する第viii因子部分のコンジュゲート
US20220047716A1 (en) * 2018-09-17 2022-02-17 Sutro Biopharma, Inc. Combination therapies with anti-folate receptor antibody conjugates
US11583590B2 (en) 2017-09-29 2023-02-21 Daiichi Sankyo Company, Limited Antibody-pyrrolobenzodiazepine derivative conjugate and method of use thereof for treating a tumor
US11873335B2 (en) 2018-03-13 2024-01-16 Phanes Therapeutics, Inc. Anti-folate receptor 1 antibodies and uses thereof
US12496346B2 (en) 2019-10-10 2025-12-16 Cellectar Biosciences, Inc. Phospholipid-flavagline conjugates and methods of using the same for targeted cancer therapy
US12503479B2 (en) 2018-04-10 2025-12-23 Cellectar Biosciences, Inc. Phospholipid-flavagline conjugates and methods of using the same for targeted cancer therapy

Families Citing this family (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TW201609152A (zh) 2014-09-03 2016-03-16 免疫原公司 包含細胞結合劑及細胞毒性劑之偶聯物
ES2815353T3 (es) * 2014-09-03 2021-03-29 Immunogen Inc Derivados de benzodiazepina citotóxicos
JP7297408B2 (ja) 2015-02-06 2023-06-26 セル アイディーエックス, インコーポレイテッド 抗原をカップリングさせた免疫試薬
TWI750194B (zh) * 2016-07-05 2021-12-21 大陸商江蘇恆瑞醫藥股份有限公司 Egfr抗體-藥物偶聯物及其在醫藥上的應用
EP3554544A4 (en) 2016-12-16 2020-07-29 Bluefin Biomedicine, Inc. ANTI-PROTEIN 1 ANTIBODY CONTAINING AN ANTI-CUB DOMAIN (CDCP1), ANTIBODY-DRUG CONJUGATES AND THEIR METHODS OF USE
SI3558391T1 (sl) * 2016-12-23 2022-06-30 Immunogen, Inc. Imunokonjugati, ciljno usmerjeni na ADAM9, in načini njihove uporabe
EP3713962A4 (en) * 2017-11-21 2021-08-25 Novartis AG TRISPECIFIC BINDING MOLECULES AGAINST TUMOR-ASSOCIATED ANTIGENS AND THEIR USE
MA51629A (fr) * 2018-01-12 2020-11-18 Immunogen Inc Procédés de production, purification et formulation de conjugués anticorps-médicaments
CN112955548B (zh) 2018-07-09 2023-11-24 普众发现医药科技(上海)有限公司 叶酸受体α特异性抗体
TWI897855B (zh) * 2018-10-26 2025-09-21 美商免疫遺傳股份有限公司 E p C A M 抗體、可活化抗體及免疫偶聯物以及其用途
WO2020092631A1 (en) * 2018-10-31 2020-05-07 Fred Hutchinson Cancer Research Center Compositions and methods for detecting and treating cancers characterized by expression of mesothelin
US20210032285A1 (en) * 2019-03-11 2021-02-04 Cell Idx, Inc. Methods, compositions, and kits for trapping modified biomolecules
CN120131907A (zh) 2019-03-19 2025-06-13 瓦尔希伯伦私人肿瘤研究基金会 采用Omomyc和结合PD-1或CTLA-4的抗体治疗癌症的联合疗法
US11833214B2 (en) * 2019-03-21 2023-12-05 Immunogen, Inc. Methods of preparing cell-binding agent-drug conjugates
PE20220568A1 (es) 2019-05-21 2022-04-20 Novartis Ag Moleculas de union a cd19 y usos de las mismas
EP3972993A1 (en) 2019-05-21 2022-03-30 Novartis AG Variant cd58 domains and uses thereof
CN110922482B (zh) * 2019-12-25 2021-08-31 源道隆(苏州)医学科技有限公司 可结合cd19的多肽及其应用
CN112794911B (zh) * 2021-04-14 2021-08-03 上海偌妥生物科技有限公司 人源化抗叶酸受体1抗体及其应用
CN113908589B (zh) * 2021-10-08 2022-09-27 天津工业大学 一种表面印迹抗体的疏水电荷诱导模式膜层析介质及其制备方法
AU2023370106A1 (en) 2022-10-25 2025-05-08 Fundació Privada Institut D'investigació Oncològica De Vall Hebron Combination therapy for the treatment of cancer
EP4473974A1 (en) 2023-06-07 2024-12-11 Peptomyc, S.L. Omomyc and kras inhibitors combination therapy for the treatment of cancer
TW202513088A (zh) 2023-06-07 2025-04-01 瓦爾希伯倫私人腫瘤研究基金會 用於治療癌症的與mek抑制劑的組合療法
KR20260020418A (ko) 2023-06-07 2026-02-11 펀다시오 프리바다 인스티튜트 드인베스티가시오 온콜로지카 데 발 헤브론 Braf 저해제를 이용한 암 치료용 조합 요법
CN117659041A (zh) * 2023-12-08 2024-03-08 联宁(苏州)生物制药有限公司 用于抗体偶联药物的氘代蒽环类毒素连接子及其合成方法和应用
KR20250146159A (ko) * 2024-03-29 2025-10-13 진메디신 주식회사 약물 및 항체를 연결하는 링커 화합물 및 이를 이용한 항체-약물 복합체

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1993006132A1 (en) * 1991-09-27 1993-04-01 Pfizer Inc. Modified peptide derivatives
WO2007020965A1 (ja) * 2005-08-19 2007-02-22 National Institute Of Agrobiological Sciences 一本鎖抗体によるサイトゾルタンパク質の機能阻害法およびその利用
US20090181037A1 (en) * 2007-11-02 2009-07-16 George Heavner Semi-Synthetic GLP-1 Peptide-FC Fusion Constructs, Methods and Uses
US20100129314A1 (en) * 2008-04-30 2010-05-27 Immunogen Inc. Potent conjugates and hydrophilic linkers
WO2012112687A1 (en) * 2011-02-15 2012-08-23 Immunogen, Inc. Methods of preparation of conjugates
US8557966B2 (en) * 2010-02-24 2013-10-15 Immunogen, Inc. Folate receptor 1 antibodies and immunoconjugates and uses thereof
US20130295007A1 (en) * 2012-05-01 2013-11-07 Genentech, Inc. Anti-pmel17 antibodies and immunoconjugates
WO2013174003A1 (en) * 2012-05-24 2013-11-28 Mountgate Group Limited Compositions and methods related to prevention and treatment of rabies infection
WO2015031815A2 (en) * 2013-08-30 2015-03-05 Immunogen, Inc. Antibodies and assays for detection of folate receptor 1

Family Cites Families (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2801904B1 (fr) 1999-12-07 2002-02-08 Pasteur Institut Produits comprenant un support sur lequel sont fixes des acides nucleiques et leur utilisation comme puce a adn
CA2499496C (fr) 2002-09-19 2012-04-24 Centre National De La Recherche Scientifique - Cnrs Synthese et caracterisation de nouveaux systemes de guidage et de vectorisation de molecules d'interet therapeutique vers des cellules cibles
EA008866B1 (ru) 2002-12-26 2007-08-31 Маунтин Вью Фамэсьютикэлс, Инк. ПОЛИМЕРНЫЙ КОНЪЮГАТ МОДИФИКАЦИЙ ИНТЕРФЕРОНА-β, ФАРМАЦЕВТИЧЕСКИЕ ПРОДУКТЫ НА ЕГО ОСНОВЕ И СПОСОБ ИХ ПОЛУЧЕНИЯ
GB0305704D0 (en) 2003-03-13 2003-04-16 Amersham Plc Radiofluorination methods
KR20120064120A (ko) 2004-06-01 2012-06-18 제넨테크, 인크. 항체 약물 접합체 및 방법
WO2006042848A2 (en) 2004-10-18 2006-04-27 Novo Nordisk A/S Growth hormone conjugates
CA2600749C (en) 2005-03-10 2014-04-15 Nascacell Ip Gmbh Dimeric or multimeric microproteins
EP1877100A2 (en) 2005-04-25 2008-01-16 GE Healthcare AS Liposomes
WO2007048127A2 (en) 2005-10-20 2007-04-26 The Scripps Research Institute Fc labeling for immunostaining and immunotargeting
FR2897616B1 (fr) 2006-02-20 2008-05-30 Univ Grenoble 1 Presentation de motifs de reconnaissance par une matrice multivalente greffee sur un support solide
US7985783B2 (en) * 2006-09-21 2011-07-26 The Regents Of The University Of California Aldehyde tags, uses thereof in site-specific protein modification
DK2474557T3 (da) 2007-07-16 2014-11-10 Genentech Inc Anti-CD79b-antistoffer og immunkonjugater og fremgangsmåder til anvendelse
RU2476441C2 (ru) 2007-10-19 2013-02-27 Сиэтл Дженетикс, Инк. Cd19-связывающие средства и их применение
US9381058B2 (en) * 2010-11-05 2016-07-05 Ethicon Endo-Surgery, Llc Recharge system for medical devices
JP6310909B2 (ja) 2012-06-06 2018-04-11 ビオノール イミュノ エーエスBionor Immuno As 免疫原及び投薬反応物として使用するためのウイルスタンパク質に由来するペプチド
US9834597B2 (en) 2012-09-21 2017-12-05 The Regents Of The University Of California Modified FC polypeptides, FC conjugates, and methods of use thereof
EP3300108B1 (en) * 2013-03-28 2019-07-24 Toshiba Hokuto Electronics Corporation Light emitting device and method for manufacturing the same
EP3001813B1 (en) 2013-05-13 2019-03-27 Vision Global Holdings Ltd. Pharmaceutical composition comprising modified hemoglobin- based therapeutic agent for cancer targeting treatment and diagnostic imaging
WO2015079376A1 (en) 2013-11-26 2015-06-04 Novartis Ag Methods for oxime conjugation to ketone-modified polypeptides
TW201609152A (zh) 2014-09-03 2016-03-16 免疫原公司 包含細胞結合劑及細胞毒性劑之偶聯物

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1993006132A1 (en) * 1991-09-27 1993-04-01 Pfizer Inc. Modified peptide derivatives
WO2007020965A1 (ja) * 2005-08-19 2007-02-22 National Institute Of Agrobiological Sciences 一本鎖抗体によるサイトゾルタンパク質の機能阻害法およびその利用
US20090181037A1 (en) * 2007-11-02 2009-07-16 George Heavner Semi-Synthetic GLP-1 Peptide-FC Fusion Constructs, Methods and Uses
US20100129314A1 (en) * 2008-04-30 2010-05-27 Immunogen Inc. Potent conjugates and hydrophilic linkers
US8557966B2 (en) * 2010-02-24 2013-10-15 Immunogen, Inc. Folate receptor 1 antibodies and immunoconjugates and uses thereof
WO2012112687A1 (en) * 2011-02-15 2012-08-23 Immunogen, Inc. Methods of preparation of conjugates
US20130295007A1 (en) * 2012-05-01 2013-11-07 Genentech, Inc. Anti-pmel17 antibodies and immunoconjugates
WO2013174003A1 (en) * 2012-05-24 2013-11-28 Mountgate Group Limited Compositions and methods related to prevention and treatment of rabies infection
WO2015031815A2 (en) * 2013-08-30 2015-03-05 Immunogen, Inc. Antibodies and assays for detection of folate receptor 1

Cited By (64)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3188761A4 (en) * 2014-09-02 2018-04-18 ImmunoGen, Inc. Methods for formulating antibody drug conjugate compositions
EP3311846A1 (en) * 2014-09-02 2018-04-25 ImmunoGen, Inc. Methods for formulating antibody drug conjugate compositions
US10077313B2 (en) 2015-06-29 2018-09-18 Immunogen, Inc. Anti-CD123 antibodies and conjugates and derivatives thereof
US10919969B2 (en) 2015-06-29 2021-02-16 Immunogen, Inc. Anti-CD123 antibodies and conjugates and derivatives thereof
US10875925B2 (en) 2015-06-29 2020-12-29 Immunogen, Inc. Anti-CD123 antibodies and conjugates and derivatives thereof
US11332535B2 (en) 2015-06-29 2022-05-17 Immunogen, Inc. Anti-CD123 antibodies and conjugates and derivatives thereof
EP3842459A1 (en) * 2015-06-29 2021-06-30 ImmunoGen, Inc. Anti-cd123 antibodies and conjugates and derivatives thereof
WO2017004026A1 (en) * 2015-06-29 2017-01-05 Immunogen, Inc. Anti-cd 123 antibodies and conjugates and derivatives thereof
US10442865B2 (en) 2015-06-29 2019-10-15 Immunogen, Inc. Methods of use of anti-CD123 antibodies and antigen-binding fragments thereof
US11897961B2 (en) 2015-06-29 2024-02-13 Immunogen, Inc. Anti-CD123 antibodies and conjugates and derivatives thereof
US11420982B2 (en) 2015-07-21 2022-08-23 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
RU2727151C2 (ru) * 2015-07-21 2020-07-21 Иммуноджен, Инк. Способы получения цитотоксических производных бензодиазепина
JP2018526340A (ja) * 2015-07-21 2018-09-13 イミュノジェン・インコーポレーテッド 細胞毒性ベンゾジアゼピン誘導体の調製方法
CN108055844A (zh) * 2015-07-21 2018-05-18 伊缪诺金公司 制备细胞毒性苯并二氮杂*衍生物的方法
US10081640B2 (en) 2015-07-21 2018-09-25 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
WO2017015495A1 (en) * 2015-07-21 2017-01-26 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
CN108026103A (zh) * 2015-07-21 2018-05-11 伊缪诺金公司 制备细胞毒性苯并二氮杂䓬衍生物的方法
US10370389B2 (en) 2015-07-21 2019-08-06 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
US10392407B2 (en) 2015-07-21 2019-08-27 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
US10899775B2 (en) 2015-07-21 2021-01-26 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
US9890179B2 (en) 2015-07-21 2018-02-13 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
WO2017015496A1 (en) * 2015-07-21 2017-01-26 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
EP4163284A1 (en) * 2015-07-21 2023-04-12 ImmunoGen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
US10787463B2 (en) 2015-07-21 2020-09-29 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
US9873708B2 (en) 2015-07-21 2018-01-23 Immunogen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
EP3653628A1 (en) * 2015-07-21 2020-05-20 ImmunoGen, Inc. Methods of preparing cytotoxic benzodiazepine derivatives
WO2017136693A1 (en) * 2016-02-05 2017-08-10 Millennium Pharmaceuticals, Inc. Gcc-targeted antibody-drug conjugates
US12324828B2 (en) 2016-07-22 2025-06-10 Nektar Therapeutics Conjugates of a factor VIII moiety having an oxime-containing linkage
JP2019532019A (ja) * 2016-07-22 2019-11-07 ネクター セラピューティクス オキシム含有リンケージを有する第viii因子部分のコンジュゲート
US11628205B2 (en) 2016-07-22 2023-04-18 Nektar Therapeutics Conjugates of a factor VIII moiety having an oxime-containing linkage
JP7618383B2 (ja) 2016-07-22 2025-01-21 ネクター セラピューティクス オキシム含有リンケージを有する第viii因子部分のコンジュゲート
WO2018085359A1 (en) * 2016-11-02 2018-05-11 Immunogen, Inc. Combination treatment with antibody-drug conjugates and parp inhibitors
CN116785451A (zh) * 2017-02-28 2023-09-22 伊缪诺金公司 具有自分解肽接头的类美登素衍生物和其缀合物
JP2022137200A (ja) * 2017-02-28 2022-09-21 イミュノジェン・インコーポレーテッド 自己犠牲型ペプチドリンカーを有するメイタンシノイド誘導体及びそのコンジュゲート
US11135308B2 (en) 2017-02-28 2021-10-05 Immunogen, Inc. Maytansinoid derivatives with self-immolative peptide linkers and conjugates thereof
RU2765098C2 (ru) * 2017-02-28 2022-01-25 Иммуноджен, Инк. Производные майтанзиноида с саморасщепляющимися пептидными линкерами и их конъюгаты
KR102891599B1 (ko) 2017-02-28 2025-11-28 이뮤노젠 아이엔씨 자기희생적 펩티드 링커 및 이들의 접합체를 갖는 메이탄시노이드 유도체
US10792372B2 (en) 2017-02-28 2020-10-06 Immunogen, Inc. Maytansinoid derivatives with self-immolative peptide linkers and conjugates thereof
JP7106560B2 (ja) 2017-02-28 2022-07-26 イミュノジェン・インコーポレーテッド 自己犠牲型ペプチドリンカーを有するメイタンシノイド誘導体及びそのコンジュゲート
JP2020510656A (ja) * 2017-02-28 2020-04-09 イミュノジェン・インコーポレーテッド 自己犠牲型ペプチドリンカーを有するメイタンシノイド誘導体及びそのコンジュゲート
US12390471B2 (en) 2017-02-28 2025-08-19 Immunogen, Inc. Maytansinoid derivatives with self-immolative peptide linkers and conjugates thereof
KR102681168B1 (ko) 2017-02-28 2024-07-04 이뮤노젠 아이엔씨 자기희생적 펩티드 링커 및 이들의 접합체를 갖는 메이탄시노이드 유도체
WO2018160539A1 (en) * 2017-02-28 2018-09-07 Immunogen, Inc. Maytansinoid derivatives with self-immolative peptide linkers and conjugates thereof
AU2018229277B2 (en) * 2017-02-28 2025-03-20 Immunogen, Inc. Maytansinoid derivatives with self-immolative peptide linkers and conjugates thereof
IL268921A (en) * 2017-02-28 2019-10-31 Immunogen Inc History of ethinsinoid with peptide linkages and their couplings
JP7645843B2 (ja) 2017-02-28 2025-03-14 イミュノジェン・インコーポレーテッド 自己犠牲型ペプチドリンカーを有するメイタンシノイド誘導体及びそのコンジュゲート
KR20190122766A (ko) * 2017-02-28 2019-10-30 이뮤노젠 아이엔씨 자기희생적 펩티드 링커 및 이들의 접합체를 갖는 메이탄시노이드 유도체
CN110366431B (zh) * 2017-02-28 2023-07-18 伊缪诺金公司 具有自分解肽接头的类美登素衍生物和其缀合物
CN110366431A (zh) * 2017-02-28 2019-10-22 伊缪诺金公司 具有自分解肽接头的类美登素衍生物和其缀合物
IL298414B1 (en) * 2017-02-28 2024-08-01 Immunogen Inc History of methanosinoids with peptide linkers and their conjugates
WO2018183494A1 (en) * 2017-03-31 2018-10-04 Immunogen, Inc. Cd19-targeting antibody-drug conjugates
AU2018305726B2 (en) * 2017-07-26 2022-09-15 The University Of Queensland Disulfide bond containing compounds and uses thereof
WO2019018892A1 (en) 2017-07-26 2019-01-31 The University Of Queensland COMPOUNDS CONTAINING DISULFIDE BOND AND USES THEREOF
US11566044B2 (en) 2017-07-26 2023-01-31 The University Of Queensland Disulfide bond containing compounds and uses thereof
EP3658568A4 (en) * 2017-07-26 2021-04-28 The University of Queensland Disulfide bond containing compounds and uses thereof
US12246196B2 (en) 2017-09-29 2025-03-11 Daiichi Sankyo Company, Limited Antibody-drug conjugates comprising substituted benzo[e]pyrrolo[1,2-a][1,4]diazepines
US11628223B2 (en) 2017-09-29 2023-04-18 Daiichi Sankyo Company, Limited Antibody-drug conjugates comprising substituted benzo[e]pyrrolo[1,2-α][1,4]diazepines
US11583590B2 (en) 2017-09-29 2023-02-21 Daiichi Sankyo Company, Limited Antibody-pyrrolobenzodiazepine derivative conjugate and method of use thereof for treating a tumor
US12350344B2 (en) 2017-09-29 2025-07-08 Daiichi Sankyo Company, Limited Methods of treating a tumor by administering a claudin-6 (CLDN6) or CLDN9 antibody-pyrrolobenzodiazepine derivative conjugate
US12606634B2 (en) 2017-09-29 2026-04-21 Daiichi Sankyo Company, Limited Antibody-pyrrolobenzodiazepine derivative conjugate which binds caludin-6 and claudin-9
US11873335B2 (en) 2018-03-13 2024-01-16 Phanes Therapeutics, Inc. Anti-folate receptor 1 antibodies and uses thereof
US12503479B2 (en) 2018-04-10 2025-12-23 Cellectar Biosciences, Inc. Phospholipid-flavagline conjugates and methods of using the same for targeted cancer therapy
US20220047716A1 (en) * 2018-09-17 2022-02-17 Sutro Biopharma, Inc. Combination therapies with anti-folate receptor antibody conjugates
US12496346B2 (en) 2019-10-10 2025-12-16 Cellectar Biosciences, Inc. Phospholipid-flavagline conjugates and methods of using the same for targeted cancer therapy

Also Published As

Publication number Publication date
JP2017529837A (ja) 2017-10-12
KR20240027148A (ko) 2024-02-29
US20240190956A1 (en) 2024-06-13
US11732038B2 (en) 2023-08-22
EP3188733A1 (en) 2017-07-12
CN107580604A (zh) 2018-01-12
RU2017110068A (ru) 2018-10-03
US20160095938A1 (en) 2016-04-07
US20210299271A1 (en) 2021-09-30
US10988531B2 (en) 2021-04-27
AU2015312075A1 (en) 2017-03-09
EP3188733B1 (en) 2019-11-06
KR102508023B1 (ko) 2023-03-10
KR102638901B1 (ko) 2024-02-22
CA2957964A1 (en) 2016-03-10
SG10201901825YA (en) 2019-03-28
SG11201701565PA (en) 2017-03-30
TW201609152A (zh) 2016-03-16
IL250711A0 (en) 2017-08-31
KR20170054430A (ko) 2017-05-17
MA40415A (fr) 2016-03-10
RU2017110068A3 (https=) 2019-08-26
KR20230039755A (ko) 2023-03-21

Similar Documents

Publication Publication Date Title
US20240190956A1 (en) Conjugates comprising cell-binding agents and cytotoxic agents
US20230233697A1 (en) Cytotoxic benzodiazepine derivatives
US12390471B2 (en) Maytansinoid derivatives with self-immolative peptide linkers and conjugates thereof
US20180346488A1 (en) Cytotoxic benzodiazepine derivatives and conjugates thereof
HK40046012A (en) Cytotoxic benzodiazepine derivatives
HK1236943B (en) Cytotoxic benzodiazepine derivatives
HK1236943A1 (en) Cytotoxic benzodiazepine derivatives

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15766288

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2957964

Country of ref document: CA

REEP Request for entry into the european phase

Ref document number: 2015766288

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015766288

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 250711

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2017512760

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2015312075

Country of ref document: AU

Date of ref document: 20150902

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20177009020

Country of ref document: KR

Kind code of ref document: A

Ref document number: 2017110068

Country of ref document: RU

Kind code of ref document: A