WO2015092440A1 - Viral vector production system - Google Patents

Viral vector production system Download PDF

Info

Publication number
WO2015092440A1
WO2015092440A1 PCT/GB2014/053813 GB2014053813W WO2015092440A1 WO 2015092440 A1 WO2015092440 A1 WO 2015092440A1 GB 2014053813 W GB2014053813 W GB 2014053813W WO 2015092440 A1 WO2015092440 A1 WO 2015092440A1
Authority
WO
WIPO (PCT)
Prior art keywords
vector
trap
viral vector
nucleic acid
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2014/053813
Other languages
English (en)
French (fr)
Inventor
Daniel Farley
Kyriacos Mitrophanous
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Oxford Biomedica UK Ltd
Original Assignee
Oxford Biomedica UK Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP19190116.4A priority Critical patent/EP3650548B1/en
Priority to CN201480076100.0A priority patent/CN106029891B/zh
Priority to DK14821255.8T priority patent/DK3083969T3/da
Priority to EP14821255.8A priority patent/EP3083969B1/en
Priority to ES14821255T priority patent/ES2748377T3/es
Priority to US15/106,555 priority patent/US10544429B2/en
Application filed by Oxford Biomedica UK Ltd filed Critical Oxford Biomedica UK Ltd
Priority to KR1020167019013A priority patent/KR102354365B1/ko
Priority to PL14821255T priority patent/PL3083969T3/pl
Priority to JP2016541089A priority patent/JP6655014B2/ja
Publication of WO2015092440A1 publication Critical patent/WO2015092440A1/en
Anticipated expiration legal-status Critical
Priority to US16/714,516 priority patent/US12054735B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/10011Adenoviridae
    • C12N2710/10311Mastadenovirus, e.g. human or simian adenoviruses
    • C12N2710/10341Use of virus, viral particle or viral elements as a vector
    • C12N2710/10343Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/10011Adenoviridae
    • C12N2710/10311Mastadenovirus, e.g. human or simian adenoviruses
    • C12N2710/10351Methods of production or purification of viral material
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15041Use of virus, viral particle or viral elements as a vector
    • C12N2740/15043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15051Methods of production or purification of viral material
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15051Methods of production or purification of viral material
    • C12N2740/15052Methods of production or purification of viral material relating to complementing cells and packaging systems for producing virus or viral particles
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16051Methods of production or purification of viral material
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14151Methods of production or purification of viral material
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00Vectors comprising a special translation-regulating system
    • C12N2840/10Vectors comprising a special translation-regulating system regulates levels of translation
    • C12N2840/102Vectors comprising a special translation-regulating system regulates levels of translation inhibiting translation
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00Vectors comprising a special translation-regulating system
    • C12N2840/55Vectors comprising a special translation-regulating system from bacteria

Definitions

  • the invention relates to the production of viral vectors. More specifically, the present invention relates to modification of the translation of a nucleotide of interest which is encoded by a viral vector, in a viral vector production cell.
  • Gene therapy broadly involves the use of genetic material to treat disease. It includes the supplementation in cells with defective genes (e.g. those harbouring mutations) with functional copies of those genes, the inactivation of improperly functioning genes and the introduction of new therapeutic genes.
  • Therapeutic genetic material may be incorporated into the target cells of a host using vectors to enable the transfer of nucleic acids.
  • vectors can be generally divided into viral and non-viral categories.
  • Viruses naturally introduce their genetic material into target cells of a host as part of their replication cycle.
  • Engineered viral vectors harness this ability to enable the delivery of a nucleotide of interest (NOI) to a target cell.
  • NOI nucleotide of interest
  • viruses have been engineered as vectors for gene therapy. These include retroviruses, adenoviruses (AdV), adeno-associated viruses (AAV), herpes simplex viruses (HSV) and vaccinia viruses.
  • viral vectors are typically further engineered to be replication defective.
  • the recombinant vectors can directly infect a target cell, but are incapable of producing further generations of infective virions.
  • Other types of viral vectors may be conditionally replication competent within cancer cells only, and may additionally encode a toxic transgene or pro-enzyme.
  • Retroviral vectors have been developed as therapies for various genetic disorders and are now showing increasing promise in clinical trials (e.g. Galy, A. and A. J. Thrasher (2010) Curr Opin Allergy Clin Immunol l l (6): 545-550; Porter, D. L, B. L. Levine, M. Kalos, A. Bagg and C. H. June (201 1) N Engl J Med 365 (8): 725-733; Campochiaro, P. A. (2012) Gene Ther 19(2): 121-126; Cartier, N., S. Hacein-Bey-Abina, C. C. Bartholomae, P. Bougneres, M. Schmidt, C. V. Kalle, A. Fischer, M.
  • vectors include the gamma-retrovirus vector system (based on MMLV), the primate lentivirus vector system (based on HIV-1) and the non-primate lentivirus vector system (based on EIAV).
  • Reverse genetics has allowed these virus-based vectors to be heavily engineered such that vectors encoding large heterologous sequences (circa 10 kb) can be produced by transfection of mammalian cells with appropriate DNA sequences (reviewed in Bannert, K. (2010) Caister Academic Press: 347-370).
  • TetR repressor system is used to repress the NOI expression cassette it is likely that production of the vector genome molecule would also be inhibited through steric hindrance.
  • control mechanism modifications must also not adversely affect the functionality of the vector genome molecule after virion maturation and release (i.e. with regards to directing transduction of the target cell).
  • a retroviral vector genome RNA molecule must be capable of the processes of reverse transcription and integration - any modification to the NOI expression cassette must not impede these steps in the transduction process. Repression of NOI expression within viral vector production cells may present further advantages. If NOI expression leads to a reduction in the viability of vector production cells, its repression may benefit manufacturing at large scale which requires large cell numbers.
  • the reduction in cell debris due to cell death would also reduce impurities within the crude vector harvest material.
  • Processing, purification and concentration of the vector platform i.e. different therapeutic genes encoded within the same vector system
  • concentration of the vector platform could be standardised; if the only heterologous genes expressed within viral vector production cells are those required for vector production, downstream processing could be more easily optimised for an entire platform of therapeutic vectors, resulting in very similar physical specifications of vector preparations. Variability of immune response to, and toxicity of, resulting vectors in vivo may be minimised, which may lead to more persistent therapeutic NOI expression in the target cells.
  • Tissue-specific promoters which limit expression of the NOI in production cells are a possible solution to this problem, although leakiness of these promoters might lead to adverse levels of transgene protein.
  • greater and more robust expression of the NOI in target cells can be achieved using constitutive promoters. Indeed, such robust expression may be required for efficacy in vivo.
  • tissue-specific promoters may be less predictable when following a therapeutic vector product through animal models and into humans during pre-clinical and clinical development.
  • the expression of a protein of interest (POI) encoded by the viral vector expression cassette in the viral vector production cell may present a number of problems for the generation of viral vector therapeutics.
  • POI protein of interest
  • such expression may lead to a reduction in titres of the viral vector, and the undesirable incorporation of, or association with, a protein encoded by the NOI into the viral vector particle.
  • the present invention provides a nucleic acid sequence comprising a binding site operably linked to a nucleotide of interest, wherein the binding site is capable of interacting with an RNA-binding protein such that translation of the nucleotide of interest is repressed or prevented in a viral vector production cell.
  • the RNA-binding protein is tryptophan RNA-binding attenuation protein (TRAP), for example bacterial tryptophan RNA-binding attenuation protein.
  • TRIP tryptophan RNA-binding attenuation protein
  • Another aspect of the invention relates to a viral vector comprising the nucleic acid sequence of the invention.
  • Another aspect of the invention relates to a viral vector production system comprising a set of nucleic acid sequences encoding the components required for production of the viral vector, wherein the vector genome sequence comprises the nucleic acid sequence of the invention.
  • Another aspect of the invention relates to a DNA construct for use in the viral vector production system of the invention comprising the nucleic acid sequence of the invention.
  • a further aspect of the invention relates to a DNA construct for use in the viral vector production system of the invention comprising a nucleic acid sequence encoding the RNA- binding protein of the invention.
  • Another aspect of the invention relates to a set of DNA constructs for use in the viral vector production system of the invention comprising some or all of the DNA constructs of the invention and DNA constructs encoding Gag/Pol proteins and Env protein, or functional substitutes thereof.
  • a DNA construct expressing Rev may also be used in the viral vector production system.
  • Another aspect of the invention relates to a viral vector production cell comprising the nucleic acid sequence, the viral vector production system, or some or all of the DNA constructs of the invention.
  • Another aspect of the invention relates to a process for producing viral vectors comprising introducing the nucleic acid sequence, the viral vector production system, or some or all of the DNA constructs of the invention into a viral vector production cell and culturing the production cell under conditions suitable for the production of the viral vectors.
  • Another aspect of the invention relates to a viral vector produced by the viral vector production system of the invention, using the viral vector production cell of the invention or by the process of the invention.
  • Another aspect of the invention relates to a cell transduced by the viral vector of the invention.
  • Another aspect of the invention relates to the nucleic acid sequence, viral vector or a transduced cell of the invention for use in medicine.
  • Another aspect of the invention relates to a method of treatment comprising administering the nucleic acid sequence, viral vector or the transduced cell of the invention to a subject in need of the same.
  • Another aspect of the invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising the nucleic acid sequence, viral vector or the transduced cell of the invention in combination with a pharmaceutically acceptable carrier, diluent or excipient.
  • Another aspect of the invention relates to a method of identifying nucleic acid binding sites and/or nucleic acid binding proteins which are capable of interacting such that the translation of a nucleotide of interest is repressed or prevented in a viral vector production cell when operably linked to the nucleic acid binding site, wherein the method comprises analysing the expression of a reporter gene in a cell comprising both the nucleic acid binding site operably linked to the reporter gene, and the nucleic acid binding protein.
  • a significant limitation of producing therapeutic retroviral vectors at high or even moderate titres can be the adverse expression of the protein encoded by the transgene/NOI in production cells, particularly when the transgene is driven by a powerful, constitutive promoter.
  • Certain transgene proteins may have variable effects, both direct and indirect, on the cell's ability to produce active, infectious vector particles.
  • Cell metabolism, viral vector particle assembly and/or particle activity may be affected by a particular (known or unknown) action of the transgene product.
  • tissue-specific promoters to silence transgene expression in production cells have been used as a solution to this problem but a significant drawback with this approach is that often gene expression from tissue specific promoters is not as robust as it is from constitutive ones, and can be less predictable or more variable in the different animal models that are utilised during vector development.
  • RNA-binding protein e.g. the bacterial trp operon regulator protein, tryptophan RNA-binding attenuation protein, TRAP
  • TRAP tryptophan RNA-binding attenuation protein
  • TRIP Transgene Repression ]n vector Production cell system
  • RNA binding protein e.g. a TRAP-binding sequence, tbs
  • tbs TRAP-binding sequence
  • RT reverse transcriptase
  • the number of nucleotides between the tbs and translation initiation codon of the NOI may preferably be varied from 0 to 12 nucleotides without affecting the degree of repression of mRNA translation.
  • the tbs-bound TRAP may be repressing translation initiation by physically blocking the 40S scanning ribosome complex before it can reach the initiation codon, where-upon the more stable and higher- affinity translation machinery would otherwise form.
  • tbs may be placed downstream of an internal ribosome entry site (IRES) to repress translation of the NOI in a multicistronic mRNA.
  • IRES internal ribosome entry site
  • the TRIP system works maximally with a tbs sequence containing at least 8 RAGNN repeats, although in one embodiment 7 repeats may be used to still obtain robust transgene repression, and in another embodiment 6 repeats may be used to allow sufficient repression of the transgene to levels that could rescue vector titres.
  • the RAGNN consensus sequence may be varied to maintain TRAP-mediated repression, preferably the precise sequence chosen may be optimised to ensure high levels of translation in the non- repressed state.
  • the tbs sequences may be optimised by removing splicing sites, unstable sequences or stem-loops that might hamper translation efficiency of the mRNA in the absence of TRAP (i.e. in target cells).
  • the number of N "spacing" nucleotides between the RAG repeats is preferably two.
  • a tbs containing more than two N spacers between at least two RAG repeats may be tolerated (as many as 50% of the repeats containing three Ns may result in a functional tbs as judged by in vitro binding studies; Babitzke P, Y. J., Campanelli D.
  • RNA-binding protein e.g. TRAP
  • open-reading frame may be codon-optimised for expression in mammalian (e.g. Homo sapiens) cells, since the bacterial gene sequence is likely to be non-optimal for expression in mammalian cells.
  • the sequence may also be optimised by removing potential unstable sequences and splicing sites.
  • HIS-tag C-terminally expressed on the TRAP protein appears to offer a benefit in terms of translation repression and may optionally be used.
  • This C-terminal HIS-tag may improve solubility or stability of the TRAP within eukaryotic cells, although an improved functional benefit cannot be excluded. Nevertheless, both HIS-tagged and untagged TRAP allowed robust repression of transgene expression.
  • Certain c/s-acting sequences within the RNA-binding protein (e.g. TRAP) transcription unit may also be optimised; for example, EF1 a promoter-driven constructs enable better repression with low inputs of TRAP plasmid compared to CMV promoter-driven constructs in the context of transient transfection.
  • RNA-binding protein e.g. TRAP
  • Robust expression of the RNA-binding protein within the TRIP system is desirable in order to maximise repression of transgene translation. It had been expected that the requirement to include high levels of the RNA-binding protein plasmid might adversely affect the transfection of the other vector production constructs in a transient vector production system. This is because the amount/ratio of the genome construct is typically optimised in the absence of the additional plasmids; a requirement to co-transfect large amounts of RNA-binding protein-encoding plasmid could adversely affect these optimal ratios, leading to reduced vector titres.
  • TRAP RNA-binding protein
  • TRAP-to-retroviral vector genome plasmid ratio of as low as 1-to-10 enabled near-maximum levels of transgene repression when using a transient transfection protocol.
  • vector expressing a non- problematic NOI was produced at near maximal titres when a TRAP-to-retroviral vector genome plasmid ratio of as high as 1-to-5 was employed. Therefore, the addition of the TRAP-expressing plasmid at these relatively low inputs during transient transfection of retroviral vector production constructs is not likely to adversely affect previously optimised ratios of such constructs.
  • the ratios of TRAP-expressing plasmid to DNA viral vector component plasmids such as AAV have also been optimised.
  • TRIP system can be used during transient transfection vector production protocols.
  • the TRIP system may also be used for stable production systems and is therefore broadly applicable to viral vector manufacture.
  • FIG. 1 A schematic displaying typical retroviral vector components.
  • Therapeutic retroviral vector systems currently used have been highly engineered from the wild-type virus genomes from which they were derived.
  • Gamma-retroviral vectors are typically produced using 3- or 4-component systems requiring vector genome, Gag/Pol and envelope expression constructs and, for HIV-based lentiviral vectors, the accessory gene Rev is also required.
  • EIAV-based lentiviral vectors do not require Rev if an open-reading frame (ORF) replaces RRE.
  • Vector genomes typically require a packaging signal ( ⁇ ), an NOI, (optionally) a post-transcriptional element (PRE), the 3'ppu and a self-inactivating (SIN) LTR.
  • the R-U5 regions are required for correct polyadenylation of both vector genome RNA and transgene mRNA, as well as the process of reverse transcription.
  • both 'external' and 'internal' promoters (Pro) encoded within the genome cassette are strong eukaryotic or virus promoters, as are those driving the other vector system components.
  • Figure 2 A schematic describing a vector genome plasmid mixing experiment to determine the magnitude of negative impact of an NOI transgene product on the ability of production cells to produce vectors.
  • vector particles are produced by cotransfection of cells with vector packaging components and two types of vector genome plasmids: one reporter gene vector genome plasmid and a vector encoding an NOI transgene to test the impact of the transgene product on vector productivity of the cell. Since expression of lacZ or GFP reporter proteins does not impact on vector titres, these are used as control vectors.
  • Introduction of the second vector genome plasmid encoding an NOI transgene that may negatively impact vector productivity of the cell will have a bystander effect on lacZ-vector production.
  • NOI transgene will occur mainly from the internal expression cassette, which is typically driven by a powerful, constitutive promoter. Due to the possible outcomes of packaging two copies of vector genome RNA molecules per virion and the fact that only one vector RNA becomes reverse transcribed and integrated into target cells, there will be a dilution effect of mixing-in the second genome with the lacZ-vector; this dilution effect becomes more apparent when proportionally more of the second genome plasmid is mixed with the lacZ-vector genome plasmid. Consequently, a 'dilution' control is required wherein the second vector genome plasmid is that of GFP; GFP is also known to have no negative impact on vector titres.
  • Vectors produced from the mixing experiment are typically titrated by a read-out for the lacZ-vector e.g. X-gal staining of vector-transduced cells.
  • Figure 3i Vector genome mixing during production demonstrates impact of transgene protein expression on vector titres.
  • a lacZ-encoding vector genome component was mixed at 1 : 1 or 1 :5 ratio with another vector genome during transient vector production, and the impact on vector titre was assayed by X-gal assay on target cells. GFP expression does not impact vector titres and so the level of titre reduction at the different ratios indicates the baseline effect of diluting-out lacZ genome. Therefore, the impact of other vector transgenes on lacZ titres can be measured against the lacZ:GFP mixes
  • FIG. 3ii COX-2 and/or FPR genomes and lacZ genome mixing during production demonstrates impact of transgene protein expression on vector titres.
  • a lacZ- encoding vector genome component is mixed at 1 : 1 or 1 :5 ratio with GFP or a therapeutic vector genome during transient transfection vector production, and the impact on lacZ vector titre is assayed by X-gal assay on target cells.
  • GFP expression does not impact vector titres and so the lacZ titre indicates the baseline effect of diluting-out lacZ genome. Therefore, the impact of other vector transgenes on lacZ titres can be measured against the lacZ/GFP mixes at the 1 : 1 and 1 :5 ratios.
  • the therapeutic vectors tested were either single transgene vectors or bicistronic vectors harbouring an IRES element; the impact of COX-2 and FPR on lacZ titres may be additive.
  • FIG 4. An example of the TRIP system in repression of transgene expression in retroviral vector production cells.
  • a retroviral vector production cell expressing TRAP or codon-optimised TRAP (coTRAP) where the tbs is inserted in the 5'UTR of the transgene of the vector genome expression cassette.
  • TRAP binds to the tbs and blocks transgene protein translation.
  • Vector RNA molecules are also capable of binding TRAP but surprisingly this does not impede the single-round life cycle of the vector virion i.e. reverse transcription and integration steps are performed normally by the vector particle.
  • Figure 5. The limitations of using solely either number of GFP-positive cells or MFI in flow cytometry analysis of GFP-plasmid transfected cell populations.
  • FIG. 6 Fluorescent reporter gene constructs for evaluation of the TRAP/tbs configuration.
  • pCMV-tbsGFP was initially made from pONY8.4RC-GFP for simple evaluation. Subsequent to this, the non-SIN EIAV vector genome pONY8.4RC-tbsGFP was made to evaluate the effect of the TRAP/tbs configuration on vector activity.
  • Figure 7. TRAP-expression plasmids used in transient transfection evaluation studies and to make stable HEK293T-TRAP[H6] cell lines.
  • pEF1 a-coTRAP-iBsr was fully re- derived by synthesis and expresses a multicistronic mRNA encoding TRAP[H6] and a Blasticidin-resistance marker; the EMCV IRES was used to drive Bsr translation.
  • Figure 8. Select photographs from first transient transfection evaluation study of TRAP-mediated repression of transgene expression in HEK293T cells. Photographic evidence showing the ability of pCI-coTRAP[H6] to repress expression specifically from tbs- containing 5'UTR of pCMV-tbsGFP.
  • FIG. 9 Summary of flow cytometry data from first transient transfection evaluation study of TRAP-mediated repression of transgene expression in HEK293T cells.
  • A Histogram of % positive GFP population and median fluorescence intensity (ArbU) plotted on separate axes. Neither TRAP nor TRAP[H6] had any impact on GFP expression from pCMV-GFP.
  • TRAP[H6] significantly reduced GFP expression from pCMV-tbsGFP at a ratio of 1 : 1 , and in a dose-dependent manner. TRAP appeared less capable of repressing expression from pCMV-tbsGFP.
  • B Summary of flow cytometry data from first transient transfection evaluation study of TRAP-mediated repression of transgene expression in HEK293T cells.
  • GFP Median fluorescence intensityl of cotransfected HEK293T cells with GFP-reporter plasmids and EF1a promoter or CMV promoter driven TRAP[H6] plasmids relative to no TRAP-expression plasmid (stuffer). Near maximal GFP repression from pCMV-tbsGFP was possible using pEF1 a-coTRAP[H6] at a 1 :0.1 molar ratio of GFP RAP plasmid, which was not possible with pCI-coTRAP[H6].
  • Figure 10 A functional comparison of HIS 6 -tagged TRAP and untagged TRAP.
  • HIS 6 -tagged or untagged TRAP-expression or stuffer plasmid was co- transfected with either of the GFP reporter plasmids at the indicated ratios (brackets) in triplicate. Transfected cells were analysed by flow cytometry.
  • TRAP ORFs from Desulfotomaculum hydrothermale and Aminomonas paucivorans were codon/sequence optimised and cloned into the pEF1a-plasmid backbone.
  • TRAP-expression or stuffer plasmid was co-transfected with either of the GFP reporter plasmids at the indicated ratios (brackets) in triplicate. Transfected cells were analysed by flow cytometry. Average Expression Scores were generated for each transfection condition.
  • HEK293T-TRAP[H6] cell lines were compared for their ability to repress transgene expression from pCMV-tbsGFP by transient transfection in triplicate.
  • pCMV-GFP or pCMV- tbsGFP were cotransfected with either stuffer plasmid or pEF1 a-coTRAP[H6].
  • Cells were analysed by flow cytometry and average Expression Scores generated for each condition. Average fold-repression was generated by dividing the Expression Scores of pCMV- GFP/stuffer by the Expression Scores of the other conditions.
  • Figure 12 Summary of flow cytometry data from the evaluation of the TRAP-tbs system in retroviral vector production.
  • TRAP[H6] expression plasmid was co-transfected into HEK293T cells with either the single GFP reporter plasmids or the non-SIN EIAV vector genome plasmids (see Figure 6) at the indicated ratios.
  • Vector production was achieved by additional co- transfection of Gag/Pol and VSVG expression plasmids with the non-SIN EIAV vector genome plasmids. GFP repression during the production of vector was very similar to the single GFP reporter context and was dependent on the presence of both TRAP and the tbs sequence.
  • A A schematic showing the spacing variants tested within the pONY8.4RC-tbsGFP-based vector genome.
  • the 'Null' variant had the AUG changed to a stop codon to control for any GFP expression that might be derived from the full length vector genome RNA i.e. driven from the 'external' CMV promoter (see Figure 6).
  • the 5'Stem-loop (SL) sequence was derived from the trp operon leader sequence in Bacillus subtilis. Underlined nucleotides denote the kozak sequence.
  • spacer variant vector reporter plasmids were cotransfected into HEK293T cells with either stuffer plasmid or pEF1a-coTRAP[H6] at the indicated molar ratio (brackets) in triplicate. Cells were analysed by flow cytometry.
  • Figure 14i Defining the minimal number of RAGNN repeats in the TRAP-binding sequence necessary for the TRAP/tbs configuration to function.
  • the initial tbs sequence evaluated in the study was sequence optimized between the 10 th and 11 th RAGNN repeat altering a TG spacer to AA. Therefore variants tbsx1 1 M and tbsxIOM were designed such that a potential cryptic SD site is removed.
  • the RAGNN repeats were serially deleted from the 3' end of the tbsx1 1 M variant (11 to 4 repeats only), whilst maintaining the good translation context of the GFP reporter.
  • the repeat-variant tbs-GFP reporter plasmids were cotransfected into HEK293T cells with either stuffer plasmid or pEF1a-coTRAP[H6] at a ratio of 10: 1 GFP:TRAP plasmid in triplicate. Cells were analysed by flow cytometry.
  • Figure 14N Assessment of the functionality of tbs sequences with one or more RAGNNN repeats in a background of an 11 RAGNN repeat tbs.
  • N 2 x11 The tbsx11 M tbs sequence, referred to as N 2 x11 in this experiment, was used as the basis for modification with progressively more RAGNNN repeats replacing RAGNN repeats from the centre of the tbs.
  • the variants progressively contained 1 , 3, 5, 7 or 10 RAGNNN repeats (the 3' terminal ct nucleotides do not count as spacers so N 3 x1 1 contains 10 NNN spacing nucleotides).
  • These tbs variants were cloned into the therapeutic vector genome plasmid pONYK-tbsCOX2 (see Figure 1 Si), replacing the existing tbs.
  • tbs variant-containing vector genome plasmids were used to make vector by cotransfection with EIAV vector packaging components and with either stuffer plasmid or pEF1a-coTRAP[H6] at a ratio of 5: 1 vector genome:TRAP plasmid.
  • Immunoblotting to COX- 2 was carried out on cell lysates from end-of-production cells.
  • FIG 14iii Assessment of the functionality of tbs sequences with one or more RAGNNN repeats in a background of an 11 RAGNN repeat tbs: COX2 protein levels in vector production cells at 8 hours post-transfection. Previously, COX2 levels in end-of- production cells (-48 hours post-transfection) were analysed (see Figure 14NB). In order to test if TRAP-tbs mediated repression differed temporally during vector production, production cells were analysed 8 hours post-transfection for COX2 levels by immunoblot.
  • Figure 14iv Assessment of the functionality of tbs sequences with one or more RAGNNN repeats in a background of an 11 RAGNN repeat tbs: vector titres.
  • Figure 14v Assessment of the functionality of tbs sequences with one or more RAGNNN repeats in a background of x7 and x8 RAGNN repeat tbs.
  • tbs variant-containing vector genome plasmids were used to make vector by co-transfection with EIAV vector packaging components and with either stuffer plasmid or pEF1a-coTRAP[H6] at a ratio of 5: 1 vector genome:TRAP plasmid.
  • Immunoblotting to COX- 2 was carried out on cell lysates at early times during vector production (i.e. ⁇ 8 hours post- transfection). The data show that an RAGNNN repeat can be "tolerated" within an x8 repeat tbs comprising 7xRAGNN.
  • FIG. 1 Construction of IRES-tbs GFP reporter plasmids to test IRES-dependent TRAP/tbs regulation of gene expression.
  • the IRES-tbs GFP reporter constructs were made so that expression from the distal cistron (GFP) would report the degree of repression by TRAP.
  • the distance between the IRES element and the tbs in pCMV-Vi-tbsx11 G was 44nt (encoding spacing nucleotides), whereas this distance was reduced to 4nt in pCMV-Vi-tbsx4G.
  • pCMV-ViGFP was cloned as a 'no tbs' control.
  • the IRES-tbs GFP reporter plasmids were cotransfected into HEK293T cells with either stuffer plasmid or pEF1a-coTRAP[H6] at a ratio of 10: 1 GFP-reporter:TRAP plasmid in triplicate.
  • the single ORF GFP reporter plasmids were included in parallel as a control for TRAP-mediated repression. Cells were analysed by flow cytometry. Average expression scores for each condition were calculated and used as a measure of global GFP expression within the transfected populations.
  • TRAP was capable of repressing GFP expression directed from an IRES at a similar magnitude to 5'CAP-mediated expression.
  • FIG. 16 Production of EIAV SIN-vector containing the WPRE using the TRIP system.
  • the vector genome plasmid pONY8.9RC-tbsGFP(+WPRE) was tested for any impact of the WPRE on the TRAP/tbs configuration.
  • Cells were analysed by flow cytometry.
  • Expression scores were generated for cell populations co-transfected with vector genomes pONY8.4RC-tbsGFP or pONY8.9RC-tbsGFP(+WPRE) together with pEF1 a-coTRAP[H6] or stuffer plasmid. Scores are derived from multiplication of % GFP and median fluorescence intensity values to give a measure of GFP expression in the total population.
  • FIG 17i A schematic of therapeutic vector genomes based on ReQuinate ® modified to contain the tbs.
  • ReQuinate ® a vector for treatment of haemophilia A, encodes the human Factor VIII gene. It is known that Factor VIII impedes VSV-G incorporation into vector virion particle, dramatically reducing vector activity.
  • the tbs or scrambled tbs was cloned into the vector genome to generate ReQuinate-tbs and ReQuinate-con vectors respectively.
  • Figure 17N Improved ReQuinate ® titres using the TRIP system.
  • the ReQuinate ® -based vectors were produced under standard vector protocol using the TRIP system in HEK293T cells: vector genome plasmids were cotransfected with pEF1 a-coTRAP[H6] at a ratio of 5: 1 , along with EIAV vector packaging components. Vector supernatant was harvested and titrated by integration assay as well as concentrated ⁇ 70-fold by centrifugation, followed by PERT assay and then immunoblot to VSV-G and p26 (EIAV capsid).
  • ReQuinate ® -tbs vector titres were enhanced 30-fold over ReQuinate ® as judged by DNA integration assay, and this was dependent on the presence of TRAP during vector production.
  • the particle to infectivity ratios of vectors were also improved (data not shown).
  • FIG 18i A schematic of vector genomes encoding either COX2 or FPR.
  • the tbsxl 1 M variant was cloned into the single gene expression vectors. Note that the 5'UTR sequences +/- tbsx1 1 M are entirely different, in contrast to the control tbs-scrambled-containing 5'UTRs used in the ReQuinate ® study.
  • Figure 18M Improved single gene COX2 vector titres using the TRIP system.
  • the single gene COX-2 based vectors were produced using the TRIP system in HEK293T cells: vector genome plasmids were co-transfected with pEF1a-coTRAP[H6] at a ratio of 5: 1 , along with EIAV vector packaging components.
  • Vector supernatant was harvested and titrated by Integration assay using equal volumes of crude harvest supernatants, and end-of-production cell lysates probed by anti-COX-2 antibodies on an immunoblot. End-of-lntegration assay cells (i.e. those transduced with the COX-2 vector preps) were also analysed for COX-2 expression by immunoblot.
  • COX2 vector titres were enhanced 100-fold as judged by DNA integration assay, and this was dependent on the presence of TRAP and tbs during vector production.
  • Figure 18iii Improved single gene FPR vector titres using the TRIP system.
  • the single gene FPR-based vectors were produced using the TRIP system in HEK293T cells: vector genome plasmids were co-transfected with pEF1a-coTRAP[H6] at a ratio of 5: 1 , along with EIAV vector packaging components. Vector supernatant was harvested and titrated by integration assay using equal volumes of crude harvest supernatants. FPR vector titres were enhanced 24-fold as judged by DNA integration assay, and this was dependent on the presence of TRAP and tbs during vector production.
  • FIG 19i A schematic of vector genomes encoding both COX-2 or FPR ORFs.
  • the tbsx1 1 M variant was cloned into the multicistronic vector genome plasmids as indicated.
  • COX-2 and FPR were placed at either upstream or downstream positions and the tbsx1 1 M sequence inserted either at both positions or not any position.
  • FIG. 19N Improved multicistronic COX2/FPR vector titres using the TRIP system.
  • the multicistronic vectors in Figure 19i were produced using the TRIP system in HEK293T cells: vector genome plasmids were co-transfected with pEF1 a-coTRAP[H6] at a ratio of 5: 1 , along with EIAV vector packaging components. Vector supernatant was harvested and titrated by integration assay using equal volumes of crude harvest supernatants, and end-of- production cell lysates probed by anti-COX-2 antibodies on an immunoblot.
  • COX-2/FPR multicistronic vector titres were enhanced ⁇ 100-fold and FPR/COX-2 multicistronic vector titres were enhanced ⁇ 50-fold as judged by DNA integration assay, and this was dependent on the presence of TRAP and tbs during vector production.
  • Immunoblot of COX-2 within end-of-production cells indicates that vector titre correlated inversely with COX-2 levels, and the TRAP/tbs configuration was capable of transgene repression at multiple sites on the same mRNA transcript.
  • Figure 20i A schematic of OXB-102 vector genomes modified for use in the TRIP system. The tbsx11 M variant was cloned into the multicistronic vector genome plasmids as indicated. Only the upstream TH-CH1 fusion gene was modified to include the tbsx11 M sequence.
  • Figure 20N Repression of 'non-problematic' transgenes during vector production in the TRIP system.
  • the vectors in Figure 20i were produced using the TRIP system in HEK293T cells: vector genome plasmids were co-transfected with pEF1 a-coTRAP[H6] at a ratio of 5: 1 , along with EIAV vector packaging components. Vector supernatant was harvested and titrated by immunoflurescence assay using an anti-TH antibody (A), and end- of-production cell lysates probed by anti-TH and anti-CH1 antibodies on an immunoblot (B).
  • A anti-TH antibody
  • B end- of-production cell lysates probed by anti-TH and anti-CH1 antibodies on an immunoblot
  • His-tagged TRAP homologues were cloned into the pEF1a-expression plasmid, and co- transfected into HEK293T cells with either pCMV-tbsxl 1-GFP or pCMV-tbsx12-GFP reporter plasmids at a ratio of 1 :5 (pTRAP:pReporter).
  • pBluescript was used to generate "on" levels of GFP expression to compare the TRAP variants.
  • Cells were analysed by flow cytometry 2 days post-transfection, and GFP Expression scores generated in [A] (MFI x %GFP).
  • [B] displays these data as fold-repression, relative to the "No TRAP" controls for each tbs-GFP reporter.
  • Figure 21 Mi Summary of functionalities of different TRAP homologues in the novel repression system. A summary of fold-repression of the different homologues and S72N variant using x1 1- or x12-RAGNN repeat tbs-GFP reporter cassettes in HEK293T cells. The homologues represent a diverse amino sequence variance (56-78%) compared to B. Subtilis TRAP (100%; alignments include His-tag). (Additional information relating to Figure 1 1A).
  • FIG 22i The TRAP expression cassette used to isolate stable cell lines.
  • pEF1 a- coTRAP[H6] was modified such that an IRES-Bsr sequence was inserted between TRAP[H6] and the polyadenylation signal.
  • Bacterial sequences were removed from the DNA sequence during plasmid linearisation, and this cassette, encoding B.
  • Subtilis TRAP was stably transfected into low passage HEK293T cells. (Additional information relating to Figure 11 B).
  • FIG 22N Screening HEK293T.TRIP cell clones by transfection of GFP reporter plasmids.
  • A Duplicate plates of subclone cells were transfected in triplicate with either pCMV-GFP or pCMV-tbsxl 1GFP, and FACS performed on cells 2 days later. Expression scores for each subclone were calculated (MFI x %GFP) and fold-repression calculated by dividing Expression scores for pCMV-GFP (i.e. no tbs) by the Expression scores for pCMV- tbsx1 1GFP for each subclone ("Fold-repression"-labelled bars, right-hand axis). (Additional information relating to Figure 1 1 B).
  • Cells were transfected with EIAV-vector packaging components pGagPol, pVSVG, together with vector genome plasmids EIAV-[tbs]GFP and EIAV-[tbs]huFVIII at a 50:50 ratio.
  • EIAV-[tbs]huFVIII is the same as ReQuinate-tbs; see Figure 17i).
  • Genomes were either standard or contained the tbs upstream of the transgene.
  • pEF1 a- coTRAP[H6] (+TRAP TXN) or pBluescript (-) were also added where indicated.
  • Production cells were either HEK293T cells or stable TRAP cell lines 2F, 10H, 7E and 3D.
  • GFP expression scores were calculated (MFI x %GFP) on end-of-production cells.
  • Figure 22iv Improved incorporation of VSVG into mixed EIAV-[tbs]GFP
  • EIAV-[tbs]huFVIII vector genome mixing experiment were concentrated by centrifugation and analysed by immunoblot using an anti-VSVG antibody. Equal volumes of concentrated preps were loaded per well.
  • Figure 22v Improved production of a therapeutic transgene-encoding lentiviral vector using a HEK293T.TRIP stable cell line.
  • subtilis TRAP[H6] was used to produce EIAV-tbsCOX2 at Cell FactoryTM scale, alongside standard (no TRAP) and transiently transfected TRAP in HEK293T cells.
  • Vectors were titrated by DNA integration assay and TU/mL compared to EIAV-GFP vector titres (set as 100%).
  • HEK293T.TRIP[3D] cells enable further recovery of vector titre compared to transiently transfected TRAP in HEK293T cells.
  • Figure 23i Testing the importance of nucleotide choice at the "R" and "NN" position of the RAGNN repeat in tbs sequences of varying length.
  • FIG. 23N Testing G
  • HxGAGTT highly repressive tbs
  • TAGTT repeats were progressively swapped into this x11 tbs sequence.
  • Increasing TAGTT repeats modestly reduced repression function of the tbs.
  • RAGNN This revealed that the important features of the RAGNN are a pyrimidine at the first N spacer (position 4) and G>T at the R position. (GAGAT was not tested because tandem repeats of this RAGNN sequence results in multiple ATG codons upstream of the transgene ORF, which would likely attenuate expression of the transgene).
  • FIG. 24i Varying the position and copy-number of the tbs within the 5'UTR of a GFP transgene to test repression activity by TRAP.
  • the tbsx1 1 M sequence was cloned into pCMV-GFP at different positions relative to the CAP site: Ont [1], 34nt [2], 54nt [3] 74nt [4] or 114nt [5]; additional sequences added onto the 34nt leader comprising construct [2] (effectively the standard tbsx1 1 M reporter) were derived from the CMVp 5'UTR.
  • the sequence between the tbs and the AUG was also increased to 43nt in construct [6].
  • FIG. 24N Testing variable positioning of the tbs within the 5'UTR of a GFP transgene on the effect of repression activity by TRAP.
  • the seven tbs variant GFP reporter constructs in Figure 24i were tested for their ability to be repressed by TRAP under three conditions: no TRAP (HEK293T), transiently co-transfected TRAP (HEK293T + TRAP) and under maximum TRAP repressive conditions (HEK293T.TRIP[Endogenous TRAP] + co- transfected TRAP). Cultures were analysed by flow cytometry to measure GFP expression 2 days post-transfection, and GFP Expression scores (MFI x %GFP) generated.
  • Figure 25i Application of the TRIP system to HIV-based GFP vector production. [A]
  • the tbs (x1 1 M variant) was inserted into an HIV-1-based lentiviral vector backbone encoding GFP and used to make crude vector preparations in HEK293T cells +/- pEF1 a-coTRAP[H6].
  • End-of-production cells were analysed by FACS to generate the GFP expression score (MFI x %GFP; "Expression score”-labelled bars).
  • Crude vector supernatants were titrated by DNA integration assay on HEK293T cells ("Titre"-labelled bars).
  • GFP expression was repressed by >100-fold vector in production cells shedding HIV-tbsGFP vector in the presence of TRAP but vector titres were not affected (as GFP protein is not detrimental to vector production).
  • FIG. 25N Application of TRIP system to HIV-based therapeutic vector production.
  • tbs (x11 M variant) was inserted into an HIV-1-based lentiviral vector backbone encoding 5T4-CAR and used to make crude vector preparations in HEK293T cells +/- pEF1 a-coTRAP[H6].
  • Crude vector supernatants were titrated by FACS (HIV-GFP; left- hand 2 bars) or DNA integration assay on HEK293T cells (HIV-5T4.CAR; right-hand 2 bars).
  • the TRIP system enabled a 10-fold improvement of HIV-5T4.CAR vector titres compared to production without TRAP co-expression.
  • FIG. 26 Analysis of transgene mRNA levels within HEK293T cells transfected with standard or TRAP-tbs configuration components.
  • HEK293T cells were transfected with either pCMV-GFP or pCMV-tbsGFP +/- pEF1a-coTRAP[H6] and cells analysed 48 hours later for GFP protein ([A]; FACS) and GFP mRNA levels in the cytoplasm ([B]; qRT-PCR of extracted, DNAse-treated cytoplasmic RNA using a GFP-specific primer/FAM-probe set).
  • Ct reflects the PCR cycle at which signal was first detected; the lower the Ct the more abundant the target. Abundance therefore increases by ⁇ 1.5-fold for every cycle and 40 is undetectable signal.
  • the -RT condition denotes minimal plasmid DNA contamination.
  • FIG. 27i HIV-1 based vectors encoding a TRAP-tbs regulated, bi-cistronic transgene cassette driven by constitutive or tissue-specific promoters.
  • Four constructs were generated wherein the bi-cistronic transgene cassette, encoding Firefly luciferase (1 position) and GFP (2 nd position), is transcribed by the constitutive CMV promoter and differentially regulated at the translation level by TRAP-tbs.
  • tbs sequences were inserted upstream of both transgene ORFs, or the 1 st or the 2 nd transgenes only, or without any tbs sequences.
  • tissue specific promoters were utilised; either the VMD2 promoter that is restricted to photo-receptor cells or the mAlbAT promoter that is liver-specific.
  • a control construct was made in which no internal promoter was present, so that any low-level expression from the full length vector RNA transcript could be measured.
  • Figure 27N Evaluation of transgene expression from HIV-1 based vectors encoding a TRAP-tbs regulated, bi-cistronic transgene cassette driven by constitutive or tissue- specific promoters in HEK293T production cells.
  • HEK293T cells were co-transfected with HIV-1 bi-cistronic vector genome (Figure 27i), pGagPol, pRev and pVSVG, and with either pEF1a-coTRAP[H6] (+TRAP) or pBluescript (Control); the genome-to-TRAP plasmid ratio was 5-to-1.
  • pGL3-control Renilla luciferase expression plasmid
  • One 96-well plate was used for end-of-production cell analysis by flow cytometry 2 days post-transfection, to generate GFP Expression scores (MFI x %GFP).
  • the second plate was used to generate cell lysates 2 day post-transfection for dual luciferase assay (Promega).
  • FIG. 27iii A schematic summarising the repression capabilities of the TRIP system when applied to production of retroviral (lentiviral) vectors encoding multi-cistronic transgenes.
  • retroviral lentiviral
  • ORFs open-reading frames
  • IRES internal ribosomal entry site
  • the vector genome expression cassette is driven by a strong promoter [Ext Pro] to generate abundant quantities of vector genome RNA.
  • the internal promoter [Int Pro] may be a strong/constitutive promoter, leading to abundant levels of transgene encoding/expressing mRNA , or a tissue-specific promoter that may or may not be leaky, leading to minimal/no transgene encoding/expressing mRNA levels.
  • the TRAP- binding sequence [tbs] can be inserted upstream of one or both ORF positions; thus expression of TRAP within the production cell will repress protein production from either abundant or low levels of transgene mRNA.
  • the vector genome RNA may express transgene protein in a Cap-dependent manner (typically low levels) or in a Cap- independent manner (from an IRES; typically at moderate to high levels).
  • transgene expression may be possible during vector production, and therefore the TRIP system is better able to repress this expression compared to use of tissue-specific promoters.
  • vector packaging and TRAP expression cassettes are not displayed in the schematic but are assumed to be present within the TRIP system vector production cell in this example).
  • FIG 28i Development of the TRIPAAV system. Application of the TRAP-tbs configuration to production of AAV-based vectors.
  • a standard AAV vector system utilises three DNA components for production of vectors in Adenovirus E1 -expressing cells (e.g. HEK293-based cells): genome (optionally deleted in one trs [Atrs] to generate a self- complementary [sc] AAV vector genome), RepCap and Helper functions (in this non-limiting example, Helper functions are provided by Adenovirus E2A, E4orf6 and VA).
  • the TRIPAAV system utilises the TRAP-tbs configuration: the AAV vector genome is modified such that the tbs is inserted into the 5'UTR of the transgene cassette, and during vector production a TRAP expression cassette is co-introduced, either by co-transfection of TRAP-expressing plasmid and/or by use of a cell line stably expressing TRAP; TRAP may be optionally His 6 - tagged. ITR - inverted terminal repeat; Pro - eukaryotic promoter element; tbs - TRAP- binding sequence; pA - polyadenylation signal; [ITN] - optional intron. Schematic not to scale.
  • Figure 28M Repression of scAAV vector transgene expression in HEK293T cells using the TRIPAAV system. Plasmids encoding serotype 2 scAAV-GFP vector genomes (+/- the tbs) were co-transfected into HEK293T cells along with various components to measure their impact on TRAP-tbs mediated transgene repression.
  • pEF1 a-coTRAP[H6] or pBlueScript (-) were 2
  • the pCMV-tbsGFP control plasmid (lacking flanking AAV2 ITRs) was subjected to the same conditions to compare repression levels.
  • GFP expression from the pscAAV2-[tbs]GFP plasmids was greater than pCMV-tbsGFP, possibly due to a more stable mRNA transcript (3'UTR sequences and polyA signal differed between constructs).
  • TRAP was able to repress GFP expression from pscAAV2-tbsGFP by over 300-fold in the presence of pRepCap2 and pHelper i.e. during scAAV vector production.
  • FIG. 28iii Comparison of scAAV-[tbs]GFP vector production using the standard and TRIPAAV systems.
  • scAAV-(CMV)-GFP or scAAV-(CMV)-tbsGFP vectors were produced by transient co-transfection of equal masses of genome, pRepCap2, pHelper and pEF1 a- coTRAP[H6] or pBluescript in HEK293T cells. Approximately 53 hour post-transfection, cells were harvested and subjected to freeze-thaw cycles to release AAV virions. AAV virions were purified using a VirabindTM kit, resulting in 100 ⁇ _ PBS containing vector from each 10 cm plate.
  • Vector preps were titrated on HEK293T cells ("HEK293T”-labelled bars) or HEPG2 cells ("HEPG2"-labelled bars) by flow cytometry.
  • the GFP expression scores for the respective vector production cells are co-plotted ("GFP Expr scr"-labelled bars).
  • the data shows that whilst GFP expression in AAV vector production cells is repressed by >300-fold, and the TRAP-tbs configuration of the TRIPAAV system does not impact on the basic biology of AAV vector production, implying that problematic/cytotoxic transgenes can be shut-down during AAV vector production.
  • the vector genome scAAV2-CMV-tbsBarnase encodes the bacteria RNAse Barnase, whose ORF is codon-optimised for expression in human cells.
  • the tbs was inserted into the 5' UTR of the transgene cassette.
  • a bacterial expression cassette for Barstar (Barnase's natural inihibitor) is present in the plasmid backbone in order to aid plasmid propagation in bacteria, due to leaky expression of the CMV promoter in E. coli.
  • the Barstar ORF is codon-optimised for expression in E. coli.
  • the pscAAV-CMV-GFP plasmid was used in genome mixing transfections to monitor the effect on Barnase on GFP expression.
  • Genome mixing was performed by transfection of HEK293T or HEK293T.TRiP[3D] cells with a 50:50 mix of pscAAV-CMV-tbsBarnase and pscAAV-CMV- GFP vector genome plasmids, plus pRepCap2 and pHelper. Genome plasmids were each present at 1 ⁇ / ⁇ ⁇ cm plate [i], or just pscAAV-CMV-GFP was present at 2 ⁇ / ⁇ cm plate [ii], with no additional TRAP-expression plasmid. Pictures were taken of GFP-expression in these cultures at 24 hours post-transfection.
  • Figure 29i Development of the TRIPAdeno system. Application of the TRAP-tbs configuration to production of Adenovirus-based vectors. Standard Adenoviral vectors are categorised into 1 st generation (deleted in E1/E3 regions), 2 nd generation (deleted in E1/E2/E3/E4), and Helper-dependent, "gutted" vectors.
  • E1-active oncolytic vectors may contain toxic transgenes encoded within the E3 region; for example, expression of the toxic gene may be governed by the adenovirus major late promoter or a heterologous promoter and adenovirus-encoded or a heterologous polyadenylation signal.
  • TRIPAdeno system versions of these types of vector genomes harbor the tbs within the 5'UTR of the transgene encoding transcript.
  • a TRAP expression cassette is co- introduced, either by co-transfection of TRAP-expressing plasmid and/or by use of a cell line stably expressing TRAP; TRAP may be optionally His 6 -tagged.
  • FIG. 29N Repression of GFP transgene from first generation Adenoviral vector genome components in HEK293T cells using the TRAP-tbs configuration.
  • HEK293T cells were transfected with pAd-CMV-GFP or pAd-CMV-tbsGFP shuttle plasmids (containing the left-hand side of the Adenoviral vector genome) together with pEF1 a-coTRAP[H6] (+TRAP) or pBluescript (-) [A], and flow cytometry performed 48 hours later [B].
  • parallel transfections included the RAPAd ® -backbone (pacAd5 9.2-100; containing the right hand side of the Adenoviral vector genome), simulating first generation Adenoviral vector production using the RAPAd ® kit (wherein recombination of the vector genome occurs in HEK293T cells).
  • GFP expression scores (MFI x % GFP) were generated under each condition. Over 100-fold repression of GFP was observed only when the tbs was present within the shuttle plasmid and when TRAP was expressed.
  • FIG. 29iii Repression of GFP transgene during Adeno-tbsGFP (E1/E3-deleted) vector amplification in HEK293T.TRIP cells.
  • Stocks of Adeno-CMV-GFP and Adeno- CMV-tbsGFP vector generated by co-transfection of pAd-CMV-GFP or pAd-CMV-tbsGFP shuttles with the pRAPAd -backbone and pEF1 a-coTRAP[H6] were used to transduce either HEK293T cells or HEK293T.TRIP[3D] cells (stably expressing TRAP[H6]) at an MOI of 0.01.
  • the present invention provides a nucleic acid sequence comprising a binding site operably linked to a nucleotide of interest, wherein the binding site is capable of interacting with an RNA-binding protein such that translation of the nucleotide of interest is repressed or prevented in a viral vector production cell.
  • RNA-binding protein is to be understood as a protein that is capable of binding to a nucleic acid sequence. In the context of the present invention, binding of the RNA-binding protein to its binding site sequence has the effect of repressing or preventing the translation of a nucleotide of interest to which the binding site is operably linked in a viral vector production cell.
  • the RNA-binding protein is tryptophan RNA-binding attenuation protein (TRAP), for example bacterial tryptophan RNA-binding attenuation protein.
  • TRIP tryptophan RNA-binding attenuation protein
  • the RNA-binding protein is a bacterial conserved carbon storage regulation system protein A (CsrA).
  • RNA-binding protein is a Herpes simplex virus-1 RNA-binding protein US1 1.
  • Tryptophan RNA-binding attenuation protein is a bacterial protein that has been extensively characterised in Bacillus subtilis. It regulates tryptophan biosynthesis directed from the trpEDCFBA operon by participating in either transcription attenuation or translational control mechanisms (reviewed in Gollnick, B., Antson, and Yanofsky (2005) Annual Review of Genetics 39: 47-68). In its natural context TRAP regulates tryptophan biosynthesis and transport by three distinct mechanisms:
  • Bacillus subtilis TRAP is encoded by a single gene (mtrB) and the functional protein is composed of 1 1 identical subunits arranged as a toroid ring (Antson AA, D. E., Dodson G, Greaves RB, Chen X, Gollnick P. (1999) Nature 401 (6750): 235-242). It is activated to interact with RNA by binding up to 1 1 molecules of tryptophan in pockets between neighbouring subunits. The target RNA is wound around the outside of this quaternary ring structure (Babitzke P, S. J., Shire SJ, Yanofsky C. (1994) Journal of Biological Chemistry 269: 16597-16604).
  • TRAP in the natural mechanism of sensing and controlling tryptophan synthesis, TRAP is understood to act at the level of transcription termination by binding to a binding site in the newly synthesised RNA leader. This destabilises an overlapping anti-terminator sequence such that a downstream rho-independent terminator is active, leading to the production of only short RNAs.
  • the TRAP ring can no longer bind to its RNA binding site. Accordingly, the anti- terminator is activated and transcription continues into the tryptophan synthesis gene operon.
  • TRAP can also act at the translational level: tryptophan-dependent binding of TRAP to its binding site in the 5'-UTR of the RNA transcript liberates an anti-Shine-Dalgarno sequence, this forms a stable stem with the Shine-Dalgarno sequence so that ribosome initiation of translation is repressed.
  • TRAP when bound to its nucleic acid binding site it is capable of repressing translation initiation by physically blocking the 40S scanning ribosome complex before it can reach the initiation codon, whereupon the more stable and higher-affinity translation machinery would otherwise form.
  • TRAP is derived from Bacillus subtilis.
  • TRAP may comprise the sequence:
  • SEQ ID NO: 1 is C-terminally tagged with six histidine amino acids (HISx6 tag).
  • TRAP is derived from Aminomonas paucivorans.
  • TRAP may comprise the sequence: MKEGEEAKTSVLSDYVWKALENGVTVIGLTRGQETKFAHTEKLDDGEVWIAQFTE HTSAIKVRGASEIHTKHGMLFSGRNEKG (SEQ ID NO: 2)
  • TRAP is derived from Desulfotomaculum hydrothermale.
  • TRAP may comprise the sequence: MNPMTDRSDITGDYVVVKALENGVTIIGLTRGGVTKFHHTEKLDKGEIMIAQFTEHTS Al Kl RGRAELLTKHGKI RTEVDS (SEQ ID NO: 3)
  • TRAP is derived from B. stearothermophilus.
  • TRAP may comprise the sequence: MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGK AYIQTRHGVIESEGKK (SEQ ID NO: 4)
  • TRAP is derived from B. stearothermophilus S72N.
  • TRAP may comprise the sequence:
  • TRAP is derived from B. halodurans.
  • TRAP may comprise the sequence:
  • TRAP is derived from Carboxydothermus hydrogenoformans.
  • TRAP may comprise the sequence:
  • TRAP is encoded by the tryptophan RNA-binding attenuation protein gene family mtrB (TrpBP superfamily e.g. with NCBI conserved domain database # CI03437).
  • the TRAP is C-terminally tagged with six histidine amino acids (HISx6 tag).
  • TRAP comprises an amino acid sequence that has 50%, 60%, 70%, 80%, 90%, 95%, 99% or 100% identity to any of SEQ ID NOs: 1 to 7 and is capable of interacting with an RNA-binding site such that expression of an operably linked NOI is modified, for example repressed or prevented, in a viral vector production cell.
  • TRAP comprises an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% or 100% identity to any of SEQ ID NOs: 1 to 7 and is capable of interacting with an RNA-binding site such that expression of an operably linked NOI is modified, for example repressed or prevented, in a viral vector production cell.
  • RNA-binding protein e.g. TRAP
  • TRAP may be encoded by a polynucleotide comprising a nucleotide sequence which encodes a protein which is capable of interacting with an RNA-binding site such that expression of an operably linked NOI is modified, for example repressed or prevented, in a viral vector production cell.
  • TRAP may be encoded by a polynucleotide comprising a nucleotide sequence which encodes a protein of SEQ ID NOs: 1 to 7.
  • RNA-binding proteins such as TRAP for use in the invention will retain the ability to bind to the binding site of the invention such that translation of the NOI (which may be a marker gene) is repressed or prevented in a viral vector production cell.
  • NOI which may be a marker gene
  • binding site is to be understood as a nucleic acid sequence that is capable of interacting with a certain protein.
  • the nucleic acid binding site of the present invention may be one that is capable of interacting with the RNA-binding protein of the invention, for example the tryptophan RNA-binding attenuation protein (TRAP).
  • TRIP tryptophan RNA-binding attenuation protein
  • TRAP a consensus nucleic acid binding site sequence that is capable of binding TRAP is [RAGNN] repeated multiple times (e.g. 6, 7, 8, 9, 10, 1 1 , 12 or more times); such sequence is found in the native trp operon. In the native context, occasionally AAGNN is tolerated and occasionally additional "spacing" N nucleotides result in a functional sequence. In vitro experiments have demonstrated that at least 6 or more consensus repeats are required for TRAP-RNA binding (Babitzke P, Y. J., Campanelli D. (1996) Journal of Bacteriology 178(17): 5159-5163).
  • the TRAP binding site comprises the sequence RAGN>2 (e.g. RAGN2-3).
  • this nucleic acid binding site comprises, for example, any of the sequences UAGNN, GAGNN, TAGNN, UAGNNN, GAGNNN, or TAGNNN.
  • N is to be understood as specifying any nucleotide at that position in the sequence. For example, this could be G, A, T, C or U.
  • the number of such nucleotides is preferably 2 but up to three, for example 1 , 2 or 3, RAG repeats of an 11x repeat tbs may be separated by 3 spacing nucleotides and still retain some TRAP-binding activity that leads to translation repression.
  • Preferably not more than one N 3 spacer will be used in an 1 1x repeat tbs in order to retain maximal TRAP-binding activity that leads to translation repression.
  • the nucleic acid binding site comprises multiple repeats of RAGN> 2 (e.g. multiple repeats of RAGN2-3) .
  • the nucleic acid binding site comprises multiple repeats of the sequence RAGN 2 . In another embodiment, the nucleic acid binding site comprises at least 6 repeats of RAGN> 2 (e.g. at least 6 repeats of RAGN2-3) .
  • the nucleic acid binding site comprises at least 6 repeats of RAGN 2 .
  • the nucleic acid binding site may comprise 6, 7, 8, 9, 10, 11 , 12 or more repeats of RAGN 2 .
  • the nucleic acid binding site comprises at least 8 repeats of RAGN> 2 (e.g. at least 8 repeats of RAGN 2 . 3 ).
  • the number of RAGNNN repeats present in the nucleic acid binding site is 1 or less.
  • the nucleic acid binding site comprises 1 1 repeats of RAGN> 2 (e.g. 11 repeats of RAGN 2 . 3 ).
  • the number of RAGNNN repeats present in this nucleic acid binding site is 3 or less.
  • the nucleic acid binding site comprises 12 repeats of RAGN> 2 12 repeats of RAGN 2 . 3 ). In a preferred embodiment, the nucleic acid binding site comprises 8-11 repeats of RAGN 2 (e.g. 8, 9, 10 or 11 repeats of RAGN 2 ).
  • the TRAP binding site may comprise either of the following sequences:
  • RAGN> 2 By “repeats of RAGN> 2 " it is to be understood that the general RAGN> 2 (e.g. RAGN 2 . 3 ) motif is repeated. Different RAGN> 2 sequences satisfying the criteria of this motif may be joined to make up the nucleic acid binding site. It is not intended that the resulting nucleic acid binding site is limited to repeats of only one sequence that satisfies the requirements of this motif, although this possibility is included in the definition. For example, “6 repeats of RAGN> 2 " includes, but is not limited to, the sequences:
  • an 8-repeat tbs containing one RAGNNN repeat and seven RAGNN repeats retains TRAP- mediated repression activity.
  • Less than 8-repeat tbs sequences (e.g. 7- or 6-repeat tbs sequences) containing one or more RAGNNN repeats may have lower TRAP-mediated repression activity. Accordingly, when fewer than 8-repeats are present, it is preferred that the tbs comprises only RAGNN repeats.
  • Preferred nucleotides for use in the RAGNN repeat consensus are:
  • G is used at the R position when the NN spacer positions are AA (i.e. it is preferred that TAGAA is not used as a repeat in the consensus sequence).
  • the nucleic acid binding site is capable of binding to a protein, for example TRAP, under the conditions that are encountered in a cell, for example a eukaryotic viral vector production cell.
  • a protein for example TRAP
  • TRAP RNA- binding protein
  • Such an interaction with an RNA- binding protein such as TRAP results in the repression or prevention of translation of a NOI to which the nucleic acid binding site is operably linked.
  • RNA-binding site of the invention operably linked to a NOI is positioned in such a way that translation of the NOI is modified when an RNA-binding protein such as TRAP binds to the RNA-binding site.
  • Placement of a nucleic acid binding site capable of interacting with an RNA-binding protein e.g. a TRAP-binding sequence; tbs
  • an RNA-binding protein e.g. a TRAP-binding sequence; tbs
  • ORF open reading frame
  • the number of nucleotides separating the TRAP-binding site and the translation initiation codon may be varied, for example from 0 to 12 nucleotides, without affecting the degree of repression.
  • 0 to 43 nucleotides may be used to separate the TRAP-binding site and the translation initiation codon.
  • Repression or prevention of the translation of the NOI is to be understood as alteration of the amount of the product (e.g. protein) of the NOI that is translated during viral vector production in comparison to the amount expressed in the absence of the nucleic acid binding site of the invention at the equivalent time point.
  • Such alteration of translation results in a consequential repression or prevention of the expression of the protein encoded by the NOI.
  • the nucleic acid binding site is capable of interacting with an RNA-binding protein, such as tryptophan RNA-binding attenuation protein (TRAP), such that translation of the nucleotide of interest is repressed or prevented in a viral vector production cell.
  • an RNA-binding protein such as tryptophan RNA-binding attenuation protein (TRAP)
  • TRIP tryptophan RNA-binding attenuation protein
  • the translation of the NOI at any given time during vector production may be reduced to 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5%, 4%, 3%, 2%, 1 %, 0.5% or 0.1 % of the amount translated in the absence of the nucleic acid sequence of the invention at the same time-point in vector production.
  • the translation of the NOI at any given time during vector production may be reduced to less than 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5%, 4%, 3%, 2%, 1 %, 0.5% or 0.1 % of the amount translated in the absence of the nucleic acid sequence of the invention at the same time-point in vector production.
  • Preventing the translation of the NOI is to be understood as reducing the amount of translation to substantially zero.
  • the expression of the protein from the NOI at any given time during vector production may be reduced to 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5%, 4%, 3%, 2%, 1 %, 0.5% or 0.1 % of the amount expressed in the absence of the nucleic acid sequence of the invention at the same time-point in vector production.
  • the expression of the protein from the NOI at any given time during vector production may be reduced to less than 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5%, 4%, 3%, 2%, 1 %, 0.5% or 0.1 % of the amount expressed in the absence of the nucleic acid sequence of the invention at the same time-point in vector production.
  • Preventing the expression of the protein from the NOI is to be understood as reducing the amount of the protein that is expressed to substantially zero.
  • a protein product from lysed cells may be analysed using methods such as SDS-PAGE analysis with visualisation by Coomassie or silver staining.
  • a protein product may be analysed using Western blotting or enzyme-linked immunosorbent assays (ELISA) with antibody probes which bind the protein product.
  • ELISA enzyme-linked immunosorbent assays
  • a protein product in intact cells may be analysed by immunofluorescence.
  • the nucleotide of interest is translated in a target cell which lacks the RNA-binding protein, for example tryptophan RNA-binding attenuation protein (TRAP).
  • RNA-binding protein for example tryptophan RNA-binding attenuation protein (TRAP).
  • TraP tryptophan RNA-binding attenuation protein
  • Target cell is to be understood as a cell in which it is desired to express the NOI.
  • the NOI may be introduced into the target cell using a viral vector of the present invention. Delivery to the target cell may be performed in vivo, ex vivo or in vitro.
  • the nucleotide of interest gives rise to a therapeutic effect.
  • the NOI may have a therapeutic or diagnostic application. Suitable NOIs include, but are not limited to sequences encoding enzymes, co-factors, cytokines, chemokines, hormones, antibodies, anti-oxidant molecules, engineered immunoglobulin-like molecules, single chain antibodies, fusion proteins, immune co-stimulatory molecules, immunomodulatory molecules, chimeric antigen receptors a transdomain negative mutant of a target protein, toxins, conditional toxins, antigens, tumour suppressor proteins, growth factors, membrane proteins, receptors, vasoactive proteins and peptides, anti-viral proteins and ribozymes, and derivatives thereof (such as derivatives with an associated reporter group).
  • the NOIs may also encode micro-RNA. Without wishing to be bound by theory it is believed that the processing of micro-RNA will be inhibited by TRAP.
  • the NOI may be useful in the treatment of a neurodegenerative disorder. In another embodiment, the NOI may be useful in the treatment of Parkinson's disease.
  • the NOI may encode an enzyme or enzymes involved in dopamine synthesis.
  • the enzyme may be one or more of the following: tyrosine hydroxylase, GTP-cyclohydrolase I and/or aromatic amino acid dopa decarboxylase.
  • the sequences of all three genes are available (GenBank® Accession Nos. X05290, U 19523 and M76180, respectively).
  • the NOI may encode the vesicular monoamine transporter 2 (VMAT2).
  • the viral genome may comprise a NOI encoding aromatic amino acid dopa decarboxylase and a NOI encoding VMAT2. Such a genome may be used in the treatment of Parkinson's disease, in particular in conjunction with peripheral administration of L-DOPA.
  • the NOI may encode a therapeutic protein or combination of therapeutic proteins.
  • the NOI may encode a protein or proteins selected from the group consisting of glial cell derived neurotophic factor (GDNF), brain derived neurotrophic factor (BDNF), ciliary neurotrophic factor (CNTF), neurotrophin-3 (NT-3), acidic fibroblast growth factor (aFGF), basic fibroblast growth factor (bFGF), interleukin-1 beta (I L-1 ⁇ ), tumor necrosis factor alpha (TNF-a), insulin growth factor-2, VEGF-A, VEGF-B, VEGF-C/VEGF-2, VEGF-D, VEGF-E, PDGF-A, PDGF-B, hetero- and homo-dimers of PDFG-A and PDFG-B.
  • GDNF glial cell derived neurotophic factor
  • BDNF brain derived neurotrophic factor
  • CNTF ciliary neurotrophic factor
  • NT-3 neurotrophin-3
  • aFGF acid
  • the NOI may encode an anti-angiogenic protein or anti-angiogenic proteins selected from the group consisting of angiostatin, endostatin, platelet factor 4, pigment epithelium derived factor (PEDF), restin, interferon-a, interferon-inducible protein, gro-beta and tubedown-1 , interleukin(IL)-1 , I L-12, retinoic acid, anti-VEGF antibodies or fragments /variants thereof, thrombospondin, VEGF receptor proteins such as those described in US 5,952, 199 and US 6, 100,071 , and anti-VEGF receptor antibodies.
  • angiostatin angiostatin
  • endostatin platelet factor 4
  • pigment epithelium derived factor (PEDF) pigment epithelium derived factor
  • restin interferon-a
  • interferon-inducible protein gro-beta and tubedown-1
  • interleukin(IL)-1 I L-12
  • retinoic acid interleukin(IL)
  • NOI may encode cystic fibrosis transmembrane conductance regulator (CFTR).
  • CFTR cystic fibrosis transmembrane conductance regulator
  • the NOI may encode a protein normally expressed in an ocular cell. In another embodiment, the NOI may encode a protein normally expressed in a photoreceptor cell and/or retinal pigment epithelium cell.
  • the NOI may encode a protein selected from the group comprising RPE65, arylhydrocarbon-interacting receptor protein like 1 (AIPL1), CRB1 , lecithin retinal acetyltransferace (LRAT), photoreceptor-specific homeo box (CRX), retinal guanylate cyclise (GUCY2D), RPGR interacting protein 1 (RPGRIP1), LCA2, LCA3, LCA5, dystrophin, PRPH2, CNTF, ABCR/ABCA4, EMP1 , TIMP3, MERTK, ELOVL4, MY07A, USH2A, VMD2, RLBP1 , COX-2, FPR, harmonin, Rab escort protein 1 , CNGB2, CNGA3, CEP 290, RPGR, RS1 , RP1.PRELP, glutathione pathway enzymes and opticin.
  • RPE65 arylhydrocarbon-interacting receptor protein like 1
  • CRB1 lecithin retinal acety
  • the NOI may encode human Factor VIII or Factor IX. In other embodiments the NOI may encode a chimeric antigen receptor (CAR) or a T cell receptor (TCR).
  • CAR chimeric antigen receptor
  • TCR T cell receptor
  • the NOI may encode SGSH, SUMF1 , GAA, the common gamma chain (CD132), adenosine deaminase, WAS protein, globins, alpha galactosidase A, ⁇ - aminolevulinate (ALA) synthase, ⁇ -aminolevulinate dehydratase (ALAD), Hydroxymethylbilane (HMB) synthase, Uroporphyrinogen (URO) synthase, Uroporphyrinogen (URO) decarboxylase, Coproporphyrinogen (COPRO) oxidase, Protoporphyrinogen (PROTO) oxidase, Ferrochelatase, a-L-iduronidase, Iduronate sulfatase, Heparan sulfamidase, N-acetylglucosaminidase, Heparan-a-glucosaminide N- acety
  • the vector may also comprise or encode a siRNA, shRNA, or regulated shRNA.
  • siRNA siRNA
  • shRNA regulated shRNA
  • the vectors including retroviral and AAV vectors, according to the present invention may be used to deliver one or more NOI(s) useful in the treatment of the disorders listed in WO 1998/05635, WO 1998/07859, WO 1998/09985.
  • the nucleotide of interest may be DNA or RNA. Examples of such diseases are given below: A disorder which responds to cytokine and cell proliferation/differentiation activity; immunosuppressant or immunostimulant activity (e.g. for treating immune deficiency, including infection with human immunodeficiency virus, regulation of lymphocyte growth; treating cancer and many autoimmune diseases, and to prevent transplant rejection or induce tumour immunity); regulation of haematopoiesis (e.g.
  • myeloid or lymphoid diseases promoting growth of bone, cartilage, tendon, ligament and nerve tissue (e.g. for healing wounds, treatment of burns, ulcers and periodontal disease and neurodegeneration); inhibition or activation of follicle-stimulating hormone (modulation of fertility); chemotactic/chemokinetic activity (e.g. for mobilising specific cell types to sites of injury or infection); haemostatic and thrombolytic activity (e.g. for treating haemophilia and stroke); anti-inflammatory activity (for treating, for example, septic shock or Crohn's disease); macrophage inhibitory and/or T cell inhibitory activity and thus, anti-inflammatory activity; anti- immune activity (i.e.
  • inhibitory effects against a cellular and/or humoral immune response including a response not associated with inflammation
  • inhibition of the ability of macrophages and T cells to adhere to extracellular matrix components and fibronectin, as well as up-regulated fas receptor expression in T cells are particularly useful in the treatment of cancer.
  • Malignancy disorders including cancer, leukaemia, benign and malignant tumour growth, invasion and spread, angiogenesis, metastases, ascites and malignant pleural effusion.
  • Autoimmune diseases including arthritis, including rheumatoid arthritis, hypersensitivity, allergic reactions, asthma, systemic lupus erythematosus, collagen diseases and other diseases.
  • Vascular diseases including arteriosclerosis, atherosclerotic heart disease, reperfusion injury, cardiac arrest, myocardial infarction, vascular inflammatory disorders, respiratory distress syndrome, cardiovascular effects, peripheral vascular disease, migraine and aspirin-dependent anti-thrombosis, stroke, cerebral ischaemia, ischaemic heart disease or other diseases.
  • Hepatic diseases including hepatic fibrosis, liver cirrhosis or other diseases.
  • Renal and urologic diseases including thyroiditis or other glandular diseases, glomerulonephritis or other diseases.
  • Ear, nose and throat disorders including otitis or other oto-rhino-laryngological diseases, dermatitis or other dermal diseases.
  • Dental and oral disorders including periodontal diseases, periodontitis, gingivitis or other dental/oral diseases.
  • Testicular diseases including orchitis or epididimo-orchitis, infertility, orchidal trauma or other testicular diseases.
  • Gynaecological diseases including placental dysfunction, placental insufficiency, habitual abortion, eclampsia, pre-eclampsia, endometriosis and other gynaecological diseases.
  • Ophthalmologic disorders such as posterior uveitis, intermediate uveitis, anterior uveitis, conjunctivitis, chorioretinitis, uveoretinitis, optic neuritis, glaucoma, including open angle glaucoma and juvenile congenital glaucoma, intraocular inflammation, e.g.
  • retinitis or cystoid macular oedema retinitis or cystoid macular oedema, sympathetic ophthalmia, scleritis, retinitis pigmentosa
  • macular degeneration including age related macular degeneration (AMD) and juvenile macular degeneration including Best Disease, Best vitelliform macular degeneration, Stargardt's Disease, Usher's syndrome, Doyne's honeycomb retinal dystrophy, Sorby's Macular Dystrophy, Juvenile retinoschisis, Cone-Rod Dystrophy, Corneal Dystrophy, Fuch's Dystrophy, Leber's congenital amaurosis, Leber's hereditary optic neuropathy (LHON), Adie syndrome, Oguchi disease, degenerative fondus disease, ocular trauma, ocular inflammation caused by infection, proliferative vitreo-retinopathies, acute ischaemic optic neuropathy, excessive scarring,
  • glaucoma filtration operation reaction against ocular implants, corneal transplant graft rejection, and other ophthalmic diseases, such as diabetic macular oedema, retinal vein occlusion, RLBP1 -associated retinal dystrophy, choroideremia and achromatopsia.
  • ophthalmic diseases such as diabetic macular oedema, retinal vein occlusion, RLBP1 -associated retinal dystrophy, choroideremia and achromatopsia.
  • Neurological and neurodegenerative disorders including Parkinson's disease, complication and/or side effects from treatment of Parkinson's disease, AIDS-related dementia complex HIV-related encephalopathy, Devic's disease, Sydenham chorea, Alzheimer's disease and other degenerative diseases, conditions or disorders of the CNS, strokes, post-polio syndrome, psychiatric disorders, myelitis, encephalitis, subacute sclerosing pan-encephalitis, encephalomyelitis, acute neuropathy, subacute neuropathy, chronic neuropathy, Pompe disease, Guillaim-Barre syndrome, Sydenham chorea, myasthenia gravis, pseudo-tumour cerebri, Down's Syndrome, Huntington's disease, CNS compression or CNS trauma or infections of the CNS, muscular atrophies and dystrophies, diseases, conditions or disorders of the central and peripheral nervous systems, motor neuron disease including amyotropic lateral sclerosis, spinal muscular atropy, spinal cord and avulsion injury.
  • cystic fibrosis mucopolysaccharidosis including Sanfilipo syndrome A, ADA-SCID, X-linked SCID, porphyria, haemophilia A, haemophilia B, post-traumatic inflammation, haemorrhage, coagulation and acute phase response, cachexia, anorexia, acute infection, septic shock, infectious diseases, complications or side effects of surgery, bone marrow transplantation or other transplantation complications and/or side effects, complications and side effects of gene therapy, e.g.
  • siRNA, micro-RNA and shRNA due to infection with a viral carrier, or AIDS, to suppress or inhibit a humoral and/or cellular immune response, for the prevention and/or treatment of graft rejection in cases of transplantation of natural or artificial cells, tissue and organs such as cornea, bone marrow, organs, lenses, pacemakers, natural or artificial skin tissue.
  • a viral carrier or AIDS
  • a humoral and/or cellular immune response for the prevention and/or treatment of graft rejection in cases of transplantation of natural or artificial cells, tissue and organs such as cornea, bone marrow, organs, lenses, pacemakers, natural or artificial skin tissue.
  • shRNA siRNA, micro-RNA and shRNA
  • the NOI comprises a micro-RNA.
  • Micro-RNAs are a very large group of small RNAs produced naturally in organisms, at least some of which regulate the expression of target genes. Founding members of the micro-RNA family are let-7 and lin-4.
  • the let-7 gene encodes a small, highly conserved RNA species that regulates the expression of endogenous protein-coding genes during worm development.
  • the active RNA species is transcribed initially as an -70 nt precursor, which is post-transcriptionally processed into a mature -21 nt form.
  • Both let-7 and lin-4 are transcribed as hairpin RNA precursors which are processed to their mature forms by Dicer enzyme.
  • the vector may also comprise or encode a siRNA, shRNA, or regulated shRNA (Dickins et al. (2005) Nature Genetics 37: 1289-1295, Silva et al. (2005) Nature Genetics 37: 1281-1288).
  • RNA interference RNA interference
  • siRNAs small interfering or silencing RNAs
  • dsRNA small interfering or silencing RNAs
  • dsRNA >30 bp has been found to activate the interferon response leading to shut-down of protein synthesis and non-specific mRNA degradation (Stark et al., Annu Rev Biochem 67:227-64 (1998)).
  • this response can be bypassed by using 21 nt siRNA duplexes (Elbashir et al., EMBO J. Dec 3;20(23):6877-88 (2001), Hutvagner et al., Science.Aug 3, 293(5531):834-8. Eupub Jul 12 (2001)) allowing gene function to be analysed in cultured mammalian cells.
  • a vector is a tool that allows or facilitates the transfer of an entity from one environment to another.
  • some vectors used in recombinant nucleic acid techniques allow entities, such as a segment of nucleic acid (e.g. a heterologous DNA segment, such as a heterologous cDNA segment), to be transferred into a target cell.
  • the vector may serve the purposes of maintaining the heterologous nucleic acid (DNA or RNA) within the cell, or facilitating the replication of the vector comprising a segment of DNA or RNA or the expression of the protein encoded by a segment of nucleic acid.
  • the vectors of the invention may be, for example, viral vectors provided with an origin of replication, optionally a promoter for the expression of the said polynucleotide and optionally a regulator of the promoter.
  • the vectors may contain one or more selectable marker genes (e.g. a neomycin resistance gene) and/or traceable marker genes (e.g. a gene encoding GFP).
  • Selectable marker genes e.g. a neomycin resistance gene
  • traceable marker genes e.g. a gene encoding GFP
  • the vector of the invention may be used to replicate the NOI in a compatible target cell in vitro.
  • the invention provides a method of making proteins in vitro by introducing a vector of the invention into a compatible target cell in vitro and growing the target cell under conditions which result in expression of the NOI. Protein may be recovered from the target cell by methods well known in the art. Suitable target cells include mammalian cell lines and other eukaryotic cell lines.
  • the vector may be an expression vector.
  • Expression vectors as described herein comprise regions of nucleic acid containing sequences capable of being transcribed. Thus, sequences encoding mRNA, tRNA and rRNA are included within this definition.
  • an expression vector comprises a polynucleotide of the invention operably linked to a control sequence that is capable of providing for the expression of the coding sequence by the target cell.
  • the vector is a viral vector.
  • a viral vector may also be called a vector, vector virion or vector particle.
  • the viral vector is derived from a retrovirus, adenovirus, adeno- associated virus, herpes simplex virus, vaccinia virus or baculovirus. It is anticipated that the repression system of the invention will be of benefit to any viral vector system. The system will find particular use where the nucleotide of interest causes adverse effects, for example on the viral vector production cell or during virion assembly.
  • the retrovirus is derived from a foamy virus.
  • the retroviral vector is derived from a lentivirus.
  • the lentiviral vector is derived from HIV-1 , HIV-2, SIV, FIV, BIV, EIAV, CAEV or visna lentivirus.
  • Titre is often described as transducing units/mL (TU/mL). Titre may be increased by increasing the number of infectious particles and by increasing the specific activity of a vector preparation.
  • the retroviral vector of the present invention may be derived from or may be derivable from any suitable retrovirus.
  • retroviruses include: murine leukemia virus (MLV), human T-cell leukemia virus (HTLV), mouse mammary tumour virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), Moloney murine leukemia virus (Mo MLV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukemia virus (A-MLV), Avian myelocytomatosis virus-29 (MC29) and Avian erythroblastosis virus (AEV).
  • MMV murine leukemia virus
  • HTLV human T-cell leukemia virus
  • MMTV mouse mammary tumour virus
  • RSV Rous sarcoma virus
  • Fujinami sarcoma virus FuSV
  • Retroviruses may be broadly divided into two categories, namely "simple” and “complex”. Retroviruses may even be further divided into seven groups. Five of these groups represent retroviruses with oncogenic potential. The remaining two groups are the lentiviruses and the spumaviruses. A review of these retroviruses is presented in Coffin et al (1997) ibid.
  • retrovirus and lentivirus genomes share many common features such as a 5' LTR and a 3' LTR, between or within which are located a packaging signal to enable the genome to be packaged, a primer binding site, integration sites to enable integration into a target cell genome and gag/pol and env genes encoding the packaging components - these are polypeptides required for the assembly of viral particles.
  • Lentiviruses have additional features, such as the rev gene and RRE sequences in HIV, which enable the efficient export of RNA transcripts of the integrated provirus from the nucleus to the cytoplasm of an infected target cell.
  • LTRs long terminal repeats
  • the LTRs are responsible for proviral integration, and transcription. LTRs also serve as enhancer-promoter sequences and can control the expression of the viral genes.
  • the LTRs themselves are identical sequences that can be divided into three elements, which are called U3, R and U5. U3 is derived from the sequence unique to the 3' end of the RNA. R is derived from a sequence repeated at both ends of the RNA and U5 is derived from the sequence unique to the 5' end of the RNA. The sizes of the three elements can vary considerably among different retroviruses.
  • at least part of one or more protein coding regions essential for replication may be removed from the virus; for example, gag/pol and env may be absent or not functional. This makes the viral vector replication-defective.
  • Portions of the viral genome may also be replaced by a library encoding candidate nucleic acid binding sequences of the invention operably linked to a regulatory control region and a reporter gene in the vector genome in order to generate a vector comprising candidate nucleic acid binding sequences of the invention which is capable of transducing a target non- dividing cell and/or integrating its genome into a host genome.
  • Lentiviruses are part of a larger group of retroviruses. A detailed list of lentiviruses may be found in Coffin et al (1997) "Retroviruses” Cold Spring Harbour Laboratory Press Eds: JM Coffin, SM Hughes, HE Varmus pp 758-763). In brief, lentiviruses can be divided into primate and non-primate groups. Examples of primate lentiviruses include but are not limited to: the human immunodeficiency virus (HIV), the causative agent of human auto- immunodeficiency syndrome (AIDS), and the simian immunodeficiency virus (SIV).
  • HAV human immunodeficiency virus
  • AIDS causative agent of human auto- immunodeficiency syndrome
  • SIV simian immunodeficiency virus
  • the non-primate lentiviral group includes the prototype "slow virus” visna/maedi virus (VMV), as well as the related caprine arthritis-encephalitis virus (CAEV), equine infectious anaemia virus (EIAV), feline immunodeficiency virus (FIV) and bovine immunodeficiency virus (BIV).
  • VMV visna/maedi virus
  • CAEV caprine arthritis-encephalitis virus
  • EIAV equine infectious anaemia virus
  • FIV feline immunodeficiency virus
  • BIV bovine immunodeficiency virus
  • the lentivirus family differs from retroviruses in that lentiviruses have the capability to infect both dividing and non-dividing cells (Lewis et al (1992) EMBO J 1 1 (8): 3053-3058 and Lewis and Emerman (1994) J Virol 68 (1):510-516).
  • retroviruses such as MLV
  • MLV are unable to infect non-dividing or slowly dividing cells such as those that make up, for example, muscle, brain, lung and liver tissue.
  • a lentiviral vector is a vector which comprises at least one component part derivable from a lentivirus. Preferably, that component part is involved in the biological mechanisms by which the vector infects cells, expresses genes or is replicated.
  • the lentiviral vector may be derived from either a primate lentivirus (e.g. HIV-1) or a non- primate lentivirus.
  • non-primate lentivirus may be any member of the family of lentiviridae which does not naturally infect a primate and may include a feline immunodeficiency virus (FIV), a bovine immunodeficiency virus (BIV), a caprine arthritis encephalitis virus (CAEV), a Maedi visna virus (MW) or an equine infectious anaemia virus (EIAV).
  • FV feline immunodeficiency virus
  • BIV bovine immunodeficiency virus
  • CAEV caprine arthritis encephalitis virus
  • MW Maedi visna virus
  • EIAV equine infectious anaemia virus
  • a typical retroviral vector production system involves the separation of the viral genome from the essential viral packaging functions. As illustrated in Figure 1 , these components are provided to the production cells on separate DNA expression cassettes (alternatively known as plasmids, expression plasmids, DNA constructs or expression constructs).
  • the vector genome comprises the NOI.
  • Vector genomes typically require a packaging signal ( ⁇ ), the internal expression cassette harbouring the NOI, (optionally) a post-transcriptional element (PRE), the 3'-ppu and a self-inactivating (SIN) LTR.
  • the R-U5 regions are required for correct polyadenylation of both the vector genome RNA and NOI mRNA, as well as the process of reverse transcription.
  • the vector genome may optionally include an open reading frame, as described in WO 2003/064665.
  • the packaging functions include the gag/pol and env genes. These are required for the production of vector particles by the production cell. Providing these functions in trans to the genome facilitates the production of replication-defective virus.
  • Production systems for gamma-retroviral vectors are typically 3-component systems requiring genome, gag/pol and env expression constructs.
  • Production systems for HIV-1- based lentiviral vectors additionally require the accessory gene rev to be provided in trans and for the vector genome to include the rei/-responsive element (RRE).
  • RRE rei/-responsive element
  • EIAV-based lentiviral vectors do not require rev if an open-reading frame (ORF) is present (see WO 2003/064665).
  • both the "external" promoter (which drives the vector genome cassette) and “internal” promoter (which drives the NOI cassette) encoded within the vector genome cassette are strong eukaryotic or virus promoters, as are those driving the other vector system components.
  • promoters include CMV, EF1a, PGK, CAG, TK, SV40 and Ubiquitin promoters.
  • Strong 'synthetic' promoters, such as those generated by DNA libraries e.g. JeT promoter may also be used to drive transcription.
  • tissue-specific promoters such as rhodopsin (Rho), rhodopsin kinase (RhoK), cone-rod homeobox containing gene (CRX), neural retina-specific leucine zipper protein (NRL), Vitelliform Macular Dystrophy 2 (VMD2), Tyrosine hydroxylase, neuronal-specific neuronal- specific enolase (NSE) promoter, astrocyte-specific glial fibrillary acidic protein (GFAP) promoter, human a1-antitrypsin (hAAT) promoter, phosphoenolpyruvate carboxykinase (PEPCK), liver fatty acid binding protein promoter, Flt-1 promoter, INF- ⁇ promoter, Mb promoter, SP-B promoter, SYN 1 promoter, WASP promoter, SV40 / hAlb promoter, SV40 / CD43, SV40 / CD45, NSE / RU5' promoter, ICAM-2
  • Production of retroviral vectors involves either the transient transfection of the production cells with these DNA components or use of stable producer cell lines (PCLs) wherein the components are integrated within the production cell genome (e.g. Stewart, H. J., M. A. Leroux-Carlucci, C. J. Sion, K. A. Mitrophanous and P. A. Radcliffe (2009) Gene Ther. 16(6): 805-814 Epub 2009 Mar 2005).
  • An alternative approach is to use a stable packaging cell (into which the packaging components are stably integrated) and then transiently transfect in the vector genome plasmid as required.
  • the production cells In order to generate the viral vectors of the present invention the production cells must be capable of expressing the RNA-binding protein (e.g. TRAP protein).
  • the production cells will stably express the RNA-binding protein (e.g. TRAP) construct.
  • the production cells will transiently express the RNA-binding protein (e.g. TRAP) construct.
  • the production cells will stably express a RNA-binding protein (e.g. TRAP) construct and also transiently express a RNA-binding protein (e.g. TRAP) construct.
  • TRIP system has been mainly described for producing retroviral vectors, analogous strategies can be applied to other viral vectors.
  • the viral vector is derived from EIAV.
  • EIAV has the simplest genomic structure of the lentiviruses and is particularly preferred for use in the present invention.
  • EIAV encodes three other genes: tat, rev, and S2.
  • Tat acts as a transcriptional activator of the viral LTR (Derse and Newbold (1993) Virology 194(2): 530-536 and Maury et al (1994) Virology 200(2):632-642) and rev regulates and coordinates the expression of viral genes through rei/-response elements (RRE) (Martarano et al. (1994) J Virol 68(5):3102-311 1).
  • RRE rei/-response elements
  • the mechanisms of action of these two proteins are thought to be broadly similar to the analogous mechanisms in the primate viruses (Martarano et al. (1994) J Virol 68(5):3102-31 11).
  • S2 The function of S2 is unknown.
  • an EIAV protein, Ttm has been identified that is encoded by the first exon of tat spliced to the env coding sequence at the start of the transmembrane protein.
  • the viral vector is derived from HIV: HIV differs from EIAV in that it does not encode S2 but unlike EIAV it encodes vif, vpr, vpu and nef.
  • RRV retroviral or lentiviral vector
  • RRV refers to a vector with sufficient retroviral genetic information to allow packaging of an RNA genome, in the presence of packaging components, into a viral particle capable of infecting a target cell. Infection of the target cell may include reverse transcription and integration into the target cell genome.
  • the RRV carries non-viral coding sequences which are to be delivered by the vector to the target cell.
  • a RRV is incapable of independent replication to produce infectious retroviral particles within the target cell.
  • the RRV lacks a functional gag/pol and/or env gene, and/or other genes essential for replication.
  • the RRV vector of the present invention has a minimal viral genome.
  • minimal viral genome means that the viral vector has been manipulated so as to remove the non-essential elements whilst retaining the elements essential to provide the required functionality to infect, transduce and deliver a nucleotide sequence of interest to a target cell. Further details of this strategy can be found in WO 1998/17815 and WO 99/32646.
  • a minimal EIAV vector lacks tat, rev and S2 genes and neither are these genes provided in trans in the production system.
  • a minimal HIV vector lacks vif, vpr, vpu, tat and nef.
  • the expression plasmid used to produce the vector genome within a production cell will include transcriptional regulatory control sequences operably linked to the retroviral genome to direct transcription of the genome in a production cell/packaging cell.
  • These regulatory sequences may be the natural sequences associated with the transcribed retroviral sequence, i.e. the 5' U3 region, or they may be a heterologous promoter such as another viral promoter, for example the CMV promoter, as discussed below.
  • Some lentiviral vector genomes require additional sequences for efficient virus production. For example, particularly in the case of HIV, RRE sequences may be included. However the requirement for RRE (and dependence on rev which is provided in trans) may be reduced or eliminated by codon optimisation.
  • CTE constitutive transport element
  • RRE RRE-type sequence in the genome which is believed to interact with a factor in the infected cell.
  • the cellular factor can be thought of as a rev analogue.
  • CTE may be used as an alternative to the revlRR system.
  • Any other functional equivalents which are known or become available may be relevant to the invention.
  • the Rex protein of HTLV-I can functionally replace the Rev protein of HIV-1.
  • Rev and RRE may be absent or non-functional in the vector for use in the methods of the present invention; in the alternative rev and RRE, or functionally equivalent system, may be present.
  • the vectors for use in the methods of the present invention are preferably used in a self- inactivating (SIN) configuration in which the viral enhancer and promoter sequences have been deleted.
  • SIN vectors can be generated and transduce non-dividing target cells in vivo, ex vivo or in vitro with an efficacy similar to that of wild-type vectors.
  • the transcriptional inactivation of the long terminal repeat (LTR) in the SIN provirus should prevent mobilization by replication-competent virus. This should also enable the regulated expression of genes from internal promoters by eliminating any c/s-acting effects of the LTR.
  • LTR long terminal repeat
  • self-inactivating retroviral vector systems have been constructed by deleting the transcriptional enhancers or the enhancers and promoter in the U3 region of the 3' LTR. After a round of vector reverse transcription and integration, these changes are copied into both the 5' and the 3' LTRs producing a transcriptionally inactive provirus. However, any promoter(s) internal to the LTRs in such vectors will still be transcriptionally active.
  • This strategy has been employed to eliminate effects of the enhancers and promoters in the viral LTRs on transcription from internally placed genes. Such effects include increased transcription or suppression of transcription. This strategy can also be used to eliminate downstream transcription from the 3' LTR into genomic DNA.
  • gag/pol and/or env may be mutated, absent and/or not functional.
  • a typical lentiviral vector of the present invention at least part of one or more coding regions for proteins essential for virus replication may be removed from the vector. This makes the viral vector replication-defective. Portions of the viral genome may also be replaced by a nucleotide of interest (NOI) in order to generate a vector comprising an NOI which is capable of transducing a non-dividing target cell and/or integrating its genome into the target cell genome.
  • NOI nucleotide of interest
  • the lentiviral vectors are non-integrating vectors as described in WO 2006/010834 and WO 2007/071994.
  • the vectors have the ability to deliver a sequence which is devoid of or lacking viral RNA.
  • a heterologous binding domain (heterologous to gag) located on the RNA to be delivered and a cognate binding domain on Gag or GagPol can be used to ensure packaging of the RNA to be delivered. Both of these vectors are described in WO 2007/072056.
  • the vector may be an adenovirus vector.
  • the adenovirus is a double-stranded, linear DNA virus that does not replicate through an RNA intermediate.
  • RNA intermediate There are over 50 different human serotypes of adenovirus divided into 6 subgroups based on their genetic sequence.
  • Adenoviruses are double-stranded DNA non-enveloped viruses that are capable of in vivo, ex vivo and in vitro transduction of a broad range of cell types of human and non-human origin. These cells include respiratory airway epithelial cells, hepatocytes, muscle cells, cardiac myocytes, synoviocytes, primary mammary epithelial cells and post-mitotically terminally differentiated cells such as neurons.
  • Adenoviral vectors are also capable of transducing non-dividing cells. This is very important for diseases, such as cystic fibrosis, in which the affected cells in the lung epithelium have a slow turnover rate. In fact, several trials are underway utilising adenovirus-mediated transfer of cystic fibrosis transporter (CFTR) into the lungs of afflicted adult cystic fibrosis patients.
  • CFTR cystic fibrosis transporter
  • Adenoviruses have been used as vectors for gene therapy and for expression of heterologous genes.
  • the large (36 kb) genome can accommodate up to 8 kb of foreign insert DNA and is able to replicate efficiently in complementing cell lines to produce very high titres of up to 10 12 transducing units per ml.
  • Adenovirus is thus one of the best systems to study the expression of genes in primary non-replicative cells.
  • the expression of viral or foreign genes from the adenovirus genome does not require a replicating cell.
  • Adenoviral vectors enter cells by receptor mediated endocytosis. Once inside the cell, adenovirus vectors rarely integrate into the host chromosome. Instead, they function episomally (independently from the host genome) as a linear genome in the host nucleus.
  • Adeno-associated virus is an attractive vector system for use in the present invention as it has a high frequency of integration and it can infect non-dividing cells. This makes it useful for delivery of genes into mammalian cells.
  • AAV has a broad host range for infectivity. Details concerning the generation and use of rAAV vectors are described in US Patent No. 5, 139,941 and US Patent No. 4,797,368, each incorporated herein by reference.
  • Recombinant AAV vectors have been used successfully for in vitro, ex vivo and in vivo transduction of marker genes and genes involved in human diseases.
  • AAV vectors have been developed which can efficiently incorporate large payloads (up to 8-9kb).
  • One such vector has an AAV5 capsid and an AAV2 ITR (Allocca M, et al J. Clin Invest (2008) 118: 1955-1964).
  • Herpes simplex virus is an enveloped double-stranded DNA virus that naturally infects neurons. It can accommodate large sections of foreign DNA, which makes it attractive as a vector system, and has been employed as a vector for gene delivery to neurons (Manservigiet et al Open Virol J. (2010) 4: 123-156).
  • HSV vectors are used for gene therapy in humans, the polynucleotide should preferably be inserted into an essential gene. This is because if a viral vector encounters a wild-type virus, transfer of a heterologous gene to the wild-type virus could occur by recombination. However, as long as the polynucleotide is inserted into an essential gene, this recombinational transfer would also delete the essential gene in the recipient virus and prevent "escape" of the heterologous gene into the replication competent wild-type virus population.
  • Vaccinia virus vectors are used for gene therapy in humans, the polynucleotide should preferably be inserted into an essential gene. This is because if a viral vector encounters a wild-type virus, transfer of a heterologous gene to the wild-type virus could occur by recombination. However, as long as the polynucleotide is inserted into an essential gene, this recombinational transfer would also delete the essential gene in the recipient virus and prevent "escape" of
  • the vector of the present invention may be a vaccinia virus vector such as MVA or NYVAC.
  • vaccinia vectors include avipox vectors such as fowlpox or canarypox known as ALVAC and strains derived therefrom which can infect and express recombinant proteins in human cells but are unable to replicate.
  • the vector of the present invention may also be a baculovirus vector.
  • the modification of baculovirus to enable the expression of encoded NOIs within mammalian cells is well known in the art. This can be achieved, for example, through the use of mammalian promoters upstream of the NOI.
  • the vector comprises more than one NOI wherein one or more NOI is operably linked to the nucleic acid binding site of the invention.
  • the vectors of the invention may comprise more than one NOI. In order for these NOIs to be expressed, there may be two or more transcription units within the vector genome, one for each NOI.
  • retroviral vectors achieve the highest titres and most potent gene expression properties if they are kept genetically simple (WO 96/37623; Bowtell et al., 1988 J.Virol. 62, 2464; Correll et al., 1994 Blood 84, 1812; Emerman and Temin 1984 Cell 39, 459; Ghattas et al., 1991 Mol. Cell. Biol.
  • IVS internal ribosome entry site
  • IRES elements Insertion of IRES elements into retroviral vectors is compatible with the retroviral replication cycle and allows expression of multiple coding regions from a single promoter (Adam et al (as above); Koo et al (1992) Virology 186:669-675; Chen et al 1993 J. Virol 67:2142-2148).
  • IRES elements were first found in the non-translated 5' ends of picornaviruses where they promote cap-independent translation of viral proteins (Jang et al (1990) Enzyme 44: 292- 309). When located between open reading frames in an RNA, IRES elements allow efficient translation of the downstream open reading frame by promoting entry of the ribosome at the IRES element followed by downstream initiation of translation.
  • IRES encephalomyocarditis virus
  • IRES elements from PV, EMCV and swine vesicular disease virus have previously been used in retroviral vectors (Coffin et al, as above).
  • IRES includes any sequence or combination of sequences which work as or improve the function of an IRES.
  • the IRES(s) may be of viral origin (such as EMCV IRES, PV IRES, or FMDV 2A-like sequences) or cellular origin (such as FGF2 IRES, NRF IRES, Notch 2 IRES or EIF4 IRES).
  • viral origin such as EMCV IRES, PV IRES, or FMDV 2A-like sequences
  • cellular origin such as FGF2 IRES, NRF IRES, Notch 2 IRES or EIF4 IRES.
  • Expression of a NOI may be controlled using control sequences, which include promoters/enhancers and other expression regulation signals.
  • Prokaryotic promoters and promoters functional in eukaryotic cells may be used.
  • Tissue specific or stimuli specific promoters may be used.
  • Chimeric promoters may also be used comprising sequence elements from two or more different promoters.
  • Suitable promoting sequences are strong promoters including those derived from the genomes of viruses, such as polyoma virus, adenovirus, fowlpox virus, bovine papilloma virus, avian sarcoma virus, cytomegalovirus (CMV), retrovirus and Simian Virus 40 (SV40), or from heterologous mammalian promoters, such as the actin promoter, EF1a, CAG, TK, SV40, ubiquitin, PGK or ribosomal protein promoter.
  • viruses such as polyoma virus, adenovirus, fowlpox virus, bovine papilloma virus, avian sarcoma virus, cytomegalovirus (CMV), retrovirus and Simian Virus 40 (SV40), or from heterologous mammalian promoters, such as the actin promoter, EF1a, CAG, TK, SV40, ubiquitin, PGK or
  • tissue-specific promoters such as rhodopsin (Rho), rhodopsin kinase (RhoK), cone-rod homeobox containing gene (CRX), neural retina-specific leucine zipper protein (NRL), Vitelliform Macular Dystrophy 2 (VMD2), Tyrosine hydroxylase, neuronal-specific neuronal-specific enolase (NSE) promoter, astrocyte-specific glial fibrillary acidic protein (GFAP) promoter, human a1 -antitrypsin (hAAT) promoter, phosphoenolpyruvate carboxykinase (PEPCK), liver fatty acid binding protein promoter, Flt-1 promoter, INF- ⁇ promoter, Mb promoter, SP-B promoter, SYN1 promoter, WASP promoter, SV40 / hAlb promoter, SV40 / CD43, SV40 / CD45, NSE / RU5' promoter, ICAM
  • Enhancers are relatively orientation- and position-independent; however, one may employ an enhancer from a eukaryotic cell virus, such as the SV40 enhancer on the late side of the replication origin (bp 100-270) and the CMV early promoter enhancer.
  • the enhancer may be spliced into the vector at a position 5' or 3' to the promoter, but is preferably located at a site 5' from the promoter.
  • the promoter can additionally include features to ensure or to increase expression in a suitable target cell. For example, the features can be conserved regions e.g. a Pribnow Box or a TATA box.
  • the promoter may contain other sequences to affect (such as to maintain, enhance or decrease) the levels of expression of a nucleotide sequence.
  • Suitable other sequences include the Sh1-intron or an ADH intron.
  • Other sequences include inducible elements, such as temperature, chemical, light or stress inducible elements.
  • suitable elements to enhance transcription or translation may be present.
  • RNA-binding protein-binding site e.g. TRAP-tbs
  • the RNA-binding protein-binding site (e.g. TRAP-tbs) interaction may be useful in forming the basis for a transgene protein repression system for the production of retroviral vectors, when a constitutive and/or strong promoter, including a tissue-specific promoter, driving the transgene is desirable and particularly when expression of the transgene protein in production cells leads to reduction in vector titres and/or elicits an immune response in vivo due to viral vector delivery of transgene-derived protein.
  • Figure 4 displays an example of how this may be applied in its preferred form.
  • the term "packaging signal”, which is referred to interchangeably as “packaging sequence” or “psi”, is used in reference to the non-coding, c/s-acting sequence required for encapsidation of retroviral RNA strands during viral particle formation.
  • this sequence has been mapped to loci extending from upstream of the major splice donor site (SD) to at least the gag start codon.
  • the packaging signal comprises the R region into the 5' coding region of Gag.
  • extended packaging signal or “extended packaging sequence” refers to the use of sequences around the psi sequence with further extension into the gag gene. The inclusion of these additional packaging sequences may increase the efficiency of insertion of vector RNA into viral particles.
  • RNA encapsidation determinants have been shown to be discrete and non-continuous, comprising one region at the 5' end of the genomic mRNA (R-U5) and another region that mapped within the proximal 31 1 nt of gag (Kaye et al., J Virol. Oct;69(10):6588-92 (1995).
  • Another aspect of the invention relates to a viral vector production system comprising a set of nucleic acid sequences encoding the components required for production of the viral vector, wherein the vector genome sequence comprises the nucleic acid sequence of the invention.
  • the vector production system comprises a set of nucleic acid sequences which encode the components necessary to generate viral vector particles.
  • One such nucleic acid sequence may comprise the gene encoding a RNA-binding protein.
  • the RNA binding protein is the bacterial TRAP.
  • the viral vector is a retroviral vector and the viral vector production system further comprises nucleic acid sequences encoding Gag and Gag/Pol proteins, and Env protein, or functional substitutes thereof and the vector genome sequence which comprises the binding site of the present invention.
  • the production system may optionally comprise a nucleic acid sequence encoding the Rev protein.
  • the viral vector is derived from a retrovirus, adenovirus or adeno-associated virus.
  • the viral vector is derived from a lentivirus.
  • the viral vector is derived from HIV-1 , HIV-2, SIV, FIV, BIV, EIAV, CAEV or visna lentivirus.
  • DNA constructs for use in the viral vector production system of the invention.
  • DNA constructs may include the vector genome construct which comprises the nucleic acid sequence of the invention.
  • a further aspect of the invention relates to a DNA construct for use in the viral vector production system of the invention comprising a nucleic acid sequence encoding the RNA- binding protein of the invention, for example TRAP.
  • Another aspect of the invention relates to a set of DNA constructs for use in the viral vector production system of the invention comprising the DNA constructs of the invention and DNA constructs encoding Gag and Gag/Pol proteins and Env protein, or functional substitutes thereof.
  • the set of DNA constructs additionally comprises a DNA construct encoding the RNA-binding protein, for example TRAP.
  • the set of DNA constructs additionally comprises a DNA construct encoding Rev protein or a functional substitute thereof.
  • Another aspect of the invention relates to a viral vector production cell comprising the nucleic acid sequence, the viral vector production system, or some or all of the DNA constructs of the invention.
  • viral vector production cell is to be understood as a cell that is capable of producing a viral vector or viral vector particle.
  • Viral vector production cells may be "producer cells” or
  • One or more DNA constructs of the viral vector system may be stably integrated or episomally maintained within the viral vector production cell.
  • all the DNA components of the viral vector system may be transiently transfected into the viral vector production cell.
  • a production cell stably expressing some of the components may be transiently transfected with the remaining components.
  • the DNA expression cassette encoding the RNA binding protein (e.g. TRAP) may be stably integrated or episomally maintained within the viral vector production cell.
  • the DNA expression cassette encoding the RNA binding protein e.g. TRAP
  • the production cells will stably express the RNA- binding protein (e.g. TRAP) construct.
  • the production cells will transiently express the RNA-binding protein (e.g. TRAP) construct.
  • the level of repression required may vary in accordance with the NOI, thus the level of RNA- binding protein (e.g. TRAP) required in the production cell may also depend on the NOI. In some circumstances, a combination of stable and transient RNA-binding protein (e.g. TRAP) expression may therefore be desired.
  • the stable expression may provide a continual level of RNA-binding protein expression in the production cell, while the transient expression may provide shorter term, increased levels of RNA-binding protein expression. For example, it is possible that repression of more problematic/toxic transgenes will benefit from both preexisting (e.g. provided by stable expression) and high levels of RNA-binding protein during vector production.
  • the production cells will stably express a RNA- binding protein (e.g. TRAP) construct and also transiently express a RNA-binding protein (e.g. TRAP) construct.
  • the transient expression may provide short term higher levels of RNA-binding protein expression than provided by the stable expression.
  • stable expression it is to be understood that the expression of the RNA-binding protein from the construct providing the stable expression substantially does not vary over a prolonged period of time.
  • transient expression it is to be understood that the expression of the RNA-binding protein from the construct providing the transient expression is not stable over a prolonged period of time.
  • the polynucleotide encoding the RNA-binding protein which provides for the transient expression does not integrate into the production cell genome and is not episomally maintained in the production cell.
  • packaging cell refers to a cell which contains the elements necessary for production of infectious vector particles but which are lack the vector genome.
  • packaging cells typically contain one or more expression cassettes which are capable of expressing viral structural proteins (such as gag, gag/pol and env).
  • Producer cells/packaging cells can be of any suitable cell type.
  • Producer cells are generally mammalian cells but can be, for example, insect cells.
  • the term "producer/production cell” or “vector producing/production cell” refers to a cell which contains all the elements necessary for production of retroviral vector particles, and expression of the RNA-binding protein (e.g. TRAP).
  • RNA-binding protein e.g. TRAP
  • the producer cell may be either a stable producer cell line or derived transiently.
  • the envelope and nucleocapsid, RNA-binding protein (e.g. TRAP) and, if present, rev nucleotide sequences are all stably integrated in the producer and/or packaging cell.
  • TRAP RNA-binding protein
  • rev nucleotide sequences are all stably integrated in the producer and/or packaging cell.
  • any one or more of these sequences could also exist in episomal form and gene expression could occur from the episome, or could be transfected transiently into the production cell.
  • the vector production cells may be cells cultured in vitro such as a tissue culture cell line.
  • Suitable cell lines include, but are not limited to, mammalian cells such as murine fibroblast derived cell lines or human cell lines.
  • the vector production cells are derived from a human cell line.
  • the vectors of the present invention use as their production system, four transcription units expressing a vector genome comprising the binding site of the invention operably linked to the NOI, the gag-pol components, an envelope and the RNA-binding protein (e.g. TRAP).
  • the envelope expression cassette may include one of a number of heterologous envelopes such as VSV-G.
  • the rev component may also be included.
  • Viral vector production processes Another aspect of the invention relates to a process for producing viral vectors comprising introducing the nucleic acid sequence, the viral vector production system, or some or all of the DNA constructs of the invention into a viral vector production cell and culturing the production cell under conditions suitable for the production of the viral vectors.
  • Suitable "production cells” are those cells which are capable of producing viral vectors or viral vector particles when cultured under appropriate conditions. They are generally mammalian or human cells, for example HEK293T, HEK293, CAP, CAP-T or CHO cells, but can be, for example, insect cells such as SF9 cells.
  • the production cells may also be avian cells, for example EB66 ® (Sigma) cells.
  • Avian cells may be particularly useful for the production of human and veterinary virus-based vaccines, for example influenza and Newcastle Disease virus vaccines.
  • the production cell comprises the RNA-binding protein (e.g. tryptophan RNA-binding attenuation protein, TRAP).
  • RNA-binding protein e.g. tryptophan RNA-binding attenuation protein, TRAP
  • Another aspect of the invention relates to a viral vector produced by the viral vector production system of the invention, using the viral vector production cell of the invention or by the process of the invention.
  • the viral vector particle comprises the nucleic acid binding site.
  • the viral vector particle may be derived from a retrovirus, adenovirus or adeno-associated virus.
  • the retroviral vector particle may be derived from a lentivirus.
  • the lentiviral vector particle may be derived from HIV-1 , HIV-2, SIV, FIV, BIV, EIAV, CAEV or visna lentivirus.
  • WO 2009/153563 Methods for generating lentiviral vectors and in particular the processing of lentiviral vectors, are described in WO 2009/153563. Another aspect of the invention relates to a cell transduced by the viral vector of the invention.
  • a "cell transduced by a viral vector particle” is to be understood as a cell, in particular a target cell, into which the nucleic acid carried by the viral vector particle has been transferred.
  • the viral vector of the present invention has been pseudotyped.
  • pseudotyping can confer one or more advantages.
  • the env gene product of the HIV based vectors would restrict these vectors to infecting only cells that express a protein called CD4. But if the env gene in these vectors has been substituted with env sequences from other enveloped viruses, then they may have a broader infectious spectrum (Verma and Somia (1997) Nature 389(6648) :239-242).
  • workers have pseudotyped an HIV based vector with the glycoprotein from VSV (Verma and Somia (1997) Nature 389(6648):239-242).
  • the Env protein may be a modified Env protein such as a mutant or engineered Env protein. Modifications may be made or selected to introduce targeting ability or to reduce toxicity or for another purpose (Valsesia-Wittman et al 1996 J Virol 70: 2056-64; Nilson et al (1996) Gene Ther 3(4):280-286; and Fielding et al (1998) Blood 91 (5): 1802- 1809 and references cited therein).
  • the vector may be pseudotyped with any molecule of choice.
  • the envelope glycoprotein (G) of Vesicular stomatitis virus (VSV), a rhabdovirus is an envelope protein that has been shown to be capable of pseudotyping certain enveloped viruses and viral vector virions. Its ability to pseudotype MoMLV- based retroviral vectors in the absence of any retroviral envelope proteins was first shown by Emi et al. (1991) Journal of Virology 65: 1202-1207). WO 1994/294440 teaches that retroviral vectors may be successfully pseudotyped with VSV-G. These pseudotyped VSV-G vectors may be used to transduce a wide range of mammalian cells. More recently, Abe et al. (1998) J Virol 72(8) 6356-6361 teach that non- infectious retroviral particles can be made infectious by the addition of VSV-G.
  • VSV-G pseudotyped vectors have been shown to infect not only mammalian cells, but also cell lines derived from fish, reptiles and insects (Burns et al. (1993) ibid). They have also been shown to be more efficient than traditional amphotropic envelopes for a variety of cell lines (Yee et al., (1994) Proc. Natl. Acad. Sci. USA 91 :9564-9568, Emi et al.
  • VSV-G protein can be used to pseudotype certain retroviruses because its cytoplasmic tail is capable of interacting with the retroviral cores.
  • a non-retroviral pseudotyping envelope such as VSV-G protein gives the advantage that vector particles can be concentrated to a high titre without loss of infectivity (Akkina et al. (1996) J. Virol. 70:2581-5).
  • Retrovirus envelope proteins are apparently unable to withstand the shearing forces during ultracentrifugation, probably because they consist of two non-covalently linked subunits. The interaction between the subunits may be disrupted by the centrifugation.
  • the VSV glycoprotein is composed of a single unit. VSV-G protein pseudotyping can therefore offer potential advantages.
  • WO 2000/52188 describes the generation of pseudotyped retroviral vectors, from stable producer cell lines, having vesicular stomatitis virus-G protein (VSV-G) as the membrane- associated viral envelope protein, and provides a gene sequence for the VSV-G protein.
  • VSV-G vesicular stomatitis virus-G protein
  • the Ross River viral envelope has been used to pseudotype a non-primate lentiviral vector (FIV) and following systemic administration predominantly transduced the liver (Kang et al (2002) J Virol 76(18):9378-9388). Efficiency was reported to be 20-fold greater than obtained with VSV-G pseudotyped vector, and caused less cytotoxicity as measured by serum levels of liver enzymes suggestive of hepatotoxicity.
  • FV non-primate lentiviral vector
  • the baculovirus GP64 protein has been shown to be an alternative to VSV-G for viral vectors used in the large-scale production of high-titre virus required for clinical and commercial applications (Kumar M, Bradow BP, Zimmerberg J (2003) Hum Gene Ther. 14(1):67-77). Compared with VSV-G-pseudotyped vectors, GP64-pseudotyped vectors have a similar broad tropism and similar native titres. Because, GP64 expression does not kill cells, 293T-based cell lines constitutively expressing GP64 can be generated.
  • envelopes which give reasonable titre when used to pseudotype EIAV include Mokola, Rabies, Ebola and LCMV (lymphocytic choriomeningitis virus). Intravenous infusion into mice of lentivirus pseudotyped with 4070A led to maximal gene expression in the liver.
  • Polynucleotides of the invention may comprise DNA or RNA. They may be single-stranded or double-stranded. It will be understood by a skilled person that numerous different polynucleotides can encode the same polypeptide as a result of the degeneracy of the genetic code. In addition, it is to be understood that skilled persons may, using routine techniques, make nucleotide substitutions that do not affect the polypeptide sequence encoded by the polynucleotides of the invention to reflect the codon usage of any particular host organism in which the polypeptides of the invention are to be expressed.
  • polynucleotides may be modified by any method available in the art. Such modifications may be carried out in order to enhance the in vivo activity or lifespan of the polynucleotides of the invention.
  • Polynucleotides such as DNA polynucleotides may be produced recombinantly, synthetically or by any means available to those of skill in the art. They may also be cloned by standard techniques.
  • Longer polynucleotides will generally be produced using recombinant means, for example using polymerase chain reaction (PCR) cloning techniques. This will involve making a pair of primers (e.g. of about 15 to 30 nucleotides) flanking the target sequence which it is desired to clone, bringing the primers into contact with mRNA or cDNA obtained from an animal or human cell, performing a polymerase chain reaction under conditions which bring about amplification of the desired region, isolating the amplified fragment (e.g. by purifying the reaction mixture with an agarose gel) and recovering the amplified DNA.
  • the primers may be designed to contain suitable restriction enzyme recognition sites so that the amplified DNA can be cloned into a suitable vector.
  • protein includes single-chain polypeptide molecules as well as multiple-polypeptide complexes where individual constituent polypeptides are linked by covalent or non-covalent means.
  • polypeptide and peptide refer to a polymer in which the monomers are amino acids and are joined together through peptide or disulfide bonds.
  • the present invention also encompasses the use of variants, derivatives, analogues, homologues and fragments thereof.
  • a variant of any given sequence is a sequence in which the specific sequence of residues (whether amino acid or nucleic acid residues) has been modified in such a manner that the polypeptide or polynucleotide in question retains at least one of its endogenous functions.
  • a variant sequence can be obtained by addition, deletion, substitution, modification, replacement and/or variation of at least one residue present in the naturally-occurring protein.
  • derivative in relation to proteins or polypeptides of the present invention includes any substitution of, variation of, modification of, replacement of, deletion of and/or addition of one (or more) amino acid residues from or to the sequence providing that the resultant protein or polypeptide retains at least one of its endogenous functions.
  • analogue in relation to polypeptides or polynucleotides includes any mimetic, that is, a chemical compound that possesses at least one of the endogenous functions of the polypeptides or polynucleotides which it mimics.
  • amino acid substitutions may be made, for example from 1 , 2 or 3 to 10 or 20 substitutions provided that the modified sequence retains the required activity or ability.
  • Amino acid substitutions may include the use of non-naturally occurring analogues.
  • Proteins used in the present invention may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent protein.
  • Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity and/or the amphipathic nature of the residues as long as the endogenous function is retained.
  • negatively charged amino acids include aspartic acid and glutamic acid
  • positively charged amino acids include lysine and arginine
  • amino acids with uncharged polar head groups having similar hydrophilicity values include asparagine, glutamine, serine, threonine and tyrosine.
  • Conservative substitutions may be made, for example according to the table below. Amino acids in the same block in the second column and preferably in the same line in the third column may be substituted for each other:
  • homologue means an entity having a certain homology with the wild type amino acid sequence and the wild type nucleotide sequence.
  • homology can be equated with "identity”.
  • a homologous sequence is taken to include an amino acid sequence which may be at least 50%, 55%, 65%, 75%, 85% or 90% identical, preferably at least 95% or 97% or 99% identical to the subject sequence.
  • the homologues will comprise the same active sites etc. as the subject amino acid sequence.
  • homology can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express homology in terms of sequence identity.
  • a homologous sequence is taken to include a nucleotide sequence which may be at least 50%, 55%, 65%, 75%, 85% or 90% identical, preferably at least 95% or 97% or 99% identical to the subject sequence.
  • homology can also be considered in terms of similarity, in the context of the present invention it is preferred to express homology in terms of sequence identity. Homology comparisons can be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs can calculate percentage homology or identity between two or more sequences.
  • Percentage homology may be calculated over contiguous sequences, i.e. one sequence is aligned with the other sequence and each amino acid in one sequence is directly compared with the corresponding amino acid in the other sequence, one residue at a time. This is called an "ungapped" alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues.
  • the alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pairwise comparison based on chemical similarity or evolutionary distance.
  • An example of such a matrix commonly used is the BLOSUM62 matrix - the default matrix for the BLAST suite of programs.
  • GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table if supplied (see user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62.
  • “Fragments” are also variants and the term typically refers to a selected region of the polypeptide or polynucleotide that is of interest either functionally or, for example, in an assay. “Fragment” thus refers to an amino acid or nucleic acid sequence that is a portion of a full-length polypeptide or polynucleotide.
  • Such variants may be prepared using standard recombinant DNA techniques such as site- directed mutagenesis. Where insertions are to be made, synthetic DNA encoding the insertion together with 5' and 3' flanking regions corresponding to the naturally-occurring sequence either side of the insertion site may be made. The flanking regions will contain convenient restriction sites corresponding to sites in the naturally-occurring sequence so that the sequence may be cut with the appropriate enzyme(s) and the synthetic DNA ligated into the cut. The DNA is then expressed in accordance with the invention to make the encoded protein. These methods are only illustrative of the numerous standard techniques known in the art for manipulation of DNA sequences and other known techniques may also be used.
  • All variants, fragments or homologues of the RNA-binding protein of the invention will retain the ability to bind the cognate binding site of the invention such that translation of the NOI is repressed or prevented in a viral vector production cell. All variants fragments or homologues of the binding site of the invention will retain the ability to bind the cognate RNA-binding protein, such that translation of the NOI is repressed or prevented in a viral vector production cell.
  • Codon optimisation The polynucleotides used in the present invention (including the NOI and/or components of the vector production system) may be codon-optimised. Codon optimisation has previously been described in WO 1999/41397 and WO 2001/79518. Different cells differ in their usage of particular codons. This codon bias corresponds to a bias in the relative abundance of particular tRNAs in the cell type. By altering the codons in the sequence so that they are tailored to match with the relative abundance of corresponding tRNAs, it is possible to increase expression. By the same token, it is possible to decrease expression by deliberately choosing codons for which the corresponding tRNAs are known to be rare in the particular cell type. Thus, an additional degree of translational control is available.
  • viruses including HIV and other lentiviruses, use a large number of rare codons and by changing these to correspond to commonly used mammalian codons, increased expression of a gene of interest, e.g. a NOI or packaging components in mammalian producer cells, can be achieved.
  • Codon usage tables are known in the art for mammalian cells, as well as for a variety of other organisms.
  • Codon optimisation of viral vector components has a number of other advantages.
  • the nucleotide sequences encoding the packaging components of the viral particles required for assembly of viral particles in the producer cells/packaging cells have RNA instability sequences (INS) eliminated from them.
  • INS RNA instability sequences
  • the amino acid sequence coding sequence for the packaging components is retained so that the viral components encoded by the sequences remain the same, or at least sufficiently similar that the function of the packaging components is not compromised.
  • codon optimisation also overcomes the Rev/RRE requirement for export, rendering optimised sequences Rev-independent.
  • Codon optimisation also reduces homologous recombination between different constructs within the vector system (for example between the regions of overlap in the gag- pol and eni/ open reading frames). The overall effect of codon optimisation is therefore a notable increase in viral titre and improved safety.
  • codon optimisation is therefore a notable increase in viral titre and improved safety.
  • only codons relating to INS are codon optimised.
  • the sequences are codon optimised in their entirety, with some exceptions, for example the sequence encompassing the frameshift site of gag-pol (see below).
  • the gag-pol gene comprises two overlapping reading frames encoding the gag-pol proteins. The expression of both proteins depends on a frameshift during translation. This frameshift occurs as a result of ribosome "slippage" during translation.
  • RNA secondary structures Such secondary structures exist downstream of the frameshift site in the gag-pol gene.
  • the region of overlap extends from nucleotide 1222 downstream of the beginning of gag (wherein nucleotide 1 is the A of the gag ATG) to the end of gag (nt 1503). Consequently, a 281 bp fragment spanning the frameshift site and the overlapping region of the two reading frames is preferably not codon optimised. Retaining this fragment will enable more efficient expression of the Gag-Pol proteins.
  • the beginning of the overlap has been taken to be nt 1262 (where nucleotide 1 is the A of the gag ATG). The end of the overlap is at 1461 bp. In order to ensure that the frameshift site and the gag-pol overlap are preserved, the wild type sequence has been retained from nt 1 156 to 1465.
  • Derivations from optimal codon usage may be made, for example, in order to accommodate convenient restriction sites, and conservative amino acid changes may be introduced into the Gag-Pol proteins.
  • codon optimisation is based on lightly expressed mammalian genes.
  • the third and sometimes the second and third base may be changed.
  • gag- pol sequences can be achieved by a skilled worker.
  • retroviral variants described which can be used as a starting point for generating a codon-optimised gag-pol sequence.
  • Lentiviral genomes can be quite variable. For example there are many quasi- species of HIV-1 which are still functional. This is also the case for EIAV. These variants may be used to enhance particular parts of the transduction process. Examples of HIV-1 variants may be found at the HIV Databases operated by Los Alamos National Security, LLC at http://hiv-web.lanl.gov. Details of EIAV clones may be found at the National Center for Biotechnology Information (NCBI) database located at http://www.ncbi.nlm.nih.gov.
  • NCBI National Center for Biotechnology Information
  • the strategy for codon-optimised gag-pol sequences can be used in relation to any retrovirus. This would apply to all lentiviruses, including EIAV, FIV, BIV, CAEV, VMR, SIV, HIV-1 and HIV-2. In addition this method could be used to increase expression of genes from HTLV-1 , HTLV-2, HFV, HSRV and human endogenous retroviruses (HERV), MLV and other retroviruses.
  • HERV human endogenous retroviruses
  • Codon optimisation can render gag-pol expression Rev-independent.
  • the genome also needs to be modified. This is achieved by optimising vector genome components.
  • these modifications also lead to the production of a safer system absent of all additional proteins both in the producer and in the transduced cell.
  • Another aspect of the invention relates to the viral vector of the invention or a cell or tissue transduced with the viral vector of the invention for use in medicine.
  • Another aspect of the invention relates to the use of the viral vector of the invention or a cell or tissue transduced with the viral vector of the invention in medicine.
  • Another aspect of the invention relates to the use of the viral vector of the invention, a production cell of the invention or a cell or tissue transduced with the viral vector of the invention for the preparation of a medicament to deliver a nucleotide of interest to a target site in need of the same.
  • Such uses of the viral vector or transduced cell of the invention may be for therapeutic or diagnostic purposes, as described previously.
  • a retroviral vector of the invention may be used to introduce the three genes that encode three enzymes of the dopamine synthetic pathway to treat Parkinson's disease.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector, derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • HIV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • the genes carried by the retroviral vector may comprise a truncated form of the human tyrosine hydroxylase (TH*) gene (which lacks the N-terminal 160 amino acids involved in feedback regulation of TH), the human aromatic L-amino-acid decarboxylase (AADC), and the human GTP-cyclohydrolase 1 (CH1) gene.
  • the three enzymes may be encoded by the retroviral vector in three separate open reading frames.
  • the retroviral vector may encode a fusion of the TH and CH 1 enzymes in a first open reading frame and the AADC enzyme in a second open reading frame.
  • Expression of the genes may be driven by a CMV promoter, and the expression cassette may include one or more IRES elements.
  • the retroviral vector may be administered by direct injection into the striatum of the brain.
  • a retroviral vector of the invention may be used as a gene therapy product designed to introduce the corrective MY07A gene to photoreceptors and supporting retinal pigment epithelial (RPE) cells and thereby attenuate or reverse the deterioration in vision which is associated with Usher 1 B Syndrome.
  • the retroviral vector is a non- replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV- G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is the MY07A cDNA, which codes for the MY07A protein (a large gene which is over 100mb in length). Expression of the large MY07A gene may be driven by a CMV promoter, a CMV/MY07A chimeric promoter or an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce the corrective ATP-binding cassette gene, ABCA4 (also known as ABCR), to photoreceptors and thereby attenuate or reverse the pathophysiology which leads to Stargardt disease.
  • ABCA4 also known as ABCR
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from
  • HIV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • the gene carried by the retroviral vector is the ABCA4 cDNA, which codes for ABCA4 protein.
  • ABCA4 gene may be driven by a CMV promoter, a photoreceptor-specific promoter, such as rhodopsin kinase or an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used as a gene therapy product designed to prevent recurrence of aberrant blood vessel growth and/or vascular leakage in the eyes of patients with wet-form age-related macular degeneration (AMD), diabetic macular oedema or retinal vein occlusion, and/or to prevent aberrant blood vessel growth in the eyes of patients with dry-form age-related macular degeneration (AMD).
  • This retroviral vector delivers a gene or genes encoding an anti-angiogenic protein or proteins, such as angiostatin and/or endostatin.
  • the retroviral vector is a non-replicating, self- inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • HIV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • the retroviral vector expresses human endostatin and angiostatin genes in a bicistronic configuration utilising an internal ribosome entry site (IRES) for delivery to retinal pigment epithelial cells.
  • IVS internal ribosome entry site
  • Expression of the anti- angiogenic gene(s) may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used as a gene therapy product designed to prevent recurrence of aberrant blood vessel growth in oedema in the eyes of patients with wet-form age-related macular degeneration (AMD).
  • This retroviral vector delivers a gene or genes encoding an anti-angiogenic protein or proteins, such as angiostatin and/or endostatin.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • EIAV Equine infectious anaemia virus
  • the retroviral vector expresses human endostatin and angiostatin genes in a bicistronic configuration utilising an internal ribosome entry site (IRES) for delivery to retinal pigment epithelial cells.
  • IRS internal ribosome entry site
  • Expression of the anti-angiogenic gene(s) may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • VMD2 vitelliform macular dystrophy 2
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used as a gene therapy product designed to prevent corneal graft rejection as a result of neovascularization by delivery of anti-angiogenic gene(s) to the donor cornea prior to grafting.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G, Ebola or an alternative viral envelope protein.
  • HIV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • the retroviral vector will express anti-angiogenic gene(s) such as human endostatin and angiostatin genes in a bicistronic configuration utilizing an internal ribosome entry site (IRES) for ex vivo delivery to corneal grafts.
  • the retroviral vector may be applied to corneal graft tissue ex vivo, and the transduced donor tissue may also be stored prior to transplantation.
  • Expression of the anti-angiogenic gene(s) may be driven by a constitutive promoter such as the CMV promoter; however it is also possible that alternative promoters may be used.
  • a retroviral vector of the invention may be used as a gene therapy designed to prevent recurrence of aberrant blood vessel growth and/or vascular leakage in the eyes of patients with wet-form age-related macular degeneration (AMD), diabetic macular oedema or retinal vein occlusion, and/or to prevent aberrant blood vessel growth in the eyes of patients with dry-form age-related macular degeneration (AMD).
  • ALD age-related macular degeneration
  • This retroviral vector delivers a gene encoding a soluble form of fms-like tyrosine kinase.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • HMV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • Expression of the soluble Flt-1 gene may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • VMD2 vitelliform macular dystrophy 2
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used as a gene therapy product designed to prevent recurrence of aberrant blood vessel growth and/or vascular leakage in the eyes of patients with wet-form age-related macular degeneration (AMD), diabetic macular oedema or retinal vein occlusion, and/or to prevent aberrant blood vessel growth in the eyes of patients with dry-form age-related macular degeneration (AMD).
  • ALD age-related macular degeneration
  • This retroviral vector delivers a gene or genes encoding the pigment epithelium-derived factor protein (PEDF).
  • PEDF pigment epithelium-derived factor protein
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus
  • EIAV EIAV which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • PEDF vitelliform macular dystrophy 2
  • VMD2 vitelliform macular dystrophy 2
  • bestrophin promoter a promoter that promotes the expression of the PEDF gene.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used as a gene therapy product designed to prevent recurrence of aberrant blood vessel growth and/or vascular leakage in the eyes of patients with wet-form age-related macular degeneration (AMD), diabetic macular oedema or retinal vein occlusion, and/or to prevent aberrant blood vessel growth in the eyes of patients with dry-form age-related macular degeneration (AMD).
  • AMD wet-form age-related macular degeneration
  • AMD dry-form age-related macular degeneration
  • This retroviral vector delivers a gene or genes encoding an inhibitor of vascular endothelial growth factor (VEGF), such as an anti-VEGF antibody or binding fragment thereof, a VEGF specific aptamer or a VEGF blocking peptide or polypeptide including, but not limited to, a soluble form of a VEGF receptor and/or an inhibitor of platelet-derived growth factor (PDGF), such as an anti-PDGF antibody or binding fragment thereof, a PDGF specific aptamer or a PDGF blocking peptide or polypeptide including, but not limited to, a soluble form of a PDGF receptor.
  • VEGF vascular endothelial growth factor
  • PDGF platelet-derived growth factor
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the retroviral vector expresses an inhibitor of VEGF and an inhibitor of PDGF in a bicistronic configuration utilising an internal ribosome entry site (IRES) for delivery to retinal pigment epithelial cells.
  • IRS internal ribosome entry site
  • Expression of the gene(s) may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce the corrective gene vitelliform macular dystrophy 2 (VMD2) and a cassette encoding a micro-
  • RNA specific for the disease-associated form of VMD2, or the corrective
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • HIV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • Expression of the genes may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • VMD2 vitelliform macular dystrophy 2
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce the corrective retinaldehyde binding protein 1 gene, RLBP1 , to retinal pigment epithelial cells and thereby attenuate or reverse the pathophysiology which leads to RLBP1-associated retinal dystrophy.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is the RLBP1 cDNA, which codes for RLBP1 protein.
  • Expression of the RLBP1 gene may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used as a gene therapy product designed to treat glaucoma.
  • This retroviral vector delivers a gene or genes encoding COX-2 and/or Prostaglandin F2a receptor (FPR) which act to reduce intraocular pressure.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the retroviral vector expresses COX-2 and Prostaglandin F2a receptor (FPR).
  • genes in a bicistronic configuration utilizing an internal ribosome entry site (IRES) for delivery to the anterior chamber of the eye may be driven by CMV or an alternative promoter.
  • the retroviral vector may be administered by transcorneal injection.
  • a retroviral vector of the invention may be used to introduce the corrective harmonin gene to attenuate or reverse the pathophysiology which leads to Usher Syndrome 1 c.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is the harmonin cDNA, which codes for the harmonin protein. Expression of the harmonin gene may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce the corrective Rab escort protein 1 (REP1) gene to attenuate or reverse the pathophysiology which leads to choroideremia.
  • the retroviral vector is a non-replicating, self- inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is the REP1 cDNA, which codes for the REP1 protein. Expression of the REP1 gene may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce the corrective Cyclic Nucleotide Gated Channel Beta 2 (CNGB2) and/or Cyclic Nucleotide Gated Channel Alpha 3 (CNGA3) genes(s) into the eye to attenuate or reverse the pathophysiology which leads to Achromatopsia.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene(s) carried by the retroviral vector are the CNGB2 and/or CNGA3 gene(s), that code for the CNGB2 and/or CNGA3 proteins. Expression of the gene(s) may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce the corrective CEP290 gene into the eye to attenuate or reverse the pathophysiology which leads to Leber Congenital Amaurosis (LCA).
  • the retroviral vector is a non-replicating, self- inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is the CEP290 gene, that codes for the centrosomal protein of 290 kDa. Expression of the CEP290 gene may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce the corrective retinitis pigmentosa GTPase regulator (RPGR) gene into the eye to attenuate or reverse the pathophysiology which leads to x-linked retinitis pigmentosa.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is the RPGR cDNA, which codes for the RPGR protein. Expression of the RPGR gene may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce the corrective retinoschisin 1 (RS1) gene into the eye to attenuate or reverse the pathophysiology which leads to x-linked retinochisis.
  • the retroviral vector is a non- replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV- G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is the RS1 cDNA, which codes for the RS1 protein. Expression of the RS1 gene may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce the corrective retinitis pigmentosa 1 (RP1) gene into the eye to attenuate or reverse the pathophysiology which leads to retinitis pigmentosa.
  • the retroviral vector is a non- replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV- G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is the RP1 cDNA, which codes for the RP1 protein.
  • Expression of the RP1 gene may be driven by a CMV promoter, a photoreceptor-specific promoter, such as rhodopsin kinase or an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce the corrective retinal pigment epithelium-specific 65 kDa protein (RPE65) gene to attenuate or reverse the pathophysiology which leads to Leber congenital amaurosis (LCA) type 2.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is the RPE65 cDNA, which codes for the RPE65 protein.
  • RPE65 gene may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • VMD2 vitelliform macular dystrophy 2
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce the corrective human proline/arginine-rich end leucine-rich repeat protein (PRELP) gene to attenuate or reverse the pathophysiology which leads to wet-form age-related macular degeneration (AMD), dry-form AMD, diabetic macular oedema or retinal vein occlusion.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is the PRELP cDNA, which codes for the PRELP protein.
  • Expression of the PRELP gene may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce a nucleic acid sequence encoding a synthetic myocilin-specific miRNA into the eye to attenuate or reverse the pathophysiology which leads to juvenile open angle glaucoma by knocking down the expression of myocilin.
  • the retroviral vector is a non-replicating, self- inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein. Expression of the synthetic myocilin-specific miRNA may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a retroviral vector of the invention may be used to introduce rate- limiting enzyme(s) from the glutathione biosynthesis pathway, glutamate-cysteine ligase (GCL) and/or glutathione synthetase (GSS), and /or a nucleic acid sequence encoding a synthetic gamma-glutamyltransferase (GGT) specific miRNA into the eye to attenuate or reverse the pathophysiology which leads to retinitis pigmentosa by gene augmentation and/or knock-down.
  • GCL glutamate-cysteine ligase
  • GSS glutathione synthetase
  • GGT synthetic gamma-glutamyltransferase
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector, for example derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV), which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • HCV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • Expression of the GCL and/or GSS gene(s) and/or the synthetic GGT specific miRNA may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector may express the gene(s) and/or the synthetic miRNA in a multicistronic configuration utilising one or more internal ribosome entry site (IRES).
  • the retroviral vector may be administered by direct delivery to the anterior chamber of the eye.
  • a retroviral vector of the invention may be used as a gene therapy product designed to treat neurodegenerative disorders such as frontotemporal lobe dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease and motor neuron disorders such as Amyotrophic Lateral Sclerosis (ALS).
  • This retroviral vector delivers a gene encoding a VEGF protein; which may be a VEGF-A isoform such as VEGF 45 , VEGF 65 , or VEGF 89; or may be VEGF-B, VEGF-C, or VEGF-D, such genes having a neuroprotective effect.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with Rabies G or VSV-G or an alternative viral envelope protein. Expression of the gene may be driven by CMV or an alternative promoter.
  • the retroviral vector may be administered by direct injection into large muscle groups or by direct injection into the cerebrospinal fluid via intrathecal or intraventricular injection.
  • a retroviral vector of the invention may be used as a gene therapy product designed to treat cystic fibrosis.
  • This retroviral vector delivers a gene encoding cystic fibrosis transmembrane conductance regulator (CFTR).
  • the retroviral vector is a non- replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with Flu- HA, Sendai virus envelope F or HN, Ebola, baculovirus GP64 or an alternative viral envelope protein. Expression of the gene may be driven by CMV or an alternative promoter.
  • the retroviral vector may be administered intranasally, by use of a nebuliser, or by direct delivery via bronchial alveolar lavage into the lungs.
  • a retroviral vector of the invention may be used to introduce the corrective N-Sulfoglucosamine Sulfohydrolase (SGSH) and/or Sulfatase Modifying Factor 1 (SUMF1) gene(s) into the brain to attenuate or reverse the pathophysiology which leads to Sanfilipo syndrome A.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene(s) carried by the retroviral vector are the SGSH cDNA, which codes for the SGSH protein and/or the SUMF1 gene which codes for the SUMF1 protein. Expression of the gene(s) may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector may express the SGSH and SUMF1 genes in a bicistronic configuration utilising an internal ribosome entry site (IRES).
  • the retroviral vector may be administered by direct intracerebral injection.
  • a retroviral vector of the invention may be used to introduce the corrective acid-alpha glycosidase (GAA) gene into large muscle groups and/or the lungs to attenuate or reverse the pathophysiology which leads to Pompe Disease.
  • GAA corrective acid-alpha glycosidase
  • This retroviral vector delivers a gene encoding a GAA protein.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with Flu-HA, Sendai virus envelope F or HN, Ebola, baculovirus GP64, Rabies G, VSV-G or an alternative viral envelope protein.
  • the retroviral vector may be administered by; (i) direct injection into large muscle groups and/or (ii) intranasally, by use of a nebuliser, or by direct delivery via bronchial alveolar lavage into the lungs.
  • a retroviral vector of the invention may be used ex vivo to transduce autologous or allogeneic T cells with a nucleic acid sequence encoding a CD19-specific chimeric antigen receptor (CAR19). These transduced T cells are then infused into a subject to treat cancers and leukaemias expressing CD19.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • HCV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • Expression of the CAR encoding nucleic acid sequence may be driven by EF1 a, CMV or an alternative promoter.
  • a retroviral vector of the invention may be used ex vivo to transduce autologous or allogeneic T cells with a nucleic acid sequence encoding a 5T4-specific chimeric antigen receptor (CAR). These transduced T cells then are infused into a subject to treat cancers and leukaemias expressing 5T4.
  • the retroviral vector is a non-replicating, self- inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • HCV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • Expression of the 5T4 CAR-encoding nucleic acid sequence may be driven by EF1 a, CMV or an alternative promoter.
  • chimeric antigen receptors can be produced that are specific for a range of cancer or leukaemia-associated polypeptides.
  • a retroviral vector of the invention may be used ex vivo to transduce autologous or allogeneic T cells with a nucleic acid sequence encoding a chimeric antigen receptor (CAR) specific for any cancer or leukaemia-associated polypeptide. These transduced T cells then are infused into a subject to treat cancers and leukaemias expressing the cancer or leukaemia- associated polypeptide to which the CAR binds.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • HIV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • Expression of the CAR-encoding nucleic acid sequence may be driven by EF1 a, CMV or an alternative promoter.
  • Suitable cancer or leukaemia- associated polypeptides that may be targeted by said CARs include, but are not limited to, the following: mesothelin, folate receptor a, kappa light chain of immunoglobulin, CD30, Carcinoembryonic antigen (CEA), CD138, Ganglioside G2 (GD2), CD33, CD22, Epidermal growth factor receptors (EGFRs) such as EGFR VIII, IL-13Ra2, CD20, ErbBs such as Her2, prostate-specific membrane antigen (PSMA), Lewis Y antigen and fibroblast activation protein (FAB).
  • CARs include, but are not limited to, the following: mesothelin, folate receptor a, kappa light chain of immunoglobulin, CD30, Carcinoembryonic antigen (CEA), CD138, Ganglioside G2 (GD2), CD33, CD22, Epidermal growth factor receptors (EGFRs) such as EGFR VIII, IL-13Ra
  • a retroviral vector of the invention may be used ex vivo to transduce autologous or allogeneic T cells with a nucleic acid sequence encoding a T cell receptor (TCR) which is specific for a peptide-MHC expressed on diseased, leukemic or cancerous cells. These transfected T cells then are infused into a subject to treat the disease, cancer or leukaemia that is associated with the expression of the peptide-MHC to which the TCR binds.
  • TCR T cell receptor
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • HSV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • Expression of the TCR-encoding nucleic acid sequence may be driven by EF1 a, CMV or an alternative promoter.
  • the TCRs that are encoded by the vectors of the invention may be single-chain TCRs (scTCRs) or dimeric TCRs (dTCRs).
  • scTCRs single-chain TCRs
  • dTCRs dimeric TCRs
  • suitable dTCRs include those described in WO 2003/020763 and suitable scTCRs include those described in WO 1999/018129.
  • the T cells transfected with TCRs may be used to treat AIDs, leukaemia, and cancers including myelomas and sarcomas.
  • a retroviral vector of the invention may be used to introduce the gene that encodes the common gamma chain (CD132) to treat x-linked Severe combined immunodeficiency (SCID).
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector, derived from Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein. Expression of the gene may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector of the invention may be used ex vivo to transduce bone marrow stem cells. These transduced bone marrow stem cells can then be infused into a subject to treat the disease.
  • a retroviral vector of the invention may be used to introduce the gene that encodes adenosine deaminase to treat ADA Severe combined immunodeficiency (SCID).
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector, derived from derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein. Expression of the gene may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector of the invention may be used ex vivo to transduce bone marrow stem cells. These transduced bone marrow stem cells can then be infused into a subject to treat the disease.
  • a retroviral vector of the invention may be used to introduce the gene that encodes the WAS protein to treat Wskott-Aldrich Syndrome (WAS).
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector, derived from derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein. Expression of the gene may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector of the invention may be used ex vivo to transduce bone marrow stem cells. These transduced bone marrow stem cells can then be infused into a subject to treat the disease.
  • a retroviral vector of the invention may be used to introduce a gene that encodes one of several globins, including wild-type ⁇ -globin, wild-type fetal globin, and mutated "anti-sickling" globins to treat Sickle Cell disease or thalassemia.
  • anti-sickling globins include, but are not limited to those described in WO 2014/043131 and WO 1996/009385.
  • the retroviral vector is a non- replicating, self-inactivating minimal lentiviral vector, derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV- G or an alternative viral envelope protein. Expression of the gene may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector of the invention may be used ex vivo to transduce bone marrow stem cells. These transduced bone marrow stem cells can then be infused into a subject to treat the disease.
  • a retroviral vector of the invention may be used to introduce a corrective gene, Factor VIII, to liver, muscle or adipose cells to treat haemophilia A.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from the derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • HIV Human immunodeficiency virus
  • EIAV Equine infectious anaemia virus
  • the gene carried by the retroviral vector is Factor VIII. Expression of the Factor VIII gene may be driven by a CMV promoter or an alternative promoter.
  • a retroviral vector of the invention may be used to introduce a corrective gene, Factor IX, to liver, muscle or adipose cells to treat haemophilia B.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector derived from the derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is Factor IX. Expression of the Factor IX gene may be driven by a CMV promoter or an alternative promoter.
  • a retroviral vector of the invention may be used to introduce the gene that encodes alpha galactosidase A (a-GAL A) to treat Fabry disease.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector, derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is the GLA cDNA, which codes for the a-GAL A protein Expression of the gene may be driven by a CMV promoter or an alternative promoter.
  • the retroviral vector of the invention may be used ex vivo to transduce hematopoietic CD34 + stem cells. These transduced hematopoietic CD34 + stem cells can then be infused into a subject to treat the disease.
  • a retroviral vector of the invention may be used to introduce the gene that encodes a deficient enzyme to treat a form of porphyria.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector, derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is that encoding the deficient enzyme associated with the type of porphyria to be treated selected from the table below. Expression of the gene may be driven by a CMV promoter or an alternative promoter.
  • a retroviral vector of the invention may be used to introduce the gene that encodes a deficient enzyme to treat a form of mucopolysaccharidosis.
  • the retroviral vector is a non-replicating, self-inactivating minimal lentiviral vector, derived from Human immunodeficiency virus (HIV) or Equine infectious anaemia virus (EIAV) which may be pseudotyped with VSV-G or an alternative viral envelope protein.
  • the gene carried by the retroviral vector is that encoding the deficient enzyme associated with the type of musocpolysaccharidosis to be treated selected from the table below. Expression of the gene may be driven by a CMV promoter or an alternative promoter.
  • Retroviral vectors of the invention may be produced by the transient transfection of HEK293T cells with four plasmids: (1) the recombinant retroviral vector genome plasmid encoding the required transgene(s) and a binding site that is capable of interacting with an RNA-binding protein,
  • envelope (env) expression plasmid which may, for example, express VSV-G
  • retroviral vectors of the invention such as HIV, may be produced by the transient transfection of HEK293T cells with five plasmids:
  • envelope (env) expression plasmid which may, for example, express VSV-G,
  • a transient transfection system may utilise a cell line which stably expresses the RNA-binding protein of the invention (for example, TRAP).
  • TRAP RNA-binding protein of the invention
  • retroviral vectors of the invention may be produced by using packaging cells that stably express (1) gag/pol, (2) env and (3) the RNA-binding protein, and, for HIV vectors, Rev, and wherein a plasmid encoding the recombinant retroviral vector genome encoding the required transgene(s) and a binding site that is capable of interacting with the an RNA-binding protein, and for HIV vectors, includes the RRE sequence, is introduced into such cells by transient transfection.
  • retroviral vectors of the invention may be produced in producer cells that stably express (1) gag/pol, (2) env, (3) the RNA-binding protein, (4) the recombinant EIAV vector genome encoding the required transgene(s) and a binding site that is capable of interacting with an RNA-binding protein.
  • HIV vectors of the invention may be produced in producer cells that stably express (1) gag/pol, (2) env, (3) the RNA-binding protein, (4) the recombinant HIV vector genome encoding the required transgene(s), a binding site that is capable of interacting with an RNA-binding protein, and the RRE sequence, and (5) REV.
  • an AAV vector of the invention may be used to introduce the three genes that encode three enzymes of the dopamine synthetic pathway to treat Parkinson's disease.
  • the genes carried by the AAV vector may comprise a truncated form of the human tyrosine hydroxylase (TH*) gene (which lacks the N-terminal 160 amino acids involved in feedback regulation of TH), the human aromatic L-amino-acid decarboxylase (AADC), and the human GTP-cyclohydrolase 1 (CH1) gene.
  • the three enzymes may be encoded by the AAV vector in three separate open reading frames.
  • the AAV vector may encode a fusion of the TH and CH1 enzymes in a first open reading frame and the AADC enzyme in a second open reading frame.
  • the genes may be driven by a CMV promoter, and the expression cassette may include one or more IRES elements.
  • the AAV vector may be administered by direct injection into the striatum of the brain.
  • an AAV vector of the invention may be used as a gene therapy product designed to introduce the corrective MY07A gene to photoreceptors and supporting retinal pigment epithelial (RPE) cells and thereby attenuate or reverse the deterioration in vision which is associated with Usher 1 B Syndrome.
  • the gene carried by the AAV vector is the MY07A cDNA, which codes for the MY07A protein (a large gene which is over 100mb in length). Expression of the large MY07A gene may be driven by a CMV promoter, a CMV/MY07A chimeric promoter or an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce the corrective ATP-binding cassette gene, ABCA4 (also known as ABCR), to photoreceptors and thereby attenuate or reverse the pathophysiology which leads to Stargardt disease.
  • ABCA4 also known as ABCR
  • the gene carried by the AAV vector is the ABCA4 cDNA, which codes for ABCA4 protein.
  • Expression of the ABCA4 gene may be driven by a CMV promoter, a photoreceptor-specific promoter, such as rhodopsin kinase or an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used as a gene therapy product designed to prevent recurrence of aberrant blood vessel growth and/or vascular leakage in the eyes of patients with wet-form age-related macular degeneration (AMD), diabetic macular oedema or retinal vein occlusion, and/or to prevent aberrant blood vessel growth in the eyes of patients with dry-form age-related macular degeneration (AMD).
  • AAV vector delivers a gene or genes encoding an anti-angiogenic protein or proteins, such as angiostatin and/or endostatin.
  • the AAV vector expresses human endostatin and angiostatin genes in a bicistronic configuration utilising an internal ribosome entry site (IRES) for delivery to retinal pigment epithelial cells.
  • IRS internal ribosome entry site
  • Expression of the anti- angiogenic gene(s) may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • VMD2 vitelliform macular dystrophy 2
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used as a gene therapy product designed to prevent corneal graft rejection as a result of neovascularization by delivery of anti-angiogenic gene(s) to the donor cornea prior to grafting.
  • the AAV vector will express anti-angiogenic gene(s) such as human endostatin and angiostatin genes in a bicistronic configuration utilizing an internal ribosome entry site (IRES) for ex vivo delivery to corneal grafts.
  • IRS internal ribosome entry site
  • the AAV vector may be applied to corneal graft tissue ex vivo, and the transduced donor tissue may also be stored prior to transplantation.
  • an AAV vector of the invention may be used as a gene therapy designed to prevent recurrence of aberrant blood vessel growth and/or vascular leakage in the eyes of patients with wet-form age-related macular degeneration (AMD), diabetic macular oedema or retinal vein occlusion, and/or to prevent aberrant blood vessel growth in the eyes of patients with dry-form age-related macular degeneration (AMD).
  • ALD wet-form age-related macular degeneration
  • AMD diabetic macular oedema or retinal vein occlusion
  • This AAV vector delivers a gene encoding a soluble form of fms-like tyrosine kinase.
  • Soluble Flt-1 Expression of the soluble Flt-1 gene may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • a AAV vector of the invention may be used as a gene therapy product designed to prevent recurrence of aberrant blood vessel growth and/or vascular leakage in the eyes of patients with wet-form age-related macular degeneration (AMD), diabetic macular oedema or retinal vein occlusion, and/or to prevent aberrant blood vessel growth in the eyes of patients with dry-form age-related macular degeneration (AMD).
  • AAV vector delivers a gene or genes encoding the pigment epithelium-derived factor protein (PEDF).
  • PEDF pigment epithelium-derived factor protein
  • PEDF vitelliform macular dystrophy 2
  • VMD2 vitelliform macular dystrophy 2
  • bestrophin promoter a promoter that promotes the expression of the PEDF gene.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used as a gene therapy product designed to prevent recurrence of aberrant blood vessel growth and/or vascular leakage in the eyes of patients with wet-form age-related macular degeneration (AMD), diabetic macular oedema or retinal vein occlusion, and/or to prevent aberrant blood vessel growth in the eyes of patients with dry-form age-related macular degeneration (AMD).
  • AMD wet-form age-related macular degeneration
  • AMD dry-form age-related macular degeneration
  • This AAV vector delivers a gene or genes encoding an inhibitor of vascular endothelial growth factor (VEGF), such as an anti-VEGF antibody or binding fragment thereof, a VEGF specific aptamer or a VEGF blocking peptide or polypeptide including, but not limited to, a soluble form of a VEGF receptor and/or an inhibitor of platelet-derived growth factor (PDGF), such as an anti-PDGF antibody or binding fragment thereof, a PDGF specific aptamer or a PDGF blocking peptide or polypeptide including, but not limited to, a soluble form of a PDGF receptor.
  • VEGF vascular endothelial growth factor
  • PDGF platelet-derived growth factor
  • the AAV vector expresses an inhibitor of VEGF and an inhibitor of PDGF in a bicistronic configuration utilising an internal ribosome entry site (IRES) for delivery to retinal pigment epithelial cells.
  • IRS internal ribosome entry site
  • Expression of the gene(s) may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • VMD2 vitelliform macular dystrophy 2
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce the corrective gene vitelliform macular dystrophy 2 (VMD2) and a cassette encoding a micro- RNA (miRNA) specific for the disease-associated form of VMD2, or the corrective Peripherin 2 encoding RDS gene and a cassette encoding an miRNA specific for the disease-associated form of RDS to retinal pigment epithelial cells and thereby attenuate or reverse the pathophysiology which leads to Best disease or Best vitelliform macular degeneration (BVMD).
  • VMD2 micro- RNA
  • Expression of the genes may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • VMD2 vitelliform macular dystrophy 2
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce the corrective retinaldehyde binding protein 1 gene, RLBP1 , to retinal pigment epithelial cells and thereby attenuate or reverse the pathophysiology which leads to RLBP1-associated retinal dystrophy.
  • the gene carried by the AAV vector is the RLBP1 cDNA, which codes for RLBP1 protein.
  • Expression of the RLBP1 gene may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used as a gene therapy product designed to treat glaucoma.
  • This AAV vector delivers a gene or genes encoding COX-2 and/or Prostaglandin F2a receptor (FPR).
  • the AAV vector expresses COX-2 and Prostaglandin F2a receptor (FPR).
  • the AAV vector may be administered by transcorneal injection.
  • an AAV vector of the invention may be used to introduce the corrective harmonin gene to attenuate or reverse the pathophysiology which leads to Usher Syndrome 1 c.
  • the gene carried by the AAV vector is the harmonin cDNA, which codes for the harmonin protein.
  • Expression of the harmonin gene may be driven by a CMV promoter or an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce the corrective Rab escort protein 1 (REP1) gene to attenuate or reverse the pathophysiology which leads to choroideremia.
  • the gene carried by the AAV vector is the REP1 cDNA, which codes for the REP1 protein.
  • Expression of the REP1 gene may be driven by a CMV promoter or an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce the corrective Cyclic Nucleotide Gated Channel Beta 2 (CNGB2) and/or Cyclic Nucleotide Gated Channel Alpha 3 (CNGA3) genes(s) into the eye to attenuate or reverse the pathophysiology which leads to Achromatopsia.
  • the gene(s) carried by the AAV vector are the CNGB2 and/or CNGA3 gene(s), that code for the CNGB2 and/or CNGA3 proteins. Expression of the gene(s) may be driven by a CMV promoter or an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce the corrective CEP290 gene into the eye to attenuate or reverse the pathophysiology which leads to Leber Congenital Amaurosis (LCA).
  • the gene carried by the AAV vector is the CEP290 gene, that codes for the centrosomal protein of 290 kDa.
  • Expression of the CEP290 gene may be driven by a CMV promoter or an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce the corrective retinitis pigmentosa GTPase regulator (RPGR) gene into the eye to attenuate or reverse the pathophysiology which leads to x-linked retinitis pigmentosa.
  • the gene carried by the AAV vector is the RPGR cDNA, which codes for the RPGR protein. Expression of the RPGR gene may be driven by a CMV promoter or an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce the corrective retinoschisin 1 (RS1) gene into the eye to attenuate or reverse the pathophysiology which leads to x-linked retinochisis.
  • the gene carried by the AAV vector is the RS1 cDNA, which codes for the RS1 protein.
  • Expression of the RS1 gene may be driven by a CMV promoter or an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce the corrective retinitis pigmentosa 1 (RP1) gene into the eye to attenuate or reverse the pathophysiology which leads to retinitis pigmentosa.
  • the gene carried by the AAV vector is the RP1 cDNA, which codes for the RP1 protein.
  • Expression of the RP1 gene may be driven by a CMV promoter, a photoreceptor-specific promoter, such as rhodopsin kinase or an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce the corrective retinal pigment epithelium-specific 65 kDa protein (RPE65) gene to attenuate or reverse the pathophysiology which leads to Leber congenital amaurosis (LCA) type 2.
  • the gene carried by the AAV vector is the RPE65 cDNA, which codes for the RPE65 protein.
  • Expression of the RPE65 gene may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • VMD2 vitelliform macular dystrophy 2
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV of the invention may be used to introduce the corrective human proline/arginine-rich end leucine-rich repeat protein (PRELP) gene to attenuate or reverse the pathophysiology which leads to wet-form age-related macular degeneration (AMD), dry-form AMD, diabetic macular oedema or retinal vein occlusion.
  • the gene carried by the AAV vector is the PRELP cDNA, which codes for the PRELP protein.
  • Expression of the PRELP gene may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • VMD2 vitelliform macular dystrophy 2
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce a nucleic acid sequence encoding a synthetic myocilin-specific miRNA into the eye to attenuate or reverse the pathophysiology which leads to juvenile open angle glaucoma by knocking down the expression of myocilin.
  • Expression of the synthetic myocilin-specific miRNA may be driven by a CMV promoter or an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used to introduce rate- limiting enzyme(s) from the glutathione biosynthesis pathway, glutamate-cysteine ligase (GCL) and/or glutathione synthetase (GSS), and /or a nucleic acid sequence encoding a synthetic gamma-glutamyltransferase (GGT) specific miRNA into the eye to attenuate or reverse the pathophysiology which leads to retinitis pigmentosa by gene augmentation and/or knock-down.
  • GCL glutamate-cysteine ligase
  • GSS glutathione synthetase
  • GGT gamma-glutamyltransferase
  • Expression of the GCL and/or GSS gene(s) and/or the synthetic GGT specific miRNA may be driven by a CMV promoter or an alternative promoter.
  • the AAV vector may express the gene(s) and/or the synthetic miRNA in a multicistronic configuration utilising one or more internal ribosome entry site (I RES).
  • the AAV vector may be administered by direct delivery to the anterior chamber of the eye.
  • an AAV vector of the invention may be used as a gene therapy product designed to treat neurodegenerative disorders such as frontotemporal lobe dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease and motor neuron disorders such as Amyotrophic Lateral Sclerosis (ALS).
  • This AAV vector delivers a gene encoding a VEGF protein; which may be a VEGF-A isoform such as VEGFi 45 , VEGFi 6 5, or VEGFi 89; or may be VEGF-B, VEGF-C, or VEGF-D, such genes having a neuroprotective effect. Expression of the gene may be driven by CMV or an alternative promoter.
  • the AAV vector may be administered by direct injection into large muscle groups or by direct injection into the cerebrospinal fluid via intrathecal or intraventricular injection.
  • an AAV vector of the invention may be used as a gene therapy product designed to treat cystic fibrosis.
  • This AAV vector delivers a gene encoding cystic fibrosis transmembrane conductance regulator (CFTR). Expression of the gene may be driven by CMV or an alternative promoter.
  • the AAV vector may be administered intranasally, by use of a nebuliser, or by direct delivery via bronchial alveolar lavage into the lungs.
  • an AAV vector of the invention may be used to introduce the corrective N-Sulfoglucosamine Sulfohydrolase (SGSH) and/or Sulfatase Modifying Factor 1 (SUMF1) gene(s) into the brain to attenuate or reverse the pathophysiology which leads to Sanfilipo syndrome A.
  • the gene(s) carried by the AAV vector are the SGSH cDNA, which codes for the SGSH protein and/or the SUMF1 gene which codes for the SUMF1 protein. Expression of the gene(s) may be driven by a CMV promoter or an alternative promoter.
  • the AAV vector may express the SGSH and SUMF1 genes in a bicistronic configuration utilising an internal ribosome entry site (IRES).
  • the AAV vector may be administered by direct intracerebral injection.
  • an AAV vector of the invention may be used to introduce the corrective acid-alpha glycosidase (GAA) gene into large muscle groups and/or the lungs to attenuate or reverse the pathophysiology which leads to Pompe Disease.
  • GAA acid-alpha glycosidase
  • This AAV vector delivers a gene encoding a GAA protein. Expression of the gene may be driven by CMV or an alternative promoter.
  • the AAV vector may be administered by; (i) direct injection into large muscle groups and/or (ii) intranasally, by use of a nebuliser, or by direct delivery via bronchial alveolar lavage into the lungs.
  • an AAV vector of the invention may be used to introduce a corrective gene, Factor VIII, to liver, muscle or adipose cells to treat haemophilia A.
  • the gene carried by the AAV vector is Factor VIII.
  • Expression of the Factor VIII gene may be driven by a CMV promoter or an alternative promoter.
  • an AAV vector of the invention may be used to introduce a corrective gene, Factor IX, to liver, muscle or adipose cells to treat haemophilia B.
  • the gene carried by the AAV vector is Factor IX. Expression of the Factor IX gene may be driven by a CMV promoter or an alternative promoter.
  • an AAV vector of the invention may be used to introduce the gene that encodes a deficient enzyme to treat a form of porphyria.
  • the gene carried by the AAV vector is that encoding the deficient enzyme associated with the type of porphyria to be treated selected from the table below. Expression of the gene may be driven by a CMV promoter or an alternative promoter.
  • an AAV vector of the invention may be used to introduce the gene that encodes a deficient enzyme to treat a form of mucopolysaccharidosis.
  • the gene carried by the AAV vector is that encoding the deficient enzyme associated with the type of musocpolysaccharidosis to be treated selected from the table below. Expression of the gene may be driven by a CMV promoter or an alternative promoter.
  • an AAV vector of the invention may be used as a gene therapy product designed to prevent recurrence of aberrant blood vessel growth in oedema in the eyes of patients with wet-form age-related macular degeneration (AMD).
  • AAV vector delivers a gene or genes encoding an anti-angiogenic protein or proteins, such as angiostatin and/or endostatin.
  • the AAV vector expresses human endostatin and angiostatin genes in a bicistronic configuration utilising an internal ribosome entry site (IRES) for delivery to retinal pigment epithelial cells.
  • Expression of the anti- angiogenic gene(s) may be driven by CMV, an RPE-specific promoter such as the vitelliform macular dystrophy 2 (VMD2) promoter (more recently known as the bestrophin promoter) or by an alternative promoter.
  • the AAV vector may be administered by direct subretinal injection following vitrectomy of the eye.
  • an AAV vector of the invention may be used as a gene therapy product designed to treat neurodegenerative disorders such as frontotemporal lobe dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease and motor neuron disorders such as Amyotrophic Lateral Sclerosis (ALS).
  • This AAV vector delivers a gene encoding a VEGF protein; which may be a VEGF-A isoform such as VEGFi 45 , VEGFi 6 5, or VEGFi 89; or may be VEGF-B, VEGF-C, or VEGF-D, such genes having a neuroprotective effect. Expression of the gene may be driven by CMV or an alternative promoter.
  • the AAV vector may be administered by direct injection into the cerebrospinal fluid bathing the spinal cord via intraventricular or intrathecal injection.
  • Another aspect of the invention relates to a method of treatment comprising administering the viral vector of the invention or a cell transduced with the viral vector of the invention to a subject in need of the same.
  • references herein to treatment include curative, palliative and prophylactic treatment; although in the context of the present invention references to preventing are more commonly associated with prophylactic treatment. Treatment may also include prevention or slowing of disease progression.
  • the treatment of mammals is particularly preferred. Both human and veterinary treatments are within the scope of the present invention.
  • the viral vectors or viral vector particles of the invention may be for use as vaccines.
  • the vaccines may be, for example, human or veterinary virus-based vaccines (e.g. influenza and Newcastle Disease virus vaccines).
  • the present invention may be of particular use where the vaccine is based on a modified competent virus that harbours a transgene.
  • avian production cells may be used in the production of viral vectors and viral vector particles for use as vaccines.
  • a pharmaceutical composition comprising the viral vector of the invention or a cell or tissue transduced with the viral vector of the invention, in combination with a pharmaceutically acceptable carrier, diluent or excipient.
  • the present invention provides a pharmaceutical composition for treating an individual by gene therapy, wherein the composition comprises a therapeutically effective amount of a vector.
  • the pharmaceutical composition may be for human or animal usage.
  • the composition may comprise a pharmaceutically acceptable carrier, diluent, excipient or adjuvant.
  • a pharmaceutically acceptable carrier diluent, excipient or adjuvant.
  • the choice of pharmaceutical carrier, excipient or diluent can be made with regard to the intended route of administration and standard pharmaceutical practice.
  • the pharmaceutical compositions may comprise, or in addition to, the carrier, excipient or diluent any suitable binder(s), lubricant(s), suspending agent(s), coating agent(s), solubilising agent(s) and other carrier agents that may aid or increase vector entry into the target site (such as for example a lipid delivery system).
  • the composition can be administered by any one or more of inhalation; in the form of a suppository or pessary; topically in the form of a lotion, solution, cream, ointment or dusting powder; by use of a skin patch; orally in the form of tablets containing excipients such as starch or lactose, or in capsules or ovules either alone or in admixture with excipients, or in the form of elixirs, solutions or suspensions containing flavouring or colouring agents; or they can be injected parenterally, for example intracavernosally, intravenously, intramuscularly, intracranially, intraoccularly or subcutaneously.
  • compositions may be best used in the form of a sterile aqueous solution which may contain other substances, for example enough salts or monosaccharides to make the solution isotonic with blood.
  • compositions may be administered in the form of tablets or lozenges which can be formulated in a conventional manner.
  • the vector of the invention may also be used to transduce target cells or target tissue ex vivo prior to transfer of said target cell or tissue into a patient in need of the same.
  • An example of such cell may be autologous T cells and an example of such tissue may be a donor cornea.
  • Method of screening Another aspect of the invention relates to a method of identifying nucleic acid binding sites and/or cognate nucleic acid binding proteins which are capable of interacting such that the translation of a nucleotide of interest is repressed or prevented in a viral vector production cell when operably linked to the nucleic acid binding site, wherein the method comprises analysing the expression of a reporter gene in a cell comprising both the nucleic acid binding site operably linked to the reporter gene, and the nucleic acid binding protein.
  • the method may allow the identification of new RNA-binding proteins and their corresponding binding sites which are useful in the present invention.
  • the method may also allow the identification of variants of known RNA-binding proteins or binding sites.
  • the method allows the identification of binding sites which interact with TRAP.
  • the method allows the identification of nucleic acid binding proteins which interact with a binding site that is capable of binding to TRAP.
  • the reporter gene encodes a fluorescent protein. In another embodiment, the reporter gene encodes a positive cell growth selection marker, for example the sh ble gene product enabling cell resistance to Zeocin " .
  • the reporter gene encodes a negative cell growth selection marker, for example the HSV thymidine kinase gene product which causes cell death in the presence of Ganciclovir.
  • a negative cell growth selection marker for example the HSV thymidine kinase gene product which causes cell death in the presence of Ganciclovir.
  • An example of screening TRAP-binding sites (tbs) for improved functionality may be as follows: o Synthesise a degenerate DNA library comprising 8 repeats of the sequence RAGNN or a total of 8 repeats of RAGNN and RAGNNN. o Clone the library within the 5' UTR of a reporter gene cassette such as GFP (preferably within 12 nucleotides of ORF).
  • the library-linked reporter gene may be optionally cloned into a retroviral vector genome and a retroviral vector library produced.
  • o Stably introduce the library-linked reporter gene cassette into a cell line (this can be achieved by transfection or retroviral vector delivery) and isolate single clones.
  • o Screen clones by parallel transfection using control DNA (e.g. pBlueScript) or TRAP- expressing plasmid DNA. Measure reporter gene expression in both scenarios and identify clones with high, non-repressed reporter gene levels (control) and low, repressed reporter gene levels (TRAP).
  • TRAP repressed reporter gene levels
  • the testing of the TRAP-tbs configuration was carried out by transient co-transfection of HEK293T cells with pCMV-GFP or pCMV-tbsGFP (or variants thereof) together with TRAP- expressing plasmids using Lipofectamine 2000CD.
  • Stuffer DNA pBlueScript
  • ⁇ g total DNA per 10cm plate pre-seeded with 3.5x10 6 cells 24hours prior to transfection. These parameters were scaleddown according to tissue culture vessel area when using multiwell plates. Transfections were carried out in triplicate. The molar ratio of GFP-reporter plasmid to TRAP-expressing plasmid is indicated in each experiment. Media was replaced -18 hours post-transfection and GFP analysis was carried out on live cells 48 hours post-transfection.
  • Vector production by transient transfection of HEK293T cells using the 3 vector components occurred using Lipofectamine 2000CD; the ratio of pDNAs was 4 ⁇ g vector genome, 2 ⁇ g GagPol, 0.1 ⁇ g VSVG plasmid per 10cm plate (plates pre-seeded with 3.5x10 6 cells 24hours prior to transfection) - these parameters were scaled according to vessel area.
  • Co- transfection of TRAP plasmid or stuffer plasmid (pBluescript) occurred at stated molar ratios with vector genome e.g. for a 10-to-1 molar ratio of vector genome plasmid to TRAP plasmid, the mass ratio was 4 ⁇ g vector genome to 0.28 ⁇ g TRAP plasmid.
  • GFP analysis was carried out on live cells 48 hours post-transfection. End-of-vector-production cell samples for immunoblotting were typically made using fractionation buffer (130mM NaCI, 20mM Tris-HCI[pH7.4], 2mM EDTA, 0.2% IEGPAL) and nuclei removed by centrifugation. Vector harvest supernatants were filtered through 0.45 ⁇ filters and stored at -80°C prior to vector titration assays.
  • GFP- encoding vectors were titrated by transduction of target cells and analysis 3 days later by flow cytometry (see below).
  • Therapeutic vectors were titrated by qPCR of host cell DNA 10 days post-transduction (DNA integration assay; see below) or by immunofluorescence against the transgene product 3 days post-transduction.
  • GFP-positive cells The analysis of GFP-positive cells was carried out primarily with flow cytometry, which allowed sensitive quantification of both percentage GFP-positive cells in the population as well as the degree of GFP expression per cell, as measured by the median fluorescence intensity. It should be noted that the reporting of the magnitude of global GFP expression in the transfected population was carried out by multiplying the percentage GFP-positive cell number by the median fluorescence intensity (MFI; arbitrary units) to yield an 'Expression Score'. We believe that this measure is a better representation of the total level of GFP protein expression within the transfected cell population - it essentially assumes a normal distribution of GFP expression level within the transfected population and therefore approximates 'the area under the curve'.
  • MFI median fluorescence intensity
  • Standard SDS-PAGE and Immunoblotting protocols were carried out primarily on End-of- vector production cells, post vector harvest.
  • ⁇ 2ml_ of filtered vector supernatnant was centrifuged at 21 ,000rpm in a microfuge for 1-2 hours at 4°C, before the 'pellet' was resuspended in 20-30 ⁇ _ PBS.
  • These concentrated vector preparations were quantified by PERT assay (below) and 7x10 4 PERT-predicted TUs of vector loaded per well of a SDS-PAGE gel.
  • Approximately 1x10 6 end-of-vector production cell were lysed in 200 ⁇ _ fractionation buffer and the nuclei removed by centrifugation.
  • Protein samples were quatified by BioRad assay and typically 5 ⁇ g of protein was loaded onto pre-formed, 12-15 well, 4-20% acrylamide gels. Proteins were transferred onto nitrocellulose at 45V for 3 hours on ice. Blots were blocked in 5% milk PBS/tween-20 overnight at 4°C. Blots were probed with primary antibodies and HRP-secondary antibodies at typically 1 : 100 dilution in blocking buffer. Immunoblots were analysed by ECL-detection followed by X-ray film exposure. Retroviral vector titration o Integration assay
  • PERT-predicted titre is an arbitary physical particle titre based on the RT activity associated with the biological titre of a
  • GFP-encoding EIAV vector prep used as the qRT-PCR standard curve in the PERT assay.
  • the expression of the reporter proteins lacZ or GFP within a vector production cell, such as HEK293T, is generally accepted not to adversely impact the titre or specific activity of the vector particles produced; therefore vectors encoding these reporters can be made at high titres.
  • the mixing of plasmids encoding a vector genome with such a reporter gene and that of a vector genome encoding a transgene that does impact vector titres allows a degree of measure of that impact by titration of vector using the reporter gene activity as a read-out in target cells.
  • the ratio of the reporter- to-NOI vector genome plasmids used at transfection is typically between 1 : 1 and 1 :5. Note that since retroviral vector particles package two copies of genome RNA per virion, there will be a 'dilution' effect on reporter-specific vector titre even when two non-problematic proteins (e.g. Lac Z and GFP) are expressed from two different vector genome plasmids within the production cell.
  • two non-problematic proteins e.g. Lac Z and GFP
  • Figures 3i and 3ii display the data from various vector genome plasmid mixing experiments using a lacZ reporter vector genome plasmid, with vector titre read-out based on X-gal staining in target cells.
  • the majority of vector genome plasmids tested including those of RetinoStat ® , StarGenTM, UshStat ® and ReQuinate ® , as well as vectors expressing COX-2 and/or FPR, impact vector titres by 7-to-100 fold, depending on the ratio of lacZ vector plasmid-to-test vector plasmid employed.
  • TRIP systems describing components necessary to repress transgene translation in other viral vector systems (e.g Adenoviral and AAV vector based vectors) can be described to include virus-specific packaging components. All such TRIP systems must contain the two following components in addition to the necessary vector components: a TRAP expression cassette and the TRAP- binding site (tbs) inserted within the 5'UTR of the NOI transgene such that production of the POI is repressed in the presence of TRAP.
  • a TRAP expression cassette and the TRAP- binding site (tbs) inserted within the 5'UTR of the NOI transgene such that production of the POI is repressed in the presence of TRAP.
  • Multiple NOI ORFs within a vector genome molecule may be regulated by TRAP i.e. the vector genome may be multicistronic (e.g. containing IRES element) and more than one ORF may have a TRAP-binding site inserted upstream of its translation initiation codon (e.g. between the IRES and downstream ORF).
  • the GFP reporter construct pCMV-tbsGFP was constructed as described in Figure 6.
  • a TRAP binding sequence (tbs) was inserted into the construct such that the 5'UTR encoded (from 5' to 3') a 41 nt leader, the 55nt tbs and a 9nt region encoding the kozak consensus sequence immediately upstream of the GFP ATG codon.
  • These GFP reporter constructs were derived from the experimental EIAV vector genome pONY8.4RC-GFP by deletion of the region between the two CMV promoters (see Figure 6).
  • the GFP reporter gene was chosen for the initial evaluation experiments so that relatively quick assessment of gene regulation could be carried out by flow cytometry.
  • GFP is not known to be toxic or detrimental to vector production but was used as a sensitive model for gene expression regulation by TRAP/tbs.
  • the existing vector genome pONY8.4RC-GFP was available for manipulation; this vector utilises a wild type EIAV U3 within the 3'LTR and a DsRED-express ORF upstream of the internal transgene cassette as depicted in Figure 6. Therefore, this vector genome plasmid is capable of both GFP and DsRed-express expression within vector production cells.
  • the publically available nucleotide sequence is of the bacterial sequence encoded within the mtrB/Jrp P Transcription attenuation protein gene family' operon.
  • the TRAP nucleotide sequence was codon/sequence optimised for expression in homo sapiens. The synthetic sequence was designed for cloning into pCI-NEO to yield pCI-coTRAP. Sapl sites were positioned such that digestion and re-circularisation allowed fusion of a HIS 6 -tag to the C-terminus of the TRAP protein.
  • the EF1 a-driven construct pEF1a-coTRAP[H6] was made as described above and tested in cotransfections with pCMV-tbsGFP at different ratios.
  • Figure 9D summarises the repression of GFP in cells cotransfected with either pCI-coTRAP[H6] or pEF1 a-coTRAP[H6] together with the GFP reporter constructs.
  • pEF1a-coTRAP[H6] can be cotransfected with tbs-GFP reporter DNA at the 1/10 th dose and maintain the level of GFP repression observed at the 1 : 1 ratio (in this case, MFI data was compared), in contrast to pCI-coTRAP[H6]. Therefore, the EF1 a-promoter may be more preferable in driving TRAP expression.
  • HIS 6 -tagged and untagged TRAP proteins are capable of repressing GFP expression to almost undetectable levels when supplied at 1 : 1 or 1 :0.1 molar ratio with tbs-containing GFP reporter plasmid.
  • the untagged TRAP version was 2- fold less effective in repression than TRAP[H6] in all measures of expression. Therefore, the HIS 6 tag may afford some minimal advantage over untagged TRAP; this may be due to enhanced protein stability, and/or solubility/folding and/or functionality (e.g RNA binding).
  • TRAP of Bacillus subtilis two other TRAP homologues were shown to mediate repression of GFP expression from cells co-transfected with pCMV-tbsGFP and TRAP- expression plasmid ( Figure 1 1A).
  • the TRAP genes from Desulfotomaculum hydrothermale and Aminomonas paucivorans were codon/sequence-optimised and cloned into the pEF1 a- based expression plasmid; both of these variants included C-terminal HIS 6 tags.
  • These TRAP variants shared 75% and 55% amino acid homology with that of Bacillus subtilis TRAP, respectively.
  • TRAP variants of varying sequence identity to Bacillus Subtilis TRAP were identified from the NCBI database ( Figure 21 i).
  • the variants represented a wide range of different TRAP variants from across the Bacterial lineage.
  • Gene sequences for these TRAP variants were codon-optimised for high expression in human cells and included a C-terminal HIS 6 (akin to Bacillus Subtilis TRAP[H6] previously shown to enhance TRAP-mediated repression; Figure 10), and cloned into the pEF1a-promoter plasmid ( Figure 7).
  • the B.Halodurans TRAP variant forms a natural 12-mer (Bayfield, O.W. et ai (2012) PLoS ONE 7: e44309. doi: 10.1371/joumal.pone.0044309), indicating that potentially, 12 RAGNN repeats within a tbs may be bound by this TRAP. It has also been shown that artificial 12-mer versions of natural 1 1-mer TRAP variants can be engineered through modifications in the C-terminus of the protein.
  • a S72N modification of Bacillus Stearothermophilus TRAP has been shown to result in 12-mer proteins as judged by X-ray crystallography (Bayfield, 0,W, et ai (2012) PLoS ONE 7; e44309. doi: 10.1371/journal.pone.0044309), although it is not known whether 11-mers or 12-mers of these variants are formed in the cellular environment.
  • the Bacillus Stearothermophilus TRAP-S72N variant was also constructed and tested alongside the other TRAP homologues for potential function in the TRAP-repression system.
  • Example 4 Evaluation of transgene repression in stable HEK293T-TRAP cell lines
  • construct pEF1a-coTRAP[H6]-iBsr was made and used to stably transfect HEK293T cells by blasticidin selection ( Figure 1 1 B).
  • Figure 1 1 B From -100 stable clones, four subcloned HEK293T-TRAP[H6] cell lines 2F, 10H, 7E and 3D were isolated and tested for their ability to repress GFP expression from transfected pCMV- tbsGFP.
  • Example 4b Development of HEK293T cell lines stably expressing TRAP[H6] and their use in production of vectors
  • HEK293T cells were stably transfected with the EF1 a-coTRAP[H6]-iBsr expression cassette ( Figure 22i) and clones isolated by blasticidin selection. These stably expressing TRAP[H6] (B.Subtilis) clones were subcloned twice and then screened for repression functionality by transfection with pCMV-GFP (no repression) or pCMV-tbsGFP. The total GFP expression in cell populations was estimated by generating the Expression score ( Figure 22NA; MFI x %GFP).
  • the TRIP system can improve the vector titres of ReQuinate- an EIAV vector expressing huFactor VIII - over the standard vector production system ( Figure 17).
  • HuFactor VIII impedes incorporation of VSVG into EIAV vector virions.
  • a stable TRIP system i.e. integrated TRAP cassette
  • HEK293T cells and the stable HEK293T.TRIP cell lines 2F, 10H, 7E and 3D were tested. End-of-production cells were analysed form GFP expression by flow cytometry ( Figure 22iiiA) and crude vector produced was titrated on fresh HEK293T cells and also analysed by flow cytometry ( Figure 22iiiB).
  • Example 5 Testing the TRIP system on production of GFP -encoding lentiviral vectors The aim of the experiment was to evaluate the potential impact of the presence of the tbs within a vector genome.
  • TRAP is capable of binding to the tbs within the vector genome RNA molecule (as well as on the transgene mRNA) and therefore be packaged into de novo vector virions, the process of reverse transcription was reasonably expected to be adversely affected.
  • the TRAP-tbs interaction is particularly high affinity (nM range) and it was not known whether reverse transcriptase was capable of disrupting this interaction during the RT step.
  • the EIAV vector genome pONY8.4RC-tbsGFP was constructed from pCMV-tbsGFP (See Figure 6).
  • Vector was produced in HEK293T cells using the genomes pONY8.4RC-tbsGFP or pONY8.4RC-GFP, packaging components (GagPol and VSVG) and co-transfected with or without pCI-coTRAP[H6] (this experiment was performed before construction of pEF1 a-coTRAP[H6]).
  • End-of-production cells were analysed by flow cytometry for GFP expression ( Figure 12A and B) and vector supernatants were used to transduce D17 cells ( Figure 12C).
  • the TRAP/tbs configuration was capable of repressing GFP from the internal transgene cassette of the tbs-containing vector genome to a similar level to that of pCMV-tbsGFP, in contrast to the vector genome without tbs ( Figure 12A). DsRed-X expression was not affected by TRAP, indicating that full length vector genome RNA was made and was translatable (data not shown). The fold-repression of GFP from the vector genome plasmid by TRAP was 50-to- 100-fold ( Figure 12B).
  • Figure 12C demonstrates that tbs-containing GFP vectors could be produced at very similar titres to standard GFP vectors; pONY8.4RC-tbsGFP produced in the presence of TRAP protein gave 1.4x10 6 TU/ml compared to the 1.8x10 6 TU/ml of pONY8.4RC-GFP produced in the absence of TRAP protein.
  • Example 6 Testing the short spacing requirements between the tbs and translation initiation codon
  • the first experiment in characterising sequences important in the TRAP-binding site (tbs) asked the question of whether the short spacing distance between the tbs and the AUG translation initiation codon is important for translation repression.
  • the configuration of tbs within pCMV-tbsGFP and pONY8.4RC-tbsGFP is such that the tbs is separated from the GFP AUG translation initiation codon by 9 nucleotides.
  • spacing parameters have been shown to contribute to functionality.
  • tbs-9nt-AUG configuration was appended with a 5' proximal stem loop (SL) sequence taken from the Bacillus subtilis trpEDCFBA operon, which has been shown to be important for TRAP-tbs binding for the transcription attenuation mechanism in vivo (McGraw AP, M. A., Major F, Bevilacqua PC, Babitzke P. (2009) RNA 15(1): 55-66).
  • SL proximal stem loop
  • the SL mutant was included to test if TRAP-mediated repression could be enhanced. These variants were cloned into the vector genome pONY8.4RC-tbsGFP and co-transfected with limiting quantities of pEF1a-coTRAP[H6] (ratio of 1 :0.05) in order that subtle differences in translation repression might be more easily quantified.
  • Example 6b Testing the impact of position of the tbs within the 5'UTR of a transgene cassette on TRAP-mediated repression
  • a series of 5'UTR variants of pCMV-tbsGFP were constructed wherein the relative distance of the tbs from the Cap site and AUG initiation codon was varied (Figure 24i).
  • another construct was made in which two copies of the tbs were inserted within the 5'UTR with a 34nt intervening sequence between the two tbs sequences. This was constructed to test whether TRAP-tbs mediated repression could be enhanced over the single copy tbs configuration.
  • the seven tbs variant GFP reporter constructs in Figure 24i were tested for their ability to be repressed by TRAP under three conditions: no TRAP (HEK293T), transiently co-transfected with pEF1a-coTRAP[H6] (HEK293T + TRAP) and under maximum TRAP repressive conditions (HEK293T.TRIP[Endogenous TRAP] + co-transfected TRAP). All the 5'UTR tbs variants were capable of being repressed by TRAP[H6] by 10-to- 100-fold. Reducing upstream UTR length to zero (i.e.
  • construct #[1] was capable of ⁇ 2-Log repression of GFP by TRAP, although unrepressed levels of GFP were lower than the other constructs.
  • RAGNNN repeats replaced RAGNN repeats within tbsx1 1 M from the centre position outwards yielding tbs sequences with 1x, 3x, 5x 7x and finally 11x RAGNNN repeats (note that for the N 3 x11 M tbs sequence, only 10 NNN spacers are effectively present, since the most 3' distal repeat spacer does not count as a spacer).
  • These vector genome plasmids were transiently co-transfected into HEK293T cells with EIAV vector packaging components +/ pEF1a-coTRAP[H6] and vector supernatants harvested (vector titres of these COX2 vectors are described below). End-of-production cell lysates were analysed by immunoblot to COX2 to measure transgene repression in the cell compared to stuffer plasmid (un- repressed) ( Figure 14NB).
  • RAGNNN repeats within the 11x repeat tbs allows some detectable repression of transgene expression within vector production cells; this may be sufficient to improve vector titres in some cases, depending on the magnitude of impact of the transgene protein on vector titres without the TRIP system.
  • a single RAGNNN repeat within the tbs appears to be as functional as the N 2 x1 1 repeat tbs.
  • Example 8b Identification of the number of [RAGNNN] repeats tolerated within the tbs Further work was carried out regarding the number of Ns comprising the spacer between RAG repeats in the consensus repeat RAGN2-3 that allow TRAP-mediated repression.
  • Figure 14iB presents COX2 expression analysis in end-of-production cells, approximately 2 days post-transfection. To test if transgene (COX2) expression in the contexts of the N 3 N 2 tbs variants differed at early times post-transfection (compared to later times), production cell lysates at 8 hours post-transfection were analysed by immunoblotting to COX2 ( Figure 14iii).
  • Figure 14iv displays these data and shows that vector titres were increased for the N 3 N 2 tbs variants in which there was clear COX2 repression in production cells; namely 'N 3 N 2 x1 1 [3]', 'N 3 N 2 x1 1 [1]' and 'N 2 x1 1 [0]'.
  • the RAGNN x8-11 tbs configuration remains the preference for reasons other than increased vector production i.e.
  • vector genome plasmids were transiently co-transfected into HEK293T cells with EIAV vector packaging components +/ pEF1 a-coTRAP[H6] and at 8 hours post-transfection, cell lysates analysed by immunoblot to COX2 to measure transgene repression in the cell compared to stuffer plasmid (un-repressed) (Figure 14vB).
  • Figure 14vB shows that an 8-repeat tbs containing one RAGNN N repeat and seven RAGNN repeats retains TRAP-mediated repression activity.
  • Less than 8-repeat tbs sequences containing one or more RAGNN N repeats may have lower TRAP-mediated repression activity.
  • Example 8c Characterisation of preferred nucleotides at the five positions of the RAGNN repeat consensus
  • the NN spacer was tested with each nucleotide (G
  • C nucleotide
  • These tbs variants were cloned into pCMV-[tbs]GFP, replacing the x1 1 M tbs, and tested by transient co-transfection of HEK293T cells +/- pEF1a-coTRAP[H6]. After 48 hours, cells were analysed by flow cytometry and GFP Expression scores calculated (Figure 23i). This revealed a preference for pyrimidines at the NN position.
  • T[U]>C>G/A The general order of functionality was T[U]>C>G/A.
  • T[U] at the first position in [TAGAA]x11 was only minimally functional, and A and C were not functional in any of these xAGAA repeats. Therefore in the context of tandem xAGAA repeat-containing tbs', x must be G and not T.
  • Multi-cistronic vectors are useful tools in delivering more than one gene to target cells in patients. Therefore it would be advantageous to be able to repress multiple transgenes within a vector genome using the TRIP system, including those dependent on IRES elements.
  • TRIP system can be applied to transgene expression cassettes wherein the distal ORF is dependent on an internal ribosomal entry site (IRES)
  • IRES internal ribosomal entry site
  • VEGF Vascular Endothelial Growth Factor
  • EMCV IRES vascular Endothelial Growth Factor
  • Two further control constructs were made that contained either only 4 [RAGNN] repeats or no repeats; these were not predicted to be repressible by TRAP.
  • the constructs were co-transfected in HEK293T cells with either stuffer plasmid or pEF1 a- coTRAP[H6], and GFP expression assessed by flow cytometry. These data are displayed in Figure 15B.
  • the level of GFP expression from the distal position in the bicistronic cassette was approximately 7-fold lower than that of the single cistron construct, which is not atypical for bistronic gene configurations.
  • the level of GFP expression in pCMV-Vi-tbsx1 1GFP- transfected cells was a further 2-fold lower, indicating that the placement of the tbs sequence had a small reduction on IRES-dependent translation efficiency.
  • the level of GFP expression in pCMV-Vitbsx11G + pEF1 a-coTRAP[H6]-transfected cells was 17-fold lower than with stuffer plasmid, demonstrating that the TRAP/tbs configuration can function in the context of internal ribosome entry.
  • the WPRE has been shown to function by decreasing read-through at polyadenylation sites (Higashimoto T, U. F., Perumbeti A, Jiang G, Zarzuela A, Chang LJ, Kohn DB, Malik P. (2007) Gene Therapy 14(17): 1298-1304). However, earlier reports suggested that the WPRE might act at RNA level in other ways.
  • the TRAP/tbs configuration could be used to repress transgene expression from a SIN-vector genome containing the WPRE, the vector genome pONY8.9RCTG(+WPRE) was constructed and tested in repressing GFP expression in HEK293T cells.
  • Figure 16 demonstrated that the inclusion of WPRE on a SIN-vector genome has no adverse effect on the TRIP system: GFP repression from pONY8.4RC-tbsGFP and pONY8.9RCTG(+WPRE) was equivalent.
  • Use of TRIP system to increase production titres of vectors expressing therapeutic transgenes was equivalent.
  • Example 11 Production of a huF ' actor Vlll-expressing vector using the TRIP system
  • ReQuinate ® developed for treatment of haemophilia A, is difficult to produce in HEK293T cells because the transgene huFactor VIII has been shown to severely inhibit VSVG envelope incorporation into vector virions.
  • ReQuinate ® vector titres are low (see Figure 3i for mixing experiment data) unless a tissue-specific promoter that is not active in HEK293T cells is used to drive huFactor VIII expression (Radcliffe PA, S. C, Wilkes FJ, Custard EJ, Beard GL, Kingsman SM, Mitrophanous KA (2008) Gene Therapy 15(4): 289-297).
  • the TRIP system was applied to ReQuinate ® to test if vector titres could be enhanced by repressing huFactor VIII expression in HEK293T production cells.
  • Vector genomes ReQuniate-tbs and ReQuniate-con were constructed ( Figure 17i), wherein the 5'UTR within the original ReQuinate ® genome was replaced with the same 5'UTR from the tbs-GFP reporter vectors (depicted in Figure 6).
  • the ReQuinate-con vector genome contained the same 5'UTR as ReQuinate-tbs except that the tbs was scrambled; this was done so that translation of huFactor VIII from tbs-negative mRNA was in the context of a similar 5'UTR in terms of sequence length and nucleotide content compared to tbs-containing mRNA.
  • These vectors were made in HEK293T cells using vector genome plasmid DNA at a 5-fold molar excess over pEF1 a-coTRAP[H6]. Filtered vector supernatants were subject to DNA integration assay to determine titres.
  • Vector supernatants were also concentrated ⁇ 100-fold, subject to PERT assay to quantify particle numbers, and equal numbers of vector particle analysed for VSVG content by immunblotting. Data from these analyses are displayed in Figure 17ii.
  • the TRIP system improved the DNA integration titre of huFactor Vlll-expressing vector genome by 30-fold, comparing ReQuinate-tbs produced in the presence of TRAP[H6] and ReQuinate ® .
  • the degree of VSVG incorporation into vector particles was massively increased using the TRAP/tbs configuration, and this correlated closely with vector titre.
  • FPR Prostaglandin F receptor
  • COX-2 Cyclooxygenase-2
  • Vector preps were titrated by standard DNA integration assay (figure 18NA) and cell lysates taken from both COX-2 vector production cells and COX-2 vector-transduced cells in order to assess the expression of COX-2 from the tbs-containing transcription unit in target cells. Data from these analyses are shown in Figures 18NB and 18NC respectively.
  • the titres of the tbs-COX-2 vector were 100-fold higher than that of the unmodified COX-2 vector ( Figure 18NA), and the level of COX-2 within production cells was inversely correlated with titre (Figure 18NB).
  • COX-2 expression could be robustly detected only within target cells that had been transduced with vector produced using the TRIP system, demonstrating that the tbs sequence did not affect expression of the transgene in target cells (Figure 18NC).
  • the titre of FPR-vector produced using the TRIP system was increased by 24-fold compared to standard vectors ( Figure 18iii); again, this was dependent on both TRAP and tbs in the system.
  • the tbsx1 1 M sequence was cloned into vector genome plasmids depicted in Figure 19i; bicistronic vector genome plasmids encoding COX-2 and FRP at either position +/- tbs were created.
  • Viral vector preps were produced in HEK293Ts under standard conditions whilst also co-transfecting pEF1a- coTRAP[H6] or stuffer plasmid at a molar ratio of 1 :0.2 vector genome:TRAP plasmid.
  • Vector preps were titrated by standard DNA integration assay and cell lysates taken from vector production cells (Figure 19ii).
  • OXB-102 is an EIAV vector being developed for the treatment of Parkinson's disease and which express 3 proteins involved in dopamine biosynthesis: tyrosine hydroxylase, GTP- cyclohydrolase and aromatic L-amino acid decarboxylase (described in WO 2013/061076). Whilst it is known that these enzymes do not adversely impact vector titres, as mentioned previously, it may be beneficial to repress transgene expression within vector production cells from the perspective of vector processing/concentration, as well as delivering a less immunogenic vector preparation to the patient.
  • the tbsx11 M sequence was cloned into the 5' proximal ORF of the multicistronic OXB-102 vector genome plasmid as depicted in Figure 20i.
  • translation of the fusion gene Tyrosine hydroxylase:GTP-cyclohydrolase 1 (TH-CH1) would be predicted to be repressed by TRAP only in vector production cells.
  • Viral vector preps were produced in HEK293Ts whilst also co-transfecting pEF1 a-coTRAP[H6] or stuffer plasmid at a molar ratio of 1 :0.2 vector genome:TRAP plasmid.
  • Vector preparations were titrated by standard DNA integration assay and cell lysates taken from vector production cells.
  • Figure 20NA and 20NB indeed show that the TH-CH1 fusion protein is repressed in vector production cells as judged by immunoblot using antibodies to both TH and CH1 ( Figure 20NB) but is readily detected in transduced cells as judged by immunostaining using anti-TH antibodies.
  • Example 14 Production of HIV- 1 -based lentiviral vectors using the TRIP system
  • GFP-encoding vectors were produced by transient co-transfection of HEK293T cells with packaging component plasmids in the following mass ratio; 4 ⁇ g vector genome, 1 ⁇ g gagpol, 1.1 Mg rev, 0 ⁇ g vsvg with either 0.56 ⁇ g of pEF1 a-coTRAP[H6] (+TRAP) or 0.56 ⁇ g pBlueScript (-), using 25 ⁇ _ Lipofectamine 2000CD per 10cm plate (seeded at 3.5x10 6 cell/plate 24 hours pre- transfection). Cultures were incubated overnight before sodium butyrate was added to a final concentration of 10mM for 5 hours.
  • the tbsx1 1 M tbs was inserted into the 5'UTR of the transgene cassette of an HIV-1 vector genome encoding 5T4-CAR ( Figure 25NA); this therapeutic vector is for the genetic modification of T-cells enabling them to target and kill tumour cells expressing the antigen 5T4.
  • the resulting vector HIV-tbs-h5T4.CAR was produced under the same conditions described above (for GFP vector) i.e. co-transfection of HEK293T cells with vector components +/- pEF1a-coTRAP[H6].
  • Vector supernatants were titrated by DNA integration assay in HEK293T cells.
  • Figure 25NB displays the results of this experiment; the titre of HIV-tbs-h5T4.CAR were 30-fold greater when TRAP[H6] was co- expressed in production cells compared to the control (pBlueScript).
  • Example 15 The TRAP-tbs configuration does not affect transgene mRNA levels in the cytoplasm
  • the TRAP-tbs configuration is capable of extremely potent transgene repression and thought to act solely at the translation level.
  • TRAP e.g. a possible destabilising effect
  • the relative levels of transgene cytoplasmic RNA was measured in HEK293T cells transfected with pCMV-[tbs]GFP +/- pEF1a-coTRAP[H6]. Cells were transfected and GFP expression measured by flow cytometry at 2 days post-transfection (Figure 26A).
  • Figure 26B the TRAP-tbs configuration was capable of repressing GFP expression in HEK293T cells by 2-Logs.
  • the detection level of GFP mRNA within the cytoplasm varied by no more than ⁇ 2-fold across all conditions (all Ct values varied less than 1.5 cycles).
  • Example 16 Comparison of TRAP/tbs-mediated bi-cistronic transgene repression in vector production cells from HIV- 1 -based vectors encoding constitutive versus tissue-specific promoters
  • HIV-1 -based vector genomes were constructed in which transgene transcription was driven by either tissue specific promoters (VMD2; photoreceptor cell expression (Esumi, N. et al. (2004) J. Biol. Chem. 279: 19064-73), mAlbAT; liver hepatocyte cells expression (Kramer, M.G. et al. (2003) Mol. Ther. 7: 375-385)) or the constitutive CMV promoter.
  • VMD2 tissue specific promoters
  • mAlbAT liver hepatocyte cells expression
  • the transgene cassette was bi-cistronic, encoding Firefly ⁇ Photinus pyralis) luciferase at the 1 st ORF and GFP at the 2 nd ORF, with the EMCV IRES element inserted between the two ORFs. Single tbs (x1 1 M) sequences were inserted upstream of both reporter genes.
  • Alternative CMV-promoter constructs were made in which only the 1 st or 2 nd ORF were regulated by TRAP-tbs, and controls without any tbs sequences or no promoter (Figure 27i).
  • the seven vector genomes were used to make vector particles in HEK293T cells.
  • Cells were co-transfected with vector genome plasmid plus packaging components and either pEF1a- coTRAP[H6] or pBluescript (control).
  • pGL3-control SV40-promoter-driven Renilla reniformis, luciferase
  • Ratios of plasmids were: genome (4.5)
  • tissue-specific constructs pHIV-VMD2-tbsLuc-itbsGFP and pHIV-mAlb-hAAT- tbsLuc-itbsGFP produced similar levels of GFP compared to pHIV-Null-tbsLuc-itbsGFP (in the absence of TRAP), despite Luciferase expression being low (compared to CMVp constructs), demonstrating that most of the GFP expression was not coming from the internal promoter-driven cassette. This level of GFP expression (from full length vector genome RNA) could also be efficiently repressed by TRAP.
  • Example 17 Demonstration of the utility of TRAP/tbs-mediated transgene repression in production of a DNA-based viral vector; case study 1 - AA V-based vectors
  • TRiPAAV vector production system which employs the TRAP-tbs configuration in a similar manner as described for RNA-based viral vector systems such as retro/lentivirus.
  • Figure 28i displays a non-limiting example of the TRiPAAV system, which comprises production cells (e.g.
  • Adenovirus E1-expressing cells HEK293-based cells, PER.C6-based cells
  • HEK293-based cells HEK293-based cells, PER.C6-based cells
  • expression cassettes [1] an AAV vector genome modified such that a tbs is inserted within the 5'UTR of the transgene (and/or between an IRES and downstream transgene), [2] a repcap expression plasmid, [3] helper functions (e.g. Adenovirus E2A, E4orf6, VA genes), and [4] a TRAP expression cassette (transiently transfected or stable TRAP cell line).
  • HEK293T cells were transfected in triplicate with either pscAAV-GFP or pscAAV-tbsGFP or pCMV-tbsGFP, in different combinations of pEF1a-coTRAP[H6], pRepCap2 and pHelper (all at equi-mass ratio of 2 ⁇ g per 10 cm plate unless otherwise stated for pEF1 a-coTRAP[H6] - see Figure 28ii). As expected, expression of TRAP had no impact on GFP expression by pscAAV-GFP, which lacked a tbs.
  • GFP expression from pscAAV-tbsGFP was repressed by almost 3-Logs in the presence of TRAP (TRAP and scAAV vector genome plasmids at 1 : 1 ratio).
  • the co- expression of pHelper or pRepCap2 did not affect this level of TRAP-mediated repression.
  • pscAAV-tbsGFP, pRepCap2, pHelper and pEF1 a-coTRAP[H6] were all transfected together (i.e. under conditions were scAAV-tbsGFP vector particles would be produced) the level of GFP repression by TRAP was over 300-fold.
  • scAAV2-[tbs]GFP vector particles were produced at 10 cm plate scale, by transfecting cells with pscAAV2-GFP genomes (+/- tbs), pRepCap2, pHelper and either pEF1a-coTRAP[H6] (TRAP) or pBluescript (-) (2 ⁇ g of all DNAs). After -53 hours, cells were freeze-thawed, and vector particles were purified using a VirabindTM kit, concentrated to a final volume of 100 ⁇ _ PBS, and then titrated by transduction of HEK293T and HEPG2 cells ( Figure 28iii). These data show that AAV-GFP vectors can be produced to equivalent titres under the TRiPAAV system as under the standard method, indicating that the tbs modification and co-expression of TRAP does not intrinsically impede AAV vector biology.
  • HEK293T and HEK293T.TRiP[3D] cell cultures were transfected with the pRepCap2 and pHelper packaging components (without pEF1a- coTRAP[H6]), except either equal masses of pscAAV2-GFP ( Figure 28ivB) and pscAAV2- tbsBarnase genome plasmids were mixed, to observe the effect of Barnase on GFP expression, or only pscAAV-(CMV)-GFP was transfected. Pictures of these cultures were taken 24 hours post-transfection, which are displayed in Figure 28v: i-ii.
  • HEK293T.TRiP cultures transfected with the same DNA mix allowed some substantial GFP expression, indicating that the endogenous levels of TRAP[H6] in these cells had inhibited barnase expression. It is likely to be possible to improve Barnase repression by isolating stable cell lines with even greater levels of endogenous TRAP.
  • the modelling of Barnase as a toxic transgene protein expressed during viral vector production represents a worst-case scenario, wherein de novo protein synthesis (including viral vector components) is effectively shut-down. Given the observed moderate recovery of GFP expression in HEK293T.TRiP cells, this suggests that expression of AAV vector component proteins also occurred, and that production of Barnase-encoding AAV vector particles is possible in stable TRAP cell lines.
  • Example 18 Demonstration of the utility of TRAP/tbs-mediated transgene repression in production of a DNA-based viral vector; case study 2 - Adenovirus-based vectors
  • TRIPAdeno vector production system which employs the TRAP-tbs configuration in a similar way as described for RNA-based viral vector systems such as retro/lentivirus, and for DNA-based AAV vectors (Example 17).
  • Figure 29i displays a non-limiting example of the TRIPAdeno system, which comprises production cells (e.g.
  • Adenovirus E1-expressing cells HEK293-based cells, PER.C6-based cells
  • HEK293-based cells HEK293-based cells, PER.C6-based cells
  • expression cassettes [1] an Adenovirus-based vector genome modified such that a tbs is inserted within the 5'UTR of the transgene (and/or between an IRES and downstream transgene), and [2] a TRAP expression cassette (transiently transfected or stable TRAP cell line).
  • an E1-deleted helper virus may be co-introduced for Helper-dependent vector production.
  • shuttle plasmids were co-transfected into HEK293T cells with pEF1a-coTRAP[H6] (TRAP) or pBlueScript (-), and in parallel transfections with pacAd5 9.2-100 (RAPAd ® kit, Cell BioLabs), which contains overlapping homology with Ad5 sequences in the shuttles, and the remainder of the Ad5 genome (E3-deleted) to the right-hand ITR ( Figure 29NB).
  • the mass ratio of shuttle plasmid to TRAP plasmid was 5: 1.
  • HEK293T cells or HEK293T.TRIP[3D] cells (stably expressing TRAP[H6]) were transduced with Adeno-CMV-GFP and Adeno-CMV-tbsGFP at an MOI of 0.01. Replicate cultures were analysed for GFP expression during vector amplification at different time-points post-inoculation, and GFP Expression scores generated (MFI x %GFP).
  • Vector stocks of Adeno-CMV-GFP and Adeno-CMV-tbsGFP that were produced in the presence of TRAP were harvested from cells at 48 hours post-inoculation; debris removed and titrated on HeLa cells ( Figure 29iiiB).
  • the titres of vector produced either in HEK293T or HEK293T.TRIP[3D] cells were equivalent, indicating that the tbs modification and co- expression of TRAP does not intrinsically impede Adenovirus vector biology.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Virology (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Apparatus Associated With Microorganisms And Enzymes (AREA)
PCT/GB2014/053813 2013-12-20 2014-12-19 Viral vector production system Ceased WO2015092440A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
KR1020167019013A KR102354365B1 (ko) 2013-12-20 2014-12-19 바이러스 벡터 생산 시스템
CN201480076100.0A CN106029891B (zh) 2013-12-20 2014-12-19 病毒载体生产系统
DK14821255.8T DK3083969T3 (da) 2013-12-20 2014-12-19 System til produktion af virusvektor
EP14821255.8A EP3083969B1 (en) 2013-12-20 2014-12-19 Viral vector production system
ES14821255T ES2748377T3 (es) 2013-12-20 2014-12-19 Sistema de producción de vector vírico
EP19190116.4A EP3650548B1 (en) 2013-12-20 2014-12-19 Viral vector production system
JP2016541089A JP6655014B2 (ja) 2013-12-20 2014-12-19 ウイルスベクター産生系
US15/106,555 US10544429B2 (en) 2013-12-20 2014-12-19 Viral vector production system
PL14821255T PL3083969T3 (pl) 2013-12-20 2014-12-19 Układ do wytwarzania wektorów wirusowych
US16/714,516 US12054735B2 (en) 2013-12-20 2019-12-13 Viral vector production system

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GBGB1322798.8A GB201322798D0 (en) 2013-12-20 2013-12-20 Production system
GB1322798.8 2013-12-20

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/106,555 A-371-Of-International US10544429B2 (en) 2013-12-20 2014-12-19 Viral vector production system
US16/714,516 Division US12054735B2 (en) 2013-12-20 2019-12-13 Viral vector production system

Publications (1)

Publication Number Publication Date
WO2015092440A1 true WO2015092440A1 (en) 2015-06-25

Family

ID=50071322

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2014/053813 Ceased WO2015092440A1 (en) 2013-12-20 2014-12-19 Viral vector production system

Country Status (10)

Country Link
US (2) US10544429B2 (cg-RX-API-DMAC7.html)
EP (2) EP3650548B1 (cg-RX-API-DMAC7.html)
JP (3) JP6655014B2 (cg-RX-API-DMAC7.html)
KR (1) KR102354365B1 (cg-RX-API-DMAC7.html)
CN (1) CN106029891B (cg-RX-API-DMAC7.html)
DK (1) DK3083969T3 (cg-RX-API-DMAC7.html)
ES (2) ES2911805T3 (cg-RX-API-DMAC7.html)
GB (1) GB201322798D0 (cg-RX-API-DMAC7.html)
PL (1) PL3083969T3 (cg-RX-API-DMAC7.html)
WO (1) WO2015092440A1 (cg-RX-API-DMAC7.html)

Cited By (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017106202A3 (en) * 2015-12-14 2017-08-31 The Trustees Of The University Of Pennsylvania Gene therapy for ocular disorders
WO2018045177A1 (en) * 2016-09-01 2018-03-08 Chimera Bioengineering, Inc. Gold optimized car t-cells
WO2018167486A1 (en) 2017-03-15 2018-09-20 Oxford Biomedica (Uk) Limited Method
CN109863243A (zh) * 2016-09-30 2019-06-07 埃斯蒂文制药股份有限公司 用于治疗粘多糖症的腺相关病毒载体
EP3502260A1 (en) 2017-12-22 2019-06-26 Oxford BioMedica (UK) Limited Retroviral vector
US10508152B2 (en) 2015-03-17 2019-12-17 Chimera Bioengineering, Inc. Smart CAR devices, DE CAR polypeptides, side CARs and uses thereof
US10675305B2 (en) 2018-02-13 2020-06-09 Chimera Bioengineering, Inc. Coordinating gene expression using RNA destabilizing elements
WO2021094752A1 (en) 2019-11-12 2021-05-20 Oxford Biomedica (Uk) Limited Production system
US11052111B2 (en) 2015-12-08 2021-07-06 Chimera Bioengineering, Inc. Smart CAR devices and DE CAR polypeptides for treating disease and methods for enhancing immune responses
US20210222197A1 (en) * 2018-05-16 2021-07-22 Ospedale San Raffaele S.R.L. Virus vector production
WO2021160993A1 (en) 2020-02-13 2021-08-19 Oxford Biomedica (Uk) Limited Production of lentiviral vectors
WO2021181108A1 (en) 2020-03-13 2021-09-16 Oxford Biomedica (Uk) Limited Lentiviral vectors
WO2021229242A1 (en) 2020-05-15 2021-11-18 Oxford Biomedica (Uk) Limited Viral vector production
GB202114532D0 (en) 2021-10-12 2021-11-24 Oxford Biomedica Ltd Lentiviral Vectors
GB202114529D0 (en) 2021-10-12 2021-11-24 Oxford Biomedica Ltd Lentiviral vectors
GB202114530D0 (en) 2021-10-12 2021-11-24 Oxford Biomedica Ltd Retroviral vectors
US11219695B2 (en) 2016-10-20 2022-01-11 Sangamo Therapeutics, Inc. Methods and compositions for the treatment of Fabry disease
WO2022101617A1 (en) 2020-11-10 2022-05-19 Oxford Biomedica (Uk) Limited Preparation of a solution of polymer/nucleic acid complexes
WO2023062363A1 (en) 2021-10-12 2023-04-20 Oxford Biomedica (Uk) Limited Lentiviral vectors
WO2023062359A2 (en) 2021-10-12 2023-04-20 Oxford Biomedica (Uk) Limited Novel viral regulatory elements
US11648277B2 (en) 2019-08-18 2023-05-16 Chimera Bioengineering, Inc. Combination therapy with gold controlled transgenes
CN116348583A (zh) * 2020-05-26 2023-06-27 川赛托斯有限责任公司 用于转染的装置和方法
US11718929B2 (en) 2016-05-17 2023-08-08 Chimera Bioengineering, Inc. Methods for making novel antigen binding domains
US11827898B2 (en) 2017-06-14 2023-11-28 The Trustees Of The University Of Pennsylvania Gene therapy for ocular disorders
WO2024038266A1 (en) 2022-08-16 2024-02-22 Oxford Biomedica (Uk) Limited Envelope proteins
US12234472B2 (en) 2021-10-18 2025-02-25 Regeneron Pharmaceuticals, Inc. Eukaryotic cells comprising adenovirus-associated virus polynucleotides
WO2025153852A1 (en) * 2024-01-17 2025-07-24 1. Revvity Gene Delivery Gmbh Production of viral vectors
US12522636B2 (en) 2019-02-08 2026-01-13 Krystal Biotech, Inc. Compositions and methods for delivering CFTR polypeptides
US12576135B2 (en) 2021-09-29 2026-03-17 Chimera Bioengineering, Inc. Compositions and methods for anti-TnMUC1 gold CAR t-cells

Families Citing this family (45)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3151866B1 (en) 2014-06-09 2023-03-08 Voyager Therapeutics, Inc. Chimeric capsids
RU2716991C2 (ru) 2014-11-05 2020-03-17 Вояджер Терапьютикс, Инк. Полинуклеотиды aadc для лечения болезни паркинсона
WO2016077687A1 (en) 2014-11-14 2016-05-19 Voyager Therapeutics, Inc. Compositions and methods of treating amyotrophic lateral sclerosis (als)
KR20230145206A (ko) 2014-11-14 2023-10-17 보이저 테라퓨틱스, 인크. 조절성 폴리뉴클레오티드
US11697825B2 (en) 2014-12-12 2023-07-11 Voyager Therapeutics, Inc. Compositions and methods for the production of scAAV
EP3448874A4 (en) 2016-04-29 2020-04-22 Voyager Therapeutics, Inc. COMPOSITIONS FOR TREATING A DISEASE
US11299751B2 (en) 2016-04-29 2022-04-12 Voyager Therapeutics, Inc. Compositions for the treatment of disease
KR102427379B1 (ko) 2016-05-18 2022-08-02 보이저 테라퓨틱스, 인크. 헌팅톤 질환을 치료하기 위한 조성물 및 방법
KR20240056729A (ko) 2016-05-18 2024-04-30 보이저 테라퓨틱스, 인크. 조절성 폴리뉴클레오티드
WO2018044933A1 (en) 2016-08-30 2018-03-08 The Regents Of The University Of California Methods for biomedical targeting and delivery and devices and systems for practicing the same
US11783918B2 (en) 2016-11-30 2023-10-10 Microsoft Technology Licensing, Llc DNA random access storage system via ligation
US10793897B2 (en) * 2017-02-08 2020-10-06 Microsoft Technology Licensing, Llc Primer and payload design for retrieval of stored polynucleotides
US12012602B2 (en) 2017-03-10 2024-06-18 The Medical College Of Wisconsin, Inc. Riboswitch modulated gene therapy for retinal diseases
GB201706121D0 (en) * 2017-04-18 2017-05-31 Glaxosmithkline Ip Dev Ltd Stable cell lines for retroviral production
JP2020518258A (ja) 2017-05-05 2020-06-25 ボイジャー セラピューティクス インコーポレイテッドVoyager Therapeutics,Inc. 筋萎縮性側索硬化症(als)治療組成物および方法
JP2020518259A (ja) 2017-05-05 2020-06-25 ボイジャー セラピューティクス インコーポレイテッドVoyager Therapeutics,Inc. ハンチントン病治療組成物および方法
US11767539B2 (en) * 2017-05-12 2023-09-26 University Of Massachusetts Viral vector production
JOP20190269A1 (ar) 2017-06-15 2019-11-20 Voyager Therapeutics Inc بولي نوكليوتيدات aadc لعلاج مرض باركنسون
CA3070087A1 (en) 2017-07-17 2019-01-24 Voyager Therapeutics, Inc. Trajectory array guide system
US20210130775A1 (en) * 2017-08-02 2021-05-06 Autolus Limited Cells expressing a chimeric antigen receptor or engineered tcr and comprising a nucleotide sequence which is selectively expressed
AU2018338728B2 (en) 2017-09-29 2025-01-02 Centre National De La Recherche Scientifique (Cnrs) Rescue of central and peripheral neurological phenotype of Friedreich's Ataxia by intravenous delivery
WO2019074907A1 (en) 2017-10-10 2019-04-18 Nantbio, Inc. MODIFIED EC7 CELLS WITH LOW TOXICITY FOR VIRAL PRODUCTION LOADS
EP3697908A1 (en) 2017-10-16 2020-08-26 Voyager Therapeutics, Inc. Treatment of amyotrophic lateral sclerosis (als)
TW202413649A (zh) 2017-10-16 2024-04-01 美商航海家醫療公司 肌萎縮性脊髓側索硬化症(als)之治療
CN113056561A (zh) * 2018-04-05 2021-06-29 牛津大学科技创新有限公司 用于治疗黄斑营养不良的组合物和方法
KR20210019996A (ko) 2018-05-15 2021-02-23 보이저 테라퓨틱스, 인크. 파킨슨병의 치료를 위한 조성물 및 방법
IL321380A (en) * 2018-08-31 2025-08-01 Univ Florida Adeno-associated viral vectors for the treatment of best disease
EP3856762A1 (en) 2018-09-28 2021-08-04 Voyager Therapeutics, Inc. Frataxin expression constructs having engineered promoters and methods of use thereof
WO2020142780A1 (en) * 2019-01-06 2020-07-09 Tocagen Inc. Car t cell methods and constructs
US20220348958A1 (en) * 2019-07-23 2022-11-03 Oxford Biomedica (Uk) Limited Enhancing Production of Lentiviral Vectors
KR20210026024A (ko) 2019-08-29 2021-03-10 변정원 학습에 대한 보상을 제공하여 동기부여를 높이는 학습 보조 어플리케이션
AU2020366460A1 (en) * 2019-10-16 2022-03-24 Kalivir Immunotherapeutics, Inc. Producer viruses for generation of retroviruses in SITU
CA3174928A1 (en) * 2020-03-11 2021-09-16 Remotor Therapeutics, Inc. Methods and materials for disseminating a protein throughout the central nervous system
CN113699112A (zh) * 2020-05-20 2021-11-26 苏州方德门达新药开发有限公司 表达重组hsv-1 us11蛋白的工程细胞及其在提高慢病毒包装效率中的应用
CN112430582B (zh) * 2020-12-04 2022-05-03 北京艺妙神州医药科技有限公司 一种慢病毒稳定包装细胞系及其制备方法
CN112501210B (zh) * 2020-12-07 2022-08-05 和元生物技术(上海)股份有限公司 外源基因可控表达的慢病毒包装方法
GB202102832D0 (en) * 2021-02-26 2021-04-14 Ip2Ipo Innovations Ltd Retroviral vectors
CN114181972A (zh) * 2021-11-23 2022-03-15 上海本导基因技术有限公司 适用于难治性血管新生性眼疾病基因治疗的慢病毒载体
CN114107231B (zh) * 2021-12-13 2023-08-18 重庆大学 实现全脑突触后神经元胞体标记的重组腺相关病毒及其应用
CN114639442B (zh) * 2022-03-30 2024-01-30 中国农业科学院农业基因组研究所 一种基于单核苷酸多态性预测开放阅读框的方法及系统
WO2023198828A1 (en) 2022-04-13 2023-10-19 Universitat Autònoma De Barcelona Treatment of neuromuscular diseases via gene therapy that expresses klotho protein
CN115161345A (zh) * 2022-06-14 2022-10-11 同宜医药(苏州)有限公司 高表达FRα的重组载体、重组细胞及其构建方法和用途
EP4601659A2 (en) * 2022-10-12 2025-08-20 University of Kansas Third-generation lentiviral gene therapy rescues function in a mouse model of usher ib
WO2024151704A2 (en) * 2023-01-10 2024-07-18 Sana Biotechnology, Inc. Process for viral vector production
CN116621947B (zh) * 2023-07-18 2023-11-07 北京智源人工智能研究院 一种基于索烃骨架的拓扑蛋白质、制备方法及应用

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000006751A2 (en) * 1998-07-30 2000-02-10 Advec Inc. Repressor proteins producing cell lines for the propagation of vectors
WO2007072056A2 (en) * 2005-12-22 2007-06-28 Oxford Biomedica (Uk) Limited Vectors
WO2010135716A1 (en) * 2009-05-22 2010-11-25 The Research Foundation Of State University Of New York Trans-acting rna switches

Family Cites Families (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4797368A (en) 1985-03-15 1989-01-10 The United States Of America As Represented By The Department Of Health And Human Services Adeno-associated virus as eukaryotic expression vector
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
US5512421A (en) 1991-02-19 1996-04-30 The Regents Of The University Of California Generation, concentration and efficient transfer of VSV-G pseudotyped retroviral vectors
CA2199832C (en) 1994-09-19 2000-08-01 Philippe Leboulch Anti-sickling beta-globin protein, compositions and methods for treating sickle cell disease
GB9510272D0 (en) 1995-05-22 1995-07-19 Isis Innovation Retroviral vectors
US5723315A (en) 1996-08-23 1998-03-03 Genetics Institute, Inc. Secreted proteins and polynucleotides encoding them
US6100071A (en) 1996-05-07 2000-08-08 Genentech, Inc. Receptors as novel inhibitors of vascular endothelial growth factor activity and processes for their production
WO1998005635A1 (en) 1996-08-07 1998-02-12 Darwin Discovery Limited Hydroxamic and carboxylic acid derivatives having mmp and tnf inhibitory activity
US6126939A (en) 1996-09-03 2000-10-03 Yeda Research And Development Co. Ltd. Anti-inflammatory dipeptide and pharmaceutical composition thereof
PT904392E (pt) 1996-10-17 2001-06-29 Oxford Biomedica Ltd Vectores retrovirais
US6924123B2 (en) 1996-10-29 2005-08-02 Oxford Biomedica (Uk) Limited Lentiviral LTR-deleted vector
ATE533784T1 (de) 1997-10-02 2011-12-15 Altor Bioscience Corp Lösliche, einzelkettige proteine des t- zellrezeptors
ES2373406T3 (es) 1997-12-22 2012-02-03 Oxford Biomedica (Uk) Limited Vectores basados en el virus de la anemia infecciosa equina (vaie).
GB9803351D0 (en) 1998-02-17 1998-04-15 Oxford Biomedica Ltd Anti-viral vectors
GB9904905D0 (en) 1999-03-03 1999-04-28 Oxford Biomedica Ltd Cells
GB0009760D0 (en) 2000-04-19 2000-06-07 Oxford Biomedica Ltd Method
IL160359A0 (en) 2001-08-31 2004-07-25 Avidex Ltd Soluble t cell receptor
SI1504108T1 (sl) 2002-02-01 2013-07-31 Oxford Biomedica (Uk) Limited Lentiviralni vektor
FR2872170B1 (fr) 2004-06-25 2006-11-10 Centre Nat Rech Scient Cnrse Lentivirus non interactif et non replicatif, preparation et utilisations
GB0526211D0 (en) 2005-12-22 2006-02-01 Oxford Biomedica Ltd Viral vectors
DK2307551T3 (en) 2008-06-18 2017-03-20 Oxford Biomedica (Uk) Ltd CLEANING RETROVIRAL VECTORS
GB201118636D0 (en) 2011-10-28 2011-12-07 Oxford Biomedica Ltd Nucleotide sequence
JP2015529466A (ja) 2012-09-14 2015-10-08 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア 鎌状赤血球症の幹細胞遺伝子治療のためのレンチウイルスベクター

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000006751A2 (en) * 1998-07-30 2000-02-10 Advec Inc. Repressor proteins producing cell lines for the propagation of vectors
WO2007072056A2 (en) * 2005-12-22 2007-06-28 Oxford Biomedica (Uk) Limited Vectors
WO2010135716A1 (en) * 2009-05-22 2010-11-25 The Research Foundation Of State University Of New York Trans-acting rna switches

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
M. NIE ET AL: "Different modes and potencies of translational repression by sequence-specific RNA-protein interaction at the 5'-UTR", NUCLEIC ACIDS RESEARCH, vol. 34, no. 19, 5 October 2006 (2006-10-05), pages 5528 - 5540, XP055172755, ISSN: 0305-1048, DOI: 10.1093/nar/gkl584 *

Cited By (60)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10508152B2 (en) 2015-03-17 2019-12-17 Chimera Bioengineering, Inc. Smart CAR devices, DE CAR polypeptides, side CARs and uses thereof
US11530272B2 (en) 2015-03-17 2022-12-20 Chimera Bioengineering, Inc. Smart car devices, DE car polypeptides, side CARs and uses thereof
US11052111B2 (en) 2015-12-08 2021-07-06 Chimera Bioengineering, Inc. Smart CAR devices and DE CAR polypeptides for treating disease and methods for enhancing immune responses
US11090392B2 (en) 2015-12-14 2021-08-17 The Trustees Of The University Of Pennsylvania Gene therapy for ocular disorders
US12403204B2 (en) 2015-12-14 2025-09-02 The Trustees Of The University Of Pennsylvania Gene therapy for ocular disorders
CN109069668A (zh) * 2015-12-14 2018-12-21 宾夕法尼亚州大学信托人 用于眼病的基因疗法
WO2017106202A3 (en) * 2015-12-14 2017-08-31 The Trustees Of The University Of Pennsylvania Gene therapy for ocular disorders
US11718929B2 (en) 2016-05-17 2023-08-08 Chimera Bioengineering, Inc. Methods for making novel antigen binding domains
EP4342978A3 (en) * 2016-09-01 2024-07-03 Chimera Bioengineering Inc. Gold optimized car t-cells
US10472637B2 (en) 2016-09-01 2019-11-12 Chimera Bioengingeering, Inc. Gold optimized CAR T-cells
US10669549B2 (en) 2016-09-01 2020-06-02 Chimera Bioengineering, Inc. Gold optimized CAR T-cells
US11572566B2 (en) 2016-09-01 2023-02-07 Chimera Bioengineering, Inc. Gold optimized CAR t-cells
US11535853B2 (en) 2016-09-01 2022-12-27 Chimera Bioengineering, Inc. Gold optimized CAR T-cells
US10323248B2 (en) 2016-09-01 2019-06-18 Chimera Bioengineering, Inc. Gold optimized CAR T-cells
US10858660B2 (en) 2016-09-01 2020-12-08 Chimera Bioengineering, Inc. Gold optimized CAR T-cells
US11459572B2 (en) 2016-09-01 2022-10-04 Chimera Bioengineering, Inc. Gold optimized CAR T-cells
EP3858365A1 (en) * 2016-09-01 2021-08-04 Chimera Bioengineering Inc. Gold optimized car t-cells
WO2018045177A1 (en) * 2016-09-01 2018-03-08 Chimera Bioengineering, Inc. Gold optimized car t-cells
CN109863243B (zh) * 2016-09-30 2023-07-28 埃斯蒂文制药股份有限公司 用于治疗粘多糖症的腺相关病毒载体
CN109863243A (zh) * 2016-09-30 2019-06-07 埃斯蒂文制药股份有限公司 用于治疗粘多糖症的腺相关病毒载体
US11219695B2 (en) 2016-10-20 2022-01-11 Sangamo Therapeutics, Inc. Methods and compositions for the treatment of Fabry disease
WO2018167486A1 (en) 2017-03-15 2018-09-20 Oxford Biomedica (Uk) Limited Method
US11427645B2 (en) 2017-03-15 2022-08-30 Oxford Biomedica (Uk) Limited 5T4-targeting agents and methods
US11827898B2 (en) 2017-06-14 2023-11-28 The Trustees Of The University Of Pennsylvania Gene therapy for ocular disorders
US12312592B2 (en) * 2017-12-22 2025-05-27 Oxford Biomedica (Uk) Limited Retroviral vector
US20230183745A1 (en) * 2017-12-22 2023-06-15 Oxford Biomedica (Uk) Limited Retroviral Vector
EP3633040A1 (en) 2017-12-22 2020-04-08 Oxford BioMedica (UK) Limited Retroviral vector
EP3502260A1 (en) 2017-12-22 2019-06-26 Oxford BioMedica (UK) Limited Retroviral vector
EP3696272A1 (en) 2017-12-22 2020-08-19 Oxford BioMedica (UK) Limited Retroviral vector
US11110125B2 (en) 2018-02-13 2021-09-07 Chimera Bioengineering, Inc. Coordinating gene expression using RNA destabilizing elements
US10675305B2 (en) 2018-02-13 2020-06-09 Chimera Bioengineering, Inc. Coordinating gene expression using RNA destabilizing elements
US10688132B2 (en) 2018-02-13 2020-06-23 Chimera Bioengineering, Inc. Coordinating gene expression using RNA destabilizing elements
US11497774B2 (en) 2018-02-13 2022-11-15 Chimera Bioengineering, Inc. Coordinating gene expression using RNA destabilizing elements
US11311577B2 (en) 2018-02-13 2022-04-26 Chimera Bioengineering, Inc. Coordinating gene expression using RNA destabilizing elements
US20210222197A1 (en) * 2018-05-16 2021-07-22 Ospedale San Raffaele S.R.L. Virus vector production
US12359217B2 (en) * 2018-05-16 2025-07-15 Ospedale San Raffaele S.R.L. Virus vector production
US12522636B2 (en) 2019-02-08 2026-01-13 Krystal Biotech, Inc. Compositions and methods for delivering CFTR polypeptides
US11648277B2 (en) 2019-08-18 2023-05-16 Chimera Bioengineering, Inc. Combination therapy with gold controlled transgenes
WO2021094752A1 (en) 2019-11-12 2021-05-20 Oxford Biomedica (Uk) Limited Production system
CN114667161A (zh) * 2019-11-12 2022-06-24 牛津生物医学(英国)有限公司 生产系统
WO2021160993A1 (en) 2020-02-13 2021-08-19 Oxford Biomedica (Uk) Limited Production of lentiviral vectors
WO2021181108A1 (en) 2020-03-13 2021-09-16 Oxford Biomedica (Uk) Limited Lentiviral vectors
WO2021229242A1 (en) 2020-05-15 2021-11-18 Oxford Biomedica (Uk) Limited Viral vector production
CN116348583A (zh) * 2020-05-26 2023-06-27 川赛托斯有限责任公司 用于转染的装置和方法
EP4335458A2 (en) 2020-11-10 2024-03-13 Oxford BioMedica (UK) Limited Preparation of a solution of polymer/nucleic acid complexes
EP4335457A2 (en) 2020-11-10 2024-03-13 Oxford BioMedica (UK) Limited Preparation of a solution of polymer/nucleic acid complexes
WO2022101617A1 (en) 2020-11-10 2022-05-19 Oxford Biomedica (Uk) Limited Preparation of a solution of polymer/nucleic acid complexes
US12576135B2 (en) 2021-09-29 2026-03-17 Chimera Bioengineering, Inc. Compositions and methods for anti-TnMUC1 gold CAR t-cells
WO2023062365A2 (en) 2021-10-12 2023-04-20 Oxford Biomedica (Uk) Limited Lentiviral vectors
WO2023062363A1 (en) 2021-10-12 2023-04-20 Oxford Biomedica (Uk) Limited Lentiviral vectors
WO2023062359A2 (en) 2021-10-12 2023-04-20 Oxford Biomedica (Uk) Limited Novel viral regulatory elements
EP4530355A2 (en) 2021-10-12 2025-04-02 Oxford BioMedica (UK) Limited Lentiviral vectors
WO2023062366A1 (en) 2021-10-12 2023-04-20 Oxford Biomedica (Uk) Limited Retroviral vectors
GB202114530D0 (en) 2021-10-12 2021-11-24 Oxford Biomedica Ltd Retroviral vectors
GB202114529D0 (en) 2021-10-12 2021-11-24 Oxford Biomedica Ltd Lentiviral vectors
GB202114532D0 (en) 2021-10-12 2021-11-24 Oxford Biomedica Ltd Lentiviral Vectors
WO2023062367A1 (en) 2021-10-12 2023-04-20 Oxford Biomedica (Uk) Limited Lentiviral vectors
US12234472B2 (en) 2021-10-18 2025-02-25 Regeneron Pharmaceuticals, Inc. Eukaryotic cells comprising adenovirus-associated virus polynucleotides
WO2024038266A1 (en) 2022-08-16 2024-02-22 Oxford Biomedica (Uk) Limited Envelope proteins
WO2025153852A1 (en) * 2024-01-17 2025-07-24 1. Revvity Gene Delivery Gmbh Production of viral vectors

Also Published As

Publication number Publication date
CN106029891B (zh) 2021-09-07
JP6655014B2 (ja) 2020-02-26
US20160333373A1 (en) 2016-11-17
EP3650548B1 (en) 2022-03-09
JP7340471B6 (ja) 2024-02-26
DK3083969T3 (da) 2019-10-14
KR102354365B1 (ko) 2022-01-20
CN106029891A (zh) 2016-10-12
JP7340471B2 (ja) 2023-09-07
EP3650548A1 (en) 2020-05-13
EP3083969A1 (en) 2016-10-26
ES2911805T3 (es) 2022-05-20
JP2020096609A (ja) 2020-06-25
JP2022091989A (ja) 2022-06-21
US10544429B2 (en) 2020-01-28
GB201322798D0 (en) 2014-02-05
EP3083969B1 (en) 2019-08-07
KR20160122125A (ko) 2016-10-21
JP2017500870A (ja) 2017-01-12
ES2748377T3 (es) 2020-03-16
PL3083969T3 (pl) 2020-03-31
US20200102578A1 (en) 2020-04-02
US12054735B2 (en) 2024-08-06

Similar Documents

Publication Publication Date Title
US12054735B2 (en) Viral vector production system
US12312592B2 (en) Retroviral vector
JP7759318B2 (ja) 産生系
US20240052366A1 (en) Production of Lentiviral Vectors
US20230118587A1 (en) Lentiviral Vectors
WO2023062359A2 (en) Novel viral regulatory elements
WO2023062365A2 (en) Lentiviral vectors
US20230183742A1 (en) Viral Vector Production
HK40023748A (en) Retroviral vector

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14821255

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2016541089

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 15106555

Country of ref document: US

ENP Entry into the national phase

Ref document number: 20167019013

Country of ref document: KR

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2014821255

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2014821255

Country of ref document: EP