WO2015042449A2 - Novel streptococcus vaccines - Google Patents
Novel streptococcus vaccines Download PDFInfo
- Publication number
- WO2015042449A2 WO2015042449A2 PCT/US2014/056632 US2014056632W WO2015042449A2 WO 2015042449 A2 WO2015042449 A2 WO 2015042449A2 US 2014056632 W US2014056632 W US 2014056632W WO 2015042449 A2 WO2015042449 A2 WO 2015042449A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- accession number
- streptococcus uberis
- uberis
- locus tag
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 ***N(*)C(C(C1O*)N*)OC(COI)C1O* Chemical compound ***N(*)C(C(C1O*)N*)OC(COI)C1O* 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/09—Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
- A61K39/092—Streptococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/10—Dispersions; Emulsions
- A61K9/107—Emulsions ; Emulsion preconcentrates; Micelles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0003—Invertebrate antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0002—Fungal antigens, e.g. Trichophyton, Aspergillus, Candida
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/002—Protozoa antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/002—Protozoa antigens
- A61K39/012—Coccidia antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/025—Enterobacteriales, e.g. Enterobacter
- A61K39/0258—Escherichia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/05—Actinobacteria, e.g. Actinomyces, Streptomyces, Nocardia, Bifidobacterium, Gardnerella, Corynebacterium; Propionibacterium
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/08—Clostridium, e.g. Clostridium tetani
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/085—Staphylococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/118—Chlamydiaceae, e.g. Chlamydia trachomatis or Chlamydia psittaci
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/06—Antiabortive agents; Labour repressants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/02—Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/14—Ectoparasiticides, e.g. scabicides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56911—Bacteria
- G01N33/56944—Streptococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
- A61K2039/552—Veterinary vaccine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55561—CpG containing adjuvants; Oligonucleotide containing adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55566—Emulsions, e.g. Freund's adjuvant, MF59
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55572—Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55577—Saponins; Quil A; QS21; ISCOMS
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55583—Polysaccharides
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/195—Assays involving biological materials from specific organisms or of a specific nature from bacteria
- G01N2333/315—Assays involving biological materials from specific organisms or of a specific nature from bacteria from Streptococcus (G), e.g. Enterococci
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2469/00—Immunoassays for the detection of microorganisms
- G01N2469/10—Detection of antigens from microorganism in sample from host
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- This invention relates generally to novel adjuvant formulations for enhancing the immune response to antigens for use in immunogenic and vaccine compositions. This invention also relates to methods of preparation and use of the adjuvant, immunogenic, and vaccine compositions.
- the present invention further provides vaccine compositions comprising Streptococcal antigens capable of raising protective and therapeutic host immune responses and for use as vaccines to protect against and/or reduce instances of Streptococcus infections.
- Bacterial, viral, and parasitic infections are wide spread in humans and animals. Diseases caused by these infectious agents are often resistant to antimicrobial pharmaceutical therapy, leaving no effective means of treatment. Consequently, a vaccinology approach is increasingly used to control infectious disease.
- a whole infectious pathogen can be made suitable for use in a vaccine formulation after chemical inactivation or appropriate genetic manipulation.
- a protein subunit of the pathogen can be expressed in a recombinant expression system and purified for use in a vaccine formulation.
- Vaccines can be made more efficacious by including an appropriate adjuvant in the composition.
- adjuvant generally refers to any material that increases the humoral or cellular immune response to an antigen.
- Adjuvants are used to accomplish two objectives: They slow the release of antigens from the injection site, and they enhance stimulation of the immune system.
- Traditional vaccines are generally composed of a crude preparation of inactivated or killed or modified live pathogenic microorganisms. The impurities associated with these cultures of pathological microorganisms may act as an adjuvant to enhance the immune response.
- the immunity invoked by vaccines that use homogeneous preparations of pathological microorganisms or purified protein subunits as antigens is often poor. The addition of certain exogenous materials such as an adjuvant therefore becomes necessary.
- synthetic and subunit vaccines may be expensive to produce.
- the pathogen cannot be grown on a commercial scale, and thus, synthetic/subunit vaccines represent the only viable option.
- the addition of an adjuvant may permit the use of a smaller dose of antigen to stimulate a similar immune response, thereby reducing l the production cost of the vaccine.
- the effectiveness of some injectable medicinal agents may be significantly increased when the agent is combined with an adjuvant.
- an adjuvant should cause a relatively slow rate of release and absorption of the antigen in an efficient manner with minimum toxic, allergenic, irritating, and other undesirable effects to the host.
- an adjuvant should be non-viricidal, biodegradable, capable of consistently creating a high level of immunity, capable of stimulating cross protection, compatible with multiple antigens, efficacious in multiple species, non-toxic, and safe for the host (eg, no injection site reactions).
- an adjuvant is capable of micro-dosing, is dose sparing, has excellent shelf stability, is amenable to drying, can be made oil-free, can exist as either a solid or a liquid, is isotonic, is easily manufactured, and is inexpensive to produce.
- an adjuvant it is highly desirable for an adjuvant to be configurable so as to induce either a humoral or cellular immune response or both, depending on the requirements of the vaccination scenario.
- the number of adjuvants that can meet the above requirements is limited.
- FCA Freund's Complete Adjuvant
- Some other materials that have been used as adjuvants include metallic oxides (e.g., aluminum hydroxide), alum, inorganic chelates of salts, gelatins, various paraffin-type oils, synthesized resins, alginates, mucoid and polysaccharide compounds, caseinates, and blood-derived substances such as fibrin clots. While these materials are generally efficacious at stimulating the immune system, none has been found to be entirely satisfactory due to adverse effects in the host (e.g., production of sterile abcesses, organ damage, carcinogenicity, or allergenic responses) or undesirable pharmaceutical properties (e.g., rapid dispersion or poor control of dispersion from the injection site, or swelling of the material).
- metallic oxides e.g., aluminum hydroxide
- alum inorganic chelates of salts
- gelatins e.g., alum
- various paraffin-type oils esized resins
- synthesized resins e.g., alginates,
- Streptococcus uberis is an important mastitis-causing pathogen, responsible for a large proportion of both clinical and sub-clinical cases of mastitis in many parts of the world.
- the pathogen affects cattle, goats and sheep; however, infection of cattle is of primary importance due to its impact on the dairy industry, through welfare issues for affected animals, and also because of the significant financial impact on producers.
- uberis is highly-heterogenous; it is biochemically and physiologically ill-defined, and is serologically heterogenous (Hardie, J.M. 1986 Other streptococci. In Sergey's Manual of Systematic Bacteriology Vol. 2, ed.
- uberis genotypes (designated types I and I I) (Garvie & Bramley 1979; Collins et a/. 1984), both associated with the bovine host and a cause of mastitis. Type I I 5.
- uberis was later re-classified as Streptococcus parauberis (Williams AM, Collins M D. 1990.
- Molecular taxonomic studies on Streptococcus uberis types I and II Description of Streptococcus parauberis sp. J. Appl. Bacteriol.
- the present invention is directed to the provision of novel vaccine compositions that employ conserved S. uberis antigens, thereby maximizing the ability of such compositions to prevent or treat infections throughout the world caused by the wide variety of genetically divergent Streptococcus species and S. uberis strains.
- the instant invention provides novel vaccine compositions and adjuvant formulations useful for vaccines.
- the invention provides an adjuvant formulation comprising an oily phase and an aqueous phase, wherein the oily phase comprises at least 50% of the formulation v/v, wherein said formulation comprises at least one of monophosphoryl lipid A (MPL-A) or an analog thereof and an immunostimulatory oligonucleotide, with provisos that a) if said immunostimulatory oligonucleotide is absent, then the formulation comprises a poly l :C, a glycolipid, and, optionally, a quaternary amine; or a polycationic carrier; and b) if said monophosphoryl lipid A (M PL-A) or the analog thereof is absent, then the formulation comprises a source of aluminum, and, optionally, a polycationic carrier.
- MPL-A monophosphoryl lipid A
- the oily phase may comprise an oil and, optionally, an oil-soluble emulsifier.
- both said monophosphoryl lipid A (MPL-A) or the analog thereof are present in the adjuvant formulation.
- the formulation further comprises a sterol (e.g., cholesterol), a poly l :C, or a combination thereof.
- the adjuvant formulations include a combination of monophosphoryl lipid A (MPL-A) or an analog thereof, a sterol, and an immunostimulatory oligonucleotide ("TCMO").
- MPL-A monophosphoryl lipid A
- TCMO immunostimulatory oligonucleotide
- the adjuvant formulation may also optionally comprise poly l :C (“TCMYO") and/or a saponin (“QTCMO” or "QTCMYO", respectively).
- the adjuvant formulations in addition to the oil and the optional emulsifier(s), also include a combination of a quaternary amine, a glycolipid, M PL-A or an analog thereof, and poly l :C ("ODYRM").
- the adjuvant formulations in addition to the oil and the optional emulsifier(s), also include a combination of a saponin, a sterol, a quaternary amine, and a polycationic carrier ("Q.CDXO").
- the adjuvant may include the immunostimulatory oligonucleotide, a source of aluminum, and, optionally, a polycationic carrier ("TO A" and "TXO-A", respectively).
- the adjuvant formulation may include an antigen component, thus forming a vaccine composition.
- the antigen component provides one or more macromolecule components from Streptococcus uberis, including any strains thereof, to include proteins, nucleic acids, lipds, glyoclipids, lipopolysacchairdes, polysaccharides, all and the like.
- the antigen component is provided from any Streptococcus species, as long as the antigen is cross reactive against Streptococcus, and is protective or immunizing, owing to combination with the efficacious adjuvants of the present invention.
- vaccine compositions comprising an effective amount of Streptococcus antigen and an adjuvant formulation, wherein the antigen is selected from any one, two, three or four of the following: Streptococcus uberis ferrichrome binding protein (SEQ ID NO: 2, locus tag SUB0423, accession number YP-002561776); Streptococcus uberis elongation factor Tu (SEQ I D NO: 5, locus tag SUB0604, accession number YP-002561947); Streptococcus uberis lipoprotein (SEQ I D NO: 8, locus tag SUB0950, accession number YP-002562276); and Streptococcus uberis serine protease (SEQ ID NO 11, locus tag SUB1868, accession number YP- 002563137); wherein the adjuvant formulation comprising an oily phase and an aqueous phase, wherein the oily phase comprises at least 50% of the formulation
- the formulation comprises:
- a poly l:C a glycolipid, and, optionally, a quaternary amine; or ii. a polycationic carrier;
- the formulation comprises a source of aluminum.
- a vaccine composition comprising an adjuvant formulation wherein
- the immunostimulatory oligonucleotide if present, is a CpG or an oligoribonucleotide
- the polycationic carrier if present, is selected from the group consisting of dextran, dextran DEAE (and derivatives thereof), PEGs, guar gums, chitosan derivatives, polycellulose derivatives like hydroxyethyl cellulose (HEC) polyethylenimene, poly aminos
- the quaternary amine if present, is selected from the group consisting of DDA and avridine.
- vaccine compositions are provided in which the glycolipid component of the adjuvant formulation, if present, comprises a compound of formula I
- R 1 and R 2 are independently hydrogen, or a saturated alkyl radical having up to 20 carbon atoms;
- X is -CH 2 -, -0- or -NH-;
- R 2 is hydrogen, or a saturated or unsaturated alkyl radical having up to 20 carbon atoms;
- R 3 , R 4 , and R 5 are independently hydrogen, -S0 4 2 ⁇ , -P0 2 ⁇ , -COCi_i 0 alkyl;
- R 6 is L- alanyl, L-alpha-aminobutyl, L-arginyl, L-asparginyl, L-aspartyl, L-cysteinyl, L-glutamyl, L-glycyl, L-histidyl, L-hydroxyprolyl, L-isoleucyl, L-leucyl, L-lysyl, L-methionyl, L-ornithinyl, L-phenyal
- a vaccine composition comprising an effective amount of 1, 2, 3, or 4 Streptococcus antigens and an adjuvant, wherein the 1, 2, 3 or 4 antigens are selected from the group consisting of Streptococcus uberis ferrichrome binding protein (SEQ.
- specific pairs of Streptococcus antigens are used with an adjuvant to form a vaccine composition, wherein the resultant combined antigen provided in the composition is either (a) Streptococcus uberis ferrichrome binding protein (SEQ ID NO: 2, locus tag SUB0423, accession number YP-002561776) and Streptococcus uberis elongation factor Tu (SEQ I D NO: 5, locus tag SUB0604, accession number YP-002561947), or (b) Streptococcus uberis lipoprotein (SEQ ID NO: 8, locus tag SUB0950, accession number YP-002562276), and Streptococcus uberis serine protease (SEQ I D NO 11, locus tag SUB1868, accession number YP-002563137).
- SEQ ID NO: 2 Streptococcus uberis ferrichrome binding protein
- Tu Streptococcus uberis elongation factor Tu
- the combination of 1, 2, 3 or 4 Streptococcus antigens that are used with an adjuvant to form a vaccine composition of the invention are thus selected from the group consisting of (a) to (k) as follows:
- Streptococcus uberis ferrichrome binding protein (SEQ ID NO: 2, locus tag SUB0423, accession number YP-002561776); Streptococcus uberis elongation factor Tu (SEQ I D NO: 5, locus tag SUB0604, accession number YP-002561947); Streptococcus uberis lipoprotein (SEQ I D NO: 8, locus tag SUB0950, accession number YP-002562276); and Streptococcus uberis serine protease (SEQ I D NO 11, locus tag SUB1868, accession number YP-002563137);
- Streptococcus uberis ferrichrome binding protein (SEQ ID NO: 2, locus tag SUB0423, accession number YP-002561776); Streptococcus uberis elongation factor Tu (SEQ I D NO: 5, locus tag SUB0604, accession number YP-002561947); and Streptococcus uberis lipoprotein (SEQ ID NO: 8, locus tag SUB0950, accession number YP-002562276);
- Streptococcus uberis ferrichrome binding protein (SEQ ID NO: 2, locus tag SUB0423, accession number YP-002561776); Streptococcus uberis elongation factor Tu (SEQ I D NO: 5, locus tag SUB0604, accession number YP-002561947); and Streptococcus uberis serine protease (SEQ I D NO 11, locus tag SUB1868, accession number YP-002563137);
- Streptococcus uberis ferrichrome binding protein (SEQ ID NO: 2, locus tag SUB0423, accession number YP-002561776); Streptococcus uberis lipoprotein (SEQ ID NO: 8, locus tag SUB0950, accession number YP-002562276); and Streptococcus uberis serine protease (SEQ ID NO 11, locus tag SUB1868, accession number YP-002563137);
- Streptococcus uberis elongation factor Tu (SEQ I D NO: 5, locus tag SUB0604, accession number YP- 002561947); Streptococcus uberis lipoprotein (SEQ ID NO : 8, locus tag SUB0950, accession number YP- 002562276); and Streptococcus uberis serine protease (SEQ ID NO 11, locus tag SUB1868, accession number YP-002563
- Streptococcus uberis ferrichrome binding protein SEQ I D NO: 2, locus tag SUB0423, accession number YP-002561776
- Streptococcus uberis elongation factor Tu SEQ ID NO: 5, locus tag SUB0604, accession number YP-002561947
- Streptococcus uberis ferrichrome binding protein SEQ ID NO: 2, locus tag SUB0423, accession number YP-002561776
- Streptococcus uberis lipoprotein SEQ ID NO: 8, locus tag SUB0950, accession number YP-002562276
- Streptococcus uberis ferrichrome binding protein (SEQ ID NO: 2, locus tag SUB0423, accession number YP-002561776); and Streptococcus uberis serine protease (SEQ ID NO 11, locus tag SUB1868, accession number YP-002563137);
- Streptococcus uberis elongation factor Tu (SEQ ID NO: 4, locus tag SUB0604, accession number YP- 002561947); and Streptococcus uberis lipoprotein (SEQ ID NO : 6, locus tag SUB0950, accession number YP-002562276);
- Figure 1 shows a map of the pFLEXlO vector, as a representative construct
- Adjuvant means any substance that increases the humoral or cellular immune response to an antigen. Adjuvants are generally used to accomplish two objectives: the controlled release of antigens from the injection site, and the stimulation of the immune system.
- Adjuvant formulation refers to formulations having adjuvanting properties.
- Alkyl refers to both straight and branched saturated hydrocarbon moieties.
- Amines refers to a chemical compound containing nitrogen. Amines are a group of compounds derived from ammonia by substituting hydrocarbon groups for the hydrogen atoms. “Quaternary amine” refers to an ammonium based compound with four hydrocarbon groups.
- Antibody refers to an immunoglobulin molecule that can bind to a specific antigen as the result of an immune response to that antigen.
- Immunoglobulins are serum proteins composed of "light” and “heavy” polypeptide chains having "constant” and “variable” regions and are divided into classes (e.g., IgA, IgD, IgE, IgG, and IgM) based on the composition of the constant regions.
- Antigen refers to any substance that is recognized by the animal's immune system and generates an immune response.
- the term includes killed, inactivated, attenuated, or modified live bacteria, viruses, or parasites.
- antigen also includes polynucleotides, polypeptides, recombinant proteins, synthetic peptides, protein extract, cells (including tumor cells), tissues, polysaccharides, or lipids, or fragments thereof, individually or in any combination thereof.
- antigen also includes antibodies, such as anti-idiotype antibodies or fragments thereof, and to synthetic peptide mimotopes that can mimic an antigen or antigenic determinant (epitope).
- Bacterin means a suspension of one or more killed bacteria which may be used as a component of a vaccine or immunogenic composition.
- Buffer means a chemical system that prevents change in the concentration of another chemical substance, e.g., proton donor and acceptor systems serve as buffers preventing marked changes in hydrogen ion concentration (pH).
- a further example of a buffer is a solution containing a mixture of a weak acid and its salt (conjugate base) or a weak base and its salt (conjugate acid).
- Cellular immune response or “cell mediated immune response” is one mediated by T- lymphocytes or other white blood cells or both, and includes the production of cytokines, chemokines and similar molecules produced by activated T-cells, white blood cells, or both; or a T lymphocyte or other immune cell response that kills an infected cell.
- “Companion animals” refers to dogs, cats and equines.
- Consisting essentially as applied to the adjuvant formulations refers to formulation which does not contain unrecited additional adjuvanting or immunomodulating agents in the amounts at which said agent exert measurable adjuvanting or immunomodulating effects.
- DTH Delayed type hypersensitivity
- Dose refers to a vaccine or immunogenic composition given to a subject.
- a “first dose” or “priming vaccine” refers to the dose of such a composition given on Day 0.
- a “second dose” or a “third dose” or an “annual dose” refers to an amount of such composition given subsequent to the first dose, which may or may not be the same vaccine or immunogenic composition as the first dose.
- emulsifier is used broadly in the instant disclosure. It includes substances generally accepted as emulsifiers, e.g., different products of TWEEN ® or SPAN ® product lines (fatty acid esters of polyethoxylated sorbitol and fatty-acid-substituted sorbitan surfactants, respectively), and different solubility enhancers such as PEG-40 Castor Oil or another PEGylated hydrogenated oil.
- “Humoral immune response” refers to one that is mediated by antibodies.
- Immune response in a subject refers to the development of a humoral immune response, a cellular immune response, or a humoral and a cellular immune response to an antigen. Immune responses can usually be determined using standard immunoassays and neutralization assays, which are known in the art.
- Immunologically protective amount or “immunologically effective amount” or “effective amount to produce an immune response” of an antigen is an amount effective to induce an immunogenic response in the recipient.
- the immunogenic response may be sufficient for diagnostic purposes or other testing, or may be adequate to prevent signs or symptoms of disease, including adverse health effects or complications thereof, caused by infection with a disease agent. Either humoral immunity or cell-mediated immunity or both may be induced.
- the immunogenic response of an animal to an immunogenic composition may be evaluated, e.g., indirectly through measurement of antibody titers, lymphocyte proliferation assays, or directly through monitoring signs and symptoms after challenge with wild type strain, whereas the protective immunity conferred by a vaccine can be evaluated by measuring, e.g., reduction in clinical signs such as mortality, morbidity, temperature number, overall physical condition, and overall health and performance of the subject.
- the immune response may comprise, without limitation, induction of cellular and/or humoral immunity.
- Immunogenic means evoking an immune or antigenic response.
- an immunogenic composition would be any composition that induces an immune response.
- Immunoser molecule refers to a molecule that stimulates a non-antigen -specific immune response.
- Lipids refers to any of a group of organic compounds, including the fats, oils, waxes, sterols, and triglycerides that are insoluble in water but soluble in nonpolar organic solvents, are oily to the touch, and together with carbohydrates and proteins constitute the principal structural material of living cells.
- “Pharmaceutically acceptable” refers to substances, which are within the scope of sound medical judgment, suitable for use in contact with the tissues of subjects without undue toxicity, irritation, allergic response, and the like, commensurate with a reasonable benefit-to-risk ratio, and effective for their intended use.
- the term "Poly l:C” refers to naturally occurring polymers of polyinosinic:polycytadylic acids as well as synthetic forms thereof, e.g., with stabilized backbone and preferably having TLR-3 agonist activity.
- Reactogenicity refers to the side effects elicited in a subject in response to the administration of an adjuvant, an immunogenic, or a vaccine composition. It can occur at the site of administration, and is usually assessed in terms of the development of a number of symptoms. These symptoms can include inflammation, redness, and abscess. It is also assessed in terms of occurrence, duration, and severity. A “low” reaction would, for example, involve swelling that is only detectable by palpitation and not by the eye, or would be of short duration. A more severe reaction would be, for example, one that is visible to the eye or is of longer duration.
- Root Temperature means a temperature from 18 to 25°C.
- “Saponin” refers to a group of surface-active glycosides of plant origin composed of a hydrophilic region (usually several sugar chains) in association with a hydrophobic region of either steroid or triterpenoid structure.
- Steroids refers to any of a group of organic compounds belonging to biochemical class of lipids, which are easily soluble in organic solvents and slightly soluble in water. Steroids comprise a four-fused ring system of three fused cyclohexane (six-carbon) rings plus a fourth cyclopentane (five- carbon) ring.
- Steprols refers to compounds in animals which are biologically produced from terpenoid precursors. They comprise a steroid ring structure, having a hydroxyl (OH) group, usually attached to carbon-3.
- the hydrocarbon chain of the fatty-acid substituent varies in length, usually from 16 to 20 carbon atoms, and can be saturated or unsaturated.
- Sterols commonly contain one or more double bonds in the ring structure and also a variety of substituents attached to the rings. Sterols and their fatty-acid esters are essentially water insoluble.
- Subject refers to any animal for which the administration of an adjuvant composition is desired. It includes mammals and non-mammals, including primates, livestock, companion animals, laboratory test animals, captive wild animals, aves (including in ova), reptiles, and fish. Thus, this term includes but is not limited to monkeys, humans, swine; cattle, sheep, goats, equines, mice, rats, guinea pigs, hamsters, rabbits, felines, canines, chickens, turkeys, ducks, other poultry, frogs, and lizards.
- TCI50 refers to "tissue culture infective dose” and is defined as that dilution of a virus required to infect 50% of a given batch of inoculated cell cultures.
- Various methods may be used to calculate TCI D50, including the Spearman-Karber method which is utilized throughout this specification. For a description of the Spearman-Karber method, see B. W. Mahy & H. 0. Kangro, Virology Methods Manual, p. 25-46 (1996).
- “Therapeutically effective amount” refers to an amount of an antigen or vaccine that would induce an immune response in a subject receiving the antigen or vaccine which is adequate to prevent or reduce signs or symptoms of disease, including adverse health effects or complications thereof, caused by infection with a pathogen, such as a virus or a bacterium.
- Humoral immunity or cell- mediated immunity or both humoral and cell-mediated immunity may be induced.
- the immunogenic response of an animal to a vaccine may be evaluated, e.g., indirectly through measurement of antibody titers, lymphocyte proliferation assays, or directly through monitoring signs and symptoms after challenge with wild type strain.
- the protective immunity conferred by a vaccine can be evaluated by measuring, e.g., reduction in clinical signs such as mortality, morbidity, temperature number, overall physical condition, and overall health and performance of the subject.
- the amount of a vaccine that is therapeutically effective may vary depending on the particular adjuvant used, the particular antigen used, or the condition of the subject, and can be determined by one skilled in the art.
- Treating refers to preventing a disorder, condition, or disease to which such term applies, or to preventing or reducing one or more symptoms of such disorder, condition, or disease.
- Treatment refers to the act of "treating” as defined above.
- Triterpeniods refers to a large and diverse class of naturally occurring organic molecules, derived from six five-carbon isoprene (2-methyl-l,3-butadiene) units, which can be assembled and modified in thousands of ways. Most are multicyclic structures which differ from one another in functional groups and in their basic carbon skeletons. These molecules can be found in all classes of living things.
- Vaccine refers to a composition that includes an antigen, as defined herein. Administration of the vaccine to a subject results in an immune response, generally against one or more specific diseases. The amount of a vaccine that is therapeutically effective may vary depending on the particular antigen used, or the condition of the subject, and can be determined by one skilled in the art. Adjuvant formulations and methods of making
- the instant application discloses several adjuvant formulations suitable for the instant invention.
- the common feature of these adjuvants is the presence of oil and one or more emulsifiers, wherein the oily phase comprises more than 50% of the vaccine composition encompassing the adjuvant formulations disclosed therein.
- oils and combinations thereof are suitable for use of the instant invention.
- These oils include, without limitations, animal oils, vegetable oils, as well as non-metabolizable oils.
- Non-limiting examples of vegetable oils suitable in the instant invention are corn oil, peanut oil, soybean oil, coconut oil, and olive oil.
- Non-limiting example of animal oils is squalane.
- Suitable non-limiting examples of non-metabolizable oils include light mineral oil, straight chained or branched saturated oils, and the like.
- the oil used in the adjuvant formulations of the instant invention is a light mineral oil.
- mineral oil refers to a mixture of liquid hydrocarbons obtained from petrolatum via a distillation technique.
- the term is synonymous with "liquefied paraffin", "liquid petrolatum” and “white mineral oil.”
- the term is also intended to include "light mineral oil,” i.e., oil which is similarly obtained by distillation of petrolatum, but which has a slightly lower specific gravity than white mineral oil. See, e.g., Remington's Pharmaceutical Sciences, 18th Edition (Easton, Pa.: Mack Publishing Company, 1990, at pages 788 and 1323).
- Mineral oil can be obtained from various commercial sources, for example, J. T. Baker (Phillipsburg, Pa.), USB Corporation (Cleveland, Ohio).
- Preferred mineral oil is light mineral oil commercially available under the name DRAKEOL ® .
- the oily phase is present in an amount from 50% to 95% by volume; preferably, in an amount of greater than 50% to 85%; more preferably, in an amount from greater than 50% to 60%, and more preferably in the amount of greater than 50-52% v/v of the vaccine composition.
- the oily phase includes oil and emulsifiers (e.g., SPAN ® 80, TWEEN ® 80 etc), if any such emulsifiers are present.
- the volume of the oily phase is calculated as a sum of volumes of the oil and the emulsifier(s). Thus, for example, if the volume of the oil is 40% and the volume of the emulsifier(s) is 12% of a composition, then the oily phase would be present at 52% v/v of the composition. Similarly, if the oil is present in the amount of about 45% and the emulsifier(s) is present in the amount of about 6% of a composition, then the oily phase is present at about 51% v/v of the composition.
- oily phase is present in an amount from 50% to 95% by volume; preferably, in an amount of greater than 50% to 85%; more preferably, in an amount from 50% to 60%, and more preferably in the amount of 50-52% v/v of each of the adjuvants of the instant invention.
- the volume percentage of the oil and the oil-soluble emulsifier together is at least 50%, e.g., 50% to 95% by volume; preferably, in an amount of greater than 50% to 85%; more preferably, in an amount from 50% to 60%, and more preferably in the amount of 50-52% v/v of the vaccine composition.
- the oil may be present in the amount of 45% and the lipid-soluble emulsifier would be present present in the amount of greater than 5% v/v.
- the volume percentage of the oil and the oil-soluble emulsifier together would be at least 50%.
- volume percentage of the oil is over 40%, e.g., 40% to 90% by volume; 40% to 85%; 43% to 60%, 44-50% v/v of the vaccine composition.
- Emulsifiers suitable for use in the present emulsions include natural biologically compatible emulsifiers and non-natural synthetic surfactants.
- Biologically compatible emulsifiers include phospholipid compounds or a mixture of phospholipids.
- Preferred phospholipids are phosphatidylcholines (lecithin), such as soy or egg lecithin.
- Lecithin can be obtained as a mixture of phosphatides and triglycerides by water-washing crude vegetable oils, and separating and drying the resulting hydrated gums.
- a refined product can be obtained by fractionating the mixture for acetone insoluble phospholipids and glycolipids remaining after removal of the triglycerides and vegetable oil by acetone washing.
- lecithin can be obtained from various commercial sources.
- suitable phospholipids include phosphatidylglycerol, phosphatidylinositol, phosphatidylserine, phosphatidic acid, cardiolipin, and phosphatidylethanolamine.
- the phospholipids may be isolated from natural sources or conventionally synthesized.
- the emulsifiers used herein do not include lecithin, or use lecithin in an amount which is not immunologically effective.
- Non-natural, synthetic emulsifiers suitable for use in the adjuvant formulations of the present invention include sorbitan-based non-ionic surfactants, e.g. fatty-acid-substituted sorbitan surfactants (commercially available under the name SPAN ® or ARLACEL ® ), fatty acid esters of polyethoxylated sorbitol (TWEEN ® ), polyethylene glycol esters of fatty acids from sources such as castor oil (EMULFOR ® ); polyethoxylated fatty acid (e.g., stearic acid available under the name SIMULSOL ® M-53), polyethoxylated isooctylphenol/formaldehyde polymer (TYLOXAPOL ® ), polyoxyethylene fatty alcohol ethers (BRIJ ® ); polyoxyethylene nonphenyl ethers (TRITON ® N), polyoxyethylene isooctylphenyl ethers (TRITON
- Preferred synthetic surfactants are the surfactants available under the name SPAN ® and TWEEN ® , such as TWEEN ® -80 (Polyoxyethylene (20) sorbitan monooleate) and SPAN ® -80 (sorbitan monooleate).
- the emulsifier(s) may be present in the vaccine composition in an amount of 0.01% to 40% by volume, preferably, 0.1% to 15%, more preferably 2% to 10%.
- Additional ingredients present in the instant adjuvant formulations include cationic carriers, immunostimulatory oligonucleotides, monophospholipid A and analogs thereof (MPL-A), Polyinosinic:polycytidylic acid (poly l :C), saponins, quaternary ammoniums, sterols, glycolipids, a source of aluminum (e.g., REHYDRAGEL ® or VAC 20 ® wet gel) and combinations thereof.
- MPL-A immunostimulatory oligonucleotides
- poly l :C Polyinosinic:polycytidylic acid
- saponins quaternary ammoniums
- sterols glycolipids
- a source of aluminum e.g., REHYDRAGEL ® or VAC 20 ® wet gel
- Suitable cationic carriers include, without limitations, dextran, dextran DEAE (and derivatives thereof), PEGs, guar gums, chitosan derivatives, polycellulose derivatives like hydroxyethyl cellulose (HEC) polyethylenimene, poly aminos like polylysine and the like.
- Suitable immunostimulatory oligonucleotides include ODN (DNA-based), ORN (RNA-based) oligonucleotides, or chimeric ODN-ORN structures, which may have modified backbone including, without limitations, phosphorothioate modifications, halogenations, alkylation (e.g., ethyl- or methyl- modifications), and phosphodiester modifications.
- ODN DNA-based
- ORN RNA-based oligonucleotides
- chimeric ODN-ORN structures which may have modified backbone including, without limitations, phosphorothioate modifications, halogenations, alkylation (e.g., ethyl- or methyl- modifications), and phosphodiester modifications.
- poly inosinic -cytidylic acid or derivative thereof poly l:C
- CpG oligonucleotides are a recently described class of pharmacotherapeutic agents that are characterized by the presence of an unmethylated CG dinucleotide in specific base-sequence contexts (CpG motif).
- CpG motif specific base-sequence contexts
- the adjuvants of the instant invention utilize a so-called P-class immunostimulatory oligonucleotide, more preferably, modified P- class immunostimulatory oligonucleotides, even more preferably, E-modified P-class oligonucleotides.
- P-class immunostimulatory oligonucleotides are CpG oligonucleotides characterized by the presence of palindromes, generally 6-20 nucleotides long.
- the P-Class oligonucleotides have the ability to spontaneously self-assemble into concatamers either in vitro and/or in vivo.
- oligonucleotides are, in a strict sense, single-stranded, but the presence of palindromes allows for formation of concatamers or possibly stem-and-loop structures.
- the overall length of P- class immunostimulatory oligonucleotides is between 19 and 100 nucleotides, e.g., 19-30 nucleotides, 30-40 nucleotides, 40-50 nucleotides, 50-60 nucleotides, 60-70 nucleotides, 70-80 nucleotides, 80-90 nucleotides, 90-100 nucleotides.
- the immunostimulatory oligonucleotide contains a 5' TLR activation domain and at least two palindromic regions, one palindromic region being a 5' palindromic region of at least 6 nucleotides in length and connected to a 3' palindromic region of at least 8 nucleotides in length either directly or through a spacer.
- the P-class immunostimulatory oligonucleotides may be modified according to techniques known in the art.
- J-modification refers to iodo-modified nucleotides.
- E-modification refers to ethyl-modified nucleotide(s).
- E-modified P-class immunostimulatory oligonucleotides are P-class immunostimulatory oligonucleotides, wherein at least one nucleotide (preferably 5' nucleotide) is ethylated. Additional modifications include attachment of 6-nitro-benzimidazol, O- Methylation, modification with proynyl-dU, inosine modification, 2-bromovinyl attachment (preferably to uridine).
- the P-class immunostimulatory oligonucleotides may also contain a modified internucleotide linkage including, without limitations, phosphodiesther linkages and phosphorothioate linkages.
- the oligonucleotides of the instant invention may be synthesized or obtained from commercial sources.
- P-Class oligonucleotides and modified P-class oligonucleotides are further disclosed in published PCT application no. WO2008/068638, published on Jun. 12, 2008. Suitable non-limiting examples of modified P-class immunostiumulatory oligonucleotides are provided below ("*" refers to a phosphorothioate bond and "_" refers to a phosphodiester bond).
- the amount of P-class immunostimulatory oligonucleotide for use in the adjuvant compositions depends upon the nature of the P-class immunostimulatory oligonucleotide used and the intended species.
- Suitable analogs of MPL-A include, without limitations can be bacterial derived natural LPS altered or unaltered in structure or synthetic, Glucopyranosyl Lipid Adjuvant (GLA), pertactin , varying substitutions at 3-O-position of the reducing sugar, synthetic forms of lipid A analog with low endotoxicity.
- GLA Glucopyranosyl Lipid Adjuvant
- pertactin pertactin
- Sterols share a common chemical core, which is a steroid ring structure ⁇ ], having a hydroxyl (OH) group, usually attached to carbon-3.
- the hydrocarbon chain of the fatty-acid substituent varies in length, usually from 16 to 20 carbon atoms, and can be saturated or unsaturated.
- Sterols commonly contain one or more double bonds in the ring structure and also a variety of substituents attached to the rings.
- Sterols and their fatty-acid esters are essentially water insoluble. In view of these chemical similarities, it is thus likely that the sterols sharing this chemical core would have similar properties when used in the vaccine compositions of the instant invention.
- Sterols are well known in the art and can be purchased commercially. For example cholesterol is disclosed in the Merck Index, 12th Ed., p. 369. Suitable sterols include, without limitations, ⁇ -sitosterol, stigmasterol, ergosterol, ergocalciferol, and cholesterol.
- Suitable saponins include triterpenoid saponins. These triterpenoids a group of surface-active glycosides of plant origin and share common chemical core composed of a hydrophilic region (usually several sugar chains) in association with a hydrophobic region of either steroid or triterpenoid structure. Because of these similarities, the saponins sharing this chemical core are likely to have similar adjuvanting properties. Triterpenoids suitable for use in the adjuvant compositions can come from many sources, either plant derived or synthetic equivalents, including but not limited to, Quillaja saponaria, tomatine, ginseng extracts, mushrooms, and an alkaloid glycoside structurally similar to steroidal saponins.
- the adjuvant compositions generally contain an immunologically active saponin fraction from the bark of Quillaja saponaria.
- the saponin may be, for example, Quil A or another purified or partially purified saponin preparation, which can be obtained commercially.
- saponin extracts can be used as mixtures or purified individual components such as QS-7, QS-17, QS- 18, and QS-21.
- the Quil A is at least 85% pure. In other embodiments, the Quil A is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% pure..
- Quaternary amine compounds are ammonium based compounds with four hydrocarbon groups.
- hydrocarbon groups are generally limited to alkyl or aryl groups.
- the quaternary amine compounds are composed of four alkyl chains, two of which are C10-C20 alkyls and the remaining two are C1-C4 alkyls.
- the quaternary amine is Dimethyldioctadecylammonium bromide, chloride or pharmaceutically acceptable counterion (DDA).
- Suitable glycolipids are generally those which activate the Th2 response.
- the glycolipids include, without limitations, those encompassed by Formula I and that are generally described in US Publication 20070196384 (Ramasamy et al).
- R 1 and R 2 are independently hydrogen, or a saturated alkyl radical having up to 20 carbon atoms;
- X is -CH 2 -, -O- or -NH-;
- R 2 is hydrogen, or a saturated or unsaturated alkyl radical having up to 20 carbon atoms;
- R 3 , R 4 , and R 5 are independently hydrogen, -S0 4 2" , -PO4 2" , -COCi_ 10 alkyl;
- R 6 is L-alanyl, L-alpha-aminobutyl, L-arginyl, L-asparginyl, L-aspartyl, L-cysteinyl, L-glutamyl, L- glycyl, L-histidyl, L-hydroxyprolyl, L-isoleucyl, L-leucyl, L-lysyl, L-methionyl, L-ornithinyl, L-phenyal
- the suitable glycolipid is N-(2-Deoxy-2-L-leucylamino-b-D- glucopyranosyl)-N-octadecyldodecanoylamide or an acetate thereof.
- Aluminum is a known adjuvant or a component of adjuvant formulations and is commercially available in such forms as Reheis, Inc, Brentag alhydrogel REHYDRAGEL ® or VAC 20 ® wet gel.
- REHYDRAGEL ® is a crystalline aluminum oxyhydroxide, known mineralogically as boehmite. It is effective in vaccines when there is a need to bind negatively charged proteins.
- the content of Al 2 0 3 ranges from 2% to 10% depending on grade, and its viscosity is 1000-1300 cP. Generally, it may be described as an adsorbent aluminum hydroxide gel.
- VAC ® 20 wet gel is a white or almost white, translucent, viscous colloidal gel. In certain embodiments, the content of Al 2 0 3 is about 2% w/v.
- the source of aluminum can also be prepared by precipitated aluminum hydroxide processes.
- the adjuvant formulations in addition to the oil and the optional one or more emulsifiers, also comprise (or consist essentially, or consist) a combination of monophosphoryl lipid A (MPL-A) or an analog thereof, a sterol, and an immunostimulatory oligonucleotide.
- MPL-A monophosphoryl lipid A
- TCMO immunostimulatory oligonucleotide
- the adjuvants containing these ingredients are referred to as "TCMO”.
- the TCMO adjuvant formulation may also optionally include poly l:C (“TCMYO") and/or a saponin.
- adjuvant formulations comprising, or consisting essentially of, or consisting of a combination of monophosphoryl lipid A (MPL-A) or an analog thereof, a sterol, and an immunostimulatory oligonucleotide and saponin are referred to as "QTCMO.”
- the adjuvant formulations may also include poly l:C.
- Such adjuvants are referred to as "QTCMYO”.
- TCMO adjuvants comprise light mineral oil in the amount of 40% to 50% v/v of the total volume of the vaccine composition.
- the emulsifiers include TWEEN-80 and SPAN- 80, total amount 0.1% to 40% v/v of the total volume of the vaccine composition, provided that sorbitan monooleate and oil together comprise about 50.5% to 52% v/v of the composition.
- the immunostimulatory oligonucleotide is an ODN, preferably, a palindrome containing ODN, optionally, with a modified backbone.
- one dose of TCMO contains between about 1 ug and about 400 ug of the immunostimulating oligonucleotide, between about 1 ug and about 1000 ug of the sterol, between about 0.1 ug and 500 ug MPL-A or the analog thereof.
- the amounts of other compounds per dose are selected based on the subject species.
- one dose of TCMO would contain between about 50 and 400 ug (e.g., 50-300, or 100-250 ug, or about 50 to about 100 ug for adult pigs and about 100 to about 250 ug for cattle) of the immunostimulatory oligonucleotide, between about 100 and about 1000 ug (e.g., 200-1000, 250-700 ug, or about 400-500 ug) of the sterol, such as cholesterol, and between about 5 and about 500 ug (e.g., 5-100 ug, or 5-50 ug, or 10-25 ug) of MPL-A or the analog thereof.
- the immunostimulatory oligonucleotide between about 100 and about 1000 ug (e.g., 200-1000, 250-700 ug, or about 400-500 ug) of the sterol, such as cholesterol
- sterol such as cholesterol
- 5 and about 500 ug e.g., 5-100 ug,
- one dose of TCMO would contain between about 5 and 100 ug (e.g., 10-80, or 20-50 ug) of the immunostimulatory oligonucleotide, between about 5 and 100 ug (e.g., 10-80, or 20-50 ug) of the sterol such as cholesterol, and between about 0.5 and about 200 ug (e.g., 1-100 ug, or 5-50 ug, or 5-20 ug) of MPL-A or the analog thereof.
- the immunostimulatory oligonucleotide between about 5 and 100 ug (e.g., 10-80, or 20-50 ug) of the sterol such as cholesterol
- sterol such as cholesterol
- one dose of TCMO adjuvant would contain between about 0.1 and about 5 ug (e.g., 0.5-3 ug, or 0.9-1.1 ug) of immunostimulatory oligonucleotide, between about 0.5 and about 50 ug (e.g., 1-20 ug, or 1-10 ug) of the sterol such as cholesterol, and between about 0.1 to 10 ug (e.g., 0.5 - 5 ug, or 1-5 ug) of MPLA or the analog thereof. ).
- MPL-A is present in the amount of 0. lug/dose to 2,000 ug/dose.
- TCMO adjuvants are prepared as follows:
- Sorbitan monooleate, MPL-A and cholesterol are dissolved in light mineral oil.
- the resulting oil solution is sterile filtered;
- the cholesterol, oil, optional emulsifiers, MPL-A, and the immunostimulatory oligonucleotides are present as in the TCMO adjuvant formulation for the respective species.
- Poly l:C may be present generally in the amount between about 1 ug and about 100 ug per dose. More specifically, poly l:C may be present in the amount of 5-100 ug per dose (e.g., 5-50 ug, or 10-30 ug) in certain embodiments suitable for cattle, adult swine, or sheep.
- one dose of TCMYO contains between about 1 and about 50 ug (e.g., 5-50 ug, or 10-20 ug) of poly l :C. In certain embodiments suitable for poultry vaccines, one dose of TCMYO contains between about 1 and about 10 ug (e.g., 1-5 ug, or 3-5 ug) of poly l:C.
- TCMYO adjuvants are prepared similarly to the TCMO adjuvants, and the poly l:C is added to the aqueous solution.
- the cholesterol, oil, optional emulsifiers, MPL-A, and the immunostimulatory oligonucleotides are present as in the TCMO adjuvant formulation for the respective species.
- a saponin is preferably Quil A or a purified fraction thereof, and may be present in the amounts of between about 0.1 ug and about 1000 ug per dose.
- the saponin may be present in the amount of of 0.1 to 5 ug per 50 ul of the vaccine composition (e.g., 0.5 - 30 ug per 50 ul of the composition, or more preferably 1 - 10 ug) per dose in certain embodiments suitable for poultry vaccines.
- the saponin e.g., Quil A or a purified fraction thereof is present in the amounts between about 10 and about 100 ug per dose (e.g., 10-50 ug or 20-50 ug per dose).
- the saponin such as Quil A or a purified fraction thereof, is present in the amount of between about 100 and about 1000 ug per dose (e.g., 200-800 ug, or 250-500 ug per dose).
- QTCMO adjuvants are prepared similarly to TCMO adjuvants, and the saponin is added to the aqueous solution.
- the saponin in QTCMYO adjuvants, is present as in QTCMO adjuvant, and the rest of the ingredients are present as in TCMYO, for the respective species.
- QTCMYO adjuvants are prepared similarly to TCMYO adjuvants, and the saponin is added to the aqueous solution.
- the adjuvant formulations also comprise (or consist essentially of, or consist of) a combination of monophosphoryl lipid A (MPL-A) or an analog thereof and a polycationic carrier.
- MPL-A monophosphoryl lipid A
- XOM XOM
- the polycationic carrier is present in the amount of 1-50 mg per dose (e.g., 1-25 mg per dose, or 10-25 mg per dose)
- the M PL-A or the analog thereof is present in the amount of between about 1-50 ug per dose (e.g., 1-25 ug per dose, or 10-25 ug per dose).
- the polycationic carrier is present in the amount of between about 5 and about 500 mg per dose (e.g., 10-500 mg, or 10-300 mg, or 50-200 mg per dose) and the MPL-A or the analog therof is present in the amount ofbetween about 1 and about 100 ug per dose (e.g., 5-100 ug, or 5-50 ug, or 10-30 ug).
- the polycationic carrier is present in the amount of between about 1 and about 50 mg per dose (e.g., 1-25 mg per dose, or 10-25 mg per dose), and MPL-A or the analog thereof is present in the amount of between about 0.5 and about 200 ug (e.g., 1-100 ug, or 5-50 ug, or 5-20 ug) per dose.
- the polycationic carrier is present in the amount of between 0.5 and 25 mg per dose (e.g., 1-20 mg, or 1-10 mg or 5-10 mg), and the M PL-A or the analog thereof is present in the amount between about 0.5 and 10 ug per dose (e.g., 1-10 ug, or 1- 5 ug, or 2-5 ug).
- XOM adjuvants are prepared as follows:
- Sorbitan monooleate, MPL-A and cholesterol are dissolved in light mineral oil.
- the resulting oil solution is sterile filtered;
- the adjuvant formulations also comprise (or consist essentially of, or consist of) a combination of an immunostimulatory oligonucleotide and a polycationic carrier, with a proviso that if said polycationic carrier is dextran DEAE, then the antigen is not E coli J-5 bacterin.
- TXO an immunostimulatory oligonucleotide
- a polycationic carrier with a proviso that if said polycationic carrier is dextran DEAE, then the antigen is not E coli J-5 bacterin.
- TXO adjuvants may also include a source of aluminum, such as AI(OH) 3 gel.
- the TXO adjuvants with aluminum are referred to as "TXO-A".
- the immunostimulatory oligonucleotide preferably an ODN, preferably containing a palindromic sequence, and optionally with a modified backbone
- the immunostimulatory oligonucleotide may be present in the amount of 0.5-400 ug per dose
- the polycationic carrier may be present in the amount of 0.5-400 mg per dose.
- the dosages wary depending on the subject species.
- one dose of TXO would comprise between about 50 and 400 ug (e.g., 50-300, or 100-250 ug, or about 50 to about 100 ug for adult pigs and about 100 to about 250 ug for cattle) of the immunostimulatory oligonucleotide, and the polycationic carrier may be present in the amount of between about 5 and about 500 mg per dose (e.g., 10-500 mg, or 10-300 mg, or 50-200 mg per dose).
- one dose of TXO would comprise between about 5 and 100 ug (e.g., 10-80 ug, or 20-50 ug) of the immunostimulatory oligonucleotide, while the polycationic carrier may be present in the amount of 1-50 mg per dose (e.g., 1-25 mg per dose, or 10-25 mg per dose).
- one dose of TXO adjuvant would between about 0.1 and about 5 ug (e.g., 0.5-3 ug, or 0.9-1.1 ug) of immunostimulatory oligonucleotide, and the polycationic carrier may be present in the amount of between 0.5 and 25 mg per dose (e.g., 1-20 mg, or 1-10 mg or 5-10 mg).
- TXO adjuvants are prepared as follows:
- Sorbitan monooleate is dissolved in light mineral oil.
- the resulting oil solution is sterile filtered;
- the immunostimulatory oligonucleotide, Dextran DEAE and Polyoxyethylene (20) sorbitan monooleate are dissolved in aqueous phase, thus forming the aqueous solution; and
- the aqueous solution is added to the oil solution under continuous homogenization thus forming the adjuvant formulation TXO.
- the immunostimulatory oligonucleotide in TXO-A adjuvants, is present as in the TXO adjuvant, the source of aluminum is present in the amount of up to 40% v/v (e.g., 35%, 30%, 25%, 20%, 15%, 10%, 5%, 1%). In a set of embodiments, the source of aluminum is present at 2%- 20% v/v of the vaccine composition, more preferably between about 5% and about 17% v/v.
- TXO-A adjuvants are prepared similarly to TXO adjuvants, and the source of aluminum is added to the aqueous solution.
- TXO and TXO-A adjuvants are preferred in regard of Streptococcus vaccines.
- the adjuvants of the instant invention contain the oil, optional emulsifier(s), the immunostimulatory oligonucleotide and the source of aluminum. These compounds are present in the ranges disclosed for TXO-A adjuvant, except that the polycationic carrier is absent in TOA.
- TOA adjuvant is prepared similarly to TXO adjuvant, except the aqueous phase contains the source of aluminum rather than DEAE dextran.
- the adjuvant formulations in addition to the oil and the emulsifier(s), also comprise (or consist essentially of, or consist of) a combination of a polycationic carrier and a source of Aluminum. This adjuvant is referred to as AXO. These compounds may be present in amounts similar to those present in an adjuvant TXO-A for the respective species, and adjuvant AXO may be prepared similarly to TXO-A, but without addition of the immunostimulating oligonucleotide. In certain other embodiments, in addition to the oil and the emulsifier(s), the adjuvant formulations also comprise (or consist essentially of, or consist of) a combination of a saponin and sterol.
- Q.CO This adjuvant is referred to as Q.CO.
- the nature and the amounts of the ingredients of Q.CO are similar to the amounts of the saponin, the sterol, the oil and the emulsifier(s) in adjuvant QTCMO.
- QCO may be prepared by adding an aqueous solution comprising the saponin the sterol and, preferably, the water soluble emulsifier into an oily phase, comprising the oil and, preferably, the oil-soluble emulsifier under continuous homogenization.
- the adjuvant formulations in addition to the oil and the emulsifier(s), also comprise (or consist essentially of, or consist of) a combination of a quaternary amine, a glycolipid, MPL-A or an analog thereof, and poly l :C. These adjuvants are referred to as "ODYRM”.
- the oil is generally a mixture of phospholipids such as phosphatidyl cholines.
- AMPHIGEN ® is a suitable example of such oil, and would be present in the amount similar to the amount of oil, as described above.
- the quaternary amine e.g., DDA
- poly l:C is present in the amount of between about 0.5 ug and 100 ug per dose
- the glycolipid is present in the amount of between about 0.5 ug and about 2000 ug per dose
- the MPL-A or the analog thereof is present in the amount of between about 0.5 ug and 100 ug per dose.
- the quaternary amine may be present in the amount of between about 50 ug and about 200 ug per dose (e.g., 50-150 ug, or about 100 ug), poly l :C may be present in amounts of between about 1 ug and about 100 ug per dose (e.g., 1-50 ug or 5-50 ug), the glycolipid may be present in the amount of between about 500 ug and about 2000 ug per dose (e.g., 500-100 ug or about 1000 ug), and MPLA or the analog thereof may be present in the amount of between about 5 ug and about 100 ug per dose (e.g., 5-50 ug, or 10-50 ug).
- poly l :C may be present in amounts of between about 1 ug and about 100 ug per dose (e.g., 1-50 ug or 5-50 ug)
- the glycolipid may be present in the amount of between about 500 ug and about 2000 ug per dose
- the quaternary amine may be present in the amount between about 5 and about 500 ug per dose (e.g., 10- 100 ug per dose, or 20-50 ug per dose), the poly l :C may be present in the amount of between about 5 ug and about 25 ug per dose (e.g., 50-20 ug, or about 10 ug), the glycolipid may be present in the amount of between about 10 and about 100 ug per dose (e.g., 20-100 ug or 25-50 ug), and the M PL-A or the analog thereof may be present in the amount of between about 5 and about 50 ug per dose (e.g., 5-20 ug, or 10-20 ug).
- the poly l :C may be present in the amount of between about 5 ug and about 25 ug per dose (e.g., 50-20 ug, or about 10 ug)
- the glycolipid may be present in the amount of between about 10 and about 100 ug per dose
- one dose would contain between about 1 ug and about 10 ug of the quaternary ammonium compound (e.g., 5-10 ug, or about 5 ug), between about 0.5 and about 10 ug of poly l:C (e.g., 1-10 ug or 1-5 ug), between about 0.5 and 10 ug of the glycolipid (e.g., 1-10 ug or 5-10 ug or 1-5 ug), and between about 0.5 ug and about 5 ug of MPL-A or the analog thereof (e.g., 0.5-5 ug or 1-5 ug).
- the quaternary ammonium compound e.g., 5-10 ug, or about 5 ug
- poly l:C e.g., 1-10 ug or 1-5 ug
- the glycolipid e.g., 1-10 ug or 5-10 ug or 1-5 ug
- MPL-A or the analog thereof e.g.
- ODYRM adjuvants are prepared as follows:
- Sorbitan monooleate, MPL-A are dissolved in light mineral oil.
- the resulting oil solution is sterile filtered and dispersed in water with some surfactant, ethanol and acetic acid;
- Polyoxyethylene (20) sorbitan monooleate, quaternary amine, e.g., DDA, and poly l :C are dissolved in aqueous phase, thus forming the aqueous solution;
- the aqueous solution is added to the oil solution under continuous homogenization thus forming the adjuvant formulation ODYRM.
- the adjuvant formulations in addition to the oil and the emulsifier(s), also comprise (or consist essentially of, or consist of) a combination of a saponin, a sterol, a quaternary amine, a polycationic carrier, with a proviso that if said polycationic carrier is dextran DEAE, then the antigen is not E coli J-5 bacterin.
- these adjuvants are referred to as "Q.CDXO" .
- the saponin e.g., Quil A
- the sterol e.g., cholesterol
- the quaternary amine e.g., DDA
- the polycationic carrier may be present in the amount of 0.5-400 mg per dose.
- the dosages wary depending on the subject species.
- the saponin is present in the amount of between about 100 and about 1000 ug per dose (e.g., 200-800 ug, or 250-500 ug per dose)
- sterol is present in the amounts between about 100 and about 1000 ug (e.g., 200-1000, 250-700 ug, or about 400-500 ug)
- the quaternary amine may be present in the amount of between about 50 ug and about 200 ug per dose (e.g., 50-150 ug, or about 100 ug)
- the polycationic carrier may be present in the amount of between about 5 and about 500 mg per dose (e.g., 10-500 mg, or 10-300 mg, or 50- 200 mg per dose).
- the saponin e.g., Quil A or a purified fraction thereof is present in the amounts between about 10 and about 100 ug per dose (e.g., 10-50 ug or 20-50 ug per dose)
- the sterol is present in the amounts between about 5 and 100 ug (e.g., 10-80, or 20-50 ug)
- the quaternary amine may be present in the amount between about 5 and about 500 ug per dose (e.g., 10-100 ug per dose, or 20-50 ug per dose)
- the polycationic carrier may be present in the amount of 1-50 mg per dose (e.g., 1-25 mg per dose, or 10- 25 mg per dose.
- the saponin may be present in the amount of of 0.1 to 5 ug per 50 ul of the vaccine composition (e.g., 0.5 - 30 ug per 50 ul of the composition, or more preferably 1 - 10 ug) per dose
- the sterol may be present in the amounts between about 0.5 and about 50 ug (e.g., 1-20 ug, or 1-10 ug)
- the quaternary amine may be present in the amount between about 5 and about 500 ug per dose (e.g., 10-100 ug per dose, or 20-50 ug per dose)
- the polycationic carrier may be present in the amount of between 0.5 and 25 mg per dose (e.g., 1-20 mg, or 1-10 mg or 5-10 mg).
- Q.CDXO adjuvants are prepared as follows:
- Sorbitan monooleate is dissolved in oil.
- the resulting oil solution is sterile filtered;
- Polyoxyethylene (20) sorbitan monooleate, quaternary amine, e.g., DDA, the polycationic carrier, the sterol and the saponin are dissolved in aqueous phase, thus forming the aqueous solution; and The aqueous solution is added to the oil solution under continuous homogenization thus forming the adjuvant formulation QCDXO.
- compositions can contain one or more antigens.
- the antigen can be any of a wide variety of substances capable of producing a desired immune response in a subject, including, without limitations, one or more of viruses (inactivated, attenuated, and modified live), bacteria, parasites, nucleotides (including, without limitation nucleic-acid based antigens, e.g., DNA vaccines), polynucleotides, peptides, polypeptides, recombinant proteins, synthetic peptides, protein extract, cells (including tumor cells), tissues, polysaccharides, carbohydrates, fatty acids, teichioc acid, peptidoglycans, lipids, or glycolipids, individually or in any combination thereof.
- antigens used with the adjuvants of the invention also include immunogenic fragments of nucleotides, polynucleotides, peptides, polypeptides, that can be isolated from the organisms referred to herein.
- Live, modified-live, and attenuated viral strains that do not cause disease in a subject have been isolated in non-virulent form or have been attenuated using methods well known in the art, including serial passage in a suitable cell line or exposure to ultraviolet light or a chemical mutagen.
- Inactivated or killed viral strains are those which have been inactivated by methods known to those skilled in the art, including treatment with formalin, betapropriolactone (BPL), binary ethyleneimine (BEI), sterilizing radiation, heat, or other such methods.
- Two or more antigens can be combined to produce a polyvalent composition that can protect a subject against a wide variety of diseases caused by the pathogens.
- conventional adjuvants are often limited in the variety of antigens with which they can be effectively used (either monovalently or polyvalently)
- the adjuvants described herein can be used effectively with a wide range of antigens, both monovalently and polyvalently.
- the antigens described herein can be combined in a single composition comprising the adjuvants described herein.
- bacteria which can be used as antigen combinations with the adjuvant compositions include, but are not limited to, Aceinetobacter calcoaceticus, Acetobacter paseruianus, Actinobacillus pleuropneumoniae, Aeromonas hydrophila, Alicyclobacillus acidocaldarius, Arhaeglobus fulgidus, Bacillus pumilus.
- Bacillus stearothermophillus Bacillus subtilis, Bacillus thermocatenulatus, Bordetella bronchiseptica, Burkholderia cepacia, Burkholderia glumae, Campylobacter coli, Campylobacter fetus, Campylobacter jejuni, Campylobacter hyointestinalis.
- Chlamydia psittaci Chlamydia trachomatis, Chlamydophila spp., Chromobacterium viscosum, Erysipelothrix rhusiopathieae, Listeria monocytogenes, Ehrlichia canis, Escherichia coli, Haemophilus influenzae, Haemophilus somnus, Helicobacter suis, Lawsonia intracellulars, Legionella pneumophilia, Moraxellsa sp., Mycobactrium bovis, Mycoplasma hyopneumoniae, Mycoplasma mycoides subsp.
- mycoides LC Clostridium perfringens, Odoribacter denticanis, Pasteurella (Mannheimia) haemolytica, Pasteurella multocida, Photorhabdus luminescens, Porphyromonas gulae, Porphyromonas gingivalis, Porphyromonas salivosa, Propionibacterium acnes, Proteus vulgaris, Pseudomonas wisconsinensis, Pseudomonas aeruginosa, Pseudomonas fluorescens C9, Pseudomonas fluorescens SIKWl, Pseudomonas fragi, Pseudomonas luteola, Pseudomonas oleovorans, Pseudomonas sp Bll-1, Alcaliges eutrophus, Psychrobacter immobilis, Rickettsia prowa
- viruses which can be used as antigens include, but are not limited to, Avian herpesviruses, Bovine herpesviruses. Canine herpesviruses, Equine herpesviruses.
- Feline viral rhinotracheitis virus Marek's disease virus, Ovine herpesviruses, Porcine herpesviruses, Pseudorabies virus, Avian paramyxoviruses, Bovine respiratory syncytial virus, Canine distemper virus, Canine parainfluenza virus, canine adenovirus, canine parvovirus, Bovine Parainfluenza virus 3, Ovine parainfluenza 3, Rinderpest virus, Border disease virus, Bovine viral diarrhea virus (BVDV), BVDV Type I, BVDV Type II, Classical swine fever virus. Avian Leukosis virus. Bovine immunodeficiency virus.
- Bovine leukemia virus Bovine tuberculosis, Equine infectious anemia virus, Feline immunodeficiency virus, Feline leukemia virus (FeLV), Newcastle Disease virus, Ovine progressive pneumonia virus, Ovine pulmonary adenocarcinoma virus, Canine coronavirus (CCV), pantropic CCV, Canine respiratory coronavirus, Bovine coronavirus, Feline Calicivirus, Feline enteric coronavirus, Feline infectious peritonitis, virus.
- Porcine epidemic diarrhea virus Porcine hemagglutinating encephalomyletitis virus.
- Porcine parvovirus Porcine Circovirus (PCV) Type I, PCV Type II, Porcine Reproductive and Respiratory Syndrome (PRRS) Virus, Transmissible gastroenteritis virus, Turkey coronavirus, Bovine ephemeral fever virus, Rabies, Rotovirus, Vesicular stomatitis virus, lentivirus, Avian influenza, Rhinoviruses, Equine influenza virus, Swine influenza virus, Canine influenza virus, Feline influenza virus, Human influenza virus.
- PCV Porcine Circovirus
- PCV Type II Porcine Reproductive and Respiratory Syndrome (PRRS) Virus
- Transmissible gastroenteritis virus Turkey coronavirus
- Bovine ephemeral fever virus Rabies
- Rotovirus Vesicular stomatitis virus
- lentivirus lentivirus
- Avian influenza Rhinoviruses
- Equine influenza virus Swine influenza virus
- Canine influenza virus Feline influenza virus
- Human influenza virus Human influenza virus.
- Eastern Equine encephalitis virus EEE
- Venezuelan equine encephalitis virus West Nile virus
- Western equine encephalitis virus human immunodeficiency virus
- human papilloma virus varicella zoster virus
- hepatitis B virus hepatitis B virus
- rhinovirus rhinovirus
- measles virus and combinations thereof.
- Antigens from any of the above viruses can be combined with bacterial antigens (whether whole or subunit components) using the adjuvant formulations of the present invention, in which case preferred bacterial antigens include those provided from Streptococcus uberis.
- peptide antigens examples include Bordetella bronchiseptica p68, GnRH, IgE peptides, Fel dl, and cancer antigens, and combinations thereof.
- antigens include nucleotides, carbohydrates, lipids, glycolipids, peptides, fatty acids, lipoteichoic and teichoic acid, and peptidoglycans, and combinations thereof.
- parasites which can be used as antigens with the adjuvant compositions include, but are not limited to, Anaplasma, Fasciola hepatica (liver fluke), Coccidia, Eimeria spp., Neospora caninum.
- ticks including Ixodes, Rhipicephalus, Dermacentor, Amblyomma, Boophilus, Hyalomma, and Haemaphysalis species, and combinations thereof.
- the vaccine composition preferably also contains antigens derived from Streptococcus uberis, again in the presence of the vaccine formulations of the invention.
- a therapeutically effective amount of the antigen generally ranges from about 10 2 Tissue Culture Infective Dose (TCID) 50 to about 10 10 TCID 50 , inclusive.
- TCID Tissue Culture Infective Dose
- a therapeutically effective dose is generally in the range of about 10 2 TCID 50 to about 10 8 TCID 50 , inclusive.
- the ranges of therapeutically effective doses are about 10 3 TCID 50 to about 10 6 TCID 50 , inclusive.
- the ranges of therapeutically effective doses are about 10 4 TCID 50 to about 10 5 TCID 50 , inclusive.
- a therapeutically effective amount of the antigen is generally at least about 100 relative units per dose, and often in the range from about 1,000 to about 4,500 relative units per dose, inclusive. In other embodiments, the therapeutically effective amount of the antigen is in a range from about 250 to about 4,000 relative units per dose, inclusive, from about 500 to about 3,000 relative units per dose, inclusive, from about 750 to about 2,000 relative units per dose, inclusive, or from about 1,000 to about 1,500 relative units per dose, inclusive.
- a therapeutically effective amount of antigen in vaccines containing inactivated viruses can also be measured in terms of Relative Potency (RP) per mL.
- RP Relative Potency
- a therapeutically effective amount is often in the range from about 0.1 to about 50 RP per mL, inclusive.
- the therapeutically effective amount of the antigen is in a range from about 0.5 to about 30 RP per mL, inclusive, from about 1 to about 25 RP per mL, inclusive, from about 2 to about 20 RP per mL, inclusive, from about 3 to about 15 RP per mL, inclusive, or from about 5 to about 10 RP per mL, inclusive.
- the number of cells for a bacterial antigen administered in a vaccine ranges from about lxlO 5 to about 5xl0 10 colony forming units (CFU) per dose, inclusive. In other embodiments, the number of cells ranges from about lxlO 7 to 5xl0 10 CFU/dose, inclusive, or from about lxlO 8 to 5xl0 10 CFU/dose, inclusive.
- the number of cells ranges from about lxlO 2 to 5xl0 10 CFU/dose, inclusive, or from about lxlO 4 to 5xl0 9 CFU/dose, inclusive, or from about lxlO 5 to 5xl0 9 CFU/dose, inclusive, or from about lxlO 6 to 5xl0 9 CFU/dose, inclusive, or from about lxlO 6 to 5xl0 8 CFU/dose, inclusive, or from about lxlO 7 to 5xl0 9 CFU/dose, inclusive.
- the number of cells for a parasite antigen administered in a vaccine ranges from about lxlO 2 to about lxlO 10 per dose, inclusive. In other embodiments, the number of cells ranges from about lxlO 3 to about lxlO 9 per dose, inclusive, or from about lxlO 4 to about lxlO 8 per dose, inclusive, or from about lxlO 5 to about lxlO 7 per dose, inclusive, or from about lxlO 6 to about lxlO 8 per dose, inclusive.
- Dose sizes of the compositions typically range from about 1 mL to about 5 mL, inclusive, depending on the subject and the antigen. For example, for a canine or feline, a dose of about 1 mL is typically used, while in cattle a dose of about 2-5 mL is typically used. However, these adjuvants also can be formulated in microdoses, wherein doses of about 100 .mu.L can be used.
- the routes of administration for the adjuvant compositions include parenteral, oral, oronasal, intranasal, intratracheal, topical, subcutaneous, intramuscular, transcutaneous, intradermal, intraperitoneal, intraocular, intravenous administration and in ova.
- Any suitable device may be used to administer the compositions, including syringes, droppers, needleless injection devices, patches, and the like.
- the route and device selected for use will depend on the composition of the adjuvant, the antigen, and the subject, and such are well known to the skilled artisan.
- compositions One of the requirements for any vaccine adjuvant preparation for commercial use is to establish the stability of the adjuvant solution for long periods of storage.
- adjuvant formulations that are easy to manufacture and stable for at least 18 months. In one embodiment, the formulations are stable for about 18 months. In another embodiment, the formulations are stable for between about 18 to about 24 months. In another embodiment the formulations are stable for about 24 months. Accelerated testing procedures also indicate that the formulations described herein are stable.
- an advantageous feature of the present adjuvant compositions is that they can be safely and effectively administered to a wide range of subjects.
- combinations of adjuvants will demonstrate more reactogenicity than the individual components.
- the compositions described herein show decreased reactogenicity when compared to compositions in which any one or two of the components are used, while the adjuvant effect is maintained. It has also been surprisingly found that the adjuvant compositions described herein demonstrate safety improvements when compared with other adjuvant compositions.
- the adjuvant compositions described herein are useful for inducing a desired immune response in a subject.
- the adjuvants described herein can be used to show serological differentiation between infected and vaccinated animals.
- they can be used in a marker vaccine in which the antigen in the vaccine elicits in the vaccinated animals a different antibody pattern from that of the wild-type virus.
- a marker vaccine is generally used in conjunction with a companion diagnostic test which measures the difference in antibody patterns and demonstrates which animals have been vaccinated and which animals are infected with the wild-type virus.
- Such technology is useful in the control and eradication of viruses from a subject population. The invention will be further described in the following non- limiting examples.
- the invention provides an adjuvant formulation comprising an oily phase and an aqueous phase, wherein the oily phase comprises at least 50% of the formulation v/v, wherein said formulation comprises at least one of monophosphoryl lipid A (MPL-A) or an analog thereof and an immunostimulatory oligonucleotide, with provisos that: a) if said immunostimulatory oligonucleotide is absent, then the formulation comprises:
- a poly l:C a glycolipid, and, optionally, a quaternary amine; or ii. a polycationic carrier;
- the formulation comprises a source of aluminum.
- the invention provides the adjuvant formulation of the first embodiment, wherein the immunostimulatory oligonucleotide, if present, is a CpG or an oligoribonucleotide; the polycationic carrier, if present, is selected from the group consisting of dextran, dextran DEAE (and derivatives thereof), PEGs, guar gums, chitosan derivatives, polycellulose derivatives like hydroxyethyl cellulose (HEC) polyethylenimene, poly aminos; and the quaternary amine, if present, is selected from the group consisting of DDA and avridine.
- the immunostimulatory oligonucleotide if present, is a CpG or an oligoribonucleotide
- the polycationic carrier if present, is selected from the group consisting of dextran, dextran DEAE (and derivatives thereof), PEGs, guar gums, chitosan derivatives, polycellulose derivatives like
- the invention provides the adjuvant formulation according to the first or the second embodiment, wherein the immunostimulatory oligonucleotide if present, is the CpG, the polycationic carrier, if present, is dextran DEAE, and the quaternary amine, if present, is DDA.
- the inv ention provides the adjuvant formulation according to any one of first through third embodiments, wherein the glycolipid, if present, comprises a compound of formula I
- R 1 and R 2 are independently hydrogen, or a saturated alkyl radical having up to 20 carbon atoms;
- X is -CH 2 -, -0- or -NH-;
- R 2 is hydrogen, or a saturated or unsaturated alkyl radical having up to 20 carbon atoms;
- R 3 , R 4 , and R 5 are independently hydrogen, -S0 4 2 ⁇ , -P0 4 2 ⁇ , -COCi_i 0 alkyl;
- R 6 is L- alanyl, L-alpha-aminobutyl, L-arginyl, L-asparginyl, L-aspartyl, L-cysteinyl, L-glutamyl, L-glycyl, L-histidyl, L-hydroxyprolyl, L-isoleucyl, L-leucyl, L-lysyl, L-methionyl, L-ornithinyl, L-pheny
- the invention provides the adjuvant formulation of the fourth embodiment, wherein the glycolipid is N-(2-Deoxy-2-L-leucylamino-b-D-glucopyranosyl)-N- octadecyldodecanoylamide or a salt thereof.
- the invention provides the adjuvant formulation of the fifth embodiment, wherein the salt is an acetate.
- the invention provides the adjuvant formulation of any one of fists thought fourth embodiments, comprising both said monophosphoryl lipid A (MPL-A) or the analog thereof, and further comprising at least one of a sterol and a poly l :C.
- MPL-A monophosphoryl lipid A
- the invention provides the adjuvant formulation according to the seventh embodiment, comprising the sterol and further comprising a saponin.
- the invention provides the adjuvant formulation of any one of the senventh and the eighth embodiments, wherein the saponin, if present, is a triterpenoid saponin, and the sterol, if present, is selected from the group consisting of ergosterol, lanosterol and cholesterol.
- the invention provides the adjuvant formulation according to the ninth embodiment, wherein the saponin, if present, is Quil A, and the sterol, if present, is cholesterol.
- the invention provides the adjuvant formulation according to the seventh embodiment, comprising the poly l:C, and further comprising at least one of the quaternary amine and the glycolipid.
- the invention provides the adjuvant formulation of any one of the first-eleventh embodiments, comprising the MPL-A or the analog thereof in the amount of 0.5 - 100 ug per dose.
- the invention provides the adjuvant formulation according to the twelfth embodiment, wherein the MPL-A or the analog thereof is present in the amount of 5-50 ug per dose, or 5-20 ug per dose, or 1-5 ug per dose.
- the invention provides the adjuvant formulation of any one of the fisrt-thirteenth embodiments, comprising the immunostimulatory oligonucleotide in the amount of 0.5 to 400 ug per dose.
- the invention provides the adjuvant formulation of the fourteenth embodiment, wherein the immunostimulatory oligonucleotide is present in the amount of about 100 to about 250 ug per dose or about 20 to about 50 ug per dose, or about 1 ug per dose.
- the invention provides the adjuvant formulation of any one of first through fifteenth embodiments, comprising the polycationic carrier in the amount of between about 0.5 and about 400 mg per dose.
- the invention provides the adjuvant formulation of the sixteenth embodiment, wherein said polycationic carrier is present in the amount of 50-300 mg per dose or 1-25 mg per dose, or 1-10 mg per dose.
- the invention provides the adjuvant formulation of any one of the first-seventeenth embodiment, comprising the glycolipid in the amount of between about 0.5 and about 2000 ug per dose.
- the invention provides the adjuvant formulation of the eighteenth embodiment, wherein the glycolipid is present in the amount of about 1000 ug per dose, or 25-50 ug per dose, or 1-10 ug per dose.
- the invention provides the adjuvant formulation of any one of the first-nineteenth embodiments, comprising the sterol in the amount of between about 0.1 and about 1000 ug per dose.
- the invention provides the adjuvant formulation according to the twentieth embodiment, wherein the sterol is present in the amount of 250-500 ug per dose, or 20-50 ug per dose, or 1-10 ug per dose.
- the invention provides the adjuvant formulation of any one of first through twenty-first embodiment, comprising the saponin in the amount of between 0.1 and 1000 ug per dose.
- the invention provides the adjuvant formulation of the twenty- second embodiment, wherein the saponin is present in the amount of 250-500 ug per dose, or 20-50 ug per dose, or 1-10 ug per dose.
- the invention provides the adjuvant formulation of any one of first through twenty-third embodiment, comprising the poly l:C is in the amount of between about 0.5 and about 100 ug per dose.
- the invention provides the adjuvant formulation of the twenty- fourth embodiment, wherein the poly l:C is present in the amount of 5-50 ug per dose, or 5-20 ug per dose, or 1-5 ug per dose.
- the invention provides the adjuvant formulation of any one of first through twenty-fifth embodiment, comprising the source of aluminum, which is an aluminum hydroxide gel.
- the invention provides the adjuvant formulation of twenty-sixth embodiment, wherein said source of aluminum is present in the amount of 5%-20% v/v of the formulation.
- the invention provides the adjuvant formulation of the twenty- seventh embodiment, wherein said source of aluminum is present in the amount of 10% v/v of the formulation.
- the invention provides The adjuvant formulation of any one of the first through twenty-eighth embodiment, wherein the oily phase comprises an oil and an oil- soluble emulsifier.
- the invention provides the adjuvant formulation of any one of the first through the twenty-ninth embodiment, wherein said oily phase is present in the amount of up to 85% v/v.
- the invention provides the adjuvant formulation according to the thirtieth embodiment, wherein said oily phase is present in the amount of 51%.
- the invention provides the adjuvant formulation of any one of the twenty-ninth through the thirty-first embodiments, wherein the oil comprises 40-84% v/v of the formulation, and the oil-soluble emulsifier comprises 1-11% v/v of the formulation.
- the invention provides the adjuvant formulation of the thirty-second embodiment, wherein the oil comprises 45% v/v of the formulation, and the oil-soluble emulsifier comprises 6% v/v of the formulation.
- the invention provides the adjuvant formulation according to any one of the first through thirty-third embodiment, wherein said oil is selected from the group consisting of squalane, vegetable oils, triglycerides, non-metabolizable straight- chain alkane oils, and any combination thereof.
- said oil is a light mineral oil.
- the invention provides a vaccine composition comprising an effective amount of an antigen and the adjuvant formulation according to any one of the first through the thirty-fifth embodiment, wherein the oily phase of the composition is at least 50% v/v.
- the invention provides a vaccine composition comprising an effective amount of an antigen and an adjuvant formulation comprising an oily phase and an aqueous phase, wherein the oily phase comprises at least 50% of the formulation v/v, a polycationic carrier, and
- a a combination of a saponin and a sterol, and optionally, a quaternary amine; with provisos that if said adjuvant formulation consists essentially of DEAE dextran, Quil A, Cholesterol, and DDA, the antigen is not E coli J-5 bacterin; or
- the invention provides he vaccine composition according to the thirty-seventh embodiment, wherein the saponin, if present, is a triterpenoid saponin, the sterol, if present, is selected from the group consisting of ergosterol, lanosterol and cholesterol, the polycationic carrier, if present, is selected from the group consisting of dextran, dextran DEAE (and derivatives thereof), PEGs, guar gums, chitosan derivatives, polycellulose derivatives like hydroxyethyl cellulose (HEC) polyethylenimene, poly aminos, and the quaternary amine, if present, is selected from the group consisting of DDA and avridcine.
- the saponin if present, is a triterpenoid saponin
- the sterol if present, is selected from the group consisting of ergosterol, lanosterol and cholesterol
- the polycationic carrier if present, is selected from the group consisting of dex
- the invention provides the vaccine composition according to the thirty-eighth embodiment, wherein the saponin is Quil A, the sterol is cholesterol, the polycationic carrier is dextran DEAE, and the quaternary amine is DDA.
- the invention provides the vaccine composition of any one of thirty-seventh though thirty-ninth embodiments, wherein the immunostimulatory oligonucleotide is a CpG.
- the invention provides the vaccine composition of any one of thirty-seventh through fourtieth embodiment, wherein said polycationic carrier is present in the amount of between about 0.5 and about 400 mg per dose.
- the invention provides the vaccine composition of the fourty-first embodiment, wherein said polycationic carrier is present in the amount of 50-300 mg per dose or 1-25 mg per dose, or 1-10 mg per dose.
- the invention provides the vaccine composition of any one of thirty-seventh through fourty-second embodiments, comprising the saponin in the amount of between about 0.1 and about 1000 ug per dose.
- the invention provides the vaccine composition of the fourty-third embodiment, wherein the saponin is present in the amount of 250-500 ug per dose, or 20- 50 ug per dose, or 1-10 ug per dose.
- the invention provides the vaccine composition of any one of thirty-seventh through fourty-fourth embodiments, comprising the sterol in the amount of between about 0.1 and about 1000 ug per dose.
- the invention provides the vaccine composition of the fourty-fifth embodiment, wherein the sterol is present in the amount of 250-500 ug per dose, or 20-50 ug per dose, or 1-10 ug per dose.
- the invention provides the vaccine composition of any one of thirty-seventh through fourty-sixth embodiments, comprising the quaternary amine in the amount of between about 1 and about 200 ug per dose.
- the invention provides the vaccine composition of fourty-seventh embodiment, wherein the quaternary amine is present in the amount of about 100 ug per dose or between about 10 and about 100 ug per dose or about 5 ug per dose.
- the invention provides the vaccine composition of any one of of thirty-seventh through fourty-eighth embodiments, comprising the immunostimulatory oligonucleotide in the amount of between about 0.5 ug and about 400 ug per dose.
- the invention provides the vaccine composition of the fourty- ninth embodiment, wherein the immunostimulatory oligonucleotide is present in the amount of 100- 250 ug per dose, or 20-50 ug per dose or about 1 ug per dose.
- the invention provides the vaccine composition of any one of thirty-seventh through fiftieth embodiments, wherein the oily phase comprises an oil and an oil- soluble emulsifier.
- the invention provides the vaccine composition of any one of thirty-seventh through fifty-first embodiments, wherein said oily phase is present in the amount of up to 85% v/v.
- the invention provides the vaccine composition of the fifty- second embodiment, wherein said oily phase is present in the amount of 51% v/v.
- the invention provides the vaccine composition of any one of fifty-first through fifty-third embodiments, wherein the oil comprises 40-84% v/v of the vaccine composition, and the oil-soluble emulsifier comprises 1-11% v/v of the vaccine composition.
- the invention provides the vaccine composition of the fifty- third embodiment, wherein the oil comprises 45% v/v of the formulation, and the oil-soluble emulsifier comprises 6% v/v of the formulation.
- the invention also provides a vaccine composition comprising a Streptococcus uberis antigen and an adjuvant comprising an oily phase, said oily phrase beuing preferably present at at least 50% v/v of the composition, and also a polycationic carrier, wherein said composition may further comprise an immunostimulatory oligonucleotide, a saponin, a sterol, and a quartenary amine, and any combinations thereof.
- the invention further provides provides a vaccine composition comprising a Streptococcus uberis (S. uberis) antigen and an adjuvant formulation comprising an oily phase, said oily phase being present in the amount of at least 50% v/v of the composition; a polycationic carrier; and an immunostimulatory oligonucleotide;
- a combination comprising a saponin, a sterol, and a quaternary amine
- the present invention is also based upon the identification of a number of antigens derived from a species of the genus Streptococcus, which can be used to raise immune responses in animals - particularly those animals susceptible or predisposed to infection by (or with) the Streptococcus species.
- the antigens provided by this invention may be exploited to provide compositions and vaccines for raising protective immune responses in animals - the protective immune responses serving to reduce, prevent, treat or eliminate certain Streptococcus infections as well as diseases and/or conditions caused or contributed to thereby.
- the present invention provides one or more Streptococcus uberis antigen(s) or a fragment or fragments thereof, for use in raising an immune response in an animal.
- Streptococcus uberis is a highly-heterogeneous species
- the inventors have discovered antigens which are conserved in different 5.
- uberis strains that is to say, while the antigens of this invention may be derived or obtained from a single 5.
- uberis strain they may protect animals against infections and/or diseases caused or contributed to different (heterologous) Streptococcus uberis strains.
- the antigens provided by this invention may also be used to protect animals against infections (or diseases) caused or contributed to by other Streptococcus spp., including, for example, infections, diseases and/or conditions caused or contributed to by including (but not limited to) 5. parauberis, 5.
- the antigens described herein may find application in the diagnosis of infections, diseases and/or conditions with a streptococcal (including, but not limited to, 5. uberis, S. parauberis, S. agalactiae and 5. dysgalactiae) aetiology.
- streptococcal including, but not limited to, 5. uberis, S. parauberis, S. agalactiae and 5. dysgalactiae
- streptococcal including, but not limited to, 5. uberis, S. parauberis, S. agalactiae and 5. dysgalactiae
- each of the specific Streptococcus species and strains relevant to this invention shall be collectively referred to under the general term "Streptococcus", “streptococci", or “streptococcal”.
- references to 5. uberis include all related 5. uberis strains and variants.
- an immune response which protects against infection by/with a pathogen or against certain diseases or conditions may be a referred to as a 'protective response'. Therefore, in the context of this invention, the immune responses elicited by the antigens described herein may be regarded as 'protective' immune responses.
- the antigens provided by this invention are immunogenic or antigenic in that they elicit host immune responses; the precise nature of the response (humoral and/or cellular for example) may depend on the formulation of the antigen, its route of administration and/or the presence or absence of adjuvant.
- any immune response elicited by the antigens of this invention may be assessed relative to the prevalence or rate of the relevant Streptococcus based infection/disease among a population of animals not exposed to, contacted with or administered antigens of this invention.
- animals not exposed to, contacted with or administered an antigen of this invention may lack a protective immune response and are therefore more susceptible to Streptococcus infections and/or diseases.
- a second aspect of this invention provides a composition, immunogenic composition or vaccine composition comprising, consisting essentially of, or consisting of, two or more of the Streptococcus uberis antigens described herein, for use in raising an immune response in an animal.
- the immune response is a protective response.
- the invention provides the use of one or more Streptococcus uberis antigens or a fragment(s) thereof for the manufacture of a medicament or vaccine for use in the treatment and/or prevention of a Streptococcus uberis infection and/or a disease or condition caused thereby or associated therewith.
- the invention provides a method of raising an anti-Sfreprococcus uberis immune response in an animal, said method comprising the step of administering to an animal, an amount of one or more Streptococcus antigen(s) or fragment(s) thereof, sufficient to induce an anti- Streptococcus uberis immune response.
- animal also encompasses any animal known to be susceptible to a Streptococcus infection, disease or condition.
- dysgalactiae (or indeed any strains of any of these) is encompassed under the general term "animal” as used herein.
- the term “animal” may include humans and animals collectively known as avian (birds), piscine (e.g. fish), porcine (e.g. pig), bovine (e.g. cattle), caprine (e.g. goats) and/or ovine (e.g. sheep) animals.
- the antigens provided by this invention may be used to raise immune responses in animals which are susceptible, predisposed or prone to developing (streptococcal based) mastitis, said responses being protective against the development of mastitis.
- the invention may be used to raise immune responses in human, porcine, bovine, caprine and/or ovine animals, said responses being protective against the development of mastitis.
- this invention provides:
- antigens encompass immunogenic components, proteins or peptides derived from Streptococcus.
- the antigens may comprise cell-surface antigens and/or intracellular antigens.
- the antigens of this invention may be prepared using recombinant technology (as described later) but may be obtained or purified from 5. uberis cells and cell cultures. For example, S. uberis cell-surface antigens may be isolated from 5. uberis cell-wall preparations.
- the term "antigen” encompasses the exemplary Streptococcus uberis antigens identified and listed as (1) ferrichrome binding protein (See SEQ I D NOS: 1,2 and 3, locus tag SUB0423, and accession number YP-002561776); (2) elongation factor Tu (See SEQ ID NOS: 4, 5 and 6, locus tag SUB0604, and accession number YP-002561947; (3) a lipoprotein (See SEQ ID NOS: 7, 8 and 9, locus tag SUB0950, and accession number YP-002562276; and (4) a serine protease (See SEQ ID NOS: 10, 11 and 12, locus tag SUB1868, and accession number YP-002563137).
- uberis antigens identified in Table 1 are those identified by mass spectrometric analysis of cell-wall sub-cellular fractions of 20 5. uberis strains, and further found (by PCR analysis to determine carriage of the antigen-encoding genes) among a larger panel of S. uberis strains. Consequently, one or more of these antigens may be exploited in this invention and used in the methods, vaccines and/or compositions described herein., as they are conserved among strains, making such antigens widely applicable vaccine candidates.
- the term "antigen" as used herein encompasses antigens encoded by or comprising/ consisting (essentially of) the sequences deposited under each of the accession numbers identified in Table 1. It should be noted that the sequences deposited under each of the accession numbers identified above are derived from a 5. uberis strain designated 0140J (accession number NC 012044). Thus, while the invention encompasses antigens derived from this S. uberis strain, it also encompasses the identical, homologous or othologous antigens present in other Streptococci and/or 5. uberis strains.
- recombinant sequences may comprise sequences which differ from any corresponding wild type or reference sequences and may comprise, for example sequences which encode protein or peptide tags.
- Recombinant sequences may be modified by, for example, the deletion of signal peptide sequences.
- the sequences presented in Table 1 may have a 5'-nucleotide sequence encoding a 6 x histidine tag - a tag of this type may be used for purification purposes. Also, some of the sequences presented in Table 1 have been further modified to lack sequences encoding secretion signal peptides present in the corresponding wild type sequences.
- Seq ID NO: 1 Seq ID NO: 2
- CTTAA rSUB0950 lipoprotein (SEQ ID NO: 7 and 8)
- this invention relates to one or more recombinant forms of any of the Streptococcus uberis antigens identified in this specification - the recombinant sequences being optionally modified (relative to the corresponding wild type sequence) to include sequences encoding tagging or labelling moieties and or through the deletion of one or more wild type sequences - such as, for example, a sequence encoding a signal peptide.
- the invention may further relate to the equivalent or corresponding antigens present in other Streptococcal species, including for example the identical, homologous or orthologous antigens present in S. agalactiae, S. parauberis and 5. dysgalactiae.
- the degeneracy of the code may be exploited to yield variant nucleic acid sequences which encode the same or similar primary amino acid sequences.
- the invention further encompasses sequences which have been codon optimised, perhaps for expression in certain cellular (for example bacterial) systems. As such, the term
- antigen encompasses nucleic acid sequences which encode the amino acid sequences of the S. uberis antigens described herein including for example described in Tables 1 and 2.
- the invention may further extend to cDNA generated from messenger RNA encoding any of the antigens of this invention. It should be understood that this invention further extends to fragments or portions of the various antigens and sequences disclosed herein. The fragments and/or portions of these antigens and/or sequences may themselves provide or encode antigens which are antigenically/immunogenically similar to the complete or whole Streptococcus uteris antigens disclosed herein.
- fragments and/or portions of this invention are capable of eliciting an immune response which is substantially identical, or similar, to an immune response elicited by the complete antigen from which the fragment is derived.
- fragments and portions as applied to the S. uberis antigens of this invention, encompass immunogenic and/or antigenic fragments and/or portions, which fragments and/or portions can be used to raise immune responses in animals. Fragments or portions of any of the antigens disclosed herein may elicit protective immune responses in animals and may comprise epitopes capable of eliciting protective immune responses.
- a fragment or portion of an antigen provided by this invention may comprise any number of amino acid/nucleic acid residues from about 5 to about 10 residues to about n-1 residues, wherein "n” is the total number of (amino acid or nucleic acid) residues of a 5.
- uberis antigen described herein a fragment or portion of a S. uberis antigen may comprise at least about 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 150, 200, 250, 300 residues - the upper limit (n-1) depending upon the size (n) of the nucleic acid encoding the complete antigen or the number (n) of amino acid residues comprising the primary sequence of the antigen.
- antigen fragments or portions provided by this invention include fragments and portions of any of the sequences identified in Tables 1 above.
- antigen may further encompass antigens which exhibit a degree of identity and/or homology to the antigens and/or antigen sequences described herein.
- a homologous or identical sequence provided by this invention may exhibit at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% homology or identity to the various sequences provided herein - including, for example, those sequences identified by accession number in Table 1.
- homology is 80% or higher, most preferably 90%, or optimally 95% or higher.
- the degree of (or percentage) "homology" between two or more (amino acid or nucleic acid) sequences may be determined by aligning the sequences and determining the number of aligned residues which are identical or which are not identical but which differ by redundant nucleotide substitutions (the redundant nucleotide substitution having no effect upon the amino acid encoded by a particular codon, or conservative amino acid substitutions). Homology may assessed by using the Basic Local Alignment Search Tool (BLAST) (Altschul et al., 1990, Basic local alignment search tool, J. Mol. Biol. V. 215, pp 403-410.)
- BLAST Basic Local Alignment Search Tool
- a degree (or percentage) "identity" between two or more (amino acid or nucleic acid) sequences may also be determined by aligning the sequences and ascertaining the number of exact residue matches between the aligned sequences and dividing this number by the number of total residues compared - multiplying the resultant figure by 100 would yield the percentage identity between the sequences.
- identity is 80% or higher, most preferably 90%, or optimally 95% or higher.
- any antigens encoded by or comprising/consisting (essentially of) sequences which homology and/or identity to the sequences described in this application may be immunogenic and suitable for raising immune responses in animals, wherein the immune responses are protective against S. uberis infection and/or diseases and/or conditions caused or contributed to thereby.
- a variant, derivative or mutant antigen of this invention may comprise or be encoded by, a nucleic acid or amino acid sequence which comprises one or more nucleotide and/or amino acid substitutions, inversions, additions and/or deletions relative to a reference sequence.
- a reference sequence may be any of the sequences described in this application.
- substitution may encompass one or more conservative substitution(s).
- conservative substitution is intended to embrace the act of replacing one or more amino acids of a protein or peptide with an alternate amino acid with similar properties and which does not substantially alter the physico-chemical properties and/or structure or function of the native (or wild- type) protein. Examples of such conservative substitutions are presented in Table 2. Table 2 Conservative amino acid substitutions
- antigens described herein may comprise domains and regions (or epitopes) which represent the immunogenic or active parts.
- the immunogenic of active parts of an antigen of this invention are those domains, regions or epitopes which are capable of inducing an immune response in the relevant animal. Therefore, antigens for use in this invention may comprise synthetic or recombinant constructs or fusions which comprise these immunogenic or active regions, domains or epitopes.
- antigens for use in this invention may comprise sequences which exhibit at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% homology or identity (as defined above) to the sequences of the active or immunogenic (epitope containing) domains or regions of the antigens described herein, including, for example, those sequences identified by accession number in Table 1.
- uberis antigen may comprise or be encoded by a variant, derivative or mutant sequence which, when compared to a reference sequence (such as for example a wild-type S. uberis sequence or a sequence encoding any of the specific 5.
- uberis antigens presented above is found to contain one or more amino acid/nucleotide substitutions, additions, deletions and/or inversions.
- uberis antigens described herein may further comprise one or more features (for example epitopes or domains) of an 5.
- mutant, variant and/or derivative sequences described herein may be immunogenic and suitable for raising immune responses in animals, wherein the immune responses are protective against 5. uberis infection and/or diseases and/or conditions caused or contributed to thereby.
- antigens comprising sequences corresponding to the immunogenic domains of the antigens described herein (for example, the antigens presented in Table 2).
- Antigens of this type may comprise sequences which share about 60% to about 100% sequence identity with the immunogenic domains of any of the antigens described herein;
- antigens typically proteins which antigens or proteins comprise, consist essentially of, or consist of, one or more immunogenic fragments or domains derived from one or more of the antigens as specifically named above.
- S. uberis antigens described in this application may be obtained by direct purification from 5. uberis cultures and/or protein/membrane preparations thereof. Additionally or alternatively, the antigens of this invention may be generated recombinantly.
- PCR techniques may be exploited to selectively amplify the appropriate antigen (for example 5. uberis antigen) gene sequences from a variety of sources including, for example, stored Streptococcus and/or S. uberis isolates, clinical isolates, diseased material and the like.
- Cloned antigen sequences may be introduced into a vector (such as a plasmid or expression cassette). I n one embodiment, the vector may further comprise a nucleotide sequence of a tag or label to assist in protein purification procedures.
- a host cell may be transformed or transfected with a vector and maintained under conditions suitable to induce expression of and antigen (for example a S. uberis antigen) gene sequence and production of recombinant antigen.
- Prokaryotic or eukaryotic cells such as, for example bacterial, plant, insect, mammalian and/or fungal dcells, may be transformed or transfected with one or more of the vectors described herein.
- the host cell is a bacterial cell such as, for example, an Escherichia coli cell.
- Techniques used to purify recombinant proteins generated in this way are known and, where the recombinant protein is tagged or labelled, these may include the use of, for example, affinity chromatography techniques.
- this invention may provide expression vectors comprising S. uberis antigen gene sequence(s) and host cells transformed therewith.
- uberis antigens both purified and/or recombinant forms
- antigens shall hereinafter be collectively referred to as "antigens" or "S. uberis antigens”.
- uberis antigens should be taken to include (immunogenic) fragments or portions derived therefrom (as described above) as well as any mutants, variants and derivatives thereof and/or antigens exhibiting a degree of homology/identity thereto.
- mice in particular bovine, porcine, caprine and/or ovine animals administered one or more of the 5.
- uberis lipoprotein (acc No: YP_002562276), 5.
- uberis serine proteinase (acc No: YP_002563137), 5.
- uberis ferrichrome binding protein (acc No: YP_002561776) and/or S. uberis elongation factor Tu: (acc No: YP_002561947) antigens elicit particularly effective protective immune responses.
- this invention may provide immunogenic and/or vaccine compositions comprising one or more of the 5. uberis lipoprotein (acc No: YP_002562276), 5. uberis serine proteinase (acc No: YP_002563137), 5. uberis ferrichrome binding protein: (acc No: YP_002561776) and/or S. uberis elongation factor Tu : (acc No: YP_002561947).
- a vaccine of this invention may comprise, consist essentially of or consist of a 5. uberis ferrichrome binding protein, 5. uberis elongation factor Tu, S. uberis lipoprotein, 5. uberis serine proteinase, an immunogenic fragment of any of these or a combination thereof optionally in combination with an adjuvant for use in (i) treating masititis or (ii) raising an immune response which is protective against mastitis.
- the vaccine composition may provide only one of the above antigens, although it is preferred that at least 2 antigens be used, more preferably 3, and most preferably that all 4 antigens be used, taking into account that the definition of antigen includes any immunologically active fragment of said antigen.
- the vaccine may be further exploited in methods of treating subjects in need thereof, the method comprising administering an immunologically effective amount of the vaccine to the subject.
- the subject may be a bovine subject or any subject (bovine or otherwise) predisposed or susceptible to contracting or developing mastitis.
- the subject may be suffering from mastitis.
- the subject may be predisposed or susceptible to contracting or developing a 5. uberis infection or a 5. uberis associated disease and/or condition.
- uberis antigens described herein may be admixed with another component, such as another polypeptide and/or an adjuvant, diluent or excipient.
- vaccines or vaccine compositions provided by this invention may, for example, contain viral, fungal, bacterial or other parasite antigens used to control other diseases/infections or infestations.
- the vaccine or vaccine composition may be included within a multivalent vaccine, which includes antigens against other ovine or bovine pathogens/diseases.
- the antigens of this invention may independently (or together) be used with additional (for example non-S. uberis) polypeptides.
- the antigens of this invention may be fused, bound or otherwise conjugated to the 5. uberis antigens described herein.
- this invention further encompasses fusions comprising the 5. uberis antigens described herein.
- the fusions may be internal fusions where a polypeptide, peptide or protein is embedded into the amino acid sequence of an antigen of this invention.
- the fusions may comprise C- or N-terminal fusions in which a polypeptide, peptide or protein is fused to the N- and/or C-terminal portion of a 5. uberis antigen of this invention. I n some cases, the 5.
- uberis antigens (or the fragments thereof) of this invention may take the form of haptens - that is to say they are small molecules which elicit immune responses only when attached to a large carrier such as a peptide or protein. In some cases, the carier protein or peptide may not elicit an immune response by itself. Where the 5. uberis antigen is a hapten, it may be fused, combined, bound or conjugated with or to a carrier protein or peptide so as to enhance or increase its ability to raise an immune response in an animal. In a further aspect, the present invention provides an animal population treated, vaccinated and/or immunised with an antigen or antigen(s), vaccine or composition of this invention.
- the invention provides treated, vaccinated or immunised human, avian, piscine,bovine, porcine, caprine and/or ovine populations; for example, the invention may provide farmed populations of birds, fish, cattle, pigs sheep and/or goats which have been treated, vaccinated and/or immunised with an antigen or antigen(s), vaccine or composition described herein.
- a vaccine or composition of this invention may comprise one or more of the 5. uberis antigens described herein optionally in combination with one or more other antigens and/or adjuvants.
- compositions including the vaccine compositions, provided by this invention may be formulated as sterile pharmaceutical compositions comprising one or more of the antigens described herein and a pharmaceutical excipient, carrier or diluent. These composition may be formulated for oral, topical (including dermal and sublingual), intramammary, parenteral (including subcutaneous, intradermal, intramuscular and intravenous), transdermal and/or mucosal administration.
- compositions described herein may comprise a discrete dosage unit and may be prepared by any of the methods well-known in the art of pharmacy. Methods typically include the step of bringing into association one or more of the S. uberis antigens described herein with liquid carriers or finely-divided solid carriers or both.
- compositions suitable for oral administration , wherein the carrier is a solid, are most preferably presented as unit dose formulations such as boluses, capsules or tablets each containing a predetermined amount of one or more of the 5. uberis antigens of this invention.
- a tablet may be made by compression or moulding, optionally with one or more accessory ingredients.
- Compressed tablets may be prepared by compressing in a suitable machine an active compound (for example one or more 5.
- uberis antigen(s)) in a free-flowing form such as a powder or granules optionally mixed with a binder, lubricant, inert diluent, lubricating agent, surface-active agent or dispersing agent.
- Moulded tablets may be made by moulding an active compound with an inert liquid diluent. Tablets may be optionally coated and, if uncoated, may optionally be scored.
- Capsules may be prepared by filling an active compound, either alone or in admixture with one or more accessory ingredients, into the capsule shells and then sealing them in the usual manner. Cachets are analogous to capsules wherein an active compound together with any accessory ingredient(s) is sealed in a rice paper envelope.
- An active compound may also be formulated as dispersible granules, which may for example be suspended in water before administration, or sprinkled on food.
- the granules may be packaged, for example in a sachet.
- Formulations suitable for oral administration wherein the carrier is a liquid may be presented as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water liquid emulsion.
- compositions suitable for oral administration include controlled release dosage forms, for example tablets wherein an active compound (for example one or more S. uberis a ntigens) is formulated in an appropriate release-controlling matrix, or is coated with a suitable release-controlling film.
- an active compound for example one or more S. uberis a ntigens
- Such compositions may be particularly convenient for prophylactic use.
- compositions and vaccine compositions formulated for parenteral administration include sterile solutions or suspensions of an active compound (for example one or more 5. uberis antigens) in aqueous or oleaginous vehicles.
- Compositions of this invention including vaccine and/or immunogenic compositions, may comprise, or further comprise cryoprotectant compounds or compositions, preservative(s), antibiotics, adjuvants and the like.
- compositions and vaccines may be adapted for bolus injection or continuous infusion. Such preparations are conveniently presented in unit dose or multi-dose containers, which are sealed after introduction of the formulation until required for use.
- an active compound for example one or more 5.
- uberis antigens may be in powder form that is constituted with a suitable vehicle, such as sterile, pyrogen-free water or phosphate buffered saline PBS before use.
- compositions comprising one or more antigens or 5.
- uberis antigens of this invention may also be formulated as long-acting depot preparations, which may be administered by intramuscular injection or by implantation, e.g. subcutaneously or intramuscularly.
- Depot preparations may include, for example, suitable polymeric or hydrophobic materials, or ion-exchange resins. They may also include preparations or adjuvants known to enhance the affinity and/or longevity of an animal (for example bovine, ovine or caprine) immune response, such as single or double emulsions of oil in water.
- Such long-acting compositions are particularly convenient for prophylactic use.
- compositions suitable (or formulated) for mucosal administration include compositions comprising particles for aerosol dispersion, or dispensed in drinking water. When dispensed, such compositions should desirably have a particle diameter in the range 10 to 200 microns to enable retention in, for example, the nasal cavity; this may be achieved by, as appropriate, use of a powder of a suitable particle size or choice of an appropriate valve.
- Other suitable compositions include coarse powders having a particle diameter in the range 20 to 500 microns, for administration by rapid inhalation through the nasal passage from a container held close up to the nose, and nasal drops comprising 0.2 to 5% w/v of an active compound in aqueous or oily solution or suspension.
- compositions described herein may include an appropriate one or more additional (pharmaceutically acceptable) carrier ingredients such as diluents, buffers, flavouring agents, binders, surface active agents, thickeners, lubricants, preservatives (including anti-oxidants) and the like, and substances included for the purpose of rendering the formulation isotonic with the blood of the intended recipient.
- additional (pharmaceutically acceptable) carrier ingredients such as diluents, buffers, flavouring agents, binders, surface active agents, thickeners, lubricants, preservatives (including anti-oxidants) and the like, and substances included for the purpose of rendering the formulation isotonic with the blood of the intended recipient.
- Pharmaceutically acceptable carriers are well known to those skilled in the art and include, but are not limited to, 0.1 M and preferably 0.05 M phosphate buffer or 0.8% saline. Additionally, pharmaceutically acceptable carriers may be aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
- Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's or fixed oils. Preservatives and other additives may also be present, such as, for example, antimicrobials, antioxidants, chelating agents, inert gases and the like. Compositions suitable for topical formulation may be provided, for example, as gels, creams or ointments.
- compositions for veterinary use may conveniently be in either powder or liquid concentrate form.
- conventional water-soluble excipients such as lactose or sucrose, may be incorporated in the powders to improve their physical properties.
- particularly suitable powders of this invention comprise 50 to 100% w/w and preferably 60 to 80% w/w of the active ingredient(s) (for example one or more 5. uteris antigens) and 0 to 50% w/w and preferably 20 to 40% w/w of conventional veterinary excipients.
- These powders may either be added to, for example, animal feed - perhaps by way of an intermediate premix, or diluted in animal drinking water.
- Liquid concentrates of this invention suitably contain one or more antigens or S. uberis antigens and may optionally further include an acceptable water-miscible solvent for veterinary use, for example polyethylene glycol, propylene glycol, glycerol, glycerol formal or such a solvent mixed with up to 30% v/v of ethanol.
- the liquid concentrates may be administered to the drinking water of animals.
- the present invention may also provide polyclonal and/or monoclonal antibodies (or antigen binding fragments thereof) that bind (or have affinity or specificity for) any of the antigens or S. uberis antigens provided by this invention.
- Production and isolation of polyclonal/monoclonal antibodies specific for protein/peptide sequences is routine in the art, and further information can be found in, for example "Basic methods in Antibody production and characterisation” Howard & Bethell, 2000, Taylor & Francis Ltd.
- Such antibodies may be used in diagnostic procedures, to, for example detect or diagnose S. uberis infection/infestations in animal (for example bovine, caprine or ovine) species, as well as for passive immunisation
- the present invention further provides a vaccine for use in preventing or controlling Streptococcus infections and/or associated diseases and/or conditions.
- the vaccines may find particular application in preventing or controlling mastitis (namely mastitis with a streptococcal aetiology).
- the vaccines provided by this invention may be used to prevent or control 5. uberis infections and/or associated diseases.
- the vaccines may also be used to prevent or control streptococcal infections and/or associated diseases in human, avian, piscine, bovine, porcine, ovine and/or caprine hosts.
- the vaccine may be a polypeptide or polynucleotide vaccine - the polypeptides and/or polynucleotides providing, or encoding, one or more of the (5. uberis) antigens described herein.
- the invention further provides a method for immunising an animal against an infection or disease caused or contributed to by a Streptococcus species, said method comprising the step of administering a vaccine of the invention to a subject in need thereof.
- Subjects in need thereof may be animals suffering (or suspected of suffering from) a streptococcal infection or disease and/or animals regarded as susceptible or predisposed to such diseases and/or infections.
- the invention provides methods of immunising a human, an avian, a piscine, a caprine, a porcine, an ovine and/or bovine subject against 5. uberis infection/infestation and associated diseases, said method comprising the step of administering a vaccine of the invention to the human, avian, piscine, caprine, porcine, ovine or bovine subject.
- the antigens and/or vaccines of this invention may be exploited in the immunisation of animals against mastitis, wherein the mastitis results from, is associated with or is caused or contributed to by, a Streptococcus species (for example 5. uberis or S. dysgalactioe) or infection therewith.
- a Streptococcus species for example 5. uberis or S. dysgalactioe
- the antigens of this invention may find further application as the basis of diagnostic or identification/detection tests for various Streptococcus species/strains including any species or strain which expresses any of the antigens described herein.
- the antigens provided by this invention may be applied to the detection, identification and/or diagnosis of S. uberis, S. agalactiae, S. dysgalactioe, and S. parauberis infections, and/or diseases caused thereby or associated therewith.
- the antigens may also be used in methods for detecting the presence of streptococci in samples.
- an aspect of this invention may provide an ⁇ in vitro) method of detecting, identifying and/or diagnosing a streptococcus spp., 5. uberis, S. agalactiae, S. dysgalactioe and/or S. parauberis infection or a disease caused thereby or associated therewith, the method comprising detecting a level of one or more of the antigens described herein in a sample and/or detecting a level of an antibody with specificity for one or more of the antigens described herein, in a sample.
- a sample may comprise any biological fluid or tissue including, for example, whole blood; red blood cells, serum; plasma; saliva; sweat; semen; milk, (disease) tissue biopsy; tissue scraping; tissue/organ wash/lavage; and/or faecal preparations.
- sample may further extend to samples of animal feed/drink, bedding or field samples such as soil and grass.
- Methods of detecting levels of antigen or antibody in a sample may comprise immunological methods.
- methods of detecting levels of antigen or antibody may exploit enzyme-linked immunosorbant assay (ELISA) techniques.
- ELISA enzyme-linked immunosorbant assay
- one or more of the antigens described herein may be immobilised to a substrate and the immobilised antigen(s) used to probe a sample for the presence of antibodies reactive thereto. After a suitable period of incubation between the immobilised antigen and the sample, the presence or absence of antibodies may be detected by means of a secondary binding agent (for example antibody) optionally conjugated to a detectable moiety, with specificity for antibodies generated by the relevant species - for example bovine, caprine or ovine antibodies.
- the presence of antibodies may indicate the presence of a Streptococcus (for example S. uberis) and/or an infection therewith or a Streptococcus (for example an 5. uberis) associated disease or condition.
- binding agents or antibodies with specificity to one or more of the antigens described herein may be immobilised onto a substrate.
- the substrate may then be used to probe a sample for the presence of one or more antigens to which the binding agents or antibodies bind.
- the substrate may be contacted with a secondary binding agent or antibody with specificity for the relevant antigens.
- the secondary binding agent or antibody may be conjugated to a detectable moiety.
- the immobilised binding agent:antigen:binding agent complexes may be further probed with a tertiary binding agent or antibody capable of binding to the secondary binding agent.
- the tertiary binding agent may be conjugated to a detectable moiety.
- immunohistochemical staining may exploit binding agents (for example antibodies/ conjugated antibodies) with specificity for one or more of the antigens described herein, to detect the presence or absence of Streptococci (for example 5. uberis) antigens in a sample, for example a tissue sample.
- binding agents for example antibodies/ conjugated antibodies
- Streptococci for example 5. uberis
- Molecular methods may also be used to detect the presence of any of the antigens described herein (for example 5. uberis antigens) in a sample.
- primer sequences designed to amplify sequences encoding one or more of the (5. uberis) antigens of this invention may be used to probe samples for the presence of the relevant (for example 5. uberis) nucleic acid.
- PCR-based techniques may be found in, for example, PCR Primer: A Laboratory Manual, Second Edition Edited by Carl W. Dieffenbach & Gabriela S. Dveksler: Cold Spring Harbour Laboratory Press and Molecular Cloning: A Laboratory Manual by Joseph Sambrook & David Russell: Cold Spring Harbour Laboratory Press.
- kits comprising reagents and compositions suitable for identifying or detecting the presence or absence of Streptococci (including 5. uberis, S. dysgalactiae and/or S. parauberis) and/or diagnosing or detecting streptococci (including 5. uberis, S. dysgalactiae and/or S. parauberis) infections or diseases.
- the kits may comprise substrates having antigens of this invention or agents capable of binding the same, bound thereto.
- the kits may comprise agents capable of binding the relevant (for example 5. uberis) antigens.
- the kit may comprise an agent capable of binding the relevant S. uberis antigen.
- the kit may comprise specifically raised polyclonal antibodies or monoclonal antibodies - the antibodies having specificity for antigens provided by this invention.
- the kits are intended to diagnose or detect streptococci or streptococcal diseases in specific animals (for example human, avian, porcine, piscine, bovine, caprine and/or ovine animals) the kits may comprise binding agents or antibodies capable of binding immunoglobulin from the relevant species.
- the antibodies may be conjugated to detectable moieties.
- Kits for use in detecting the expression of genes encoding any of the antigens of this invention may comprise one or more oligonucleotides/primers for detecting/amplifying/probing the relevant antigen-encoding sequences.
- the kits may also comprise other reagents to facilitate, for example, sequencing, PCR and/or RFLP analysis. All kits described herein may further comprise instructions for use.
- Adjuvant formulations that are less than 50% oily phase
- the vaccine compositions of the instant invention comprise the adjuvants as described above, wherein the content of the oily phase in these adjuvant formulations is diluted and wherein the vaccine composition comprises a water-in-oil emulsion.
- the vaccine composition comprises a water-in-oil emulsion wherein the oily phase is less than 50%.
- the adjuvant formulation of the instant invention is prepared as described above.
- the oily phase comprises over 50% v/v of the adjuvant formulation.
- the amounts of ingredients other than oil and emulsifiers a re scaled up respectively, based on the final target concentration and desired dilution. For example, if one aims to prepare a vaccine composition where the adjuvant formulation comprises 80% v/v, the amounts of ingredients other than the oil are scaled up by the factor of 1.25 (1/0.8).
- emulsifiers if any (e.g., TWEEN ® 80 and/or SPAN ® 80) do not need to be scaled up, but preferably, the volume ratio between the oil and the emulsifier(s) is kept the same in the adjuvant formulation and in the final vaccine composition. Antigen solution is then added to the adjuvant formulation.
- Water-in-oil emulsion's integrity can be maintained as long as the dispersed spherical water droplets are not present in a more concentrated form than the maximum packing fraction for random packing of monodisperse droplets, i.e. : 0.64.
- vaccine formulations comprising the antigen compound, and the diluted adjuvant formulation according to the previously described embodiments, wherein the oily phase comprises over 36% of the vaccine composition v/v, and wherein the vaccine composition is a water-in-oil emulsion.
- adjuvant formulations suitable for this aspect of the invention include TCMO, TCMYO, QTCMO, QTCMYO, XOM, TXO, TXO-A, TAO, AXO, QCO, ODYRM, QCDXO.
- the volume of the oily phase is, in different embodiments, 37% 38%v/v, 39%v/v, 40% v/v, 41%v/v, 42%v/v, 43%v/v, 44% v/v, 45%v/v, 46%v/v, 47%v/v, 48% v/v, 49%v/v, or 50%v/v of the vaccine composition.
- the concentration of oily phase should be sufficiently high to create a depot effect and protect the antigen and immunomodulator(s) from a rapid degradation by the host's immune system, preferably 20% or more v/v of the vaccine composition.
- the amounts of the oily phase in the adjuvant formulations are diluted such that the vaccine formulation is an oil-in- water emulsion, with the oily phase comprising 20% or more v/v of the vaccine composition.
- the amounts of ingredients other than oil and emulsifiers are scaled up respectively, based on the final target concentration and desired dilution. For example, if one aims to prepare a vaccine composition where the adjuvant formulation comprises 33.3% v/v, the amounts of ingredients other than the oil are scaled up by the factor of 3 (1/0.333).
- emulsifiers if any (e.g., TWEEN ® 80 and/or SPAN ® 80) do not need to be scaled up, but preferably, the volume ratio between the oil and the emulsifier(s) is kept the same in the adjuvant formulation and in the final vaccine composition.
- the vaccine composition is an oil-in-water emulsion, wherein the oily phase comprises 21% v/v, 22%v/v, 23%v/v, 24%v/v, 25% v/v, 26%v/v, 27%v/v, 28%v/v, 29% v/v, 30%v/v, 31%v/v, 32%v/v, 33% v/v, 34%v/v, 35%v/v, 36%v/v, 37% v/v, 38%v/v, 39%v/v, 40% v/v, 41%v/v, 42%v/v, 43%v/v, 44% v/v, 45%v/v, 46%v/v, 47%v/v, 48% v/v, 49%v/v, or 50%v/v of the vaccine composition.
- adjuvant formulations suitable for this aspect of the invention include TCMO, TCMYO, Q.TCMO, QTCMYO, XOM, TXO, TXO-A, TAO, AXO, QCO, ODYRM, QCDXO, with a proviso that the oily phase in the adjuvant formulation may be below 50% v/v, but above 20% v/v of the final vaccine composition.
- I mmunogenic compositions of the present invention can include one or more adjuvants.
- Adjuvants include, but a re not limited to any of the following, individually or in combination:
- Triterpenoids suitable for use in the adjuvant compositions can come from many sources, either plant derived or synthetic equivalents, including but not limited to, Quillaja saponaria, tomatine, ginsing extracts, mushrooms, and an alkaloid glycoside structurally similar to steroidal saponins.
- triterpenoids suitable for use in the adjuvant compositions include saponins, squalene, and lanosterol. If a saponin is used, the adjuvant compositions generally contain an immunologically active saponin fraction from the bark of Quillaja saponaria.
- the saponin may be, for example, Quil A or another purified or partially purified saponin preparation, which can be obtained commercially.
- saponin extracts can be used as mixtures or purified individual components such as QS-7, QS-17, Q.S-18, and QS-21.
- Sterols suitable for use in the adjuvant compositions include ⁇ -sitosterol, stigmasterol, ergosterol, ergocalciferol, and cholesterol. These sterols are well known in the art and can be purchased commercially. For example cholesterol is disclosed in the Merck Index, 12th Ed., p. 369.
- the adjuvant compositions can further include one or more immunomodulatory agents such as, e.g., quaternary ammonium compounds (e.g., DDA), and interleukins, interferons, or other cytokines. These materials can be purchased commercially.
- the adjuvant compositions can further include one or more polymers such as, for example, DEAE Dextran, polyethylene glycol, and polyacrylic acid and polymethacrylic acid (eg, CARBOPOL ® ; Lubrizol Corp., Wickliffe, OH). Such material can be purchased commercially.
- polyacrylic acid e.g., the CARBOPOL ® polymers
- CARBOPOL ® polymers which has an average equivalent weight of 76. They are produced from primary polymer particles of about 0.2 to 6.0 microns in average diameter.
- the CARBOPOL ® polymers swell in water up to 1000 times their original volume and ten times their original diameter to form a gel when exposed to a pH environment greater than the pKa of the carboxylate group. At a pH greater than the pKa of carboxylate group, the carboxylate groups ionize resulting in repulsion between the negative charges, which adds to the swelling of the polymer.
- the adjuvant compositions can further include one or more Th2 stimulants such as, for example.
- Bay R1005 ® and aluminum Bay R1005 ® , a glycolipid, can be synthesized according to the procedure found in Lockhoff, 0. (Angew. Chem. Int. Ed. Engl. 30:1611-1620; 1991). It is recommended that it is stored at 2-8° C in an airtight container. Its chemical or physical properties are that it is slightly hygroscopic, does not form polymorphs, is chemically stable in air and light at temperatures up to 50° C and in aqueous solvents at pH 2-12 at ambient temperature. It is an amphiphilic molecule which forms micelles in aqueous solution.
- M ultiple oils and combinations thereof are suitable for use. These oils include, without limitations, animal oils, vegetable oils, as well as non-metabolizable oils.
- vegetable oils suitable in the instant invention are corn oil, peanut oil, soybean oil, coconut oil, and olive oil.
- animal oils is squalane.
- non-metabolizable oils include light mineral oil, straight chained or branched saturated oils, and the like.
- mineral oil refers to a mixture of liquid hydrocarbons obtained from petrolatum via a distillation technique.
- the term is synonymous with "liquefied paraffin", “liquid petrolatum” and “white mineral oil.”
- the term is also intended to include "light mineral oil,” i.e., oil which is similarly obtained by distillation of petrolatum, but which has a slightly lower specific gravity than white mineral oil. See, e.g., Remington's Pharmaceutical Sciences, 18th Edition (Easton, Pa.: Mack Publishing Company, 1990, at pages 788 and 1323).
- Mineral oil can be obtained from various commercial sources, for example, J. T. Baker (Phillipsburg, Pa.), USB Corporation (Cleveland, Ohio).
- Preferred mineral oil is light mineral oil commercially available under the name DRAKEOL ® (Penreco; Karns City, PA).
- Emulsifiers may be present in the adjuvant formulation. Such can include natural biologically compatible emulsifiers, and non-natural synthetic surfactants.
- Biologically-compatible emulsifiers include phospholipid compounds or a mixture of phospholipids.
- Preferred phospholipids are phosphatidylcholines (lecithin), such as soy or egg lecithin.
- Lecithin can be obtained as a mixture of phosphatides and triglycerides by water-washing crude vegetable oils, and separating and drying the resulting hydrated gums.
- a refined product can be obtained by fractionating the mixture for acetone insoluble phospholipids and glycolipids remaining after removal of the triglycerides and vegetable oil by acetone washing.
- lecithin can be obtained from various commercial sources.
- suitable phospholipids include phosphatidylglycerol, phosphatidylinositol, phosphatidylserine, phosphatidic acid, cardiolipin, and phosphatidylethanolamine.
- the phospholipids may be isolated from natural sources or conventionally synthesized.
- Non-natural, synthetic emulsifiers suitable for use in the adjuvant formulations of the present invention include sorbitan-based non-ionic surfactants, e.g. fatty-acid-substituted sorbitan surfactants, commercially available under the name SPAN ® (Sigma-Aldrich; St.
- ARLACEL ® (Croda; East Yorkshire, England); fatty acid esters of polyethoxylated sorbitol (TWEEN ® ; Croda), polyethylene glycol esters of fatty acids from sources such as castor oil (EMULFOR ® ); polyethoxylated fatty acid (e.g., stearic acid available under the name SIMULSOL ® M-53; Seppic, Puteaux, France), polyethoxylated isooctylphenol/formaldehyde polymer (TYLOXAPOL ® ; Sigma-Aldrich), polyoxyethylene fatty alcohol ethers (BRIJ ® ; Sigma-Aldrich); polyoxyethylene nonphenyl ethers (TRITON ® N; Dow Chemical Co., Midland, Ml), polyoxyethylene isooctylphenyl ethers (TRITON ® X; Sigma-Aldrich).
- Preferred synthetic surfactants are the surfactants available under the name SPAN ® and TWEEN ® , such as TWEEN ® -80 (Polyoxyethylene (20) sorbitan monooleate) and SPAN ® -80 (sorbitan monooleate).
- Suitable cationic carriers may be included in the adjuvant formuation, and can include, without limitations, dextran, dextran DEAE (and derivatives thereof), PEGs, guar gums, chitosan derivatives, polycellulose derivatives like hydroxyethyl cellulose (HEC) polyethylenimene, poly aminos like polylysine and the like.
- Immunostimulatory oligonucleotides may be present in the aduvant, and can include ODN (DNA-based), ORN (RNA-based) oligonucleotides, or chimeric ODN-ORN structures, which may have modified backbone including, without limitations, phosphorothioate modifications, halogenations, alkylation (e.g., ethyl- or methyl- modifications), and phosphodiester modifications.
- poly inosinic -cytidylic acid or derivative thereof may be used.
- CpG oligonucleotides are a recently described class of pharmacotherapeutic agents that are characterized by the presence of an unmethylated CG dinucleotide in specific base-sequence contexts (CpG motif).
- CpG motif specific base-sequence contexts
- Suitable oligonucleotides can include P-class immunostimulatory oligonucleotides, also modified P- class immunostimulatory oligonucleotides, as well as E-modified P-class oligonucleotides.
- P-class immunostimulatory oligonucleotides are CpG oligonucleotides characterized by the presence of palindromes, generally 6-20 nucleotides long.
- the P-Class oligonucleotides have the ability to spontaneously self-assemble into concatamers either in vitro and/or in vivo.
- oligonucleotides are, in a strict sense, single-stranded, but the presence of palindromes allows for formation of concatamers or possibly stem-and-loop structures.
- the overall length of P- class immunostimulatory oligonucleotides is between 19 and 100 nucleotides, e.g., 19-30 nucleotides, 30-40 nucleotides, 40-50 nucleotides, 50-60 nucleotides, 60-70 nucleotides, 70-80 nucleotides, 80-90 nucleotides, 90-100 nucleotides.
- the immunostimulatory oligonucleotide contains a 5' TLR activation domain and at least two palindromic regions, one palindromic region being a 5' palindromic region of at least 6 nucleotides in length and connected to a 3' palindromic region of at least 8 nucleotides in length either directly or through a spacer.
- P-class immunostimulatory oligonucleotides may be modified according to techniques known in the art. For example, J-modification refers to iodo-modified nucleotides. E-modification refers to ethyl-modified nucleotide(s).
- E-modified P-class immunostimulatory oligonucleotides are P-class immunostimulatory oligonucleotides, wherein at least one nucleotide (preferably 5' nucleotide) is ethylated. Additional modifications include attachment of 6-nitro-benzimidazol, O-Methylation, modification with proynyl-dU, inosine modification, 2-bromovinyl attachment (preferably to uridine). P-class immunostimulatory oligonucleotides may also contain a modified internucleotide linkage including, without limitations, phosphodiesther linkages and phosphorothioate linkages.
- oligonucleotides of the instant invention may be synthesized or obtained from commercial sources.
- P- Class oligonucleotides and modified P-class oligonucleotides are further disclosed in published PCT application no. WO2008/068638, published on Jun. 12, 2008.
- Aluminum is a known adjuvant, or a component of adjuvant formulations, and is commercially available in such forms as REHYDRAGEL ® (General Chemical; Parsippany, New Jersey).
- REHYDRAGEL ® is a crystalline aluminum oxyhydroxide, known mineralogically as boehmite. It is effective in vaccines when there is a need to bind negatively charged proteins.
- cytokines or lymphokines have been shown to have immune-modulating activity, and thus may be used as adjuvants. These can include, but not be limited to, the interleukins 1-a, 1- ⁇ , 2, 4, 5, 6, 7, 8, 10, 12 (see, e.g., US 5,723,127), 13, 14, 15, 16, 17 and 18 (and its mutant forms), the interferons-a, ⁇ and ⁇ , granulocyte-macrophage colony stimulating factor (see, for example, US 5,078,996, and ATCC Accession Number 39900), macrophage colony stimulating factor, granulocyte colony stimulating factor, GSF, and the tumor necrosis factors a and ⁇ .
- adjuvants useful in this invention include chemokines, including without limitation, MCP-1, ⁇ - ⁇ , ⁇ - ⁇ , and RANTES.
- Adhesion molecules such as a selectin, e.g., L-selectin, P-selectin, and E-selectin may also be useful as adjuvants.
- Still other useful adjuvants include, without limitation, a mucin-like molecule, e.g., CD34, GlyCAM-1 and MadCAM-1; a member of the integrin family such as LFA-1, VLA-1, Mac-1 and pl50.95; a member of the immunoglobulin superfamily such as PECAM, ICAMs (e.g., ICAM-1, ICAM-2 and ICAM- 3), CD2 and LFA-3; co-stimulatory molecules such as CD40 and CD40L; growth factors including vascular growth factor, nerve growth factor, fibroblast growth factor, epidermal growth factor, B7.2, PDGF, BL- 1, and vascular endothelial growth factor; receptor molecules including Fas, TNF receptor.
- a mucin-like molecule e.g., CD34, GlyCAM-1 and MadCAM-1
- a member of the integrin family such as LFA-1, VLA-1, Mac-1 and pl50.95
- a member of the immunoglobulin superfamily such as
- Still another adjuvant molecule includes Caspase (ICE).
- adjuvants can include the RIBI adjuvant system (Ribi I nc.; Hamilton, MT), Freund's complete and incomplete adjuvants. Block copolymer (CytRx; Atlanta, GA), SAF-M (Chiron; Emeryville, CA), AMPHIGEN 8 adjuvant (described in US 5,084,269 and US 6,814,971), Avridine lipid-amine adjuvant, heat-labile enterotoxin from Escherichia coli (recombinant or otherwise), cholera toxin, or muramyl dipeptide. Also useful is MPLTM (3-O-deacylated monophosphoryl lipid A; Corixa, Hamilton, MT), which is described in U.S. Patent No.
- lipid A analogs or aminoalkyl glucosamine phosphate (AGP) compounds are also suitable for use as adjuvants, or derivatives or analogs thereof, which are available from Corixa (Hamilton, MT), and which are described in US 6,113,918, hereby incorporated by reference.
- a preferred TXO blend formulation may contain 50 mg/ml of DEAE Dextran.
- Dextran when present at high concentrations in subcutaneous injections, can cause injection site reactions in the animals. Hence it is proposed to try varying concentrations for DEAE Dextran to check if safety and good therapeutic value can be obtained without compromising the stability of the vaccine formulation. Characterization and stability tests are important as they inform us whether this vaccine can be formulated consistently and with a good shelf life for manufacturing. Viscosity tests are performed at a range of shear rates in order to look for shear thinning (drop in apparent viscosity as shear rate goes up) or shear thickening (increase in apparent viscosity as shear rate goes up), which is a flow characteristic of Non-Newtonian fluids. Syringe force tests are performed to ensure that the vaccine will be easy to draw out and easy to administer over a large number of doses in the field.
- AXO (Aluminum + Dextran + Oil) blends of varying REHYDRAGEL ® (5% to 16%) and DEAE Dextran (50 mg/ml - 10 mg/ml) concentrations are formulated tested for viscosity, syringe force and settling using an XO (Dextran + Oil) blend as a control.
- the tested compositions were as follows: Approximately 10 ml of sample was filled into each of five 15-ml Corning centrifuge tubes and left still over a week in order to observe an accelerated settling effect on the emulsions due to the tubes' narrow dimensions and conical bottom. The samples were also tested for syringeability and viscosity. The results are shown below. In Table 3
- Example 2 Bacillerial strains , culture conditions and expression
- Streptococcus uberis 0140J ATCC BAA-854
- ATCC BAA-854 The reference strain, Streptococcus uberis 0140J (ATCC BAA-854) was used in this study, in addition to a further 71 5.
- uberis clinical isolates derived from cases of bovine and ovine mastitis from distinct farms within the UK, Italy and the USA, and comprised strains which either persisted or were cured following antibiotic therapy.
- bacteria were propagated in Brain Heart Infusion (BHI) broth or agar.
- Bacteria for inclusion in proteomic analyses were propagated in a defined medium to provide a suitable growth environment lacking medium-derived peptides that would interfere with a mass spectrometric approach. Irrespective of the medium used, cultures were incubated static at 37°C.
- uberis strains were assessed in a proteomic analysis to identify putatively conserved proteins. Bacteria were propagated in 50 ml volumes to late exponential growth-phase; growth curves for each strain had been generated in a prior experiment, whereby growth was measured in the defined medium over time (data not shown). Bacterial cells were harvested by centrifugation at 30,000 ⁇ g for 20 m and washed twice with ice-cold PBS. Subsequently, in microcentrifuge tubes, the bacterial pellets were carefully re-suspended in 0.5 ml of PBS containing 40% (w/v) sucrose, ImM DTT and 20 ⁇ g sequencing grade modified trypsin (Promega).
- Proteolytic digestion of cells to liberate cell-wall and cell-wall-associated proteins was carried out for 2 h at 37°C with gentle shaking. Subsequently, the digestion mixtures were centrifuged at 30,000 ⁇ g for 10 m to pellet cells, and each supernatant was transferred to a fresh microcentrifuge tube. Incubation of supernatants was continued overnight at 37°C, then each was filtered through a 0.45 ⁇ Spin-X centrifuge tube filter (Corning) and stored in a refrigerator until required.
- Liquid chromatography was performed using an Ultimate 3000 nano-HPLC system (Dionex) comprising a WPS-3000-well plate micro auto-sampler, a FLM-3000 flow manager and column compartment, a UVD-3000 UV detector, an LPG-3600 dual-gradient micro-pump and an SRD- 3600 solvent rack controlled by Chromeleon chromatography software (Dionex: http://wwwl.dionex.com).
- a micro-pump flow rate of 246 ⁇ min 1 was used in combination with a cap-flow splitter cartridge, affording a s2 flow split and a final flow rate of 3 ⁇ min 1 through a 5 cm x 200 ⁇ ID monolithic reversed-phase column (Dionex/LC Packings) maintained at 50°C. Samples of 1-4 ⁇ were applied to the column by direct injection. Peptides were eluted by the application of a 15 min linear gradient from 8-45% solvent B (80% (w/v) acetonitrile, 0.1% (v/v) formic acid) and directed through a 3 nl UV detector flow cell.
- MS/MS data was submitted to an in-house server running MASCOT (MATRIX SCIENCE), and searched against the fully-annotated S. uberis 0140J genome sequence (NC 012004) using the MASCOT search algorithm.
- MASCOT MATRIX SCIENCE
- C carbamidomethyl
- M oxidation
- mass tolerance values for MS and MS/MS were set at 1.5Da and 0.5Da respectively.
- Molecular weight search (MOWSE) scores attained for individual protein identifications were inspected manually and considered significant only if two or more peptides were matched for each protein and identified peptide contained an unbroken "b" or "y” ion series of a minimum of four amino acid residues.
- PCR was used to determine the presence/absence of protein-coding sequences within the genomes of the larger panel of S. uberis strains, which included those 20 strains originally subjected to mass spectrometric analysis.
- Genomic DNA of 72 S. uberis strains was extracted from overnight cultures using the DNeasy Blood & Tissue Extraction Kit (Qiagen) as per the manufacturer's instructions for 'hard to lyse' Gram- positive bacteria.
- Oligonucleotide primer pairs were designed to allow PCR amplification of each of the target genes.
- PCR was conducted using Taq PCR MasterMix Kit (Qiagen), as per the manufacturer's instructions.
- amplicons were visualised over UV light following electrophoresis through 1% (w/v) agarose gels containing GelRed. In all cases a PCR product was observed, indicative of the antigen encoding gene being present in each of the analysed strains. Subsequently, selected PCR products were analysed further by sequencing to confirm the identity of the amplified sequences. Based upon the results of proteomic and genomic screening, 4 conserved targets were identified and were chosen for further assessment as candidate vaccine antigens.
- Each of the 4 genes were amplified by PCR (as previously) from S. uberis 0140J genomic DNA using oligonucleotide primers designed to include appropriate restriction endonuclease recognition sites to facilitate in-frame cloning into the expression plasmid.
- oligonucleotide primers designed to include appropriate restriction endonuclease recognition sites to facilitate in-frame cloning into the expression plasmid.
- each forward primer was designed to anneal, in-frame, immediately after the predicted signal peptide- encoding sequence.
- PCR amplicons were initially cloned using the TOPO TA Cloning Kit (Life Technologies Corp.). Subsequently, the 5.
- uberis genes were cleaved from the TOPO vector using the primer-encoded restriction endonuclease sites; digests were electrophoresed through 1% (w/v) agarose gels, and the desired fragments were excised and purified using the QIAquick Gel extraction Kit (Qiagen). Finally, each 5. uberis gene was cloned into pET-15b expression plasmid (Novagen), to allow expression of each protein with an N-terminal 6 ⁇ histidine (his) residue tag to facilitate downstream purification
- Target genes are listed according to their locus tag within the S. uberis 0140J genome (accession number NC 012004), and the name and accession number of the products they encode.
- the 4 antigens chosen for further study were (N.B. 'r' prefix denotes recombinant product) rSUB423 (ferrichrome binding protein), rSUB604 (elongation factor Tu), rSUB950 (lipoprotein) and rSUB1868 (serine protease).
- rSUB423 ferrichrome binding protein
- rSUB604 elongation factor Tu
- rSUB950 lipoprotein
- rSUB1868 serine protease
- the cell pellets containing rSUB950 and rSUB1868 were re-suspended in 20 ml each of lysis buffer (lx BugBuster protein extraction reagent (Merck Millipore), 50 mM Tris HCI pH 8.0, 500 mM NaCI, 10 mM imidazole, 25 U/ml Benzonase enzyme (Merck Millipore) and lx Complete EDTA-free protease inhibitor cocktail (Roche Applied Science)) and incubated at 37°C for 60 min to allow cell lysis and degradation of nucleic acids. Cell lysates were centrifuged at 22,000 ⁇ g for 30 m at 4°C to pellet cell debris.
- lysis buffer lx BugBuster protein extraction reagent (Merck Millipore), 50 mM Tris HCI pH 8.0, 500 mM NaCI, 10 mM imidazole, 25 U/ml Benzonase enzyme (Merck Millipore) and lx Complete
- Cell pellets containing inclusion bodies were initially treated according to the native extraction protocol. Subsequently, cell pellets containing inclusion bodies were suspended in 20 ml of native lysis buffer. Lysozyme was added to a final concentration of 1 kU/ml and digestion was carried out at room temperature for 15 min. After incubation, an equal volume of BugBuster reagent (diluted in distilled water) was added to the suspensions, which were mixed by vortexing for 1 min and centrifuged at 5,000 x g for 15 min at 4°C to collect inclusion bodies. Inclusion body pellets were then washed a further 3 times with 1:10 diluted BugBuster, as previously.
- each inclusion body was dissolved in 20 ml of 8 M urea (pH 8.0) at room temperature for 15 m, and then centrifuged at 5,000 ⁇ g for 15 m at room temperature to pellet (remove) insoluble material. Subsequently, purification of each protein was performed using Ni-CAM resin, as described elsewhere except that the column buffers used for native purification were replaced with: Equilibration Buffer (0.1 M sodium phosphate, 8 M urea pH 8.0), Wash Buffer (0.1 M sodium phosphate, 8 M urea pH 6.3), and Elution Buffer (0.1 M sodium phosphate, 8 M urea pH 4.5).
- Equilibration Buffer 0.1 M sodium phosphate, 8 M urea pH 8.0
- Wash Buffer 0.1 M sodium phosphate, 8 M urea pH 6.3
- Elution Buffer 0.1 M sodium phosphate, 8 M urea pH 4.5.
- Size exclusion HPLC was performed using a Superose 12 10/300GL column (GE Healthcare) pre- equilibrated with lx PBS, pH6.8 (for native, soluble proteins) or 8 M urea in 1 x PBS, pH6.8 (for denatured, insoluble proteins). I ndividual injections of 200 ml were applied to the column and proteins were resolved over a period of 60 m at a flow rate of 0.5 ml/m. The proteins that eluted from the column were monitored spectrophotometrically at a wavelength of 280nm.
- the TXO is a water in mineral oil emulsion that is used as a vaccine adjuvant.
- the preparation of this formula begins by the preparation of the oily phase which is comprised of Span-80 surfactant added into mineral oil that was pre-warmed to 37 degrees C to facilitate solubilization of the surfactant.
- This material is prepared fresh and then sterile filtered through a 0.2 um absolute sterilizing grade filter and stored at room temperature until the next step of the vaccine preparation. The mixing is achieved by using a magnetic stirring bar on small stir plate.
- the second step of this vaccine preparation is the making of the aqueous phase.
- the aqueous phase is prepared at room temperature by addition of components to a specified quantity of PBS (which is the vaccine extender) in a mixing container.
- PBS which is the vaccine extender
- DEAE-Dextran, CpG and antigen are added consecutively to achieve the specified concentrations.
- the Tween 80 surfactant is added and allowed to fully dissolve. It should be noted that different mixing orders is also operable.
- the mixing is achieved by using a magnetic stirring bar on small stir plate.
- the preferred CpG used herein is as follows although numerous other species exemplified herein can be used.
- the third and final step is to form the emulsion by adding the aqueous phase into the oily phase.
- the oily phase is placed into a beaker under a laminar airflow hood and a Silverson
- the aqueous phase is fed directly into the already mixing oily phase at ⁇ 30 mL/in with a recirculation speed of 10,000 to 11,000 RPM .
- the resulting mixture should be an opaque white stable water in oil emulsion.
- Each vaccine antigen is provided to a final concentration of 37.5 units/mL or 75 units/dose, in this case from stock solutions as follows: uberis 0423, 760 microgram/mL, volume added 0.0987 mL; uberis 00604, 700 microgram/mL, volume added 0.1071 mL; uberis 0950, 1400 microgram/mL, volume added 0.0536 mL; and uberis 1868, 680 microgram/mL, volume added 0.1103 mL.
- a 2 ML dose also contains 0.1260 mL of a 100% stock solution of Span 80, and 0.0290 mL of a 100% stock solution of Tween 80.
- CpG "23877" (SEQ ID NO:20 as above) is added as 0.0125 mL of a 20mg/mL stock solution, thereby providing 250 micrograms per 2mL dose (it should be noted the amount of CpG can be varied still with good vaccine effect, such as by providing about 10-1000 micrograms CpG per 2 mL dose, preferably 50-500 micrograms per 2 mL dose, and most preferably about 100-250 micrograms CpG per 2 mL dose, which may be higher or lower based on the CpG species selected.
- Each 2 mL dose further comprises 0.1 gram of DEAE dextran (added as 0.5 mL of a 0.2 g/mL solution).
- a typical 2M L dose is made up to total volume using lOmM PBS, which typically requires about 0.0628 mL/2mL dose, with trace merthiolate also added.
- the objective of the study was to evaluate sub0423, sub0604, sub0950 and subl868 as potential antigen candidates for Streptococcus uberis vaccine development in a vaccination-challenge model. Animals were allotted to treatment groups (Table 5 below) and vaccinated on Study Days 0 and 28 in accordance with this allotment. T01 received a dose of saline, T02 received sub0423 & sub0604, T03 received sub0950 & subl868 and T04 received sub0423, sub0604, sub0950 & subl868.
- Challenge Phase was corrected from twice daily observations to once daily observations on Study Day 34 to reflect Section 8.4.1 General Health Observations (GHO) which states that GHO will be observed and recorded daily.
- the Challenge Phase calendar was updated to include injection site observations on Challenge Phase Day ⁇ -)!.
- an abnormal clinical observation score was recorded for an animal, rectal temperature and physical examination were completed and results recorded in a "Note-to-File" instead of DVMax as was noted in the protocol.
- I njection site evaluations were conducted for all cows on Study Day 14. However, data for Animals 526, 529, 530, 531 and 532 in Group 3 and Animals 533, 537 and 539 in Group 4 did not save in FREDe.
- Injection sites for these animals were re-evaluated and recorded in FREDe on Study Day 15. Data from these two days of observations were combined for summary and analysis. Clinical observation, milk appearance and udder evaluation scores were inadvertently not saved in FREDe for animals in Block 1 on AM, Challenge Phase Day 9. These data are missing from the dataset. Clinical observations, milk appearance and udder evaluation scores were inadvertently not completed on Challenge Study Day 14 PM, for all animals in Block 1. For subsequent blocks the aforementioned observations were removed from the study calendar. However, these observations were inadvertently collected on Challenge Day 14 PM, for all animals in Block 4, data for these animals was flagged from the summary and analysis. Due to insufficient quantities of the recombinant antigens, reagents were not available to conduct S.
- uberis challenge strain 29048 culture was stored at approximately -70° C in Trypticase soy broth (TSB) containing 10% glycerol. The day before challenge, 50 mL of pre-warmed Todd Hewitt broth was inoculated with 50 ⁇ of thawed stock. After 15 to 18 hours of incubation at 37° C, 1 mL of the overnight culture was used to inoculate 50 mL of pre-warmed Todd Hewitt broth and incubated for ⁇ 7 hours at 37° C, or until the broth reached the pre-determined optical density.
- TAB Trypticase soy broth
- the flask grown suspension was diluted ten-fold in sterile, cold PBS (pH 7.4) to reach a concentration of approximately 100 colony-forming units (CFU) / mL.
- This final suspension was further diluted in cold, sterile PBS to achieve a final concentration of 50 CFU / 5 mL dose.
- Challenge material was maintained on ice prior to and during challenge of all animals. Aliquots were retained in the Laboratory and serial dilutions were performed at beginning and end of challenge for viable plate counts. Beginning and final challenge material concentrations are presented as shown below (Table 8).
- Animals were placed into thestudy as follows. Animals arrived at the farm site, and the number of days that animals were acclimated is presented by block as shown below. Animals were initially housed in Building 608 and then were moved with their co-hort to the winter feed lots (building 305 and 422) for calving. Moving of animals to the winter feed lots ranged from Study Day 0 post vaccination to Study Day 10. When an animal calved it was transported back to Building 608. Approximately one week prior to challenge, all animals within the block were transported to Building 609 for the challenge phase of the study. All animals met inclusion criteria as defined in the protocol. Animal details at the time of enrollment were documented,see also Table 9, as to acclimation times.
- CM Clinical mastitis
- Intramammary infection was defined as the isolation of S. uberis (>100 cfu / mL) from two samples within a 5-day period and data are presented in Table 12.
- serum antibody titers for all four proteins were significantly higher for animals in treatment group T04 compared to T01 on Study Day 70. Further, least square mean values for animals in both treatment groups T01 and T04 on Study Day 0 were not different indicating no previous exposure to these antigens. Milk antibody titer least square mean values for all four proteins were significantly higher for animals in treatment group T04 compared to T01 on Study Day 70, as well.
- the gene construction included a pFLEX 30 vector (see below), which expressed the protein as a soluble intracellular protein with a molecular weight of 34,164.70 Daltons and an isoelectric point of 6.055. After fermentation and expression in a 500 mL shake flask, the cells were centrifuged to a hard pellet, prior to cell breakage with an Avestin homogenizer. The expressed protein was in the soluble fraction after centrifugation, and it failed to bind to Q-Sepharose Fast Flow anion exchange
- DAKVVSATDLESITALEPDLI IVGSNEENISQLAEIAPLISIEYRKHDYLQVFSDFGKVFNKTKETDKWLQEWKTKTASFES DVKAVTGNNATFTI MGLYEKDIYLFGKDWGRGGEIIHQAFQYQAPEKVKM EVFPKGYLSISQEVLPDYIGDYVV VAAEDEKTGSSLYESDLWK IPAVQKNHVINVNANTFYFTDPLSLEYELKTLTDAILTQ.KTHN (see SEQ ID NO:3)
- the fermentation seed was prepared in 10 mL of o/n culture in Teknova product Kan50 (Catalog # L8950, Lot # L895002J1201).
- the agitation was set at 200 RPM, the temperature was 33°C, and the pH was 7.0.
- the batch fermentation was conducted in 500 mL of Terrific Broth (Gibco) with 25 mL o/n culture in a 2 L flask. The fermentation conditions are shown in Table 15, below.
- the cell paste resulting from centrifugation of the fermentation broth was suspended in 200 mL of a buffer containing 5 mM Tris-HCI, I mM EDTA, pH 8.0 using a tissue homogenizer. The suspension then was passed through the Avestin homogenizer, followed by centrifugation at 9000 RPM for 20 minutes. After SDS PAGE indicated that the SUB423 Ferrichrome Binding Protein was in the soluble supernatant (data not shown); this soluble fraction was submitted to chromatography on a 2.5 X 4.5 cm column of Q. Sepharose Fast Flow equilibrated with 5 mM sodium phosphate, 1 mM EDTA, pH 8.0 buffer.
- the sample was titrated to pH 8.5 with dilute NaOH prior to application to the column.
- the column load and spent fraction contained 200 mL; an additiona l 200 mL of 5 mM sodium phosphate, 1 mM EDTA, pH 8.0 buffer was utilized to provide an additional wash of the column. These two eluted fractions were combined, thus the spent and wash fractions contained a total of 400 mL.
- the column then was eluted successively with 200 mL each of equilibration buffer containing 100 mM NaCI, 200 mM NaCI and 300 mM NaCI. All of these fractions were analyzed by SDS PAGE.
- the SUB423 Ferrichrome Binding Protein was expressed as a soluble intracellular protein which was released from the cells upon cell breakage in the Avestin homogenizer.
- a dilute buffer containing 5 mM sodium phosphate, 1 mM EDTA, pH 8.0 was used to suspend the cells and in cell breakage, and the resulting supernatant after cell breakage and centrifugation was adjusted to pH 8.5 with dilute NaOH. These procedures were followed so that the supernatant could be applied directly to a Q-Sepharose Fast Flow column in the same dilute buffer.
- SDS-PAGE analysis of the eluted fractions (Data not shown) indicated that the SUB423 protein did not bind to the Q-Sepharose column under the conditions of chromatography.
- the SUB423 protein eluted in the column spent and wash fraction, which contained a total of 400 mL and a protein concentration of 0.43 mg/mL.
- the sample was concentrated in Millipore Centriprep centrifugal concentrators with a molecular weight cutoff of 50,000. The resulting
- concentrated protein solution had a protein concentration of 2.89 mg/mL in a volume of 50 mL, for a total protein content of 144.5 mg.
- the resulting protein was soluble in aqueous buffer, and was sterile filtered into sterile 50 mL centrifuge tubes prior to storage at -50°C.
- the lot number for this protein sample was 1024-RLG-4, which also was the notebook reference for the protein.
- the isoelectric point of the SUB950 Lipoprotein is somewhat lower, at 4.815.
- the reason for the Ferrichrome Binding Protein not adhering to the Q- Sepharose column may have been that the protein was in a high molecular weight soluble aggregate form; we have seen lack of binding to anion exchangers of protein aggregates in the past.
- the Ferrichrome Binding Protein was of reasonable purity after Q-Sepharose chromatography.
- a total of 144.5 mg of the Ferrichrome Binding Protein was prepared and it was in 50 mL and a protein concentration of 2.89 mg/mL. The resulting protein was sterile filtered into sterile tubes and stored at -50°C until needed.
- the pFLEX vector system (see also Figure 1) is further described as follows.
- a series of vectors designed for the flexible expression of recombinant proteins in E. coli has been developed. These plasmids are based upon a colEl (pUC) origin of replication, which allows them to be maintained at a high copy number. They also contain the M13 origin of replication, which allows for rescue of single- stranded plasmid DNA when cells containing this plasmid are transfected with a helper phage.
- the gene of interest (GOI) is cloned into a multiple cloning site (MCS) downstream of the P L promoter.
- MCS multiple cloning site
- ⁇ c/857 temperature-sensitive repressor also encoded on the pFLEX plasmids. This prevents expression from the ⁇ P L promoter at 30°C. At 42°C, the repressor is inactive, thereby allowing a high level of transcription and subsequent translation to occur from the P L promoter.
- these plasmids contain the kanamycin resistance gene.
- Encoded is a 10 amino acid peptide containing 6 threonine residues; this peptide has been shown to increase protein stability when fused to the amino terminus.
- This element encodes for the FLAG monoclonal antibody binding site; this can be used for detection and purification purposes.
- the third element encodes an enterokinase recognition sequence; this allows for specific removal of the PFE cassette via enterokinase cleavage.
- a variant of the PFE cassette has been generated which encodes only for the Protective Peptide (P).
- the PFE cassette is inserted within the MCS of the pFLEX vectors. In-frame cloning of the GOI into one of the restriction sites downstream of the PFE cassette will result in a PFE-GOI fusion protein. Integrity of the fusion junctions can be determined by sequencing with the EEL-Forward and M13- Forward primers.
- This cassette contains the genes encoding for two tRNAs; the codons that these tRNAs recognize are used infrequently in E. coli.
- the first (I) recognizes the codon AUA, which adds isoleucine to the growing polypeptide chain; the second (R) recognizes the codons AGA and AGG, and inserts arginine.
- the IR cassette when present in any of the pFLEX vectors, is inserted at the Kas ⁇ site.
- pFLEX30 uses a P element, and a representative general construct appears as Figure 1 (shown for FLEX 10) which uses a PFE element
- the SUB950 Lipoprotein was expressed as an intracellular soluble protein. After cell breakage and centrifugation, the soluble recombinant SUB950 protein was applied to a Q-Sepharose anion exchange colum n, and it adhered to the column. The SUB950 protein then was eluted with a buffer containing 50 mM NaCI in equilibration buffer. The resulting purified protein appeared relatively pure on SDS-PAGE. After concentration in a centrifugal concentrator, the protein content was 0.66 mg/mL in 166 mL, for a total protein content of 109.6 mg.
- the gene for the SUB950 Lipoprotein was cloned into E. coli strain BL21 using a pFLEX 30 vector.
- the complete amino acid sequence of the resulting protein is shown below.
- the expressed protein should have a molecular weight of 34,978.86 Daltons and an isoelectric point of 4.815.
- the complete amino acid sequence of the 5. uberis recombinant SUB950 Lipoprotein is shown below.
- the amino acid sequence from the structural gene is shown in black, the amino acids added by the pFLEX vector are shown in bold.
- the fermentation seed was prepared in 10 mL of o/n culture in Teknova Kan ⁇ (Catalog # L8950, Lot U L895002J 1201).
- the agitation was set at 200 RPM, the temperature was 37°C, and the pH was 7.0.
- the batch fermentation was conducted in 500 mL of Terrific Broth with 25 mL o/n culture in a 2 L flask. The fermentation conditions are shown in Table 16, below. A total of 6 grams of cell pellet were recovered.
- a sample of cell paste containing 6 grams was suspended in 200 mL of a buffer containing 5 mM Tris-HCI, 1 mM EDTA, pH 8.0 using a tissue homogenizer. The suspension then was passed through the Avestin homogenizer, followed by centrifugation at 9000 RPM for 20 minutes. After SDS-PAGE indicated that the SUB950 Lipoprotein was in the soluble fraction (data not shown), the soluble fraction then was subjected to chromratography on a 2.5 X 6.0 cm column of Q-Sepharose Fast Flow equilibrated in 5 mM sodium phosphate, 1 mM EDTA, pH 8.0 buffer.
- the column was washed with the equilibration buffer, and a total of 225 mL was collected. After this, an additional 250 mL ofequilibration buffer plus 50 mM NaCI was applied to the column, followed by another 225 mL of 50 mM NaCI in equilibration buffer. The column then was eluted with two 100 mL aliquots of 100 mM NaCI in equilibration buffer, two 100 mL aliquots of 200 mM NaCI in equilibration buffer, and one 225 mL volume of 500 mM NaCI in equilibration buffer.
- the cell density increased from 2.8 at TO to 7.0 at harvest. After harvest, the cells were centrifuged to a pellet. The wet weight of the cell pellet was 6 grams. After induction of the fermentation flasks with a temperature shift, the amount of the expressed SUB950 Lipoprotein increased until harvest at 3 hours post induction. For purification, The SUB950 Lipoprotein was expressed as a soluble intracellular protein which was released from the cells upon cell breakage in the Avestin homogenizer.
- SUB950 Lipoprotein was sterile filtered into sterile 50 mL centrifuge tubes, and then stored at -50°C.
- This sample of SUB950 Lipoprotein was designated as lot # 1024-RLG-2, which also is the notebook reference. Accordingly, we have cloned the gene for Strep, uberis SUB950 Lipoprotein into recombinant E. coli using a pFLEX 30 vector. The resulting protein was expressed in fermentation after heat induction. The SUB950 Lipoprotein was expressed as a soluble, intracellular protein which was purified by chromatography on the anion exchanger Q-Sepharose Fast Flow. After concentration using centrifugal concentrators, the resulting protein appeared on SDS PAGE as one major band. From 500 mL of fermentation medium in a shake flask we recovered 109.6 mg of purified protein, as 166 mL of a 0.66 mg/mL protein solution.
- the insoluble fraction was centrifuged to a pellet, after which it was resuspended in 4% Tergitol 15-S-7 in water and centrifuged again, followed by two water washes and centrifugation after each water wash.
- the resulting protein fraction showed a major protein band on SDS-PAGE with an approximate apparent molecular weight in the 46,000 Dalton range, plus several very minor bands.
- Bradford total protein analysis indicated a protein concentration of 0.95 mg/mL, after concentrating the protein sample from 100 mL to 55 mL. The total amount of protein isolated was ⁇ 52 mg.
- the sample was sterile filtered into sterile 50 mL tubes and stored at -50°C
- the gene for the S. uberis Elongation Factor Tu protein was cloned into E. coli using a pET15 vector, which places a hexahistidinyl tag near the N-terminus of the protein.
- the molecular weight of the protein should be 46,450.56 Daltons, and the isoelectric point should be 5.203.
- the compelte amino acid sequence of the protein is shown below containing a hexahistidinyl tag (in bold).
- the fermentation seed was prepared in lOOmL of o/n culture in Teknova Amp " * " ⁇ (Catalog # L8950, Lot U L895002J1201).
- the agitation was set at 200 RPM, the temperature was 37°C, and the pH was 7.0.
- the batch fermentation was conducted in 500 mL of Terrific Broth with 12.5 mL o/n culture in a 2 L flask. The fermentation conditions are shown in Table 17, below.
- the cells were centrifuged to a hard pellet and frozen at - 20°C.
- the frozen cells were thawed in 200 mL of 50 mM Tris-HCI, 10 mM EDTA, pH 8.0, using a tissue homogenizer.
- the cells then were lysed by use of an Avestin homogenizer, followed by centrifugation. SDS-PAGE was performed on the lysate, the soluble supernatant, and the inclusion body protein pellet.
- the pellet was resuspended in 4% Tergitol 15-S-7 in water.
- the resuspended pellet then was recentrifuged, resuspended in water, centrifuged again, and then resuspended in water and centrifuged again.
- the final pellet was solubilized in 6M urea in Dulbecco's phosphate buffered saline.
- SDS-PAGE was conducted on Novex NuPAGE 4-12% Bis-Tris polyacrylamide gels using Novex NuPAGE MES SDS Running Buffer and Mark 12 protein standards.
- the gel was stained with Invitrogen Simply Blue SafeStain and destained against deionized water.
- the Invitrogen prestained protein standards were used for SDS-PAGE of fermentation fluids.
- the concentration of the resulting protein solution was determined using the Pierce-Thermo Fisher Bradford Coomassie Blue colorimetric protein assay, using bovine serum albumin as a standard. The protocol that came with the kit was followed.
- the cell density increased from an OD of 3.0 at TO, the time of induction with 1 mM I PTG, to 3.5 at T3 when the cells were harvested.
- the cells continued to grow after induction, and the wet weight of the centrifuged cell pellet was 4.0 grams.
- SDS-PAGE of samples taken during the shake flask fermentation showed that the Elongation Factor Tu protein was present at induction, and increased over time after induction.
- SDS-PAGE indicated that Elongation Factor Tu was in the insoluble fraction after lysis of the E. coli cells post harvest, and that the purity of the protein increased after washing in the detergent Tergitol 15-S-7 followed by a water wash, in each case followed by centrifugation.
- the major band from SDS-PAGE was in the range of ⁇ 46,000, and there were only minor protein bands in addition to the major band.
- the Elongation Factor Tu was dissolved in 100 mL of 6M urea in Dulbecco's phosphate buffered saline, after which it was subjected to concentration in Centriprep centrifugal concentrators to reduce the volume to 55 mL.
- the apparent total protein concentration from the Bradford reaction was 0.54 mg/mL prior to concentration and 0.95 mg/mL after concentration.
- the total amount of protein in the prep after concentration was ⁇ 52 mg.
- the protein still is in 6M urea in Dulbecco's phosphate buffered saline.
- the sample was sterile filtered into sterile 50 mL tubes and stored at -50°C. Accordingly, We have expressed and isolated the recombinant Streptococcus uberis Elongation Factor Tu protein using an E. coli construct containing a pET15 vector which will put a hexa- histidinyl tag near the N-terminus of the protein. After performing a 500 mL shake flask fermentation, the product protein was expressed as an insoluble inclusion body protein which was isolated by centrifugation followed by washing the inclusion body pellet with a solution containing 4% Tergitol 15-S-7 in water followed by centrifugation. The resulting pellet was washed twice more with water, followed by a final centrifugation.
- the fina l pellet was dissolved in 6M urea in Dulbecco's phosphate buffered saline, followed by concentration in a Centriprep centrifugal concentrator.
- the isolated protein showed a major band on SDS-PAGE corresponding to
- the insoluble inclusion body material also was made 6 M in urea and applied to a nickel chelate affinity chromatography column. The majority of serine protease in this fraction bound to the column and was eluted with 25 mM imidazole.
- the serine protease purified from the insoluble inclusion body fraction was more heterogeneous than the serine protease purified from the soluble fraction. We were able to purify 1.5 mg of serine protease from the initial chromatography of the soluble fraction, and another 59 mg of serine protease from
- the fermentation seed was prepared in 50 mL of o/n culture in Teknova Amp " * ⁇
- the batch fermentation (see Table 18) was conducted in 500 mL of "Terrific Broth" with 25 mL o/n culture in a 2 Liter flask. Growth was conducted at 37°C until TO, when the culture was induced at an O.D. of ⁇ 1.5 with 1 mM IPTG. The culture continued to grow after induction.
- the final centrifuged cell pellet weighed 5.0 grams (wet weight).
- a sample of centrifuged cell paste containing 5.0 grams was dissolved in 200 mL of chilled 50 mM Tris-HCI, 10 mM EDTA, pH 8.0. Initially the sample was homogenized with a tissue homogenizer, a VWR Power Max Advanced Homogenizing System, AHS-250, using a setting of 3. All homogenization was conducted on ice. The setting then was increased to 6, after which the cells were lysed by passage through an Avestin homogenizer. The sample then was centrifuged at 9000 RPM using a Sorvall RC6+ centrifuge at 4°C. The supernatant and the pellet were subjected to SDS-PAGE. When the serine protease was found in both the soluble supernatant and the pellet, both fractions were subjected to nickel chelate affinity chromatography.
- the clarified supernatant was dialyzed against two 4-Liter changes of 500 mM NaCI, 50 mM sodium phosphate, pH 8.7, prior to loading onto a 2.5 X 8.0 cm column of QJAGEN Ni-NTA Superflow nickel chelate affinity chromatographic medium, using a BioRad low pressure open ended chromatography column without a flow adaptor, a three-way stopcock, and plastic tubing.
- the dialyzed supernatant contained a total of 200 mL. The column had been
- equilibration buffer was used to wash the column until a total of 500 mL of column effluent, the spent/wash fraction was collected. After this elution, a total of 200 mL of 25 mM Imidazole in equilibration buffer, pH 8.0, was used to elute the column.
- the insoluble inclusion body fraction after cell lysis was made 4% in Tergitol 15-S-7, after which it subjected to disruption with a tissue homogenizaer, and it was again centrifuged. This pellet from centrifugation was resuspended in purified water, subjected to disruption with a tissue homogenizer, and recentrifuged. The inclusion body pellet was dissolved in 100 mL of a buffer containing 6 M urea in Dulbecco's phosphate buffered saline, pH adjusted to 8.5 with dibasic sodium phosphate.
- the soluble fraction which did not bind to nickel chelate affinity chromatography was made 6M in urea, followed by ultrafiltration and diafiltration. The resulting sample was reapplied to a nickel chelate affinity chromatographic column which was equilibrated and eluted using buffers which were 6M in urea. Urea was included in all elution buffers.
- the first two fractions eluted with 100 mM imidazole also contained the serine protease, but at a lower concentration than the fraction eluting with 25 mM imidazole.
- this pool contained 190 mL. After reduction of the volume of this pool to ⁇ 80 mL by use of centrifugal concentrators, the total protein content of this pool, lot # 1024-RLG-15B, was 0.738 mg/mL. This pool therefore contained a total protein content of 59 mg.
- This unbound material was made 6M in urea and applied to a nickel chelate affinity column in which 6M urea was included in all of the buffers. Under these conditions nearly all of the serine protease bound to the column, and the majority of it eluted with application of 25 mM imidazole to the column, a small amount was eluted with 100 mM imidazole. This material also was of reasonable purity.
- the insoluble inclusion body fraction contained the SUB1868 serine protease, although there was less of this protein in the insoluble fraction as compared to the soluble fraction, and the insoluble protein was not as pure.
- the protein in the insoluble inclusion body fraction was applied to a nickel chelate affinity column utilizing buffers containing 6M urea. The majority of the serine protease bound to the column and was eluted from the column with 25 mM imidazole. This column rich fraction was not as pure as that seen with the soluble protein, there were multiple minor bands on SDS-PAGE indicating proteins larger and smaller than the serine protease.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Immunology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Tropical Medicine & Parasitology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Virology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Molecular Biology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Pathology (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- General Physics & Mathematics (AREA)
- Biochemistry (AREA)
- Food Science & Technology (AREA)
- Gynecology & Obstetrics (AREA)
- Pulmonology (AREA)
- Reproductive Health (AREA)
- Pregnancy & Childbirth (AREA)
- Endocrinology (AREA)
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361879959P | 2013-09-19 | 2013-09-19 | |
| US61/879,959 | 2013-09-19 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2015042449A2 true WO2015042449A2 (en) | 2015-03-26 |
| WO2015042449A3 WO2015042449A3 (en) | 2015-10-08 |
Family
ID=51663499
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/056632 Ceased WO2015042449A2 (en) | 2013-09-19 | 2014-09-19 | Novel streptococcus vaccines |
| PCT/US2014/056591 Ceased WO2015042423A2 (en) | 2013-09-19 | 2014-09-19 | Vaccine |
| PCT/US2014/056512 Ceased WO2015042369A2 (en) | 2013-09-19 | 2014-09-19 | Oil-based adjuvants |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/056591 Ceased WO2015042423A2 (en) | 2013-09-19 | 2014-09-19 | Vaccine |
| PCT/US2014/056512 Ceased WO2015042369A2 (en) | 2013-09-19 | 2014-09-19 | Oil-based adjuvants |
Country Status (16)
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017140683A2 (en) | 2016-02-15 | 2017-08-24 | Hipra Scientific, S.L.U. | Streptococcus uberis extract as an immunogenic agent |
| WO2019090386A1 (en) * | 2017-11-03 | 2019-05-16 | The University Of Sydney | Vaccine compositions |
| US10744192B2 (en) * | 2013-09-19 | 2020-08-18 | Moredun Research Institute | Vaccine |
| US20220047696A1 (en) * | 2020-08-11 | 2022-02-17 | Zoetis Services Llc | Anti-coronavirus vaccines |
Families Citing this family (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SG11201505086QA (en) * | 2012-12-28 | 2015-07-30 | Boehringer Ingelheim Vetmed | Immunogenic composition comprising mycoplasma antigens |
| EP4241853B1 (en) * | 2013-11-26 | 2026-02-11 | Zoetis Services LLC | Compositions for induction of immune response |
| SI3166634T1 (sl) | 2014-07-11 | 2021-11-30 | Zoetis Services Llc | Sestave novih cepiv za virus prašičje epidemične diareje |
| CN115317600A (zh) | 2015-01-16 | 2022-11-11 | 硕腾服务有限责任公司 | 口蹄疫疫苗 |
| AU2016211916B2 (en) * | 2015-01-27 | 2018-10-18 | 3M Innovative Properties Company | Alum-containing coating formulations for microneedle vaccine patches |
| US10456459B2 (en) * | 2015-07-20 | 2019-10-29 | Zoetis Services Llc | Liposomal adjuvant compositions |
| EP3325015B1 (en) * | 2015-07-20 | 2021-05-12 | Zoetis Services LLC | Liposomal adjuvant compositions |
| CN106421775B (zh) * | 2015-08-12 | 2020-12-01 | 普莱柯生物工程股份有限公司 | 一种疫苗用佐剂及含该佐剂的疫苗组合物和其应用 |
| WO2017123201A1 (en) | 2016-01-11 | 2017-07-20 | Zoetis Services Llc | Novel cross protective vaccine compositions for porcine epidemic diarrhea virus |
| US11013798B2 (en) | 2016-03-21 | 2021-05-25 | South Dakota Board Of Regents | Orf virus-based platform for vaccine delivery |
| KR20210068602A (ko) | 2016-06-02 | 2021-06-09 | 조에티스 서비시즈 엘엘씨 | 감염성 기관지염에 대한 백신 |
| EP3558350A1 (en) * | 2016-12-22 | 2019-10-30 | Intervet International B.V. | Eimeria vaccine with improved efficacy |
| KR101996538B1 (ko) * | 2017-02-13 | 2019-07-04 | 단디바이오사이언스 주식회사 | 이미다조퀴놀린계열 물질을 포함하는 나노에멀젼 및 이의 용도 |
| GB201703529D0 (en) | 2017-03-06 | 2017-04-19 | Cambridge Entpr Ltd | Vaccine composition |
| KR20230039766A (ko) * | 2017-12-20 | 2023-03-21 | 조에티스 서비시즈 엘엘씨 | Hendra 및 Nipah 바이러스 감염을 대비한 백신 |
| CN108553479A (zh) * | 2018-04-03 | 2018-09-21 | 南京大学 | 阳离子修饰的琼脂糖和核酸药物组合物及制备方法和应用 |
| CN108853493A (zh) * | 2018-07-26 | 2018-11-23 | 中国人民解放军陆军军医大学 | 麦冬皂苷d及其纳米乳在制备疫苗佐剂中的应用 |
| WO2020023950A1 (en) | 2018-07-27 | 2020-01-30 | Research Development Foundation | Chimeric immunogenic polypeptides |
| CN110967482B (zh) * | 2018-09-30 | 2023-04-07 | 重庆市畜牧科学院 | 一种山羊化脓隐秘杆菌感染检测试剂盒及其检测方法 |
| CN109675028A (zh) * | 2019-03-01 | 2019-04-26 | 龙阔(苏州)生物工程有限公司 | 疫苗佐剂及其制备方法和应用及猪繁殖与呼吸综合征疫苗 |
| KR102285977B1 (ko) | 2019-03-15 | 2021-08-05 | 대한민국 | 오일 에멀젼과 병용 투여 가능한 면역증강용 보조물질 및 이를 포함하는 구제역 백신 조성물 |
| CN114514238A (zh) * | 2019-07-12 | 2022-05-17 | 研究发展基金会 | 埃立克体疫苗和免疫原性组合物 |
| US12514917B2 (en) * | 2019-07-15 | 2026-01-06 | South Dakota Board Of Regents | Senecavirus A virus strains and immunogenic compositions therefrom |
| KR20220041142A (ko) * | 2019-07-30 | 2022-03-31 | 피브로 애니멀 헬스 코포레이션 | 조류에 점막 투여하기 위한 조성물 |
| US10973908B1 (en) | 2020-05-14 | 2021-04-13 | David Gordon Bermudes | Expression of SARS-CoV-2 spike protein receptor binding domain in attenuated salmonella as a vaccine |
| US12537071B1 (en) | 2020-07-22 | 2026-01-27 | David Gordon Bermudes | Bacteria having boolean control pathways expressing therapeutic proteins including immunotherapeutic cytotoxins |
| CN112611864B (zh) * | 2020-12-03 | 2024-03-12 | 重庆市畜牧科学院 | 筛分病菌模型的系统及筛分方法 |
| JP2024500360A (ja) * | 2020-12-11 | 2024-01-09 | エイシーエム バイオラブズ プライベート リミテッド | 関連づけられた抗原および関連づけられたアジュバントを有する2つのポリマーソーム集団を投与することによる、Th1/Th2免疫応答の調整方法 |
| CN114015621B (zh) * | 2021-12-13 | 2022-04-26 | 云南农业大学 | 一种降解α-茄碱的谷氨酸杆菌GH202103菌株及其制备方法和应用 |
| JP2026509384A (ja) * | 2023-03-21 | 2026-03-18 | インディアン カウンシル オブ アグリカルチュラル リサーチ | 口蹄疫の制御のためのワクチン組成物および方法 |
| US12226468B2 (en) | 2023-06-26 | 2025-02-18 | Research Development Foundation | Immunoreactive peptides |
| CN116747312B (zh) * | 2023-07-21 | 2025-08-08 | 辽宁成大生物股份有限公司 | 一种疫苗冻干保护剂、制剂及制备方法 |
| CN119925590A (zh) * | 2025-04-08 | 2025-05-06 | 北京华诺泰生物医药科技有限公司 | 一种mpl复合佐剂及其制备方法和应用 |
Family Cites Families (112)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NZ221306A (en) | 1986-08-15 | 1990-02-26 | Commw Scient Ind Res Org | 2-component immunoadjuvant comprising a mycobacterial free immunoadjuvant oil and a polycationic polyelectrolyte immunoadjuvant and vaccines thereof |
| EP0273512B1 (en) | 1986-12-19 | 1991-02-27 | Duphar International Research B.V | Stabilised adjuvant suspension comprising dimethyl dioctadecyl ammonium bromide |
| US5057540A (en) | 1987-05-29 | 1991-10-15 | Cambridge Biotech Corporation | Saponin adjuvant |
| NZ230747A (en) | 1988-09-30 | 1992-05-26 | Bror Morein | Immunomodulating matrix comprising a complex of at least one lipid and at least one saponin; certain glycosylated triterpenoid saponins derived from quillaja saponaria molina |
| RU1615918C (ru) | 1989-05-22 | 1995-07-09 | Всероссийский научно-исследовательский институт защиты животных | Адъювант |
| GB8921470D0 (en) * | 1989-09-22 | 1989-11-08 | Peptide Technology Ltd | Vaccines |
| ZA936095B (en) | 1992-08-21 | 1994-03-14 | Univ Melbourne | Cytokine applications. |
| US6764682B1 (en) | 1994-06-16 | 2004-07-20 | Aventis Pasteur Limited | Adjuvant compositions containing more than one adjuvant |
| US7935675B1 (en) | 1994-07-15 | 2011-05-03 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| US6207646B1 (en) | 1994-07-15 | 2001-03-27 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| US6846489B1 (en) | 1995-04-25 | 2005-01-25 | Smithkline Beecham Biologicals S.A. | Vaccines containing a saponin and a sterol |
| ZA978434B (en) * | 1996-09-27 | 1998-03-26 | Akzo Nobel Nv | Inactivated vaccines. |
| ATE292980T1 (de) | 1996-10-11 | 2005-04-15 | Univ California | Immunostimulierende oligonucleotidekonjugate |
| US20100267012A1 (en) * | 1997-11-04 | 2010-10-21 | Bergeron Michel G | Highly conserved genes and their use to generate probes and primers for detection of microorganisms |
| EP0855184A1 (en) | 1997-01-23 | 1998-07-29 | Grayson B. Dr. Lipford | Pharmaceutical composition comprising a polynucleotide and an antigen especially for vaccination |
| WO1998037919A1 (en) | 1997-02-28 | 1998-09-03 | University Of Iowa Research Foundation | USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE IN THE TREATMENT OF LPS-ASSOCIATED DISORDERS |
| DK1005368T3 (da) | 1997-03-10 | 2010-01-04 | Ottawa Hospital Res Inst | Anvendelse af nukleinsyrer, der indeholder ikke-metyleret CpG dinukleotid i kombination med alun som hjælpestoffer |
| US6406705B1 (en) | 1997-03-10 | 2002-06-18 | University Of Iowa Research Foundation | Use of nucleic acids containing unmethylated CpG dinucleotide as an adjuvant |
| CA2289253A1 (en) | 1997-04-30 | 1998-11-05 | Merieux Oravax | Anti-helicobacter vaccine composition for use by the subdiaphragmatic systemic route, and combined mucosal/parenteral immunization method |
| AU733310C (en) | 1997-05-14 | 2001-11-29 | University Of British Columbia, The | High efficiency encapsulation of charged therapeutic agents in lipid vesicles |
| EP1003850B1 (en) | 1997-06-06 | 2009-05-27 | The Regents of the University of California | Inhibitors of dna immunostimulatory sequence activity |
| JP2002514397A (ja) | 1998-05-14 | 2002-05-21 | コーリー ファーマシューティカル ゲーエムベーハー | CpGオリゴヌクレオチドを用いる造血調節の方法 |
| SI1077722T1 (sl) | 1998-05-22 | 2007-02-28 | Ottawa Health Research Inst | Metode in produkti za induciranje sluznicne imunosti |
| US20040247662A1 (en) | 1998-06-25 | 2004-12-09 | Dow Steven W. | Systemic immune activation method using nucleic acid-lipid complexes |
| PT1104306E (pt) | 1998-08-10 | 2006-05-31 | Antigenics Inc | Composicoes de cpg e adjuvantes de saponina e seus metodos |
| AUPP807399A0 (en) | 1999-01-08 | 1999-02-04 | Csl Limited | Improved immunogenic lhrh composition and methods relating thereto |
| EP1156781B1 (en) | 1999-02-26 | 2005-06-08 | Chiron Corporation | Microemulsions with adsorbed macromolecules and microparticles |
| AU4188100A (en) | 1999-04-08 | 2000-11-14 | Gregory M. Glenn | Dry formulation for transcutaneous immunization |
| US6977245B2 (en) | 1999-04-12 | 2005-12-20 | The United States Of America As Represented By The Department Of Health And Human Services | Oligodeoxynucleotide and its use to induce an immune response |
| PT1187629E (pt) | 1999-04-19 | 2005-02-28 | Glaxosmithkline Biolog Sa | Composicao adjuvante que compreende saponina e um oligonucleotido imunoestimulador |
| EP1177439B1 (en) | 1999-04-29 | 2004-09-08 | Coley Pharmaceutical GmbH | Screening for immunostimulatory dna functional modifiers |
| AU2001227889A1 (en) | 2000-01-14 | 2001-07-24 | The United States of America, represented by The Secretary, Department of Health & Human Services | Oligodeoxynucleotide and its use to induce an immune response |
| US20010044416A1 (en) | 2000-01-20 | 2001-11-22 | Mccluskie Michael J. | Immunostimulatory nucleic acids for inducing a Th2 immune response |
| AT409085B (de) | 2000-01-28 | 2002-05-27 | Cistem Biotechnologies Gmbh | Pharmazeutische zusammensetzung zur immunmodulation und herstellung von vakzinen |
| JP5025871B2 (ja) | 2000-02-21 | 2012-09-12 | エイチ.リュンドベック エイ/エス | アミロイドの新規なダウン−レギュレート方法 |
| AU5736601A (en) | 2000-05-01 | 2001-11-12 | Hybridon Inc | Modulation of oligonucleotide cpg-mediated immune stimulation by positional modification of nucleosides |
| AT410173B (de) | 2000-06-08 | 2003-02-25 | Cistem Biotechnologies Gmbh | Antigene zusammensetzung |
| AU2002244337B2 (en) * | 2000-10-18 | 2005-08-11 | Glaxosmithkline Biologicals S.A. | Vaccines |
| GB0025577D0 (en) | 2000-10-18 | 2000-12-06 | Smithkline Beecham Biolog | Vaccine |
| CA2881568C (en) * | 2000-10-27 | 2019-09-24 | Novartis Vaccines And Diagnostics, Inc. | Nucleic acids and proteins from streptococcus groups a & b |
| ES2307568T3 (es) | 2000-12-08 | 2008-12-01 | Coley Pharmaceutical Gmbh | Acidos nucleicos de tipo cpg y metodos de uso de los mismos. |
| US7244438B2 (en) | 2001-01-05 | 2007-07-17 | Intercell Ag | Uses for polycationic compounds |
| US7713942B2 (en) | 2001-04-04 | 2010-05-11 | Nordic Vaccine Technology A/S | Cage-like microparticle complexes comprising sterols and saponins for delivery of polynucleotides |
| CA2439111A1 (en) | 2001-04-05 | 2002-10-17 | Chiron Corporation | Mucosal boosting following parenteral priming |
| US7105495B2 (en) | 2001-04-30 | 2006-09-12 | Idera Pharmaceuticals, Inc. | Modulation of oligonucleotide CpG-mediated immune stimulation by positional modification of nucleosides |
| WO2002094845A2 (en) | 2001-05-21 | 2002-11-28 | Intercell Ag | Method for stabilising of nucleic acids |
| EP1395262A4 (en) | 2001-06-15 | 2006-04-12 | Ribapharm Corp | NUCLEOSIDE-VACCINE-ADJUVANTS |
| WO2003003941A2 (en) | 2001-07-02 | 2003-01-16 | Pfizer Products Inc. | One dose vaccination with mycoplasma hyopneumoniae |
| WO2003004051A2 (en) | 2001-07-02 | 2003-01-16 | Pfizer Products Inc. | Mycoplasma hyopneumoniae vaccine and methods for reducing mycoplasma bovis pneumonia in cattle |
| US7666674B2 (en) | 2001-07-27 | 2010-02-23 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Use of sterically stabilized cationic liposomes to efficiently deliver CPG oligonucleotides in vivo |
| CA2456193A1 (en) | 2001-08-03 | 2003-03-27 | Medarex, Inc. | Compositions comprising immunostimulatory oligonucleotides and uses thereof to enhance fc receptor-mediated immunotherapies |
| US20030133988A1 (en) | 2001-08-07 | 2003-07-17 | Fearon Karen L. | Immunomodulatory compositions, formulations, and methods for use thereof |
| US20030138434A1 (en) | 2001-08-13 | 2003-07-24 | Campbell Robert L. | Agents for enhancing the immune response |
| ATE411054T1 (de) | 2001-08-17 | 2008-10-15 | Coley Pharm Gmbh | Kombinations-motif-immunstimulierende oligonukleotide mit verbesserter wirkung |
| IL159145A0 (en) | 2001-08-28 | 2004-06-01 | Pfizer Prod Inc | Mycoplasma bovis challenge model, methods for administering m. bovis and methods for inducing pneumonic lung lesions |
| DE60234375D1 (de) | 2001-09-14 | 2009-12-24 | Cytos Biotechnology Ag | VERPACKUNG VON IMMUNSTIMULIERENDEM CpG IN VIRUSÄHNLICHEN PARTIKELN: HERSTELLUNGSVERFAHREN UND VERWENDUNG |
| US20030119774A1 (en) | 2001-09-25 | 2003-06-26 | Marianna Foldvari | Compositions and methods for stimulating an immune response |
| GB0123580D0 (en) | 2001-10-01 | 2001-11-21 | Glaxosmithkline Biolog Sa | Vaccine |
| US20050238660A1 (en) | 2001-10-06 | 2005-10-27 | Babiuk Lorne A | Cpg formulations and related methods |
| US7276489B2 (en) | 2002-10-24 | 2007-10-02 | Idera Pharmaceuticals, Inc. | Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5′ ends |
| EP1441763A2 (en) | 2001-11-07 | 2004-08-04 | Inex Pharmaceuticals Corp. | Mucosal adjuvants comprising an oligonucleotide and a cationic lipid |
| AU2002358616A1 (en) | 2001-12-07 | 2003-06-17 | Intercell Ag | Immunostimulatory oligodeoxynucleotides |
| WO2003066649A1 (en) | 2002-02-04 | 2003-08-14 | Biomira Inc. | Immunostimulatory, covalently lipidated oligonucleotides |
| US8088388B2 (en) * | 2002-02-14 | 2012-01-03 | United Biomedical, Inc. | Stabilized synthetic immunogen delivery system |
| EP1476456A4 (en) | 2002-02-19 | 2007-06-20 | Syntherica Corp | COMPOSITIONS AND METHOD FOR SUBROGEN-ANTIBODY MODULATION OF AN IMMUNE RESPONSE AND TRANSPORT |
| EP3006043B1 (en) | 2002-04-04 | 2019-05-29 | Zoetis Belgium S.A. | Immunostimulatory g,u-containing oligoribonucleotides |
| WO2003089590A2 (en) | 2002-04-16 | 2003-10-30 | Vaxin, Inc. | TRANSIENT AND/OR PERMANENT MODIFICATION OF SEXUAL BEHAVIOR AND/OR FERTILITY USING RECOMBINANT CHIMERIC GnRH |
| KR101092043B1 (ko) | 2002-04-22 | 2011-12-12 | 바이오니취 라이프 사이언시즈 인코포레이티드 | 올리고뉴클레오티드 조성물 및 면역 반응 조절시 이의 용도 |
| KR100456681B1 (ko) | 2002-05-22 | 2004-11-10 | 주식회사 대웅 | 박테리아의 염색체 dna 파쇄물과 비독성리포폴리사카라이드를 포함하는 면역강화 및 조절 조성물 |
| CA2487452A1 (en) | 2002-05-28 | 2003-12-04 | Robinson Ramirez-Pineda | A method for generating antigen-presenting cells |
| CA2388049A1 (en) | 2002-05-30 | 2003-11-30 | Immunotech S.A. | Immunostimulatory oligonucleotides and uses thereof |
| US20040009949A1 (en) | 2002-06-05 | 2004-01-15 | Coley Pharmaceutical Group, Inc. | Method for treating autoimmune or inflammatory diseases with combinations of inhibitory oligonucleotides and small molecule antagonists of immunostimulatory CpG nucleic acids |
| SE0201701D0 (sv) | 2002-06-05 | 2002-06-05 | Gotovax Ab | Treatment of epithelial tumors and infections |
| EP1575504A4 (en) | 2002-08-01 | 2009-11-04 | Us Gov Health & Human Serv | METHOD FOR THE TREATMENT OF INFLAMMATORY ARTHROPATHIES WITH SUPPRESSORS OF THE CPG OLIGONUCLEOTIDES |
| TWI314134B (en) | 2002-11-05 | 2009-09-01 | James Hardie Int Finance Bv | Calcium silicate hydrate and the method for producing the same |
| MXPA05008051A (es) | 2003-01-29 | 2005-09-21 | Pfizer Prod Inc | Vacunas caninas contra bordetella bronchiseptica. |
| TWI350174B (en) * | 2003-03-12 | 2011-10-11 | Wyeth Corp | Adjuvanted bovine vaccines |
| AU2004224761A1 (en) | 2003-03-26 | 2004-10-07 | Cytos Biotechnology Ag | HIV-peptide-carrier-conjugates |
| AU2004226591B2 (en) | 2003-04-04 | 2009-06-04 | Zoetis Services Llc | Microfluidized oil-in-water emulsions and vaccine compositions |
| SE0301998D0 (sv) | 2003-07-07 | 2003-07-07 | Isconova Ab | Quil A fraction with low toxicity and use thereof |
| KR20110132416A (ko) | 2004-04-05 | 2011-12-07 | 화이자 프로덕츠 인코포레이티드 | 미세유체화된 수중유 유화액 및 백신 조성물 |
| US7749520B2 (en) | 2004-07-07 | 2010-07-06 | Statens Serum Institut | Compositions and methods for stabilizing lipid based adjuvant formulations using glycolipids |
| JP4987704B2 (ja) * | 2004-07-07 | 2012-07-25 | スタテンス セールム インスティトゥート | 糖脂質を用いた、脂質系アジュバント製剤を安定化する組成物及び方法 |
| WO2006106424A2 (en) | 2005-04-07 | 2006-10-12 | Pharmacia & Upjohn Company Llc | Formulations and process for production of bordetella bronchiseptica p68 antigen and vaccines |
| CA2634888C (en) | 2006-01-26 | 2016-06-21 | Pfizer Products Inc. | Novel glycolipid adjuvant compositions |
| WO2007125940A1 (ja) * | 2006-04-25 | 2007-11-08 | Kyowa Hakko Kogyo Co., Ltd. | ネコノミ成虫由来ポリペプチド |
| PT2078080E (pt) * | 2006-09-27 | 2015-09-18 | Coley Pharm Gmbh | Análogos dos oligonucleotídeos cpg que contêm análogos t hidrofóbicos com atividade imunoestimulante potenciada |
| US20080292663A1 (en) | 2007-05-22 | 2008-11-27 | Gerber Jay D | Adjuvant compositions and methods for delivering vaccines |
| CL2008001806A1 (es) * | 2007-06-20 | 2008-09-05 | Wyeth Corp | Composicion de vacuna en emulsion agua en aceite que comprende un antigeno y un adyuvante en la fase acuosa; y metodo de elaboracion. |
| EP2023143A1 (en) * | 2007-08-06 | 2009-02-11 | Boehringer Ingelheim Vetmedica Gmbh | Immunogenic streptococcus proteins |
| US8703153B2 (en) * | 2008-06-16 | 2014-04-22 | Prokarium Ltd. | Salmonella vectored vaccines against Chlamydia and methods of use |
| ES2569907T3 (es) * | 2008-06-27 | 2016-05-13 | Zoetis Services Llc | Composiciones adyuvantes novedosas |
| GB0818231D0 (en) * | 2008-10-06 | 2008-11-12 | Univ Nottingham | Composition |
| CN101721698B (zh) | 2008-10-24 | 2014-04-02 | 法罗斯疫苗公司 | 抗口蹄疫疫苗组合物及其制备和应用 |
| CA2753567C (en) | 2009-02-27 | 2019-12-31 | Toray Industries, Inc. | Immunogenic antigen-adjuvant microparticle complex |
| JP2013525271A (ja) * | 2010-03-12 | 2013-06-20 | チルドレンズ メディカル センター コーポレーション | 免疫原およびそのスクリーニング方法 |
| EP2575878B1 (en) * | 2010-05-28 | 2018-06-13 | Zoetis Belgium S.A. | Vaccines comprising cholesterol and cpg as sole adjuvant-carrier molecules |
| US8765141B2 (en) * | 2010-07-01 | 2014-07-01 | The United States Of America, As Represented By The Secretary Of Agriculture | Development of a marker foot and mouth disease virus vaccine candidate that is attenuated in the natural host |
| CN101954080B (zh) | 2010-09-21 | 2013-11-06 | 中国农业科学院兰州兽医研究所 | 一种猪口蹄疫苗用的复合分子型佐剂及其制造方法 |
| PL2670432T3 (pl) | 2011-02-04 | 2021-10-11 | Zoetis Services Llc | Kompozycje immunogenne Bordetella bronchiseptica |
| EP2707025B8 (en) * | 2011-05-13 | 2017-08-23 | Zoetis Services LLC | Hendra and nipah virus g glycoprotein immunogenic compositions |
| US20130309273A1 (en) | 2012-05-17 | 2013-11-21 | Kimberly Hassett | Thermostable Vaccine Compositions and Methods of Preparing Same |
| GB201111183D0 (en) | 2011-06-30 | 2011-08-17 | Animal Health Inst | Peptide |
| MX382968B (es) * | 2012-11-16 | 2025-03-12 | United Biomedical Inc | Vacuna de emergencia basada en péptidos sintéticos contra la fiebre aftosa. |
| CN103083663B (zh) | 2013-02-04 | 2014-12-10 | 江苏省农业科学院 | 一种免疫增强剂、灭活疫苗及其制备方法 |
| BR112015021755A2 (pt) * | 2013-03-07 | 2017-07-18 | Kane Biotech Inc | composições antimicrobianas e antibiofilmes e métodos de aplicação das mesmas |
| US10357470B2 (en) * | 2013-03-07 | 2019-07-23 | Kane Biotech Inc. | Antimicrobial-antibiofilm compositions and methods of use thereof |
| CN105209067A (zh) | 2013-03-26 | 2015-12-30 | 皮尔布赖特研究所 | 稳定的fmdv衣壳 |
| HK1224177A1 (zh) * | 2013-09-05 | 2017-08-18 | 硕腾服务有限责任公司 | Hendra和nipah病毒g糖蛋白免疫原性組合物 |
| UA130246C2 (uk) * | 2013-09-19 | 2025-12-31 | Зоетіс Сервісіз Ллс | Ад'ювант на основі олії |
| CN104013955B (zh) * | 2014-06-18 | 2016-02-24 | 中国科学院过程工程研究所 | 一种不含表面活性剂的水包油乳液及其用途 |
| RU2593718C1 (ru) | 2015-03-16 | 2016-08-10 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Вакцина инактивированная эмульсионная против ящура типов а, о, азия-1 |
-
2014
- 2014-09-19 UA UAA201811195A patent/UA130246C2/uk unknown
- 2014-09-19 CA CA2924526A patent/CA2924526A1/en active Pending
- 2014-09-19 WO PCT/US2014/056632 patent/WO2015042449A2/en not_active Ceased
- 2014-09-19 WO PCT/US2014/056591 patent/WO2015042423A2/en not_active Ceased
- 2014-09-19 KR KR1020167010038A patent/KR101943171B1/ko active Active
- 2014-09-19 EP EP14781775.3A patent/EP3049105B1/en not_active Not-in-force
- 2014-09-19 NZ NZ757210A patent/NZ757210A/en active IP Right Revival
- 2014-09-19 BR BR112016005948A patent/BR112016005948A2/pt not_active Application Discontinuation
- 2014-09-19 MX MX2016003658A patent/MX386918B/es unknown
- 2014-09-19 AU AU2014321369A patent/AU2014321369B2/en active Active
- 2014-09-19 UA UAA201602745A patent/UA121200C2/uk unknown
- 2014-09-19 WO PCT/US2014/056512 patent/WO2015042369A2/en not_active Ceased
- 2014-09-19 NZ NZ733383A patent/NZ733383A/en active IP Right Revival
- 2014-09-19 KR KR1020207009952A patent/KR20200039025A/ko not_active Ceased
- 2014-09-19 CN CN201910169631.9A patent/CN109675026A/zh active Pending
- 2014-09-19 CN CN201480057805.8A patent/CN105764525A/zh active Pending
- 2014-09-19 EP EP14781771.2A patent/EP3046580A2/en active Pending
- 2014-09-19 RU RU2016109925A patent/RU2730011C2/ru active
- 2014-09-19 KR KR1020197001890A patent/KR20190009840A/ko not_active Ceased
- 2014-09-19 CA CA3060664A patent/CA3060664A1/en active Pending
- 2014-09-19 KR KR1020187005478A patent/KR102257743B1/ko active Active
- 2014-09-19 NZ NZ717594A patent/NZ717594A/en unknown
- 2014-09-19 CN CN201910169638.0A patent/CN109675029A/zh active Pending
- 2014-09-19 CN CN201910169636.1A patent/CN109675025A/zh active Pending
- 2014-09-19 JP JP2016515364A patent/JP6586083B2/ja active Active
- 2014-09-19 US US14/491,414 patent/US10117921B2/en active Active
- 2014-09-19 CA CA3174897A patent/CA3174897C/en active Active
- 2014-09-19 CA CA3005608A patent/CA3005608C/en active Active
-
2016
- 2016-03-09 PH PH12016500456A patent/PH12016500456A1/en unknown
- 2016-03-16 ZA ZA2016/01840A patent/ZA201601840B/en unknown
- 2016-03-18 CL CL2016000650A patent/CL2016000650A1/es unknown
- 2016-03-18 MX MX2021012346A patent/MX2021012346A/es unknown
- 2016-03-18 US US15/074,689 patent/US10744192B2/en active Active
- 2016-03-18 MX MX2021005619A patent/MX2021005619A/es unknown
-
2018
- 2018-02-05 CL CL2018000320A patent/CL2018000320A1/es unknown
- 2018-02-05 CL CL2018000319A patent/CL2018000319A1/es unknown
- 2018-09-07 JP JP2018167649A patent/JP2018203770A/ja active Pending
- 2018-10-22 US US16/166,455 patent/US10953080B2/en active Active
-
2019
- 2019-05-17 JP JP2019093377A patent/JP6667704B2/ja active Active
- 2019-05-29 ZA ZA2019/03400A patent/ZA201903400B/en unknown
- 2019-05-29 ZA ZA2019/03401A patent/ZA201903401B/en unknown
- 2019-09-06 JP JP2019162865A patent/JP7181847B2/ja active Active
-
2020
- 2020-03-26 AU AU2020202147A patent/AU2020202147B2/en active Active
- 2020-12-28 JP JP2020218214A patent/JP7189410B2/ja active Active
-
2021
- 2021-02-16 US US17/176,749 patent/US11701415B2/en active Active
- 2021-09-29 JP JP2021159615A patent/JP7751438B2/ja active Active
-
2022
- 2022-06-01 JP JP2022089518A patent/JP7675048B2/ja active Active
- 2022-11-08 AU AU2022268311A patent/AU2022268311B2/en active Active
- 2022-11-21 AU AU2022275399A patent/AU2022275399B2/en active Active
-
2023
- 2023-05-16 US US18/318,093 patent/US12121576B2/en active Active
-
2024
- 2024-09-24 US US18/894,405 patent/US20250108103A1/en active Pending
-
2025
- 2025-04-17 AU AU2025202708A patent/AU2025202708A1/en active Pending
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10744192B2 (en) * | 2013-09-19 | 2020-08-18 | Moredun Research Institute | Vaccine |
| WO2017140683A2 (en) | 2016-02-15 | 2017-08-24 | Hipra Scientific, S.L.U. | Streptococcus uberis extract as an immunogenic agent |
| US10946085B2 (en) | 2016-02-15 | 2021-03-16 | Hipra Scientific, S.L.U. | Streptococcus uberis extract as an immunogenic agent |
| WO2019090386A1 (en) * | 2017-11-03 | 2019-05-16 | The University Of Sydney | Vaccine compositions |
| US20220047696A1 (en) * | 2020-08-11 | 2022-02-17 | Zoetis Services Llc | Anti-coronavirus vaccines |
| US12285479B2 (en) * | 2020-08-11 | 2025-04-29 | Zoetis Services Llc | Anti-coronavirus vaccines |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2015042449A2 (en) | Novel streptococcus vaccines | |
| JP2006522090A (ja) | マイクロ流動化された水中油形エマルジョン及びワクチン組成物 | |
| EP3325015B1 (en) | Liposomal adjuvant compositions | |
| CA2932878C (en) | Compositions for induction of immune response | |
| WO2018162428A1 (en) | Pentavalent streptococcus suis vaccine composition | |
| WO2022072431A1 (en) | Novel pasteurella multocida strains and vaccines having hyac and nanp deletions | |
| RU2816849C2 (ru) | Адъюванты на масляной основе | |
| WO2022072232A1 (en) | Novel pasteurella multocida strains and vaccines having hyac and nanp deletions | |
| CA3276160A1 (en) | Water-in-oil emulsions comprising immunostimulatory oligonucleotides | |
| HK1250338B (en) | Liposomal adjuvant compositions |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14782007 Country of ref document: EP Kind code of ref document: A2 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WA | Withdrawal of international application |