WO2014206563A2 - New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases - Google Patents
New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases Download PDFInfo
- Publication number
- WO2014206563A2 WO2014206563A2 PCT/EP2014/001736 EP2014001736W WO2014206563A2 WO 2014206563 A2 WO2014206563 A2 WO 2014206563A2 EP 2014001736 W EP2014001736 W EP 2014001736W WO 2014206563 A2 WO2014206563 A2 WO 2014206563A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- jnk
- disease
- sequence
- syndrome
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/55—Protease inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/02—Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/02—Drugs for disorders of the urinary system of urine or of the urinary tract, e.g. urine acidifiers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/10—Drugs for disorders of the urinary system of the bladder
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/04—Antipruritics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/14—Drugs for dermatological disorders for baldness or alopecia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/02—Muscle relaxants, e.g. for tetanus or cramps
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/04—Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/02—Drugs for disorders of the nervous system for peripheral neuropathies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/08—Antiepileptics; Anticonvulsants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/18—Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/26—Psychostimulants, e.g. nicotine, cocaine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/06—Antiglaucoma agents or miotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/12—Ophthalmic agents for cataracts
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/16—Otologicals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P41/00—Drugs used in surgical methods, e.g. surgery adjuvants for preventing adhesion or for vitreum substitution
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/38—Drugs for disorders of the endocrine system of the suprarenal hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4703—Inhibitors; Suppressors
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention refers to the use of protein kinase inhibitors and more specifically to the use of inhibitors of the protein kinase c-Jun amino terminal kinase, JNK inhibitor sequences, chimeric peptides, or of nucleic acids encoding same as well as pharmaceutical compositions containing same, for the treatment of various novel diseases or disorders strongly related to JNK signaling.
- the c-Jun amino terminal kinase (JNK) is a member of the stress-activated group of mitogen- activated protein (MAP) kinases. These kinases have been implicated in the control of cell growth and differentiation, and, more generally, in the response of cells to environmental stimuli.
- JNK signal transduction pathway is activated in response to environmental stress and by the engagement of several classes of cell surface receptors. These receptors can include cytokine receptors, serpentine receptors and receptor tyrosine kinases.
- JNK has been implicated in biological processes such as oncogenic transformation and mediating adaptive responses to environmental stress.
- JNK has also been associated with modulating immune responses, including maturation and differentiation of immune cells, as well as effecting programmed cell death in cells identified for destruction by the immune system. This unique property makes JNK signaling a promising target for developing pharmacological intervention.
- JNK signaling is particularly implicated in ischemic stroke and Parkinson's disease, but also in other diseases as mentioned further below.
- mitogen-activated protein kinase (MAPK) p38alpha was shown to negatively regulate the cell proliferation by antagonizing the JNK- cjun-pathway.
- the mitogen-activated protein kinase (MAPK) p38alpha therefore appears to be active in suppression of normal and cancer cell proliferation and, as a further, demonstrates the involvement of JNK in cancer diseases (see e.g. Hui eta/., Nature Genetics, Vol 39, No. 6, June 2007).
- JNK c-Jun N-terminal Kinase
- JNK signaling pathway Inhibition or interruption of JNK signaling pathway, particularly the provision of inhibitors of the JNK signaling pathway, thus appears to be a promising approach in combating disorders strongly related to JNK signaling. However, there are only a few inhibitors of the JNK signaling pathway known so far.
- Inhibitors of the JNK signaling pathway as already known in the prior art, particularly include e.g. upstream kinase inhibitors (for example, CEP-1 347), small chemical inhibitors of JNK (SP600125 and AS601245), which directly affect kinase activity e.g. by competing with the ATP-binding site of the protein kinase, and peptide inhibitors of the interaction between JNK and its substrates (D-JNKI and l-JIP) (see e.g. Kuan et al., Current Drug Targets - CNS & Neurological Disorders, February 2005, vol. 4, no. 1 , pp. 63-67(5)).
- upstream kinase inhibitors for example, CEP-1 347
- small chemical inhibitors of JNK SP600125 and AS601245
- D-JNKI and l-JIP peptide inhibitors of the interaction between JNK and its substrates
- the upstream kinase inhibitor CEP-1347 (KT751 5) is a semisynthetic inhibitor of the mixed lineage kinase family.
- CEP-1 347 (KT7515) promotes neuronal survival at dosages that inhibit activation of the c-Jun amino-terminal kinases (JNKs) in primary embryonic cultures and differentiated PC12 cells after trophic withdrawal and in mice treated with 1 -methyl-4-phenyl tetrahydropyridine.
- JNKs c-Jun amino-terminal kinases
- CEP-1347 (KT751 5) can promote long term-survival of cultured chick embryonic dorsal root ganglion, sympathetic, ciliary and motor neurons (see e.g. Borasio et al., Neuroreport. 9(7): 1435-1439, May 1 1 " 1 1 998.).
- JNK inhibitor SP600125 was found to reduce the levels of c-Jun phosphorylation, to protect dopaminergic neurons from apoptosis, and to partly restore the level of dopamine in MPTP-induced PD in C57BL/6N mice (Wang et al., Neurosci Res. 2004 Feb; 48(2); 195-202). These results furthermore indicate that JNK pathway is the major mediator of the neurotoxic effects of MPTP in vivo and inhibiting JNK activity may represent a new and effective strategy to treat PD.
- AS601245 inhibits the JNK signalling pathway and promotes cell survival after cerebral ischemia.
- AS601245 provided significant protection against the delayed loss of hippocampal CA1 neurons in a gerbil model of transient global ischemia. This effect is mediated by JNK inhibition and therefore by c-Jun expression and phosphorylation (see e.g. Carboni et al., J Pharmacol Exp Ther. 2004 Jul; 310(1 ):25-32. Epub 2004 Feb 26 th ).
- a third class of inhibitors of the JNK signaling pathway represent peptide inhibitors of the interaction between JNK and its substrates, as mentioned above.
- a sequence alignment of naturally occurring JNK proteins may be used.
- these proteins comprise JNK binding domains QBDs) and occur in various insulin binding (IB) proteins, such as IB1 or IB2.
- IB insulin binding
- the results of such an exemplary sequence alignment is e.g. a sequence alignment between the JNK binding domains of IB1 [SEQ ID NO: 1 3], IB2 [SEQ ID NO: 14], c-Jun [SEQ ID NO: 1 5] and ATF2 [SEQ ID NO: 1 6] (see e.g. FIGS. 1 A-1 C).
- Such an alignment reveals a partially conserved 8 amino acid sequence (see e.g. Figure 1 A).
- a comparison of the JBDs of IB1 and IB2 further reveals two blocks of seven and three amino acids that are highly conserved between the two sequences.
- WO 2007/031280 and WO 01 /27268 disclose small cell permeable fusion peptides, comprising a so-called TAT cell permeation sequence derived from the basic trafficking sequence of the HIV-TAT protein and a minimum 20 amino acid inhibitory sequence of IB1 . Both components are covalently linked to each other.
- Exemplary (and at present the only) inhibitors of the MAPK-JNK signaling pathway disclosed in both WO 2007/031280 and WO 01/27268 are e.g.
- L-JNKI1 JNK-inhibitor peptide composed of L amino acids
- D-JNKI1 the protease resistant D-JNKI1 peptides
- JNK-inhibitor peptide composed of non-native D amino acids These JNK-inhibitor (JNKI) peptides are specific for JNK (JNK1 , JNK2 and JNK3).
- the inhibitor sequences in WO 2007/031280 or WO 01 /27268 e.g. JNKI1 , rather inhibit the interaction between JNK and its substrate.
- the fusion peptide By its trafficking sequence derived from TAT, the fusion peptide is efficiently transported into cells. Due to the novel properties obtained by the trafficking component the fusion peptides are actively transported into cells, where they remain effective until proteolytic degradation.
- peptides according to WO 2007/031280 or WO 01/27268 have only shown to be active in a particularly limited number of diseases, particularly non-malignant or immunological-related cell proliferative diseases.
- One object of the present invention is thus, to identify further diseases, which can be combated with JNK inhibitor peptides.
- Another object of the present invention is to provide (the use of) new JNK inhibitor peptides and derivatives thereof for the treatment of those diseases and of diseases not yet or already known to be strongly related to JNK signaling.
- JNK inhibitor sequence preferably as defined herein, typically comprising less than 1 50 amino acids in length for the preparation of a pharmaceutical composition for treating various inflammatory or non-inflammatory diseases strongly related to JNK signaling in a subject, wherein the diseases or disorders are selected from the following groups:
- encephalomyelitis in particular acute disseminated encephalomyel itis, spondylitis, in particularanky losing spondylitis, antisynthetase syndrome, dermatitis, in particular atopic dermatitis or contact dermatitis, hepatitis, i n particular autoimmune hepatitis, autoimmune peripheral neuropathy, pancreatitis, in particular autoimmune pancreatitis, Beh et's disease, Bickerstaff's, encephalitis, Blau syndrome, Coeliac disease, Chagas disease, polyneuropathy, in particular chronic inflammatory demyeli nating polyneuropathy, osteomyelitis, in particular chronic recurrent multifocal osteomyelitis, Churg- Strauss syndrome, Cogan syndrome, giant-cell arteritis, CREST syndrome, vasculitis, in particular cutaneous small-vessel vasculitis and urticarial vasculitis, dermatitis herpet
- eye inflammatory diseases in particular selected from uveitis, scleritis, corneal surgery, conjunctivitis, non-infectious keratitis, ulceris, chorioretinal inflammation, inflammatory diseases damaging the retina of the eye (retinopathy), in particular diabetic retinopathy, arterial hypertension induced hypertensive retinopathy, radiation induced retinopathy, sun-induced solar retinopathy, trauma-induced retinopathy, e.g. Purtscher's retinopathy, retinopathy of prematurity (ROP) and hyperviscosity-related retinopathy,
- retinopathy in particular diabetic retinopathy, arterial hypertension induced hypertensive retinopathy, radiation induced retinopathy, sun-induced solar retinopathy, trauma-induced retinopathy, e.g. Purtscher's retinopathy, retinopathy of prematurity (ROP) and hyperviscosity-related retinopathy
- Autoimmune polyendocrine syndrome Autoimmune progesterone dermatitis, Idiopathic thrombocytopenic purpura, Autoimmune urticaria, Balo concentric sclerosis, Bullous pemphigoid, Castleman's disease, Cicatricial pemphigoid, Cold agglutinin disease, Complement component 2 deficiency associated disease, Cushing's syndrome, Dagos disease, Adiposis dolorosa, Eosinophilic pneumonia, Epidermolysis bullosa acquisita,
- Hemolytic disease of the newborn Cryoglobulinemia, Evans syndrome, Fibrodysplasia ossificans progressive, Gastrointestinal pemphigoid, Goodpasture's syndrome, Hashimoto's encephalopathy, Gestational pemphigoid, Hughes-stovin syndrome, Hypogammaglobulinemia, Lambert-eaton myasthenic syndrome, Lichen sclerosus, Morphea, Pityriasis lichenoides et varioliformis acuta, Myasthenia gravis, Narcolepsy,
- Neuromyotonia Opsoclonus myoclonus syndrome, Paraneoplastic cerebellar degeneration, Paroxysmal nocturnal hemoglobinuria, Parry-romberg syndrome, Pernicious anemia, POEMS syndrome, Pyoderma gangrenosum, Pure red cell aplasia, Raynaud's phenomenon, Restless legs syndrome, Retroperitoneal fibrosis, Autoimmune polyendocrine syndrome type 2, Stiff person syndrome, Susac's syndrome, Febrile neutrophilic dermatosis, Sydenham's chorea, Thrombocytopenia, and vitiligo, (d) arthritis, in particular juvenile idiopathic arthritis, psoriastic arthritis and rheumatoid arthritis, and arthrosis, and osteoarthritis,
- inflammatory diseases of the mouth or the jaw bone in particular pulpitis, periimplantitis, periodontitis, gingivitis, stomatitis, mucositis, desquamative disorders, temporomandibular joint disorder,
- age-related macular degeneration in particular the wet or the dry form of age-related macular degeneration, and cataract
- fibrotic diseases and/or disorders particularly selected from lung, heart, liver, bone marrow, mediastinum, retroperitoneum, skin, intestine, joint, and shoulder fibrosis,
- the disease is a hereditary or non-heriditary metabolic disease, in particular selected from the group of metabolic disorders of the carbohydrate metabolism, e.g., glycogen storage disease, disorders of amino acid metabolism, e.g., phenylketonuria, maple syrup urine disease, glutaric acidemia type 1 , urea Cycle Disorder or urea Cycle Defects, e.g., carbamoyl phosphate synthetase I deficiency, disorders of organic acid metabolism (organic acidurias), e.g., alcaptonuria, disorders of fatty acid oxidation and mitochondrial metabolism, e.g., medium-chain acyl-coenzyme A dehydrogenase deficiency (often shortened to MCADD.), disorders of porphyrin metabolism, e.g.
- metabolic disorders of the carbohydrate metabolism e.g., glycogen storage disease, disorders of amino acid metabolism, e.g., phenylketonuria, maple syrup
- disorders of purine or pyrimidine metabolism e.g., Lesch-Nyhan syndrome
- disorders of steroid metabolism e.g., lipoid congenital adrenal hyperplasia, or congenital adrenal hyperplasia
- disorders of mitochondrial function e.g., Kearns-Sayre syndrome
- disorders of peroxisomal function e.g., Zellweger syndrome
- lysosomal storage disorders e.g., Gaucher's disease or Niemann Pick disease.
- the disorder/disease to be treated is AMD, the wet or the dry form, and cataract.
- the disorder/disease to be treated is retinopathy, in particular diabetic retinopathy.
- the disorder/disease to be treated is psoriasis.
- the disorder/disease to be treated is a graft rejection or transplant rejection reaction, in particular a liver, lung, kidney, pancreas, skin or heart transplant graft rejection, e.g. graft versus host or host versus graft.
- the disorder/disease to be treated is glomerulonephritis.
- the JNK inhibitors of the present invention may be used for example for the treatment of inflammatory diseases including for example acute inflammation as wel l as chronic inflammation.
- the JNK inhibitors of the present invention may be used to treat any type of tissue inflammation, e.g. inflammation in the eye, inflammation in the mouth, inflammation of the respiratory system including in particular the lung, inflammation of the skin, inflammation within the cardiovascular system, inflammation of the brain, inflammation in the ear, etc.
- Some non-limiting examples for such inflammatory disease states are mucositis, stomatitis, peri-implantitis, retinitis, chorioiditis, keratoconjunctivitis sicca, i nflammatory bowel diseases (IBD), uveitis (e.g.
- the JNK inhibitors as disclosed herein may for example be used in methods of treatment of ear diseases (in particular diseases of the inner ear), hearing loss (in particular acute hearing loss), damaged hair cell stereocilia, hair cell apoptosis, noise trauma, otitis, otitis media etc.
- Hearing loss and associated hair cell apoptosis are non-limiting examples for disorders resulting from stress situations for cel ls in which JNK inhibition can modulate the stress response and for example block apoptosis.
- the JNK inhibitors of the present invention may also be used for the treatment of metabolic disorders, for example for the treatment of diabetes (type 1 or type 2, in particular type 1 ), Fabry disease, Gaucher disease, hypothermia, hyperthermia hypoxia, lipid histiocytosis, lipidoses, metachromatic leukodystrophy, mucopolysaccharidosis, Niemann Pick disease, obesity, and Wolman's disease.
- Diabetes type 1 or type 2, in particular type 1
- hypothermia hyperthermia hypoxia
- lipid histiocytosis lipid histiocytosis
- lipidoses metachromatic leukodystrophy
- mucopolysaccharidosis Niemann Pick disease
- obesity obesity
- Wolman's disease Hypothermia, hyperthermia and hypoxia are again non- limiting examples for stress situations for cells in which JNK inhibition can modulate the stress response and for example block apoptosis.
- the JNK inhibitors of the present invention may
- Such diseases are for example Alexander disease, Alzheimer's disease, amyotrophic lateral sclerosis (ALS), apoplexy, Ataxia Telangiectasia, cut or otherwise disrupted axons, axotomy, brain lesions, CMT (Charcot-Marie-Tooth), corticobasal degeneration, dementia, diseases or disorders of the nervous system, dystonia, epilepsy, Farber's disease, Friedreich ataxia (SCA), gangliosidoses, Guillain-Barre syndrome, hereditary spastic paraplegia, Hirschsprung's disease, human immunodeficiency virus dementia, Huntington's disease, infarct of the brain, ischemic stroke, Krabbe disease, Lennox Gastaut Syndrome, lissencephaly, multiple sclerosis, myelodysplastic syndromes, myelopathy, AIDS-related neurodegenerative diseases, neurofibromatosis type 2 (NF-2), neurolatyerism, neuronal apopto
- the JNK inhibitor peptides of the present invention may for example be used in a method of treatment of autoimmune diseases of the CNS, auto- inflammatory diseases, Celiac disease; Sjogren's syndrome, systemic lupus erythematosus etc.
- bone diseases which may be treated with the JNK inhibitors of the present invention are for example arthritis, disc herniation, fibrodysplasia ossificans progressiva (FOP), osteoarthritis, osteopetrosis, osteoporosis, in particular diabetes induced osteoporosis, Paget's Disease, rheumatoid arthritis, etc.
- FOP fibrodysplasia ossificans progressiva
- osteoarthritis osteopetrosis
- osteoporosis in particular diabetes induced osteoporosis
- Paget's Disease Paget's Disease
- rheumatoid arthritis etc.
- Examples for skin diseases which may be treated with the JNK inhibitors of the present invention are for example psoriasis and lupus erythematosus.
- Diseases of the eye, which may be treated with the JNK inhibitors of the present invention involve for example age-related macular degeneration (AMD); angioid streaks; anterior ischemic optic neuropathy; anterior uveitis; cataract, in particular age related cataract; central exudative chorioretinopathy; central serous chorioretinopathy; chalazion; chorioderemia; chorioiditis; choroidal sclerosis; conjunctivitis; cyclitis; diabetic retinopathy; dry eye syndrome; endophthalmitis; episcleritis; eye infection; fundus albipunctatus; gyrate atrophy of choroid and retina; hordeolum; inflammatory diseases of the blephara; inflammatory diseases of the choroid; inflammatory diseases of the ciliary
- NMDA induced retinotoxicity non-chronic or chronic inflammatory eye diseases; Oguchi 's disease; optic nerve disease; orbital phlegmon; panophtalmitis; panuveitis; post caspule opacification; posterior capsule opacification (PCO) (a cataract after-surgery complication); posterior uveitis; proliferative vitreoretinopathy; retinal artery occlusion; retinal detachment, reti nal diseases; retinal injuries; retinal macroaneurysm; reti nal pigment epithel ium detachment; retinal vein occlusion; retinitis; retinitis pigmentosa; retinitis punctata albescens; retinopathy, i n particular retinopathy of prematurity and diabetic retinopathy; scleritis; Stargardt's disease; treatment
- Exemplary diseases of the mouth which may be treated with the JNK inhibitors as disclosed herein are periodontitis, in particular chronic periodontitis; mucositis, oral desquamative disorders, oral liquen planus, pemphigus vulgaris, pulpitis; stomatitis; temporomandibular joint disorder, peri-implantitis etc.
- the present invention is also suitable for use in the treatment of diseases resulting in loss of bladder function (e.g., urinary incontinence, overactive bladder, interstitial cystitis, or bladder cancer).
- Another field of use is the treatment of pain, in particular neuropathic, incident, breakthrough, psychogenic, or phantom pain, all of these types of pain either in the acute or chronic form.
- JNK inhibitors of the present invention may - as already previously proposed for other JNK inhibitors - be used for the treatment of proliferative diseases like cancer and tumor diseases, such as acusticus neurinoma lung carcinomas; acute lymphocytic leukemia (LI , L2, L3); acute lymphoid leukaemia (ALL); acute myelogenous leukemia (AML); adenocarcinomas; anal carcinoma; bronchial carcinoma; cervix carcinoma; cervical cancer; astrocytoma; basalioma; cancer with Bcr-Abl transformation; bladder cancer; blastomas; bone cancer; brain metastases; brain tumours; breast cancer; Burkitt's lymphoma; carcinoids; cervical cancer; chronic lymphocytic leukaemia (CLL); chronic myeloid leukaemia (CML); colon cancer; colon carcinoma; corpus carcinoma; craniopharyngeomas; CUP syndrome; virus- induced tumours; EBV-induced B
- the inhibitors of the present invention may be used accordingly, e.g. for the treatment of cardiovascular diseases such as arterial hypertension; arteriosclerosis; arteriosclerotic lesions; Behcet's syndrome; bifurcations of blood vessels; cardiac hypertrophy; cardiavascular hypertrophy; cardiomyopathies, in particular chemotherapy induced cardiomyopathies; cerebral ischemia; coronary heart diseases; dilatation of the abdominal aorta; focal cerebral ischemia; global cerebral ischemia; heart hypertrophy; infrarenal aneurism hypertension; ischemia; myocardial infarct, in particular acute myocardial infarction; myocarditis; reperfusion; restenosis; vasculitis; Wegener's granulomatosis; etc.
- cardiovascular diseases such as arterial hypertension; arteriosclerosis; arteriosclerotic lesions; Behcet's syndrome; bifurcations of blood vessels; cardiac hypertrophy; cardiavascular hypertrophy; cardiomyopathies, in particular chemotherapy
- the JNK inhibitors of the present invention may in the context of cardiovascular diseases also be used complementary to coronary artery bypass graft surgery (CABG surgery); percutaneous transluminal coronary angioplasty (PTCA); and/or stent treatment, for example to prevent or treat intimal hyperplasia resulting from said (surgical) treatment.
- CABG surgery coronary artery bypass graft surgery
- PTCA percutaneous transluminal coronary angioplasty
- stent treatment for example to prevent or treat intimal hyperplasia resulting from said (surgical) treatment.
- ARDS acute respiratory distress syndrome
- COPD chronic obstructive pulmonary disease
- cystic fibrosis inflammatory lung diseases; pneumonia; pulmonary fibrosis; etc.
- the inhibitors of the present invention may also be used to treat disease of the intestinal tract, e.g. colitis (e.g. atypical colitis, chemical colitis; collagenous colitis, distal colitis, diversion colitis; fulminant colitis, indeterminate colitis, infectious colitis, ischemic colitis, lymphocytic colitis, or microscopic colitis), Crohn's disease, gastroenteritis, Hirschsprung's disease, inflammatory digestive diseases; inflammatory bowel disease (IBD), Morbus Crohn, non-chronic or chronic digestive diseases, non-chronic or chronic inflammatory digestive diseases; regional enteritis; ulcerative colitis etc.
- colitis e.g. atypical colitis, chemical colitis; collagenous colitis, distal colitis, diversion colitis; fulminant colitis, indeterminate colitis, infectious colitis, ischemic colitis, lymphocytic colitis, or microscopic colitis
- Crohn's disease gastroenteritis, Hirschsprung's disease, inflammatory digestive diseases
- the JNK inhibitors of the present invention may also serve as therapeutic agent for the treatment of infectious diseases resulting from e.g. bacterial or viral infection.
- the JNK inhibitors as disclosed herein may for example prevent or ameliorate inflammatory reactions caused by said infections.
- diseases states which are not considered to be limiting, are viral encephalitis; viral induced cancers (e.g. as mentioned above), human immunodeficiency virus dementia, meningitis, meningoencephalitis, encephalomyelitis, tonsillitis, etc.
- the inventors of the present invention consider temporomandibular joint disorder, mucositis, stomatitis, oral liquen planus (desquamative disorder), Pemphigus vulgaris (desquamative disorder), periodontitis, chronic periodontitis, pulpitis, peri-implantitis, uveitis (anterior uveitis, intermediate uveitis, posterior uveitis), keratoconjunctivitis sicca (dry eye syndrome), coronary artery bypass graft surgery (CABG surgery), acute myocardial infarction, prevention of intimal hyperplasia following percutaneous transluminal coronary angioplasty (PTCA), prevention of intimal hyperplasia following stent placement, atherosclerosis, COPD, asthma, rheumatoid arthritis, osteoarthritis, Crohn's disease, inflammatory bowel disease (IBD), psoriasis, diabetes, stroke, Parkinson's disease, Alzheimer's disease, systemic
- a inhibitor sequence comprising less than 1 50 amino acids in length for the (in vitro) treatment of a tissue or organ transplant prior its transplantation.
- a transplant originating from brain-dead donors is typically not subjected to WIT has 8-12 hrs of CIT (time needed for transportation from the procurement hospital to the isolation lab. It was found that such transplants may be pre-treated by the JNK inhibitors according to the present inventionin order improve their viability and functionality until transplanted to host.
- the transplant is a kidney, heart, lung, pancreas, liver, blood cell, bone marrow, cornea, accidental severed limb, in particular fingers, hand, foot, face, nose, bone, cardiac valve, blood vessel or intestine transplant, preferably a kidney, heart, pancreas or skin transplant.
- JNK inhibitor sequences as known in the art only proved usability for a limited number of diseases, it was a surprising finding that JNK inhibitor sequences as defined herein may be used and are suitable for the treatment of diseases or disorders strongly related to JNK signaling as mentioned above. This was neither obvious nor suggested by the prior art, even though JNK inhibitor sequences in general have been known from the art.
- a JNK inhibitor sequence as defined above may be derived from a human or rat IB1 sequence, preferably from an amino acid sequence as defined or encoded by any of sequences according to SEQ ID NO: 102 (depicts the IB1 cDNA sequence from rat and its predicted amino acid sequence), SEQ ID NO: 103 (depicts the IB1 protein sequence from rat encoded by the exon-intron boundary of the rlB1 gene - splice donor), SEQ ID NO: 104 (depicts the IB1 protein sequence from Homo sapiens), or SEQ ID NO: 105 (depicts the IB1 cDNA sequence from Homo sapiens), more preferably from an amino acid sequence as defined or encoded by any of sequences according to SEQ ID NO: 1 04 (depicts the IB1 protein sequence from Homo sapiens), or SEQ ID NO: 105 (depicts the IB1 cDNA sequence from Homo sapiens), or from any fragments
- the JNK inhibitor sequence comprises a fragment, variant, or variant of such fragment of a human or rat IB1 sequence.
- Human or rat IB sequences are defined or encoded, respectively, by the sequences according to SEQ ID NO: 1 02, SEQ ID NO: 1 03, SEQ ID NO: 1 04 or SEQ ID NO: 105.
- such a JNK inhibitor sequence as used herein comprises a total length of less than 1 50 amino acid residues, preferably a range of 5 to 150 amino acid residues, more preferably 10 to 100 amino acid residues, even more preferably 10 to 75 amino acid residues and most preferably a range of 10 to 50 amino acid residues, e.g. 10 to 30, 10 to 20, or 10 to 1 5 amino acid residues.
- such a JNK inhibitor sequence and the above ranges may be selected from any of the above mentioned sequences, even more preferably from an amino acid sequence as defined according to SEQ ID NO: 104 or as encoded by SEQ ID NO: 105, even more preferably in the region between nucleotides 420 and 980 of SEQ ID NO: 1 05 or amino acids 105 and 291 of SEQ ID NO: 1 04, and most preferably in the region between nucleotides 561 and 647 of SEQ ID NO: 105 or amino acids 1 52 and 1 80 of SEQ ID NO: 1 04.
- a JNK inhibitor sequence as used herein typically binds JNK and/or inhibits the activation of at least one JNK activated transcription factor, e.g. c-Jun or ATF2 (see e.g. SEQ ID NOs: 15 and 16, respectively) or Elkl .
- the JNK inhibitor sequence as used herein preferably comprises or consists of at least one amino acid sequence according to any one of SEQ ID NOs: 1 to 4, 13 to 20 and 33 to 100, or a fragment, derivative or variant thereof. More preferably, the JNK inhibitor sequence as used herein may contain 1 , 2, 3, 4 or even more copies of an amino acid sequence according to SEQ ID NOs: 1 to 4, 13 to 20 and 33 to 100, or a variant, fragment or derivative thereof.
- these amino acid sequences according to SEQ ID NOs: 1 to 4, 13 to 20 and 33 to 100, or variants, fragments, or derivatives thereof as used herein may be directly linked with each other without any linker sequence or via a linker sequence comprising 1 to 10, preferably 1 to 5 amino acids.
- Amino acids forming the linker sequence are preferably selected from glycine or proline as amino acid residues. More preferably, these amino acid sequences according to SEQ ID NOs: 1 to 4, 1 3 to 20 and 33 to 1 00, or fragments, variants or derivatives thereof, as used herein, may be separated by each other by a hinge of two, three or more proline residues.
- the JNK inhibitor sequences as used herein may be composed of L-amino acids, D-amino acids, or a combination of both.
- the JNK inhibitor sequences as used herein comprise at least 1 or even 2, preferably at least 3, 4 or 5, more preferably at least 6, 7, 8 or 9 and even more preferably at least 10 or more D- and/or L-amino acids, wherein the D- and/or L-amino acids may be arranged in the JNK inhibitor sequences as used herein in a blockwise, a non-blockwise or in an alternate manner.
- the JNK inhibitor sequences as used herein may be exclusively composed of L-amino acids.
- the JNK inhibitor sequences as used herein may then comprise or consist of at least one relaxingnative JNK inhibitor sequence" according to SEQ ID NO: 1 or 3.
- the term "native” or “native JNK inhibitor sequence(s)” is referred to non-altered JNK inhibitor sequences according to any of SEQ ID NOs: 1 or 3, as used herein, entirely composed of L-amino acids.
- the JNK inhibitor sequence as used herein may comprise or consist of at least one (native) amino acid sequence NH 2 -X n b -X n a -RPTTLXLXXXXXXQD-X n b -COOH (L-IB generic (s)) [SEQ ID NO: 3] and/or the JNK binding domain (JBDs) of IB! XRPTTLXLXXXXXXQDS rX (L-IB (generic)) [SEQ ID NO: 19] .
- each X typically represents an amino acid residue, preferably selected from any (native) amino acid residue.
- X123 typically represents one amino acid residue, preferably selected from any amino acid residue except serine or threonine, wherein n (the number of repetitions of X) is 0 or 1 .
- each X n b may be selected from any amino acid residue, wherein n (the number of repetitions of X) is 0-5, 5-10, 10-1 5, 1 5-20, 20-30 or more, provided that if n (the number of repetitions of X) is 0 for X n a , X die b does preferably not comprise a serine or threonine at its C- terminus, in order to avoid a serine or threonine at this position.
- X tract b represents a contiguous stretch of peptide residues derived from SEQ ID NO: 1 or 3.
- X tract a and X tract b may represent either D or L amino acids.
- the JNK inhibitor sequence as used herein may comprise or consist of at least one (native) amino acid sequence selected from the group comprising the JNK binding domain of IB1 DTYRPKRPTTLNLFPQVPRSQDT (L-IB1 ) [SEQ ID NO: 1 7 ⁇ .
- the JNK inhibitor sequence as used herein further may comprise or consist of at least one (native) amino acid sequence NH 2 - RPKRPTTLNLFPQVPRSQD-COOH (L-IBI (s)) [SEQ ID NO: 1 ] .
- the JNK inhibitor sequence as used herein may comprise or consist of at least one (native) amino acid sequence selected from the group comprising the JNK binding domain of IB1 L-1B1 (si ) (NH 2 - TLNLFPQVPRSQD-COOH, SEQ ID NO: 33); L-IB1 (s2) (NH 2 -TTLNLFPQVPRSQ-COOH, SEQ ID NO: 34); L-IB1 (s3) (NH 2 -PTTLNLFPQVPRS-COOH, SEQ ID NO: 35); L-IB1 (s4) (NH 2 - RPTTLNLFPQVPR-COOH, SEQ ID NO: 36); L-IB1 (s5) (NH 2 -KRPTTLNLFPQVP-COOH, SEQ ID NO: 37); L-IB1 (s6) (NH 2 -PKRPTTLNLFPQV-COOH, SEQ ID NO: 38); L-IB1 (s7) (NH 2 - RPKRPTTLNLFPQ
- the JNK inhibitor sequence as used herein may comprise or consist of at least one (native) amino acid sequence selected from the group comprising the (long) JNK binding domain (JBDs) of IB1 PGTGCGDTYRPKRPTTLNLFPQVPRSQDT (IB1 -long) [SEQ ID NO: 13], the (long) JNK binding domain of IB2 IPSPSVEEPHKHRPTTLRLTTLGAQDS (IB2-long) [SEQ ID NO: 14], the JNK binding domain of c-Jun GAYGYSNPKILKQSMTLNLADPVGNLKPH (c- Jun) [SEQ ID NO: 1 5], the JNK binding domain of ATF2 TNEDHLAVHKHKHEMTLKFGPARNDSVIV (ATF2) [SEQ ID NO: 16] (see e.g.
- Figure 1 A-1 C an alignment revealed a partially conserved 8 amino acid sequence (see e.g. Figure 1 A) and a further comparison of the JBDs of IB1 and IB2 revealed two blocks of seven and three amino acids that are highly conserved between the two sequences.
- the JNK inhibitor sequences as used herein may be composed in part or exclusively of D-amino acids as defined above. More preferably, these JNK inhibitor sequences composed of D-amino acids are non-native D retro-inverso sequences of the above (native) JNK inhibitor sequences.
- the term "retro-inverso sequences" refers to an isomer of a linear peptide sequence in which the direction of the sequence is reversed and the chirality of each amino acid residue is inverted (see e.g. Jameson et a/., Nature, 368,744-746 (1994); Brady et a/., Nature, 368, 692-693 (1994)).
- any given L-amino acid sequence or peptide as used according to the present invention may be converted into an D retro-inverso sequence or peptide by synthesizing a reverse of the sequence or peptide for the corresponding native L-amino acid sequence or peptide.
- D retro-inverso sequences as used herein and as defined above have a variety of useful properties.
- D retro-inverso sequences as used herein enter cells as efficiently as L-amino acid sequences as used herein, whereas the D retro-inverso sequences as used herein are more stable than the corresponding L-amino acid sequences.
- the JNK inhibitor sequences as used herein may comprise or consist of at least one D retro-inverso sequence according to the amino acid sequence NH 2 -X n b - DQXXXXXXLXLTTPR-X n a -Xn b -COOH (D-IB1 generic (s)) [SEQ ID NO: 4] and/or XS/TDQXXXXXXXLXLTTPRX (D-IB (generic)) [SEQ ID NO: 20] .
- X, X n a and X n b are as defined above (preferably, representing D amino acids), wherein X n b preferably represents a contiguous stretch of residues derived from SEQ ID NO: 2 or 4.
- the JNK inhibitor sequences as used herein may comprise or consist of at least one D retro-inverso sequence according to the amino acid sequence comprising the JNK binding domain (JBDs) of IB1 TDQSRPVQPFLNLTTPRKPRYTD (D-IB1 ) [SEQ ID NO: 18].
- the JNK inhibitor sequences as used herein may comprise or consist of at least one D retro-inverso sequence according to the amino acid sequence NH 2 - DQSRPVQPFLNLTTPRKPR-COOH (D-IB1 (s)) [SEQ ID NO: 2] .
- the JNK inhibitor sequences as used herein may comprise or consist of at least one D retro-inverso sequence according to the amino acid sequence comprising the JNK binding domain (JBDs) of IB1 D- IB1 (si ) (NH2-QPFLNLTTPRKPR-COOH, SEQ ID NO: 67); D-IB1 (s2) (NH 2 -VQPFLNLTTPRKP- COOH, SEQ ID NO: 68); D-IB1 (s3) (NH 2 -PVQPFLNLTTPR -COOH, SEQ ID NO: 69); D- IB1 (s4) (NH 2 -RPVQPFLNLTTPR-COOH, SEQ ID NO: 70); D-IB1 (s5) (NH 2 -SRPVQPFLNLTTP- COOH, SEQ ID NO: 71 ); D-IB1 (s6) (NH 2 -QSRPVQPFLNLTT-COOH, SEQ ID NO: 72); D- IB1
- JNK inhibitor sequences as used herein and as disclosed above are presented in Table 1 (SEQ ID NO.s 1 -4, 13-20 and 33-100).
- the table presents the name of the JNK inhibitor sequences as used herein, as well as their sequence identifier number, their length, and amino acid sequence.
- Table 1 shows sequences as well as their generic formulas, e.g. for SEQ ID NO's: 1 , 2, 5, 6, 9 and 1 1 and SEQ ID NO's: 3, 4, 7, 8, 1 0 and 12, respectively.
- Table 1 furthermore discloses the chimeric sequences SEQ ID NOs: 9-12 and 23-32 (see below), L-IB1 sequences SEQ ID NOs: 33 to 66 and D-IB1 sequences SEQ ID NOs: 67 to 100. TABLE 1
- L-TAT- IB (generic) (s) 10 29 NH 2 -X n b -RK RRQRRR-X n b -X n a -RPTTLXLXXXXXXQD-X n b -COOH
- D-TAT-IBKs 1 1 31 DQSRPVQPFLNLTTPR PRPPRRRQRRK RG
- D-TAT- IB (generic) (s) 12 29 NH 2 -X n b -DQXXXXXXLXLTTPR-X n a -X n b -RRRQRRKKR-Xdon b -COOH
- L-generic-TAT 21 1 7 XXXXRKKRRQRRRXXXX
- D-generic-TAT 22 1 7 XXXXRRRQRRKKRXXXX
- L-TAT- IB (generic) 24 42 XXXXXXRKKRRQRRRXXXXXXXRPTTLXLXXXXXXQDS TX
- D-TAT-IB1 25 35 TDQSRPVQPFLNLTTPRKPRYTDPPRRRQRRKKRG
- D-TAT- IB (generic) 26 42 XT/SDQXXXXXXLXLTTPRXXXXXXXRRRQRRKKRXXXXXXXX
- D-TAT-IB1 (s1 ) 30 DQSRPVQPFLNLTTPR PRPPRRRQRRKKR
- D-TAT-IB1 (s3) 32 29 DQSRPVQPFLNLTTPRKPRX n c RRRQRRKKR
- L-IB1 (s22) 54 1 1 KRPTTLNLFPQ (NH 2 - RPTTLNLFPQ-COOH)
- D-IB1 (s34) 100 10 LNLTTPR PR
- the JNK inhibitor sequence as used herein comprises or consists of at least one variant, fragment and/or derivative of the above defined native or non-native amino acid sequences according to SEQ ID NOs: 1 -4, 1 3-20 and 33- 100.
- these variants, fragments and/or derivatives retain biological activity of the above disclosed native or non-native JNK inhibitor sequences as used herein, particularly of native or non-native amino acid sequences according to SEQ ID NOs: 1 -4, 1 3-20 and 33- 100, i.e. binding JNK and/or inhibiting the activation of at least one JNK activated transcription factor, e.g. c-Jun, ATF2 or Elk1 .
- Functionality may be tested by various tests, e.g. binding tests of the peptide to its target molecule or by biophysical methods, e.g. spectroscopy, computer modeling, structural analysis, etc..
- an JNK inhibitor sequence or variants, fragments and/or derivatives thereof as defined above may be analyzed by hydrophilicity analysis (see e.g. Hopp and Woods, 1 981 . Proc Natl Acad Sci USA 78: 3824-3828) that can be utilized to identify the hydrophobic and hydrophilic regions of the peptides, thus aiding in the design of substrates for experimental manipulation, such as in binding experiments, or for antibody synthesis.
- Secondary structural analysis may also be performed to identify regions of an JNK inhibitor sequence or of variants, fragments and/or derivatives thereof as used herein that assume specific structural motifs (see e.g. Chou and Fasman, 1974, Biochem 13: 222-223). Manipulation, translation, secondary structure prediction, hydrophilicity and hydrophobicity profiles, open reading frame prediction and plotting, and determination of sequence homologies can be accomplished using computer software programs available in the art. Other methods of structural analysis include, e.g. X- ray crystallography (see e.g. Engstrom, 1974. Biochem Exp Biol 1 1 : 7-1 3), mass spectroscopy and gas chromatography (see e.g.
- JNK inhibitor sequence as used herein may comprise or consist of at least one variant of (native or non-native) amino acid sequences according to SEQ ID NOs: 1 -4, 13-20 and 33-100.
- a "variant of a (native or non- native) amino acid sequence according to SEQ ID NOs: 1 -4, 13-20 and 33-100” is preferably a sequence derived from any of the sequences according to SEQ ID NOs: 1 -4, 1 3-20 and 33- 100, wherein the variant comprises amino acid alterations of the amino acid sequences according to SEQ ID NOs: 1 -4, 13-20 and 33-100.
- Such alterations typically comprise 1 to 20, preferably 1 to 10 and more preferably 1 to 5 substitutions, additions and/or deletions of amino acids according to SEQ ID NOs: 1 -4, 1 3-20 and 33-100, wherein the variant exhibits a sequence identity with any of the sequences according to SEQ ID NOs: 1 -4, 1 3-20 and 33- 100 of at least about 30%, 50%, 70%, 80%, 90%, 95%, 98% or even 99%.
- variants of (native or non-native) amino acid sequences according to SEQ ID NOs: 1 -4, 13- 20 and 33-100 as defined above and used herein are obtained by substitution of specific amino acids, such substitutions preferably comprise conservative amino acid substitutions.
- Conservative amino acid substitutions may i nclude synonymous amino acid residues within a group which have sufficiently similar physicochemical properties, so that a substitution between members of the group will preserve the biological activity of the molecule (see e.g. Grantham, R. (1 974), Science 185, 862-864).
- amino acids may also be inserted and/or deleted in the above-defined sequences without altering their function, particularly if the insertions and/or deletions only involve a few amino acids, e.g. less than twenty, and preferably less than ten, and do not remove or displace amino acids which are critical to functional activity.
- substitutions shall be avoided in variants as used herein, which lead to additional threonines at amino acid positions which are accessible for a phosphorylase, preferably a kinase, in order to avoid inactivation of the JNK- inhibitor sequence as used herein or of the chimeric peptide as used herein in vivo ox in vitro.
- synonymous amino acid residues which are classified i nto the same groups and are typically exchangeable by conservative amino acid substitutions, are defi ned in Table 2.
- Gin Glu, Lys, Asn, H is, (Thr), Arg, Gin
- Lys Glu Gin, His, Arg, Lys
- Trp Trp A specific form of a variant of SEQ ID NOs: 1 -4, 1 3-20 and 33-1 00 as used herein is a fragment of the (native or non-native) amino acid sequences according to SEQ I D NOs: 1 , 1 - 4, 1 3-20 and 33-1 00" as used herein, which is typical ly altered by at least one deletion as compared to SEQ ID NOs 1 -4, 1 3-20 and 33-1 00.
- a fragment comprises at least 4 contiguous amino acids of any of SEQ ID NOs: 1 -4, 1 3-20 and 33-100, a length typically sufficient to allow for specific recognition of an epitope from any of these sequences.
- the fragment comprises 4 to 1 8, 4 to 1 5, or most preferably 4 to 1 0 contiguous amino acids of any of SEQ ID NOs: 1 -4, 1 3-20 and 33-100, wherein the lower limit of the range may be 4, or 5, 6, 7, 8, 9, or 1 0. Deleted amino acids may occur at any position of SEQ ID NOs: 1 -4, 1 3-20 and 33-1 00, preferably N- or C-terminally.
- a fragment of the (native or non-native) amino acid sequences according to SEQ ID NOs: 1 -4, 1 3-20 and 33-100, as described above, may be defined as a sequence sharing a sequence identity with any of the sequences according to SEQ ID NOs: 1 -4, 1 3-20 and 33- 100 as used herein of at least about 30%, 50%, 70%, 80%, 90%, 95%, 98%, or even 99%.
- the J NK inhibitor sequences as used herein may further comprise or consist of at least one derivative of (native or non-native) amino acid sequences according to SEQ ID NOs: 1 -4, 1 3- 20 and 33-1 00 as defined above.
- a "derivative of an (native or non-native) amino acid sequence according to SEQ ID NOs: 1 -4, 1 3-20 and 33-100" is preferably an amino acid sequence derived from any of the sequences according to SEQ ID NOs: 1 -4, 1 3- 20 and 33-1 00, wherein the derivative comprises at least one modified L- or D-amino acid (forming non-natural amino acid(s)), preferably 1 to 20, more preferably 1 to 1 0, and even more preferably 1 to 5 modified L- or D-amino acids. Derivatives of variants or fragments also fall under the scope of the present invention.
- a modified amino acid in this respect may be any amino acid which is altered e.g. by different glycosylation in various organisms, by phosphorylation or by labeling specific ami no acids. Such a label is then typically selected from the group of labels comprising:
- radioactive labels i.e. radioactive phosphorylation or a radioactive label with sulphur, hydrogen, carbon, nitrogen, etc.
- colored dyes e.g. digoxygenin, etc.
- fluorescent groups e.g. fluorescein, etc.
- chemoluminescent groups (iv) chemoluminescent groups; (v) groups for immobilization on a solid phase (e.g. His-tag, biotin, strep-tag, flag-tag, antibodies, antigen, etc.); and
- an amino acid sequence having a sequence "sharing a sequence identity" of at least, for example, 95% to a query amino acid sequence of the present invention is intended to mean that the sequence of the subject amino acid sequence is identical to the query sequence except that the subject amino acid sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence.
- up to 5% (5 of 100) of the amino acid residues in the subject sequence may be inserted or substituted with another amino acid or deleted.
- a "% identity" of a first sequence may be determined with respect to a second sequence.
- these two sequences to be compared are aligned to give a maximum correlation between the sequences. This may include inserting "gaps" in either one or both sequences, to enhance the degree of alignment.
- a % identity may then be determined over the whole length of each of the sequences being compared (so-called global alignment), that is particularly suitable for sequences of the same or similar length, or over shorter, defined lengths (so-called local alignment), that is more suitable for sequences of unequal length.
- JNK-inhibitor sequences as used according to the present invention and as defined above may be obtained or produced by methods well-known in the art, e.g.
- a peptide corresponding to a portion of an JNK inhibitor sequence as used herein including a desired region of said JNK inhibitor sequence, or that mediates the desired activity in v/troor in vivo may be synthesized by use of a peptide synthesizer.
- JNK inhibitor sequence as used herein and as defined above may be furthermore be modified by a trafficking sequence, allowing the JNK inhibitor sequence as used herein and as defined above to be transported effectively into the cells.
- modified JNK inhibitor sequence are preferably provided and used as chimeric sequences.
- the present invention therefore provides the use of a chimeric peptide including at least one first domain and at least one second domain, for the preparation of a pharmaceutical composition for treating diseases or disorders strongly related to JNK signaling as defined above in a subject, wherein the first domain of the chimeric peptide comprises a trafficking sequence, while the second domain of the chimeric peptide comprises an JNK inhibitor sequence as defined above, preferably of any of sequences according to SEQ ID NO: 1 -4, 1 3-20 and 33-100 or a derivative or a fragment thereof.
- chimeric peptides as used according to the present invention have a length of at least 25 amino acid residues, e.g. 25 to 250 amino acid residues, more preferably 25 to 200 amino acid residues, even more preferably 25 to 1 50 amino acid residues, 25 to 100 and most preferably amino acid 25 to 50 amino acid residues.
- the chimeric peptide as used herein preferably comprises a trafficking sequence, which is typically selected from any sequence of amino acids that directs a peptide (in which it is present) to a desired cellular destination.
- the trafficking sequence typically directs the peptide across the plasma membrane, e.g. from outside the cell, through the plasma membrane, and into the cytoplasm.
- the trafficking sequence may direct the peptide to a desired location within the cell, e.g. the nucleus, the ribosome, the endoplasmic reticulum (ER), a lysosome, or peroxisome, by e.g. combining two components (e.g.
- the trafficking sequence may additionally comprise another component, which is capable of binding a cytoplasmic component or any other component or compartment of the cell (e.g. endoplasmic reticulum, mitochondria, gloom apparatus, lysosomal vesicles). Accordingly, e.g. the trafficking sequence of the first domain and the JNK inhibitor sequence of the second domain may be localized in the cytoplasm or any other compartment of the cell. This allows to determine localization of the chimeric peptide in the cell upon uptake.
- the trafficking sequence (being included in the first domain of the chimeric peptide as used herein) has a length of 5 to 1 50 amino acid sequences, more preferably a length of 5 to 100 and most preferably a length of from 5 to 50, 5 to 30 or even 5 to 1 5 amino acids.
- the trafficking sequence (contained in the first domain of the chimeric peptide as used herein) may occur as a continuous amino acid sequence stretch in the first domain.
- the trafficking sequence in the first domain may be splitted into two or more fragments, wherein all of these fragments resemble the entire trafficking sequence and may be separated from each other by 1 to 10, preferably 1 to 5 amino acids, provided that the trafficking sequence as such retains its carrier properties as disclosed above.
- These amino acids separating the fragments of the trafficking sequence may e.g. be selected from amino acid sequences differing from the trafficking sequence.
- the first domain may contain a trafficking sequence composed of more than one component, each component with its own function for the transport of the cargo JNK inhibitor sequence of the second domain to e.g. a specific cell compartment.
- the trafficking sequence as defined above may be composed of L-amino acids, D-amino acids, or a combination of both.
- the trafficking sequence (being included in the first domain of the chimeric peptide as used herein) may comprise at least 1 or even 2, preferably at least 3, 4 or 5, more preferably at least 6, 7, 8 or 9 and even more preferably at least 10 or more D- and/or L-amino acids, wherein the D- and/or L-amino acids may be arranged in the JNK trafficking sequences in a blockwise, a non-blockwise or in an alternate manner.
- the trafficking sequence of the chimeric peptide as used herein may be exclusively composed of L-amino acids.
- the trafficking sequence of the chimeric peptide as used herein comprises or consists of at least one treating agent as defined above.
- the term "native" is referred to non-altered trafficking sequences, entirely composed of L-amino acids.
- the trafficking sequence of the chimeric peptide as used herein may be exclusively composed of D-amino acids. More preferably, the trafficking sequence of the chimeric peptide as used herein may comprise a D retro-inverso peptide of the sequences as presented above.
- the trafficking sequence of the first domain of the chimeric peptide as used herein may be obtained from naturally occurring sources or can be produced by using genetic engineering techniques or chemical synthesis (see e.g. Sambrook, J., Fritsch, E. F., Maniatis, T. (1 989) Molecular cloning: A laboratory manual. 2nd edition. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.).
- Sources for the trafficking sequence of the first domain may be employed including, e.g. native proteins such as e.g. the TAT protein (e.g. as described in U.S. Patent Nos. 5,804,604 and 5,674,980, each of these references being incorporated herein by reference), VP22 (described in e.g. WO 97/05265; Elliott and O'Hare, Cell 88 : 223-233 (1 997)), non-viral proteins (Jackson et al, Proc. Natl. Acad. Sci. USA 89 : 10691 -1 0695 (1 992)), trafficking sequences derived from Antennapedia (e.g. the antennapedia carrier sequence) or from basic peptides, e.g.
- native proteins such as e.g. the TAT protein (e.g. as described in U.S. Patent Nos. 5,804,604 and 5,674,980, each of these references being incorporated herein by reference), VP22 (described in
- peptides having a length of 5 to 1 5 amino acids, preferably 1 0 to 12 amino acids and comprising at least 80 %, more preferably 85 % or even 90 % basic amino acids, such as e.g. arginine, lysine and/or histidine.
- variants, fragments and derivatives of one of the native proteins used as trafficking sequences are disclosed herewith. With regard to variants, fragments and derivatives it is referred to the definition given above for JNK inhibitor sequences as used herein. Variants, fragments as well as derivatives are correspondingly defined as set forth above for JNK inhibitor sequences as used herein.
- a variant or fragment or derivative may be defined as a sequence sharing a sequence identity with one of the native proteins used as trafficking sequences as defined above of at least about 30%, 50%, 70%, 80%, 90%, 95%, 98%, or even 99%.
- the trafficking sequence of the first domain comprises or consists of a sequence derived from the human immunodeficiency virus (HIV)1 TAT protein, particularly some or all of the 86 amino acids that make up the TAT protein.
- HAV human immunodeficiency virus
- partial sequences of the full-length TAT protein may be used forming a functionally effective fragment of a TAT protein, i.e. a TAT peptide that includes the region that mediates entry and uptake into cells.
- a functionally effective fragment of the TAT protein can be determined using known techniques (see e.g. Franked et a/., Proc. Natl. Acad. Sci, USA 86 : 7397-7401 (1 989)).
- the trafficking sequence in the first domain of the chimeric peptide as used herein may be derived from a functionally effective fragment or portion of a TAT protein sequence that comprises less than 86 amino acids, and which exhibits uptake into cells, and optionally the uptake into the cell nucleus. More preferably, partial sequences (fragments) of TAT to be used as carrier to mediate permeation of the chimeric peptide across the cell membrane, are intended to comprise the basic region (amino acids 48 to 57 or 49 to 57) of full-length TAT.
- the trafficking sequence (being included in the first domain of the chimeric peptide as used herein) may comprise or consist of an amino acid sequence containing TAT residues 48-57 or 49 to 57, and most preferably a generic TAT sequence NH 2 -X n b - K RRQRRR-X tract b -COOH (L-generic-TAT (s)) [SEQ ID NO: 7] and/or XXXXRKKRRQ RRRXXX (L-generic-TAT) [SEQ ID NO: 21 ], wherein X or X n b is as defined above.
- the number of "X n b " residues in SEQ ID NOs :8 is not limited to the one depicted, and may vary as described above.
- the trafficking sequence being included in the first domain of the chimeric peptide as used herein may comprise or consist of a peptide containing e.g. the amino acid sequence NH 2 -GRKKRRQRRR-COOH (L-TAT) [SEQ ID NO: 5] .
- the trafficking sequence (being included in the first domain of the chimeric peptide as used herein) may comprise a D retro-inverso peptide of the sequences as presented above, i.e. the D retro-inverso sequence of the generic TAT sequence having the sequence NH 2 -X n b -RRRQRRKKR-X n b -COOH (D-generic-TAT (s)) [SEQ ID NO : 8] and/or XXXXRRRQRRKKRXXX (D-generic-TAT) [SEQ ID NO: 22] .
- X n is as defined above (preferably representing D amino acids).
- the number of "X n b " residues in SEQ ID NOs :8 is not limited to the one depicted, and may vary as described above.
- the trafficking sequence as used herein may comprise the D retro-inverso sequence NH 2 -RRRQRRKKRG-COOH (D-TAT) [SEQ ID NO: 6] .
- the trafficking sequence being included in the first domain of the chimeric peptide as used herein may comprise or consist of variants of the trafficking sequences as defined above.
- a "variant of a trafficking sequence” is preferably a sequence derived from a trafficking sequence as defined above, wherein the variant comprises a modification, for example, addition, (internal) deletion (leading to fragments) and/or substitution of at least one amino acid present in the trafficking sequence as defined above.
- modification(s) typically comprise(s) 1 to 20, preferably 1 to 10 and more preferably 1 to 5 substitutions, additions and/or deletions of amino acids.
- the variant preferably exhibits a sequence identity with the trafficking sequence as defined above, more preferably with any of SEQ ID NOs: 5 to 8 or 21 -22, of at least about 30%, 50%, 70%, 80%,90%, 95%, 98% or even 99%.
- variants of the trafficking sequence can be designed to modulate intracellular localization of the chimeric peptide as used herein.
- such variants as defined above are typically designed such that the ability of the trafficking sequence to enter cells is retained (i.e. the uptake of the variant of the trafficking sequence into the cell is substantially similar to that of the native protein used a trafficking sequence). For example, alteration of the basic region thought to be important for nuclear localization (see e.g. Dang and Lee, J. Biol. Chem.
- any of the above disclosed variants of the trafficking sequences being included in the first domain of the chimeric peptide as used herein can be produced using techniques typically known to a skilled person (see e.g. Sambrook, J., Fritsch, E. F., Maniatis, T. (1 989) Molecular cloning: A laboratory manual. 2nd edition. Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.)
- the chimeric peptide as used herein typically comprises an JNK inhibitor sequence, selected from any of the JNK inhibitor sequences as defined above, including variants, fragments and/or derivatives of these JNK inhibitor sequences.
- Both domains i.e. the first and the second domain(s), of the chimeric peptide as used herein, may be linked such as to form a functional unit. Any method for linking the first and second domain(s) as generally known in the art may be applied.
- the first and the second domain(s) of the chimeric peptide as used herein are preferably linked by a covalent bond.
- a covalent bond as defined herein, may be e.g. a peptide bond, which may be obtained by expressing the chimeric peptide as defined above as a fusion protein. Fusion proteins, as described herein, can be formed and used in ways analogous to or readily adaptable from standard recombinant DNA techniques, as described below. However, both domains may also be linked via side chains or may be linked by a chemical linker moiety.
- the first and/or second domains of the chimeric peptide as used herein may occur in one or more copies in said chimeric peptide. If both domains are present in a single copy, the first domain may be linked either to the N-terminal or the C-terminal end of the second domain. If present in multiple copies, the first and second domain(s) may be arranged in any possible order. E.g. the first domain can be present in the chimeric peptide as used herein in a multiple copy number, e.g. in two, three or more copies, which are preferably arranged in consecutive order. Then, the second domain may be present in a single copy occurring at the N- or C- terminus of the sequence comprising the first domain.
- first and second domain(s) can take any place in a consecutive arrangement. Exemplary arrangements are shown in the following: e.g. first domain - first domain - first domain - second domain; first domain - first domain - second domain - first domain; first domain - second domain - first domain - first domain; or e.g. second domain - first domain - first domain - first domain. It is well understood for a skilled person that these examples are for i llustration purposes only and shall not limit the scope of the invention thereto.
- the number of copies and the arrangement may be varied as defined initially.
- the first and second domain(s) may be directly linked with each other without any linker.
- they may be linked with each other via a linker sequence comprising 1 to 1 0, preferably 1 to 5 amino acids.
- Amino acids forming the linker sequence are preferably selected from glycine or proline as amino acid residues.
- the first and second domain(s) may be separated by each other by a hinge of two, three or more proline residues between the first and second domain(s).
- the chimeric peptide as defined above and as used herein, comprising at least one first and at least one second domain, may be composed of L-amino acids, D-amino acids, or a combination of both.
- each domain (as wel l as the linkers used) may be composed of L-amino acids, D-amino acids, or a combination of both (e.g. D-TAT and L-IB1 (s) or L-TAT and D-IB1 (s), etc.).
- the chimeric peptide as used herei n may comprise at least 1 or even 2, preferably at least 3, 4 or 5, more preferably at least 6, 7, 8 or 9 and even more preferably at least 1 0 or more D- and/or L-amino acids, wherein the D- and/or L-amino acids may be arranged in the chimeric peptide as used herein in a blockwise, a non-blockwise or in an alternate manner.
- the chimeric peptide as used herein comprises or consists of the L-amino acid chimeric peptides according to the generic L-TAT-IB peptide NH 2 -X travel b -RKKRRQRRR-X penetrate b -X n a -RPTTLXLXXXXXXQD-X n b -COOH (L-TAT-IB (generic) (s)) [SEQ ID NO: 1 0], wherein X, X n a and X tract b are preferably as defined above.
- the chimeric peptide as used herein comprises or consists of the L-amino acid chimeric peptide NH 2 -GR KRRQRRRPPRP RPTTLNLFPQVPRSQD-COOH (L-TAT-IB 1 (s)) [SEQ ID NO: 9] .
- the chimeric peptide as used herein comprises or consists of the L-amino acid chimeric peptide sequence GRKKRRQRRR PPDTYRPKRP TTLNLFPQVP RSQDT (L-TAT-IB 1 ) [SEQ ID NO: 23], or XXXXXXRKK RRQRRRXXX XXXRPTTLX LXXXXXXQD S/JX (L-TAT-IB generic) [SEQ ID NO: 24], wherein X is preferably also as defined above, or the chimeric peptide as used herein comprises or consists of the L-amino acid chimeric peptide sequence RKKRRQRRRPPRPKRPTTLNLFPQVPRSQD (L-TAT-IBKsD) [SEQ ID NO: 27], GRKKRRQRRRX flesh C RPKRPTTLNLFPQVPRSQD (L-TAT- IB1 (s2)
- each X typically represents an amino acid residue as defined above, more preferably X transit c represents a contiguous stretch of peptide residues, each X independently selected from each other from glycine or proline, e.g. a monotonic glycine stretch or a monotonic proline stretch, wherein n (the number of repetitions of X tract c ) is typically 0-5, 5-10, 10-15, 1 5-20, 20-30 or even more, preferably 0-5 or 5-10.
- X n c may represent either D or L amino acids.
- the chimeric peptide as used herein comprises or consists of D-amino acid chimeric peptides of the above disclosed L-amino acid chimeric peptides.
- Exemplary D retro-inverso chimeric peptides according to the present invention are e.g. the generic D-TAT-IB peptide NH 2 -Xn b -DQXXXXXXLXLTTPR-X n a -Xn b - RRRQRRKKR-X belong b -COOH (D-TAT-IB (generic) (s)) [SEQ ID NO: 12] .
- X, X n a and X n b are preferably as defined above (preferably representing D amino acids). More preferably, the chimeric peptide as used herein comprises or consists of D-amino acid chimeric peptides according to the TAT-IB1 peptide NH 2 -DQSRPVQPFLNLTTPR PRPPRRRQRRKKRG-COOH (D-TAT-IB 1 (s)) [SEQ ID NO: 1 1 ].
- the chimeric peptide as used herein comprises or consists of the D-amino acid chimeric peptide sequence TDQSRPVQPFLNLTTPRKPRYTDPPRRRQRRKKRG (D-TAT-IB1 ) [SEQ ID NO: 25], or XT/SDQXXXXXXLXLTTPRXXXXXXXXRRRQRRKKRXXXXXX (D-TAT-IB generic) [SEQ ID NO: 26], wherein X is preferably also as defined above, or the chimeric peptide as used herein comprises or consists of the D-amino acid chimeric peptide sequence DQSRPVQPFLNLTTPRKPRPPRRRQRRKKR (D-TAT-IB1 (si )) [SEQ ID NO: 30], DQSRPVQPFLNLTTPRKPRXn c RRRQRRKKRG (D-TAT-IB1 (s
- the first and second domain(s) of the chimeric peptide as defined above may be linked to each other by chemical or biochemical coupling carried out in any suitable manner known in the art, e.g. by establishing a peptide bond between the first and the second domain(s) e.g. by expressing the first and second domain(s) as a fusion protein, or e.g. by crosslinking the first and second domain(s) of the chimeric peptide as defined above.
- Many known methods suitable for chemical crosslinking of the first and second domain(s) of the chimeric peptide as defined above are non-specific, i.e. they do not direct the point of coupling to any particular site on the transport polypeptide or cargo macromolecule.
- crosslinking agents may attack functional sites or sterically block active sites, rendering the conjugated proteins biologically inactive.
- crosslinking methods are used, which allow a more specific coupling of the first and second domain(s).
- one way to increasing coupling specificity is a direct chemical coupling to a functional group present only once or a few times in one or both of the first and second domain(s) to be crosslinked.
- cysteine which is the only protein amino acid containing a thiol group, occurs in many proteins only a few times.
- a crosslinking reagent specific for primary amines will be selective for the amino terminus of that polypeptide.
- Successful utilization of this approach to increase coupling specificity requires that the polypeptide have the suitably rare and reactive residues in areas of the molecule that may be altered without loss of the molecule's biological activity.
- Cysteine residues may be replaced when they occur in parts of a polypeptide sequence where their participation in a crosslinking reaction would otherwise likely interfere with biological activity.
- a cysteine residue is replaced, it is typically desirable to minimize resulting changes in polypeptide folding. Changes in polypeptide folding are minimized when the replacement is chemically and sterically similar to cysteine. For these reasons, serine is preferred as a replacement for cysteine.
- a cysteine residue may be introduced into a polypeptide's amino acid sequence for crosslinking purposes. When a cysteine residue is introduced, introduction at or near the amino or carboxy terminus is preferred. Conventional methods are available for such amino acid sequence modifications, wherein the polypeptide of interest is produced by chemical synthesis or via expression of recombinant DNA.
- Coupling of the first and second domain(s) of the chimeric peptide as defined above and used herein can also be accomplished via a coupling or conjugating agent.
- a coupling or conjugating agent There are several intermolecular crosslinking reagents which can be utilized (see for example, Means and Feeney, CHEMICAL MODIFICATION OF PROTEINS, Holden-Day, 1974, pp. 39-43).
- N-succinimidyl 3-(2-pyridyldithio) propionate SPDP
- N,N'-(1 ,3-phenylene) bismaleimide both of which are highly specific for sulfhydryl groups and form irreversible linkages
- N, N'-ethylene-bis-(iodoacetamide) or other such reagent having 6 to 1 1 carbon methylene bridges which are relatively specific for sulfhydryl groups
- 1 ,5-difluoro-2,4-dinitrobenzene which forms irreversible linkages with amino and tyrosine groups).
- crosslinking reagents useful for this purpose include: ⁇ , ⁇ '-difluoro-m, m'-dinitrodiphenylsulfone which forms irreversible crosslinkages with amino and phenolic groups); dimethyl adipimidate (which is specific for amino groups); phenol- 1 ,4 disulfonylchloride (which reacts principally with amino groups); hexamethylenediisocyanate or diisothiocyanate, or azophenyl-p-diisocyanate (which reacts principally with amino groups); glutaraldehyde (which reacts with several different side chains) and disdiazobenzidine (which reacts primarily with tyrosine and histidine).
- Crosslinking reagents used for crosslinking the first and second domain(s) of the chimeric peptide as defined above may be homobifunctional, i.e. having two functional groups that undergo the same reaction.
- a preferred homobifunctional crosslinking reagent is bismaleimidohexane ("BMH").
- BMH contains two maleimide functional groups, which react specifically with sulfhydryl-containing compounds under mild conditions (pH 6.5-7.7). The two maleimide groups are connected by a hydrocarbon chain. Therefore, BMH is useful for irreversible crosslinking of polypeptides that contain cysteine residues.
- Crosslinking reagents used for crosslinking the first and second domain(s) of the chimeric peptide as defined above may also be heterobifunctional.
- Heterobifunctional crosslinking agents have two different functional groups, for example an amine-reactive group and a thiol- reactive group, that will crosslink two proteins having free amines and thiols, respectively.
- heterobifunctional crosslinking agents are succinimidyl 4-(N- maleimidomethyl)cyclohexane-1 -carboxylate (“SMCC”), m-maleimidobenzoyl-N- hydroxysuccinimide ester (“MBS”), and succinimide 4-(p-maleimidophenyl)butyrate (“SMPB”), an extended chain analog of MBS.
- SMCC succinimidyl 4-(N- maleimidomethyl)cyclohexane-1 -carboxylate
- MBS m-maleimidobenzoyl-N- hydroxysuccinimide ester
- SMPB succinimide 4-(p-maleimidophenyl)butyrate
- Crosslinking reagents suitable for crosslinking the first and second domain(s) of the chimeric peptide as defined above often have low solubility in water.
- a hydrophilic moiety, such as a sulfonate group, may thus be added to the crosslinking reagent to improve its water solubility.
- Sulfo-MBS and Sulfo-SMCC are examples of crosslinking reagents modified for water solubi lity, which may be used according to the present invention.
- crosslinking reagents yield a conjugate that is essentially non-cleavable under cel lular conditions.
- some crosslinking reagents particularly suitable for crosslinking the first and second domain(s) of the chimeric peptide as defined above contain a covalent bond, such as a disulfide, that is cleavable under cel lular conditions.
- a disulfide such as a disulfide
- DSP dithiobis(succinimidylpropionate)
- SPDP N-succinimidyl 3-(2- pyridyldithio)propionate
- the use of a cleavable crosslinking reagent permits the cargo moiety to separate from the transport polypeptide after delivery into the target cel l. Direct disulfide linkage may also be useful.
- crosslinking reagents including the ones discussed above, are commercial ly available. Detailed instructions for their use are readi ly available from the commercial suppliers.
- a general reference on protein crosslinking and conjugate preparation is: Wong, CHEMISTRY OF PROTEIN CONJ UGATION AND CROSSLINKING, CRC Press (1 991 ).
- Chemical crosslinking of the first and second domain(s) of the chimeric peptide as defi ned above may include the use of spacer arms.
- Spacer arms provide intramolecular flexibi lity or adjust intramolecular distances between conjugated moieties and thereby may help preserve biological activity.
- a spacer arm may be in the form of a polypeptide moiety that includes spacer amino acids, e.g. proline.
- a spacer arm may be part of the crosslinking reagent, such as in "long-chain SPDP" (Pierce Chem. Co., Rockford, IL., cat. No. 21 651 H).
- variants, fragments or derivatives of one of the above disclosed chimeric peptides may be used herein. With regard to fragments and variants it is generally referred to the definition given above for JNK inhibitor sequences.
- a "variant of a chimeric peptide” is preferably a sequence derived from any of the sequences according to SEQ ID NOs: 9 to 1 2 and 23 to 32, wherein the chimeric variant comprises amino acid alterations of the chimeric peptides according to SEQ ID NOs: 9 to 1 2 and 23 to 32 as used herein.
- Such alterations typically comprise 1 to 20, preferably 1 to 1 0 and more preferably 1 to 5 substitutions, additions and/or deletions (leading to fragments) of amino acids according to SEQ ID NOs: 9 to 1 2 and 23 to 32, wherein the altered chimeric peptide as used herein exhibits a sequence identity with any of the sequences according to SEQ ID NOs: 9-12 and 23 to 32 of at least about 30%, 50%, 70%, 80%, or 95%, 98%, or even 99%.
- these variants retain the biological activity of the first and the second domain as contained in the chimeric peptide as used herein, i.e. the trafficking activity of the first domain as disclosed above and the activity of the second domain for binding JNK and/or inhibiting the activation of at least one jNK activated transcription factor.
- the chimeric peptide as used herein also comprises fragments of the afore disclosed chimeric peptides, particularly of the chimeric peptide sequences according to any of SEQ ID NOs: 9 to 12 and 23 to 32.
- a "fragment of the chimeric peptide" is preferably a sequence derived any of the sequences according to SEQ ID NOs: 9 to 12 and 23 to 32, wherein the fragment comprises at least 4 contiguous amino acids of any of SEQ ID NOs: 9 to 12 and 23 to 32.
- This fragment preferably comprises a length which is sufficient to allow specific recognition of an epitope from any of these sequences and to transport the sequence into the cells, the nucleus or a further preferred location.
- the fragment comprises 4 to 1 8, 4 to 1 5, or most preferably 4 to 10 contiguous amino acids of any of SEQ ID NOs: 9 to 12 and 23 to 32.
- Fragments of the chimeric peptide as used herein further may be defined as a sequence sharing a sequence identity with any of the sequences according to any of SEQ ID NOs: 99 to 12 and 23 to 32 of at least about 30%, 50%, 70%, 80%, or 95%, 98%, or even 99%.
- the chimeric peptide as used herein also comprises derivatives of the afore disclosed chimeric peptides, particularly of the chimeric peptide sequences according to any of SEQ ID NOs: 9 to 12 and 23 to 32.
- the present invention additionally refers to the use of nucleic acid sequences encoding JNK inhibitor sequences as defined above, chimeric peptides or their fragments, variants or derivatives, all as defined above, for the preparation of a pharmaceutical composition for treating diseases or disorders strongly related to JNK signaling as defined above in a subject.
- a preferable suitable nucleic acid encoding an JNK inhibitor sequence as used herein is typically chosen from human IB1 nucleic acid (GenBank Accession No. (AF074091 ), rat IB1 nucleic acid (GenBank Accession No. AF 108959), or human IB2 (GenBank Accession No AF218778) or from any nucleic acid sequence encoding any of the sequences as defined above, i.e. any sequence according to SEQ ID NO: 1 -26.
- Nucleic acids encoding the JNK inhibitor sequences as used herein or chimeric peptides as used herein may be obtained by any method known in the art (e.g. by PCR amplification using synthetic primers hybridizable to the 3 '- and 5 '-termini of the sequence and/or by cloning from a cDNA or genomic library using an oligonucleotide sequence specific for the given gene sequence). Additionally, nucleic acid sequences are disclosed herein as well, which hybridize under stringent conditions with the appropriate strand coding for a (native) JNK inhibitor sequence or chimeric peptide as defined above.
- nucleic acid sequences comprise at least 6 (contiguous) nucleic acids, which have a length sufficient to allow for specific hybridization. More preferably, such nucleic acid sequences comprise 6 to 38, even more preferably 6 to 30, and most preferably 6 to 20 or 6 to 1 0 (contiguous) nucleic acids.
- stringent conditions are sequence dependent and will be different under different circumstances. Generally, stringent conditions can be selected to be about 5°C lower than the thermal melting point (TM) for the specific sequence at a defined ionic strength and pH. The TM is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is at least about 0.02 molar at pH 7 and the temperature is at least about 60°C. As other factors may affect the stringency of hybridization (including, among others, base composition and size of the complementary strands), the presence of organic solvents and the extent of base mismatching, the combination of parameters is more important than the absolute measure of any one.
- High stringency conditions may comprise the following, e.g. Step 1 : Filters containing DNA are pretreated for 8 hours to overnight at 65°C in buffer composed of 6*SSC, 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 pg/ml denatured salmon sperm DNA. Step 2: Filters are hybridized for 48 hours at 65°C. in the above prehybridization mixture to which is added 100 mg/ml denatured salmon sperm DNA and 5- 20*10 6 cpm of 32 P-labeled probe.
- Step 3 Filters are washed for 1 hour at 37°C in a solution containing 2*SSC, 0.01 % PVP, 0.01 % Ficoll, and 0.01 % BSA. This is followed by a wash in 0.1 *SSC at 50°C for 45 minutes.
- Step 4 Filters are autoradiographed. Other conditions of high stringency that may be used are well known in the art (see e.g. Ausubel et al., (eds.), 1993, Current Protocols in Molecular Biology, John Wiley and Sons, NY; and Kriegler, 1 990, Gene Transfer and Expression, a Laboratory Manual, Stockton Press, NY).
- Moderate stringency conditions can include the following: Step 1 : Filters containing DNA are pretreated for 6 hours at 55°C. in a solution containing 6*SSC, 5*Denhardt's solution, 0.5% SDS and 100 mg/ml denatured salmon sperm DNA. Step 2: Filters are hybridized for 18-20 hours at 55°C in the same solution with 5-20*10 6 cpm 32 P-labeled probe added. Step 3: Filters are washed at 37°C for 1 hour in a solution containing 2*SSC, 0.1 % SDS, then washed twice for 30 minutes at 60°C in a solution containing 1 *SSC and 0.1 % SDS.
- Step 4 Filters are blotted dry and exposed for autoradiography.
- Other conditions of moderate stringency that may be used are well-known in the art (see e.g. Ausubel et al., (eds.), 1 993, Current Protocols in Molecular Biology, John Wiley and Sons, NY; and Kriegler, 1 990, Gene Transfer and Expression, a Laboratory Manual, Stockton Press, NY).
- low stringency conditions can include: Step 1 : Filters containing DNA are pretreated for 6 hours at 40°C in a solution containing 35% formamide, 5X SSC, 50 mM Tris- HCI (pH 7.5), 5 mM EDTA, 0.1 % PVP, 0.1 % Ficoll, 1 % BSA, and 500 g/ml denatured salmon sperm DNA.
- Step 2 Filters are hybridized for 1 8-20 hours at 0°C in the same solution with the addition of 0.02% PVP, 0.02% Ficoll, 0.2% BSA, 100 pg/ml salmon sperm DNA, 10% (w ol) dextran sulfate, and 5-20 x 106 cpm 32 P-labeled probe.
- Step 3 Filters are washed for 1 .5 hours at 55 C in a solution containing 2X SSC, 25 mM Tris-HCI (pH 7.4), 5 mM EDTA, and 0.1 % SDS. The wash solution is replaced with fresh solution and incubated an additional 1 .5 hours at 60°C.
- Step 4 Filters are blotted dry and exposed for autoradiography. If necessary, filters are washed for a third time at 65-68°C and reexposed to film.
- Other conditions of low stringency that may be used are well known in the art (e.g. as employed for cross-species hybridizations). See e.g. Ausubel et al., (eds.), 1 993, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley and Sons, NY; and Kriegler, 1 990, GENE TRANSFER AND EXPRESSION, A LABORATORY MANUAL, Stockton Press, NY.
- nucleic acid sequences as defined above according to the present invention can be used to express peptides, i.e. an JNK inhibitor sequence as used herein or an chimeric peptide as used herein for analysis, characterization or therapeutic use; as markers for tissues in which the corresponding peptides (as used herein) are preferentially expressed (either constitutively or at a particular stage of tissue differentiation or development or in disease states).
- Other uses for these nucleic acids include, e.g. molecular weight markers in gel electrophoresis-based analysis of nucleic acids.
- expression vectors may be used for the above purposes for recombinant expression of one or more JNK inhibitor sequences and/or chimeric peptides as defined above.
- expression vector is used herein to designate either circular or linear DNA or RNA, which is either double-stranded or single- stranded. It further comprises at least one nucleic acid as defined above to be transferred into a host cell or into a unicellular or multicellular host organism.
- the expression vector as used herein preferably comprises a nucleic acid as defined above encoding the JNK inhibitor sequence as used herein or a fragment or a variant thereof, or the chimeric peptide as used herein, or a fragment or a variant thereof.
- an expression vector according to the present invention preferably comprises appropriate elements for supporting expression including various regulatory elements, such as enhancers/promoters from viral, bacterial, plant, mammalian, and other eukaryotic sources that drive expression of the inserted polynucleotide in host cells, such as insulators, boundary elements, LCRs (e.g. described by Blackwood and Kadonaga (1 998), Science 281, 61 -63) or matrix/scaffold attachment regions (e.g. described by Li, Harju and Peterson, (1 999), Trends Genet. 15, 403-408).
- the regulatory elements are heterologous (i.e. not the native gene promoter).
- promoter refers to a region of DNA that functions to control the transcription of one or more nucleic acid sequences as defined above, and that is structurally identified by the presence of a binding site for DNA-dependent RNA-polymerase and of other DNA sequences, which interact to regulate promoter function.
- a functional expression promoting fragment of a promoter is a shortened or truncated promoter sequence retaining the activity as a promoter. Promoter activity may be measured by any assay known in the art (see e.g.
- the term "enhancer”, as used herein, is a DNA regulatory element that enhances, augments, improves, or ameliorates expression of a gene irrespective of its location and orientation vis-a-vis the gene to be expressed, and may be enhancing, augmenti ng, improvi ng, or ameliorating expression of more than one promoter.
- promoter/enhancer sequences to be used in the expression vector as defined herei n may utilize plant, animal, insect, or fungus regulatory sequences.
- promoter/enhancer elements can be used from yeast and other fungi (e.g. the GAL4 promoter, the alcohol dehydrogenase promoter, the phosphoglycerol kinase promoter, the alkaline phosphatase promoter).
- yeast and other fungi e.g. the GAL4 promoter, the alcohol dehydrogenase promoter, the phosphoglycerol kinase promoter, the alkaline phosphatase promoter.
- they may include animal transcriptional control regions, e.g. (i) the insulin gene control region active within pancreatic beta-cells (see e.g. Hanahan, et al., 1 985.
- the expression vector as defined herein may comprise an amplification marker.
- This amplification marker may be selected from the group consisting of, e.g. adenosine deaminase (ADA), dihydrofolate reductase (DHFR), multiple drug resistance gene (MDR), ornithine decarboxylase (ODC) and N-(phosphonacetyl)-L-aspartate resistance (CAD).
- Exemplary expression vectors or their derivatives suitable for the present invention particularly include, e.g. human or animal viruses (e.g. vaccinia virus or adenovirus); insect viruses (e.g. baculovirus); yeast vectors; bacteriophage vectors (e.g. lambda phage); plasmid vectors and cosmid vectors.
- human or animal viruses e.g. vaccinia virus or adenovirus
- insect viruses e.g. baculovirus
- yeast vectors e.g. bacteriophage vectors (e.g. lambda phage); plasmid vectors and cosmid vectors.
- the present invention additionally may utilize a variety of host-vector systems, which are capable of expressing the peptide coding sequence(s) of nucleic acids as defined above.
- host-vector systems which are capable of expressing the peptide coding sequence(s) of nucleic acids as defined above.
- These include, but are not limited to: (i) mammalian cell systems that are infected with vaccinia virus, adenovirus, and the like; (ii) insect cell systems infected with baculovirus and the like; (iii) yeast containing yeast vectors or (iv) bacteria transformed with bacteriophage, DNA, plasmid DNA, or cosmid DNA.
- any one of a number of suitable transcription and translation elements may be used.
- a host cell strain suitable for such a host-vector system, may be selected that modulates the expression of inserted sequences of interest, or modifies or processes expressed peptides encoded by the sequences in the specific manner desired.
- expression from certain promoters may be enhanced in the presence of certain inducers in a selected host strain; thus facilitating control of the expression of a genetically-engineered peptide.
- different host cells possess characteristic and specific mechanisms for the translational and post-trans I ationa I processing and modification (e.g. glycosylation, phosphorylation, and the like) of expressed peptides. Appropriate cell lines or host systems may thus be chosen to ensure the desired modification and processing of the foreign peptide is achieved.
- peptide expression within a bacterial system can be used to produce an non-glycosylated core peptide; whereas expression within mammalian cells ensures "native" glycosylation of a heterologous peptide.
- the present invention further provides the use of antibodies directed against the JNK inhibitor sequences and/or chimeric peptides as described above, for preparing a pharmaceutical composition for the treatment of diseases or disorders strongly related to JNK signaling as defined herein. Furthermore, efficient means for production of antibodies specific for JNK inhibitor sequences according to the present invention, or for chimeric peptides containing such an inhibitor sequence, are described and may be utilized for this purpose.
- JNK inhibitor sequences and/or chimeric peptides as defined herein, as well as, fragments, variants or derivatives thereof, may be utilized as immunogens to generate antibodies that immunospecifically bind these peptide components.
- Such antibodies include, e.g. polyclonal, monoclonal, chimeric, single chain, Fab fragments and a Fab expression library.
- the present invention provides antibodies to chimeric peptides or to JNK inhibitor sequences as defined above.
- various procedures known within the art may be used for the production of these antibodies.
- various host animals may be immunized for production of polyclonal antibodies by injection with any chimeric peptide or JNK inhibitor sequence as defined above.
- adjuvants may be used thereby to increase the immunological response which include, but are not limited to, Freund's (complete and incomplete) adjuvant, mineral gels (e.g. aluminum hydroxide), surface active substances (e.g. lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), CpG, polymers, Pluronics, and human adjuvants such as Bacille Calmette-Guerin and Corynebacterium parvum.
- mineral gels e.g. aluminum hydroxide
- surface active substances e.g. lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.
- CpG polymers
- Pluronics and human adjuvants
- human adjuvants such as Bacille Calmette-Guerin and Corynebacterium parvum.
- any technique may be utilized that provides for the production of antibody molecules by continuous cell line culture.
- Such techniques include, but are not limited to, the hybridoma technique (see Kohler and Milstein, 1975. Nature 256: 495-497); the trioma technique; the human B-cell hybridoma technique (see Kozbor, et a/., 1983, Immunol Today 4: 72) and the EBV hybridoma technique to produce human monoclonal antibodies (see Cole, et al., 1985. In: Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96).
- Human monoclonal antibodies may be utilized in the practice of the present invention and may be produced by the use of human hybridomas (see Cote, etal., 1983. Proc Natl Acad Sci USA 80: 2026-2030) or by transforming human B-cells with Epstein Barr Virus in vitro ⁇ see Cole, a/., 1 985. In: Monoclonal Antibodies and Cancer Therapy (Alan R. Liss, Inc., pp. 77-96).
- techniques can be adapted for the production of single-chain antibodies specific to the JNK inhibitor sequences and/or chimeric peptides (see e.g. U. S. Patent No. 4,946,778) as defined herein.
- methods can be adapted for the construction of Fab expression libraries (see e.g. Huse etal., 1989. Science 246: 1275-1281 ) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for these JNK inhibitor sequences and/or chimeric peptides.
- Non-human antibodies can be "humanized" by techniques well known in the art (see e.g. U. S. Patent No. 5,225,539).
- Antibody fragments that contain the idiotypes to a JNK inhibitor sequences and/or chimeric peptide as defined herein may be produced by techniques known in the art including, e.g. (i) a F(ab') 2 fragment produced by pepsin digestion of an antibody molecule; (ii) a Fab fragment generated by reducing the disulfide bridges of an F(ab') 2 fragment ; (iii) a Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent and (iv) Fv fragments.
- ELISA enzyme- linked immunosorbent assay
- selection of antibodies that are specific to a particular epitope of an JNK inhibitor sequence and/or an chimeric peptide as defined herein is facilitated by generation of hybridomas that bind to the fragment of an JNK inhibitor sequence and/or an chimeric peptide, as defined herein, possessing such an epitope.
- ELISA enzyme- linked immunosorbent assay
- the antibodies as defined herein may be used in methods known within the art referring to the localization and/or quantification of an JNK inhibitor sequence (and/or correspondingly to a chimeric peptide as defined above), e.g. for use in measuring levels of the peptide within appropriate physiological samples, for use in diagnostic methods, or for use in imaging the peptide, and the like.
- JNK inhibitor sequences, chimeric peptides, nucleic acids, vectors, host cells and/or antibodies as defined according to the invention can be formulated in a pharmaceutical composition, which may be applied in the prevention or treatment of any of the diseases as defined herein, particularly in the prevention or treatment of diseases or disorders strongly related to JNK signaling as defined herein.
- such a pharmaceutical composition used according to the present invention includes as an active component, e.g.: (i) any one or more of the JNK inhibitor sequences and/or chimeric peptides as defined above, and/or variants, fragments or derivatives thereof, particularly JNK inhibitor sequences according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 and/or chimeric peptides according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or JNK inhibitor sequences according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions; and/or (ii) nucleic acids encoding an JNK inhibitor sequence and/or an chimeric peptide as defined above and/or variants or fragments thereof, and/or (iii) cells comprising any one or more of
- such a pharmaceutical composition as used according to the present invention typically comprises a safe and effective amount of a component as defined above, preferably of at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 1 3 to 20 and 33-100 and/or at least one chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 1 3 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5-8 and 21 to 22, or variants or fragments thereof within the above definitions, or at least one nucleic acids encoding same, or at least one vector, host cell or antibody as defined above.
- a component as defined above preferably of at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 1 3 to 20 and 33-100 and/or at least one chimeric peptide according to any of sequence
- the inventors of the present invention additionally found, that the JNK-inhibitor sequence and the chimeric peptide, respectively, as defined herein, exhibit a particular well uptake rate into cells involved in the diseases of the present invention. Therefore, the amount of a JNK- inhibitor sequence and chimeric peptide, respectively, in the pharmaceutical composition to be administered to a subject, may -without being limited thereto - have a very low dose. Thus, the dose may be much lower than for peptide drugs known in the art, such as DTS-108 (Florence Meyer-Losic et al., Clin Cancer Res., 2008, 2145-53). This has several positive aspects, for example a reduction of potential side reactions and a reduction in costs.
- the dose (per kg bodyweight) is in the range of up to 10 mmol/kg, preferably up to 1 mmol/kg, more preferably up to 100 pmol/kg, even more preferably up to 10 pmol/kg, even more preferably up to 1 pmol/kg, even more preferably up to 100 nmol/kg, most preferably up to 50 nmol/kg.
- the dose range may preferably be from about 1 pmol/kg to about 1 mmol/kg, from about 10 pmol/kg to about 0,1 mmol/kg, from about 10 pmol/kg to about 0,01 mmol/kg, from about 50 pmol/kg to about 1 pmol/kg, from about 100 pmol/kg to about 500 nmol/kg, from about 200 pmol/kg to about 300 nmol/kg, from about 300 pmol/kg to about 100 nmol/kg, from about 500 pmol/kg to about 50 nmol/kg, from about 750 pmol/kg to about 30 nmol/kg, from about 250 pmol/kg to about 5 nmol/kg, from about 1 nmol/kg to about 10 nmol/kg, or a combination of any two of said values.
- a "safe and effective amount" as defined above for components of the pharmaceutical compositions as used according to the present invention means an amount of each or all of these components, that is sufficient to significantly induce a positive modification of diseases or disorders strongly related to JNK signal ing as defined herein.
- a "safe and effective amount” is smal l enough to avoid serious side- effects, that is to say to permit a sensible relationship between advantage and risk.
- the determination of these limits typical ly lies within the scope of sensible medical judgment.
- a "safe and effective amount” of such a component will vary in connection with the particular condition to be treated and also with the age and physical condition of the patient to be treated, the severity of the condition, the duration of the treatment, the nature of the accompanying therapy, of the particular pharmaceutically acceptable carrier used, and similar factors, within the knowledge and experience of the accompanying doctor.
- the pharmaceutical compositions according to the invention can be used according to the invention for human and also for veterinary medical purposes.
- the pharmaceutical composition as used according to the present invention may furthermore comprise, in addition to one of these substances, a (compatible) pharmaceutical ly acceptable carrier, excipient, buffer, stabilizer or other materials wel l known to those ski l led in the art.
- the expression "(compatible) pharmaceutically acceptable carrier” preferably includes the liquid or non-liquid basis of the composition.
- the term “compatible” means that the constituents of the pharmaceutical composition as used herein are capable of being mixed with the pharmaceutically active component as defined above and with one another component in such a manner that no interaction occurs which would substantial ly reduce the pharmaceutical effectiveness of the composition under usual use conditions.
- Pharmaceutically acceptable carriers must, of course, have sufficiently high purity and sufficiently low toxicity to make them suitable for administration to a person to be treated. If the pharmaceutical composition as used herein is provided in liquid form, the pharmaceutically acceptable carrier will typically comprise one or more (compatible) pharmaceutically acceptable liquid carriers.
- the composition may comprise as (compatible) pharmaceutically acceptable liquid carriers e.g.
- pyrogen-free water e.g. pyrogen-free water
- isotonic saline or buffered (aqueous) solutions e.g. phosphate, citrate etc. buffered solutions
- vegetable oils such as, for example, groundnut oil, cottonseed oil, sesame oil, olive oil, corn oil and oil from theobroma
- polyols such as, for example, polypropylene glycol, glycerol, sorbitol, mannitol and polyethylene glycol
- alginic acid etc.
- a buffer preferably an aqueous buffer, may be used.
- the pharmaceutically acceptable carrier will typically comprise one or more (compatible) pharmaceutically acceptable solid carriers.
- the composition may comprise as (compatible) pharmaceutically acceptable solid carriers e.g. one or more compatible solid or liquid fillers or diluents or encapsulating compounds may be used as well, which are suitable for administration to a person.
- suitable pharmaceutically acceptable solid carriers are e.g.
- sugars such as, for example, lactose, glucose and sucrose
- starches such as, for example, corn starch or potato starch
- cellulose and its derivatives such as, for example, sodium carboxymethylcellulose, ethylcellulose, cellulose acetate
- powdered tragacanth malt
- gelatin gelatin
- tallow solid glidants, such as, for example, stearic acid, magnesium stearate; calcium sulphate, etc.
- the precise nature of the (compatible) pharmaceutically acceptable carrier or other material may depend on the route of administration.
- the choice of a (compatible) pharmaceutically acceptable carrier may thus be determined in principle by the manner in which the pharmaceutical composition as used according to the invention is administered.
- the pharmaceutical composition as used according to the invention can be administered, for example, systemically.
- Routes for administration include, for example, parenteral routes (e.g. via injection), such as intravenous, intramuscular, subcutaneous, intradermal, or transdermal routes, etc., enteral routes, such as oral, or rectal routes, etc., topical routes, such as nasal, or intranasal routes, etc., or other routes, such as epidermal routes or patch delivery.
- the suitable amount of the pharmaceutical composition to be used can be determined by routine experiments with animal models. Such models include, without implying any limitation, rabbit, sheep, mouse, rat, dog and non-human primate models.
- Preferred unit dose forms for injection include sterile solutions of water, physiological saline or mixtures thereof. The pH of such solutions should be adjusted to about 7.4.
- Suitable carriers for injection include hydrogels, devices for controlled or delayed release, polylactic acid and collagen matrices.
- Suitable pharmaceutically acceptable carriers for topical application include those, which are suitable for use in lotions, creams, gels and the like. If the compound is to be administered perorally, tablets, capsules and the like are the preferred unit dose form.
- the pharmaceutically acceptable carriers for the preparation of unit dose forms which can be used for oral administration are well known in the prior art. The choice thereof will depend on secondary considerations such as taste, costs and storability, which are not critical for the purposes of the present invention, and can be made without difficulty by a person skilled in the art.
- compositions for oral administration may be in tablet, capsule, powder or liquid form.
- a tablet may include a solid carrier as defined above, such as gelatin, and optionally an adjuvant.
- Liquid pharmaceutical compositions for oral administration generally may include a liquid carrier as defined above, such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
- the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
- Preservatives, stabilizers, buffers, antioxidants and/or other additives may be included, as required.
- administration is preferably in a "prophylactically effective amount or a "therapeutically effective amount” (as the case may be), this being sufficient to show benefit to the individual.
- a proliferatively effective amount or a "therapeutically effective amount” (as the case may be)
- the actual amount administered, and rate and time-course of administration will depend on the nature and severity of what is being treated.
- Prevention and/or treatment of a disease as defined herein typically includes administration of a pharmaceutical composition as defined above.
- the term "modulate” includes the suppression of expression of JNK when it is over-expressed in any of the above diseases. It also includes suppression of phosphorylation of c-jun, ATF2 or NFAT4 in any of the above diseases, for example, by using at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 1 3 to 20 and 33-1 00 and/or at least one chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions, as a competitive inhibitor of the natural c-jun, ATF2 and NFAT4 binding site in a cell
- modulate also includes suppression of hetero- and homomeric complexes of transcription factors made up of, without being limited thereto, c-jun, ATF2, or NFAT4 and their related partners, such as for example the AP-1 complex that is made up of c-jun, AFT2 and c-fos.
- suppressive JNK inhibitor sequences can be introduced to a cell.
- modulate may then include the increase of JNK expression, for example by use of an IB peptide-specific antibody that blocks the binding of an IB-peptide to JNK, thus preventing JNK inhibition by the IB-related peptide.
- Prevention and/or treatment of a subject with the pharmaceutical composition as disclosed above may be typically accomplished by administering ⁇ in vivo) an ("therapeutically effective") amount of said pharmaceutical composition to a subject, wherein the subject may be e.g. any mammal, e.g. a human, a primate, mouse, rat, dog, cat, cow, horse or pig.
- therapeutically effective means that the active component of the pharmaceutical composition is of sufficient quantity to ameliorate the disease or disorder strongly related to JNK signaling as defined above.
- any peptide as defined above e.g. at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 1 3 to 20 and 33-100 and/or at least one chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or at least one JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 13 to 20 and 33-100 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions, may be utilized in a specific embodiment of the present invention to treat diseases or disorders strongly related to JNK signaling as defined above, e.g. by modulating activated JNK signaling pathways.
- gene therapy refers to therapy that is performed by administration of a specific nucleic acid as defined above to a subject, e.g. by way of a pharmaceutical composition as defined above, wherein the nucleic acid(s) exclusively comprise(s) L-amino acids.
- the nucleic acid produces its encoded peptide(s), which then serve(s) to exert a therapeutic effect by modulating function of the disease or disorder.
- Any of the methods relating to gene therapy available within the art may be used in the practice of the present invention (see e.g. Goldspiel, eta/., 1 993. Clin Pharm 12: 488-505).
- the nucleic acid as defined above and as used for gene therapy is part of an expression vector encoding and expressing any one or more of the IB-related peptides as defined above within a suitable host, i.e. an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 1 3 to 20 and 33-100 and/or a chimeric peptide according to any of sequences of SEQ ID NOs: 9 to 12 and 23 to 32, and/or an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 1 3 to 20 and 33-1 00 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or variants or fragments thereof within the above definitions.
- a suitable host i.e. an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 1 3 to 20 and 33-100 and/or a chimeric peptide according to any of sequences of SEQ ID NOs: 9 to
- such an expression vector possesses a promoter that is operably-linked to coding region(s) of a JNK inhibitor sequence.
- the promoter may be defined as above, e.g. inducible or constitutive, and, optionally, tissue-specific.
- a nucleic acid molecule as defined above is used for gene therapy, in which the coding sequences of the nucleic acid molecule (and any other desired sequences thereof) as defined above are flanked by regions that promote homologous recombination at a desired site within the genome, thus providing for intra-chromosomal expression of these nucleic acids (see e.g. Roller and Smithies, 1 989. Proc Natl Acad Sci USA 86: 8932-8935).
- nucleic acid as defined above according to the invention into a patient for the purpose of gene therapy, particular in the context of the above mentioned diseases or disorders strongly related to JNK signaling as defined above may be either direct (i.e. the patient is directly exposed to the nucleic acid or nucleic acid-containing vector) or indirect (i.e. cells are first transformed with the nucleic acid in vitro, then transplanted into the patient). These two approaches are known, respectively, as in vivo or ex vivo gene therapy.
- a nucleic acid is directly administered in vivo, where it is expressed to produce the encoded product. This may be accomplished by any of numerous methods known in the art including, e.g.
- nucleic acid as part of an appropriate nucleic acid expression vector and administering the same in a manner such that it becomes intracellular (e.g. by infection using a defective or attenuated retroviral or other viral vector; see U. S. Patent No. 4,980,286); directly injecting naked DNA; using microparticle bombardment (e.g.
- a "GeneGun” Biolistic, DuPont
- coating the nucleic acids with lipids using associated cell-surface receptors/transfecting agents; encapsulating in liposomes, microparticles, or microcapsules; administering it in linkage to a peptide that is known to enter the nucleus; or by administering it in linkage to a ligand predisposed to receptor-mediated endocytosis (see e.g. Wu and Wu, 1 987.J Biol Chem 262: 4429-4432), which can be used to "target" cell types that specifically express the receptors of interest, etc.
- An additional approach to gene therapy in the practice of the present invention involves transferring a gene (comprising a nucleic acid as defined above) into cells in in vitro tissue culture by such methods as electroporation, lipofection, calcium phosphate-mediated transfection, viral infection, or the like.
- the method of transfer includes the concomitant transfer of a selectable marker to the cells.
- the cells are then placed under selection pressure (e.g. antibiotic resistance) so as to facilitate the isolation of those cells that have taken up, and are expressing, the transferred gene. Those cells are then delivered to a patient.
- the nucleic acid prior to the in vivo administration of the resulting recombinant cell, is introduced into a cell by any method known within the art including e.g. transfection, electroporation, microinjection, infection with a viral or bacteriophage vector containing the nucleic acid sequences of interest, cell fusion, chromosome-mediated gene transfer, microcell-mediated gene transfer, spheroplast fusion, and similar methods that ensure that the necessary developmental and physiological functions of the recipient cells are not disrupted by the transfer. See e.g. Loeffler and Behr, 1 993. Meth Enzymol 21 7 : 599-618.
- the chosen technique should provide for the stable transfer of the nucleic acid to the cell, such that the nucleic acid is expressible by the cell.
- the transferred nucleic acid is heritable and expressible by the cell progeny.
- the resulting recombinant cells may be delivered to a patient by various methods known within the art including, e.g. injection of epithelial cells (e.g. subcutaneously), application of recombinant skin cells as a skin graft onto the patient, and intravenous injection of recombinant blood cells (e.g. hematopoietic stem or progenitor cells).
- epithelial cells e.g. subcutaneously
- recombinant skin cells as a skin graft onto the patient
- recombinant blood cells e.g. hematopoietic stem or progenitor cells.
- the total amount of cells that are envisioned for use depend upon the desired effect, patient state, and the like, and may be determined by one skilled within the art.
- Cells into which a nucleic acid can be introduced for purposes of gene therapy encompass any desired, available cell type, and may be xenogeneic, heterogeneic, syngeneic, or autogeneic.
- Cell types include, but are not limited to, differentiated cells such as epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes and blood cells, or various stem or progenitor cells, in particular embryonic heart muscle cells, liver stem cells (International Patent Publication WO 94/08598), neural stem cells (Stemple and Anderson, 1992, Cell 71 : 973-985), hematopoietic stem or progenitor cells, e.g. as obtained from bone marrow, umbilical cord blood, peripheral blood, fetal liver, and the like.
- the cells utilized for gene therapy are autologous to the patient.
- targeting therapies may be used to deliver the JNK inhibitor sequences, chimeric peptides, and/or nucleic acids as defined above more specifically to certain types of cell, by the use of targeting systems such as (a targeting) antibody or cell specific ligands.
- targeting systems such as (a targeting) antibody or cell specific ligands.
- Antibodies used for targeting are typically specific for cell surface proteins of cells associated with any of the diseases as defined below.
- these antibodies may be directed to cell surface antibodies such as e.g. B cell-associated surface proteins such as MHC class II DR protein, CD1 8 (LFA-1 beta chain), CD45RO, CD40 or Bgp95, or cell surface proteins selected from e.g.
- Targeting constructs may be typically prepared by covalently binding the JNK inhibitor sequences, chimeric peptides, and nucleic acids as defined herein according to the invention to an antibody specific for a cell surface protein or by binding to a cell specific ligand. Proteins may e.g. be bound to such an antibody or may be attached thereto by a peptide bond or by chemical coupling, crossl inking, etc..
- the targeting therapy may then be carried out by administering the targeting construct in a pharmaceutically efficient amount to a patient by any of the administration routes as defined below, e.g. intraperitoneal, nasal, intravenous, oral and patch delivery routes.
- the JNK inhibitor sequences, chimeric peptides, or nucleic acids as defined herein according to the invention, being attached to the targeting antibodies or cell specific ligands as defined above may be released in vitro ox in vivo, e.g. by hydrolysis of the covalent bond, by peptidases or by any other suitable method.
- the JNK inhibitor sequences, chimeric peptides, or nucleic acids as defined herein according to the invention are attached to a small cell specific ligand, release of the ligand may not be carried out. If present at the cell surface, the chimeric peptides may enter the cell upon the activity of its trafficking sequence. Targeting may be desirable for a variety of reasons; for example if the JNK inhibitor sequences, chimeric peptides, and nucleic acids as defined herein according to the invention are unacceptably toxic or if it would otherwise require a too high dosage.
- the JNK inhibitor sequences and/or chimeric peptides as defined herein according to the invention could be produced in the target cells by expression from an encoding gene introduced into the cells, e.g. from a viral vector to be administered.
- the viral vector typically encodes the JNK inhibitor sequences and/or chimeric peptides as defined herein according to the invention.
- the vector could be targeted to the specific cells to be treated.
- the vector could contain regulatory elements, which are switched on more or less selectively by the target cells upon defined regulation.
- This technique represents a variant of the VDEPT technique (virus-directed enzyme prodrug therapy), which utilizes mature proteins instead of their precursor forms.
- the JNK inhibitor sequences and/or chimeric peptides as defined herein could be administered in a precursor form by use of an antibody or a virus. These JNK inhibitor sequences and/or chimeric peptides may then be converted into the active form by an activating agent produced in, or targeted to, the cells to be treated.
- an activating agent produced in, or targeted to, the cells to be treated.
- This type of approach is sometimes known as ADEPT (antibody-directed enzyme prodrug therapy) or VDEPT (virus- directed enzyme prodrug therapy); the former involving targeting the activating agent to the cells by conjugation to a cell-specific antibody, while the latter involves producing the activating agent, e.g. a JNK inhibitor sequence or the chimeric peptide, in a vector by expression from encoding DNA in a viral vector (see for example, EP-A-41 5731 and WO 90/07936).
- immunoassays to detect, prognose, diagnose, or monitor various conditions and disease states selected from diseases or disorders strongly related to JNK signaling as defined above, or monitor the treatment thereof.
- the immunoassay may be performed by a method comprising contacting a sample derived from a patient with an antibody to an JNK inhibitor sequence, a chimeric peptide, or a nucleic acid sequence, as defined above, under conditions such that immunospecific-binding may occur, and subsequently detecting or measuring the amount of any immunospecific-binding by the antibody.
- an antibody specific for an JNK inhibitor sequence, a chimeric peptide or a nucleic acid sequence may be used to analyze a tissue or serum sample from a patient for the presence of JNK or a JNK inhibitor sequence; wherein an aberrant level of JNK is indicative of a diseased condition.
- the immunoassays include, but are not limited to, competitive and non-competitive assay systems using techniques such as Western Blots, radioimmunoassays (RIA), enzyme linked immunosorbent assay (ELISA), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, fluorescent immunoassays, complement-fixation assays, immunoradiometric assays, and protein-A immunoassays, etc..
- ⁇ in vitro assays may be performed by delivering the JNK inhibitor sequences, chimeric peptides, nucleic acid sequences or antibodies to JNK inhibitor sequences or to chimeric peptides, as defined above, to target cells typically selected from e.g. cultured animal cells, human cells or micro-organisms, and to monitor the cell response by biophysical methods typically known to a skilled person.
- the target cells typically used therein may be cultured cells ⁇ in vitro) or in vivo cel ls, i.e. cells composi ng the organs or tissues of living animals or humans, or microorganisms found in l iving animals or humans.
- kits for diagnostic or therapeutic purposes particular for the treatment, prevention or monitoring of diseases or disorders strongly related to JNK signaling as defined above
- the kit includes one or more containers containing JNK inhibitor sequences, chimeric peptides, nucleic acid sequences and/or antibodies to these JNK inhibitor sequences or to chimeric peptides as defined above, e.g.
- an anti-JNK inhibitor sequence antibody to an JNK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 1 3 to 20 and 33-1 00, to a chimeric peptide according to any of sequences of SEQ I D NOs: 9 to 12 and 23 to 32, to an J NK inhibitor sequence according to any of sequences of SEQ ID NOs: 1 to 4 and 1 3 to 20 and 33-1 00 comprising a trafficking sequence according to any of SEQ ID NOs: 5 to 8 and 21 to 22, or to or variants or fragments thereof within the above definitions, or such an anti-JNK inhibitor sequence antibody and, optional ly, a labeled binding partner to the antibody.
- kits for diagnostic use in the treatment, prevention or monitoring of diseases or disorders strongly related to JNK signaling as defined above comprise one or more containers containing nucleic acids that encode, or alternatively, that are the complement to, an JNK inhibitor sequence and/or a chimeric peptide as defined above, optional ly, a labeled binding partner to these nucleic acids, are also provided.
- the kit may be used for the above purposes as a kit, comprising one or more containers, a pair of oligonucleotide primers (e.g.
- kits may, optionally, further comprise a predetermined amount of a purified JNK inhibitor sequence as defined above, a chimeric peptide as defined above, or nucleic acids encoding these, for use as a diagnostic, standard, or control in the assays for the above purposes.
- FIGs. 1 A-C are diagrams showing alignments of conserved JBD domain regions in the indicated transcription factors. JNK inhibitor sequences used herein were identified by carrying out sequence alignments. The results of this alignment are exemplarily shown in Figures 1 A-1 C.
- Figure 1 A depicts the region of highest homology between the JBDs of IB1 , IB2, c-Jun and ATF2.
- Panel B depicts the amino acid sequence of the JBDs of L-IB1 (s) and L-IB1 for comparative reasons. Fully conserved residues are indicated by asterisks, while residues changed to Ala in the GFP-JBD 2 3M U t vector are indicated by open circles.
- Figure 1 C shows the amino acid sequences of chimeric proteins that include a JNK inhibitor sequence and a trafficking sequence.
- the trafficking sequence is derived from the human immunodeficiency virus (HIV) TAT polypeptide
- the JNK inhibitor sequence is derived from an IBl (s) polypeptide.
- Human, mouse, and rat sequences are identical in Panels B and C.
- Fig. 2 is a diagram showing sequences of generic TAT-IB fusion peptides from human, mouse and rat.
- Fig. 3 depicts the results of the inhibition of endogeneous JNK-activity in HepG2 cells using fusion peptides according to SEQ ID NOs: 9 and 1 1 in an one-well approach.
- D- TAT-IB1 (s) according to SEQ ID NO: 1 1 (here abbreviated as D-JNKI) effectively inhibits JNK activity, even better than L-TAT-IBI (s) according to SEQ ID NO: 9 (here abbreviated as L-JNKI).
- Fig. 4 shows the result of the cytotoxicity assay with a chimeric JNK inhibitor sequence according to SEQ ID NO: 1 1 , also termed XG-102 (see Example 12).
- XG-102 SEQ ID NO: 1 1
- HFFs were seeded in 96-well tissue culture plates. Medium containing DMSO (same level as the 5 ⁇ drug), or XG-102 at 1 , 2, and 5 ⁇ was added for 24 h. Neutral Red was briefly added, the cells were fixed, then the dye was extracted. Absorbance was measured at 540nm. No difference was observed between DMSO and 1 ⁇ XG-102.
- XG-102 is a potent inhibitor of Varizella Zoster Virus (VZV), particularly at concentrations of 0.5 ⁇ and 1 ⁇ shows the results of the inhibition of Varizella Zoster Virus (VZV) in cultured human fibroblasts using a chimeric JNK inhibitor sequence according to SEQ ID NO: 1 1 , also termed XG-102 (see Example 12).
- VZV shows a significant sensitivity to XG-102 (SEQ ID NO: 1 1 ).
- VZV replication was normal in the presence of the negative control (XG-100, the Tat peptide alone).
- XG-102 (SEQ ID NO: 1 1 ) thus prevented VZV replication already at the lowest concentration tested of 0.25 ⁇ .
- COPD Chronic Obstructive Pulmonary Disease
- XG-102 (SEQ ID NO: 1 1 ) had thus only little effect on the MPO levels in the lung. depicts the activity of XG-102 (SEQ ID NO: 1 1 ) on TNF levels in the treatment of Chronic Obstructive Pulmonary Disease (COPD) using an animal model of Bleomycin induced acute lung fibrosis.
- COPD Chronic Obstructive Pulmonary Disease
- a trend to reduction of the TNF level in BALF after administration of XG-102 (SEQ ID NO: 1 1 ) was observed in the BLM model. TNF levels are very low after BLM.
- XG-102 SEQ ID NO: 1 1
- COPD Chronic Obstructive Pulmonary Disease
- XG-102 reduces significantly the lymphocyte recruitment and the number of total cells recruited during the inflammatory stage characterised at this point by the lymphocytes recruitment.
- the Graphs represent the ABi- 4 o (left) and ⁇ -42 (right) levels determined by ELISA in different brain homogenate fractions with Triton 40 and Triton 42. Data are represented as scattered dot plot with individual values (black) and group mean ⁇ SEM. Significant differences are marked with asterisks (* p ⁇ 0.05; ** p ⁇ 0.01 ). Significant group differences were observed only in Triton X-100 fraction for ⁇ - 42 . depicts the effects of a treatment with XG-102 (SEQ ID NO: 1 1 ) on CSF ⁇ ,- 40 and ⁇ , -42 levels determined by ELISA.
- the Graphs represent the ⁇ _ 40 (left) and ⁇ _ 42 (right) levels determined by ELISA in CSF. Data are represented as scattered dot plot with individual values (black) and group mean + SEM. Significant differences are marked with asterisks (* p ⁇ 0.05; ** p ⁇ 0.01 ). Treatment with XG-102 (SEQ ID NO: 1 1 ) in both dosages led to a significant decrease of ⁇ . 40 and ⁇ - 42 in CSF.
- Fig. 13 shows the treatment effects on the ThioflavinS staining visualized number of plaques in the hAPP Tg mice: The graphs represent the number of ThioflavinS stained plaques per mm 2 in the cortex and the hippocampus.
- *...p ⁇ 0.05; **...p ⁇ 0.01 depicts the treatment effects on the ThioflavinS visualized plaque area [%] in the hAPP Tg mice: The Graphs represent the plaque area [%] of ThioflavinS positive plaques in the cortex and the hippocampus.
- Fig. 15 describes the results of the administration of XG-1 02 (SEQ ID NO: 1 1 ) on fasting blood glucose levels (absolute and relative) in the animal model for diabetes type 2.
- Fasting blood glucose was measured every third day until day 68 and on a regular basis until termination at day 1 1 1 in groups A and C.
- XG-102 SEQ ID NO: 1 1
- the fasting blood glucose levels of the mice treated with XG-102 (SEQ ID NO: 1 1 ) (10 mg/kg) reached a low plateau of approximately 5 mmol/L.
- Fig. 16 describes the results of the administration of XG-1 02 (SEQ ID NO: 1 1 ), 10 mg/kg on body weight in the animal model for diabetes type 2.
- XG-102 SEQ ID NO: 1 1
- Fig. 16 describes the results of the administration of XG-1 02 (SEQ ID NO: 1 1 ), 10 mg/kg on body weight in the animal model for diabetes type 2.
- XG-102 SEQ ID NO: 1 1
- Fig. 16 describes the results of the administration of XG-1 02 (SEQ ID NO: 1 1 ), 10 mg/kg on body weight in the animal model for diabetes type 2.
- Fig. 1 7, 18 describe the effect of vehicle or XG-102 (SEQ ID NO: 1 1 ) (10 mg/kg) in the animal model for diabetes type 2 on 24 hour food and water intake, and urine and faeces production as measured in metabolic cages on study day 68 in Figures 1 7 (g) and 1 8 (normalized to g of body weight).
- XG-102 SEQ ID NO: 1 1
- FIG. 19, 20 describe the effect of vehicle or XG-102 (SEQ ID NO: 1 1 ) (10 mg/kg) in the animal model for diabetes type 2 as measured on day 57, 77 and 108 on plasma levels of insulin, MCP-1 and IL-6 in Figure 19; on plasma levels of tPAI-1 , TNF and resistin in Figure 20; We observed no significant effects of XG-102 (SEQ ID NO: 1 1 ) (1 0 mg/kg) on any of the measured parameters as compared to vehicle control except the levels of plasma resistin, which was significantly higher in XG-102 (SEQ ID NO: 1 1 ) treated animals at day 77 and 108.
- FIG. 24 Primary cultured macrophages were incubated with XG-102 (SEQ ID NO: 1 1 ) and extensively washed. Presence of XG-102 (SEQ ID NO: 1 1 ) was revealed using a specific antibody against XG-102. XG-1 02 is strongly incorporated into primary macrophages.
- FIG 25 Mice were treated via three different routes of administration (s.c, i.v., i.p.) with radiolabeled peptides with C 14 (1 mg/kg). Animals were sacrificed 72 hours after injection and processed for immunoradiography. Sagital sections were exposed and revealed the accumulation XG-102 peptides in the liver, spleen, and bone marrow predominantly (XG-102: SEQ ID NO: 1 1 ).
- Figure 26 shows an immunostaining against XG-102 (SEQ ID NO: 1 1 ) in the liver of rats injected with I mg/kg of XG-102 i.v. Animals were sacrificed 24 hours after injection. Revelation was done using DAB substrate. This figure shows again the pronounced accumulation of XG-102 in the liver, and especially, in the Kupffer cells (macrophages).
- Figure 27 shows the inhibition of Cytokine & Chemokine Release in two cell lines.
- XG- 102 (SEQ ID NO:1 1 ) inhibits cytokine release in both myeloid and lymphoid cell lines, reducing LPS-induced TNFa, IL-6 and MCP-1 release in THP-1 cells (Panels A-C) and PMA & ionomycin-induced IFNg, IL-6 and IL-2 production in Jurkat cells (Panels D- F).
- the control (XG-101 ) is less effective due to its lesser stability.
- Figure 28 shows the inhibition of cytokine release in primary cells.
- NO:1 1 also inhibits cytokine release in primary lymphoid and myeloid cells, reducing LPS-induced TNFa, IL-6 and Rantes release in murine macrophages
- Figure 29 shows the IB1 cDNA sequence from rat and its predicted amino acid sequence (SEQ ID NO:102)
- Figure 30 shows the IB1 protein sequence from rat encoded by the exon-intron boundary of the rlB1 gene - splice donor (SEQ ID NO:103)
- Figure 31 shows the IB1 protein sequence from Homo sapiens (SEQ ID NO:1 04)
- Figure 32 shows the IB1 cDNA sequence from Homo sapiens SEQ ID NO:105
- Figure 33 Effect on islet Isolation on JNK/p38 activation. That experiment was designed to identify any effect evoked by the isolation process as such on JNK or p38. As control tubulin detection was used. Western blot stainig as a function of the digestion time (min) is shown.
- Figure 38 shows that XG-103 increases significantly islet viability (OCR/DNA) as measured after 7 days of culturing
- Figure 39 Figure 41 (A): Fluorescein angiography evaluation (mean score) ten minutes after fluorescein injection. The mean score is presented for day 14 and day 21 for five groups (XG-102 300 microgramm/ml, XG-102 3mg/ml, Kencort retard, 0,9 % NaCI solution, untreated)
- Fig 41 Proportion of fluorescein angiography evaluation (mean score) ten minutes after fluorescein injection, for five groups (XG-1 02 300 microgramm/ml, XG-102 3mg/ml, Kencort retard, 0,9 % NaCI solution, untreated) at day 14 and day 21 .
- Figure 40 The design of the experiment for assessing XG-102's effect on kidney tissue upon adriamycin-induced induction of nephropathy is shown. The rat groups and the and their treatment regimen is shown.
- the ELISA assay was used to dertmine the albumin concentration for group 1 , group 4 and group 5 as a function of the observation period (day 5, 8, 1 1 , 14, 1 7, 20, 23, 26, 29, 32, 25, 38, 41 )
- Adriamycin treated histological preparation in the middle: Adriamycin and XG-102 treated (resulting in a significant reduction of c-jun expression in the interstitium) and control on the right.
- Figure 47 Histological analysis (staining) of c-jun expression 14 days after onset of the experiment.
- Adriamycin treated histological preparation in the middle: Adriamycin and XG-1 02 treated (resulting in a significant reduction of c-jun expression in the interstitium) and control on the right.
- Figure 48 shows the renal function assessed by protidemia (A) and urea level (B) of rats in an Adriamycin (ADR)-induced nephropathy model on Days 8, 14, 29, 41 and 56 after ADR administration.
- ADR protidemia
- ADR + XG-102 groups No. 1
- ADR + XG-102 groups No. 3
- NaCI no. 4
- XG-102 received 0.9% NaCL.
- groups Nos. 2 and 4 have been treated on Day 0 with XG-1 02, whereas groups Nos. 1 and 3 received vehicle (0.9% NaCI).
- Figure 49 shows kidney sections of the rats in the Adriamycin (ADR)-induced nephropathy model stained with periodic acid-Schiff (PAS) (original magnification x40).
- ADR has been administered only to the groups “ADR” and “ADR + XG102", whereas the group “NaCI” received 0.9% NaCL only.
- the group “ADR + XG102” has been treated on Day 0 with XG-102, whereas the other groups (“ADR" and "NaCI”) received vehicle (0.9% NaCI).
- Figure 50 shows the kidney fibrosis in ADR nephropathy evaluated with Masson's trichrome (blue) on Days 8 (left four panels) and 56 (right four panels) following ADR administration for the group "ADR" (upper panel), which has been treated with ADR and vehicle at Day 0 and for the group "ADR + XG102" (lower panel), which has been treated with ADR and XG-102 at Day 0.
- the original magnification x10 is depicted in the left panels for the respective day and the original magnification x40 is depicted in the right panels for the respective day.
- PAN puromycine aminonucleoside
- Figure 52 shows the effects of XG-102 on the glomerulosclerosis injury in puromycine aminonucleoside (PAN)-induced nephropathy.
- XG-102 has been administered to Groups 3 to 6 (labelled as “cpd” in the legend).
- the Group 2 and the Group 6 are different in term of number of iv injections as stated in the study plan of Example 20. Note that the score for Group 2 is very similar to the one reported by Najakima et al. (2010) using the same experimental protocol.
- Figure 53 shows the effects of XG-102 on the glomerular damage in puromycine aminonucleoside (PAN)-induced nephropathy.
- XG-102 has been administered to Groups 3 to 6 (labelled as “cpd” in the legend).
- the Group 2 and the Group 6 are different in term of number of iv injections as stated in the study plan of Example 20.
- Figure 54 shows the study schedule of Example 21 investigating the effects of chronic administration of XG-102 in a rat model of diabetic nephropathy. Animals were placed on high fat diet immediately after arrival. Animals in groups E and F are dosed daily each day from baseline phase onwards.
- Figure 55 shows the effects of chronic administration of XG-102 in a rat model of diabetic nephropathy on the body weight of the rats. Only non-STZ treated rats showed an increase in body weight. Rats treated with XG-1 02 showed no differences in body weight compared to vehicle-treated rats in the STZ model. The body weight of rats treated with the positive reference (Losartan), however, was significantly lower. shows that XG-1 02 dose-dependently decreased JNK (A) and PAF2 (B) phosphorylation induced by 1 5-min ischemia in an experiment evaluating the dose-response to XG-1 02 in islet isolation/transplantation (Example 22).
- A JNK
- PAF2 PAF2
- Isolation of rat islets has been carried out either immediately after animal sacrifice or after a 1 5-minute period of warm ischemia. JNK activation has been assessed by western blot at the end of the isolation process. As negative controls, JNK activation has been assessed on unprocessed rat pancreases. shows the effects of XG-1 02 on function and viabi lity of rat pancreatic islets, whereby the islets have been isolated islets from 1 5 min ischemia rat and from no ischemia rat.
- a static insulin secretion test (basal or stimulated using glucose) has been performed directly after islet isolation and 1 8 h after culture at 37°C.
- Isolation affected islet function, whereby basal insulin secretion was higher in islets used directly after isolation compared to islets i ncubated during 1 8h whatever the conditions.
- ischemia and inhibitor XG-1 02 had no impact on islet function in this experiment. shows another experiment wherein ischemia was pushed until 30 min and XG-1 02 was used at 1 00 microM.
- Stil l a high basal secretion is observed when insulin secretion test was performed directly after isolation.
- 30 min ischemia had a negative impact on islet function.
- Figure 60 shows for the study of Example 27 the mean anterior chamber cell grade up to 28 days after the administration of the sub-conjunctival injection of study treatment for the PP analysis population for the three treatment groups XG-l 02 90 pg, XG-102 900 pg and the dexamethasone.
- the vertical lines represents the standard deviations (SD).
- Figure 61 shows for the study of Example 27 the results of the primary outcome in addition to the first secondary outcome for both the PP and FAS data sets regarding anterior chamber cell grade at day 28: Confidence Intervals and the
- Figure 62 shows for the study of Example 27 the anterior chamber flare grade (for the
- the vertical lines represents the standard deviations (SD). shows for the study of Example 27 the LFM (Laser Flare Meter) measurements which were obtained at the defined time points throughout the study up to day 28 for the FAS. The vertical lines represents the standard deviations (SD). shows for the study of Example 27 the overview of reported adverse events (serious and non-serious) by dose group. shows for the study of Example 27 the summary of the AEs (sorted by MedDRA SOC and PT term) which were reported for at least 2% of patients randomized to either of the three study groups. shows for the study of Example 27 the overview of the reported serious adverse events (SAEs).
- SAEs serious adverse events
- Figure 67 shows for Example 28 the proliferation of hepatocytes in XG-102 (in the figure referred to as "D-JNKI1 ”) or PBS treated Mapk14 f f and Mapk14 ⁇ * mice (left panel) and in XG-102 (i.e. "D-JNKI1 ") treated Mapkl 4 f f Jun f f and Mapk14 ⁇ ' Jun Ali* mice (right panel).
- Mice were injected with either XG-102 (20 mg per kg body weight) or PBS, if applicable, before DEN treatment.
- the proliferation of hepatocytes was analyzed by Ki67 staining 48 h after DEN treatment. Quantification of Ki67-positive cells is shown.
- Huh7 human liver cancer cells were injected subcutaneously to both flank area of nude mice at 4 weeks of age (Example 29).
- shows for Example 30 the mean body weight and mean body weight change curves of mice bearing orthotopically injected HEP G2 tumor are shown. Mice were IV treated with XG-102 at 1 mg/kg/inj following the Q4Dx4 treatment schedule repeated two times, at D10 and D41 .
- FIG. 70 the respective statistical data are presented. shows for Example 30 the tolerance of mice to XG-1 02. Mean body weights and MBWC +SD are indicated. MBWC% corresponds to variation of mean body weight between the considered day and day of first treatment (D10). Statistical analysis was performed with the Bonferroni-Dunn test, taking vehicle treated group as reference. shows for Example 30 the mice long survival curves, whereby proportion of surviving mice per group until sacrifice day (D185) is depicted. Mice were treated with XG-102 at the indicated doses following the Q4Dx4 treatment schedule repeated two times, at D10 and D4 . shows for Example 31 the tolerance ofmice to XG-102 and XG-414 treatments, alone or in combination.
- MBWC% corresponds to variation ofmean body weight between the considered day and day offirst treatment (DIO).
- Figure 73 shows for Example 31 the mice long survival curves, whereby proportion of surviving mice per group until sacrifice day (D1 71 ) is depicted. Mice sacrificed at D67 for autopsy were excluded from calculation. Mice were treated with XG-1 02 at the indicated doses following the Q4Dx4 treatment schedule repeated two timed, at D1 0 and D41 . shows for Example 31 the tumor invasion observed by microscopic evaluation of mice sacrificed at D67 or between D67 and final sacrifice as histogram representations. The level of tumor take was classified i n 4 different categories specified in the figure legend.
- Example 32 shows for Example 32 the mean tumor volume of PC-3 tumor bearing mice during the antitumor activity experiment.
- D33 3 groups of 5 animals were treated with vehicle and XG-1 02 (0.1 and 1 mg/kg/inj, Q4Dx4).
- Example 34 the electroretinography (ERG) measurements in right eyes of albino rats.
- Example 1 Identification of INK Inhibitor sequences Amino acid sequences important for efficient interaction with JNK were identified by sequence alignments between known JNK binding domain JBDs. A sequence comparison between the JBDs of IB1 [SEQ ID NO: 1 3], IB2 [SEQ ID NO: 14], c-Jun [SEQ ID NO: 1 5] and ATF2 [SEQ ID NO: 1 6] defined a weakly conserved 8 amino acid sequence (see Figure 1 A). Since the JBDs of IB1 and IB2 are approximately 100 fold as efficient as c-Jun or ATF2 in binding JNK (Dickens etal.
- JNK inhibitor fusion proteins according to SEQ ID NO: 9 were synthesized by covalently linking the C-terminal end of SEQ ID NO: 1 to a N-terminal 10 amino acid long carrier peptide derived from the HIV-TAT4g 57 (Vives et al., J Biol. Chem. 272: 1 6010 (1 997)) according to SEQ ID NO: 5 via a linker consisting of two proline residues. This linker was used to allow for maximal flexibility and prevent unwanted secondary structural changes.
- the basic constructs were also prepared and designated L-IB1 (s) (SEQ ID NO: 1 ) and L-TAT [SEQ ID NO: 5], respectively.
- All-D retro-inverso peptides according to SEQ ID NO: 1 1 were synthesized accordingly.
- the basic constructs were also prepared and designated D-IB1 (s) [SEQ ID NO: 2] and D-TAT [SEQ ID NO: 6], respectively.
- All D and L fusion peptides according to SEQ ID NOs: 9, 10, 1 1 and 12 were produced by classical Fmock synthesis and further analysed by Mass Spectrometry. They were finally purified by HPLC.
- two types of TAT peptide were produced one with and one without two prolines. The addition of the two prolines did not appear to modify the entry or the localization of the TAT peptide inside cells.
- Generic peptides showing the conserved amino acid residues are given in Figure 2.
- Example 3 Inhibition of Cell Death By IBD19 Effects of the 1 9 aa long JBD sequence of IB1 (s) on JNK biological activities were studied.
- the 19 aa sequence was linked N-terminal to the Green Fluorescent Protein (GFP JBD1 9 construct), and the effect of this construct on pancreatic beta-cell apoptosis induced by IL1 was evaluated.
- GFP JBD1 9 construct Green Fluorescent Protein
- Oligonucleotides corresponding to JBD19 and comprising a conserved sequence of 1 9 amino acids as well as a sequence mutated at the fully conserved regions were synthesized and directionally inserted into the EcoRI and Sail sites of the pEGFP-N1 vector encoding the Green Fluorescent Protein (GFP) (from Clontech).
- GFP Green Fluorescent Protein
- Insulin producing TC-3 cells were cultured in RPMI 1640 medium supplemented with 10% Fetal Calf Serum, 100 pg/mL Streptomycin, 100 units/mL Penicillin and 2 mM Glutamine. Insulin producing TC-3 cells were transfected with the indicated vectors and IL-1 (10 ng/mL) was added to the cell culture medium.
- the number of apoptotic cells was counted at 48 hours after the addition of IL-1 using an inverted fluorescence microscope. Apoptotic cells were discriminated from normal cells by the characteristic "blebbing out" of the cytoplasm and were counted after two days.
- GFP Green Fluorescent protein expression vector used as a control
- JBD1 9 is the vector expressing a chimeric GFP linked to the 19 aa sequence derived from the JBD of IB1
- JBD1 9Mut is the same vector as GFP-JBD1 9, but with a JBD mutated at four conserved residues shown as Figure 1 B
- JBDi- 2 eo is the GFP vector linked to the entire JBD (aa 1 - 280).
- the GFP-JBD19 expressing construct prevented IL-1 induced pancreatic -cell apoptosis as efficiently as the entire JBDi. 2 8o-
- sequences mutated at fully conserved IB1 (s) residues had greatly decreased ability to prevent apoptosis.
- TAT-IBI L-and D-enantiomeric forms of TAT and TAT-IBI (s) peptides
- TAT-IB peptides L-TAT, D-TAT, L-TAT-IB1 (s), and D-TAT-IBI (s) peptides [SEQ ID NOs: 5, 6, 9 and 12, respectively] were labeled by N-terminal addition of a glycine residue conjugated to fluorescein. Labeled peptides (1 ⁇ ) were added to TC-3 cell cultures, which were maintained as described in Example 3.
- JNKs-mediated phosphorylation of their target transcription factors were investigated in vitro.
- Recombinant and non activated JNK1 , JNK2 and JNK3 were produced using a TRANSCRIPTION AND TRANSLATION rabbit reticulocyte lysate kit (Promega) and used in solid phase kinase assays with c-Jun, ATF2 and Elkl , either alone or fused to glutathione-S-transferase (GST), as substrates.
- GST glutathione-S-transferase
- L-TAT or L-TAT-IBI (s) peptides (0-25 ⁇ ) were mixed with the recombinant JNK1 , JNK2, or JNK3 kinases in reaction buffer (20 mM Tris-acetate,1 mM EGTA, 10 mM p- nitrophenyl-phosphate (pNPP), 5 mM sodium pyrophosphate, 10 mM p-glycerophosphate, 1 mM dithiothreitol) for 20 minutes.
- reaction buffer (20 mM Tris-acetate,1 mM EGTA, 10 mM p- nitrophenyl-phosphate (pNPP), 5 mM sodium pyrophosphate, 10 mM p-glycerophosphate, 1 mM dithiothreitol
- the kinase reactions were then initiated by the addition of 10 mM MgCI 2 and 5 pCi 33 P- -dATP and 1 pg of either GST-Jun (aa 1 -89), GST-AFT2 (aa 1 - 96) or GST-ELK1 (aa 307-428).
- GST-fusion proteins were purchased from Stratagene (La Jolla, CA).
- TAT-IB(s) peptide showed superior effects in inhibiting JNK family phosphorylation of their target transcription factors.
- D-TAT, D-TAT- IB1 (s) and L-TAT-IBI (s) peptides (0-250 ⁇ dosage study) to inhibit GST-Jun (aa 1 -73) phosphorylation by recombinant JNK1 , JNK2, and JNK3 by were analyzed as described above.
- D-TAT-IBI (s) peptide decreased JNK-mediated phosphorylation of c-Jun, but at levels approximately 10-20 fold less efficiently than L-TAT-IB1 (s).
- Example 6 Inhibition of c-IUN Phosphorylation by activated INKs
- L-TAT or L-TAT-IBI (s) peptides as defined herein on JNKs activated by stressful stimuli were evaluated using GST-Jun to pull down JNKs from UV-light irradiated HeLa cells or IL-1 treated PTC cells.
- PTC cells were cultured as described above.
- HeLa cells were cultured in DMEM medium supplemented with 10 % Fetal Calf Serum, 100 pg/mL Streptomycin, 100 units/ml Penicillin and 2 mM Glutamine.
- Example 7 In vivo inhibition of c-IUN phosphorylation by TAT-lB(s) peptides as defined herein
- HeLa cells cultured as described above, were co-transfected with the 5xGAL-LUC reporter vector together with the GAL-Jun expression construct (Stratagene) comprising the activation domain of c-Jun (amino acids 1 - 89) linked to the GAL4 DNA-binding domain.
- GAL-Jun expression construct (Stratagene) comprising the activation domain of c-Jun (amino acids 1 - 89) linked to the GAL4 DNA-binding domain.
- Activation of JNK was achieved by the co- transfection of vectors expressing the directly upstream kinases MKK4 and MKK7 (see Whitmarsh et a/., Science 285: 1 573 (1 999)).
- 3x10 5 cells were transfected with the plasmids in 3.5-cm dishes using DOTAP (Boehringer Mannheim) following instructions from the manufacturer.
- 20 ng of the plasmid was transfected withl pg of the reporter plasmid pFR-Luc (Stratagene) and 0.5 pg of either MKK4 or MKK7 expressing plasmids.
- cell media were changed and TAT and TAT-IB1 (s) peptides (1 ⁇ ) were added.
- the luciferase activities were measured 1 6 hours later using the "Dual Reporter System" from Promega after normalization to protein content.
- TAT-IB1 (s) peptide blocked activation of c-Jun following MKK4 and MKK7 mediated activation of JNK. Because HeLa cells express JNK1 and JNK2 isoforms but not JNK3, we transfected cells with JNK3. Again, the TAT-IB(s) peptide inhibited JNK2 mediated activation of c-Jun.
- Peptides of the invention may be all-D amino acid peptides synthesized in reverse to prevent natural proteolysis (i.e. all-D retro-inverso peptides).
- An all-D retro-inverso peptide of the invention would provide a peptide with functional properties similar to the native peptide, wherein the side groups of the component amino acids would correspond to the native peptide alignment, but would retain a protease resistant backbone.
- Retro-inverso peptides of the invention are analogs synthesized using D-amino acids by attaching the amino acids in a peptide chain such that the sequence of amino acids in the retro-inverso peptide analog is exactly opposite of that in the selected peptide which serves as the model.
- TAT protein formed of L-amino acids
- GRKKRRQRRR sequence GRKKRRQRRR [SEQ ID NO: 5]
- the retro-inverso peptide analog of this peptide formed of D-amino acids
- heterobivalent or heteromultivalent compounds of this invention will be prepared to include the "retro-inverso isomer" of the desired peptide.
- Protecting the peptide from natural proteolysis should therefore increase the effectiveness of the specific heterobivalent or heteromultivalent compound, both by prolonging half-life and decreasing the extent of the immune response aimed at actively destroying the peptides.
- SEM Standard Error of the Means
- TC-3 cells were incubated as above for 30 minutes with one single addition of the indicated peptides (1 ⁇ ), then IL-1 (10 ng/ml) was added, followed by addition of the cytokine every two days. Apoptotic cells were then counted after 1 5 days of incubation with IL-1 by use of propidium iodide and Hoechst 33342 nuclear staining. Note that one single addition of the TAT-IB1 peptide does not confer long-term protection. A minimum of 1 .000 cells were counted for each experiment. As a result, D-TAT-IB1 (s), but not L-TAT-IB1 (s), was able to confer long term (1 5 day) protection.
- Example 10 Suppression of INK Transcription Factors by L-TAT-IBKs) peptides as used according to the present invention
- L-TAT-IBI (s) peptides as used according to the present invention decrease the formation of the AP-1 DNA binding complex in the presence of TNF-alpha.
- IL-1 beta v interleukin-1
- TNFalpha tumor necrosis factor
- AlphaScreen is a non-radioactive bead-based technology used to study biomolecular interactions in a microplate format.
- ALPHA Amplified Luminescence Proximity Homogenous Assay. It involves a biological interaction that brings a "donor” and an “acceptor” beads in close proximity, then a cascade of chemical reactions acts to produce an amplified signal. Upon laser excitation at 680 nm, a photosensitizer (phthalocyanine) in the "donor" bead converts ambient oxygen to an excited singlet state.
- the singlet oxygen molecule can diffuse up to approximately 200 nm in solution and if an acceptor bead is within that proximity, the singlet oxygen reacts with a thioxene derivative in the "acceptor" bead, generating chemiluminescence at 370 nm that further activates fluorophores contained in the same "acceptor” bead. The excited fluorophores subsequently emit light at 520-620 nm. In the absence of an acceptor bead, singlet oxygen falls to ground state and no signal is produced.
- kinase reagents (B-GST-cJun, anti P-cJun antibody and active JNK3) were first diluted in kinase buffer (20 mM Tris-HCI pH 7.6, 1 0 mM MgCl 2 , 1 mM DTT, 100 ⁇ Na 3 VO 4 , 0.01 % Tween-20) and added to wells (1 5 ⁇ ). Reactions were then incubated in presence of 10 ⁇ of ATP for 1 h at 23°C.
- Detection was performed by an addition of 10 ⁇ I of beads mix (Protein A acceptor 20 ⁇ g/ml and Streptavidin donor 20 ⁇ g/ml), diluted in detection buffer (20 mM Tris-HCI pH 7.4, 20 mM NaCI, 80 mM EDTA, 0.3% BSA), followed by an another one-hour incubation at 23°C in the dark.
- detection buffer 20 mM Tris-HCI pH 7.4, 20 mM NaCI, 80 mM EDTA, 0.3% BSA
- kinase assays were performed as described above except active JNK3 was replaced by cells lysates and reaction kinase components were added after the cells lysis.
- B-GST-cjun and P-cJun antibody were used at the same concentrations whereas ATP was used at 50 ⁇ instead of 10 ⁇ .
- AlphaScreen signal was analyzed directly on the Fusion or En Vision apparatus.
- Example 12 Determining the activity of all-D retro-inverso IB(s) Peptides and variants thereof in the treatment of viral infections - varicella-zoster virus (VZV)
- IB(s) peptides and all-D retro-inverso IB(s) peptides as used according to the present invention were tested using the JNK inhibitor peptide XG-102 (SEQ ID NO: 1 1 ) as a test compound in cultured host cells (human foreskin fibroblasts (HFFs)).
- HFFs human foreskin fibroblasts
- Viruses are obligate intracellular parasites that require a functional cell environment to complete their lifecycle; dying cells do not support virus replication. Additionally, inhibitors of cell functions may be toxic to cells, which could non-specifically prevent virus growth. Thus, sick or dying host cells could exhibit nonspecifically reduced virus titers.
- a cytotoxicity assay was carried out first, determining the tolerance of the cultured cells to the test compound. Subsequently, a plaque reduction assay was carried out and then activity of the JNK inhibitor peptide XG-102 (SEQ ID NO: 1 1 ) was tested with repect to Viral Zoster Virus (VZV) in infected cells.
- VZV Viral Zoster Virus
- HFFs human foreskin fibroblasts
- HFFs human foreskin fibroblasts
- the excess virus was washed out, and medium containing 0 (DMSO only), 0.5, 1 , or 2 ⁇ XG-102 (SEQ ID NO: 1 1 ) was added.
- XG-102 (SEQ ID NO: 1 1 ) had thus a strong antiviral effect at all the concentrations tested, with VZV yields near 200-300 pfu.
- VZV yields near 200-300 pfu.
- HFFs human foreskin fibroblasts
- XG-102 SEQ ID NO: 1 1
- XG-102 SEQ ID NO: 1 1
- Virus yield was measured by luciferase assay. Samples were in triplicate and the average luminescence is shown; error bars represent the standard deviation of the mean.
- Example 13 Determining the activity of all-D retro-inverso IB(s) Peptides and variants thereof in the treatment of Chronic Obstructive Pulmonary Disease (COPD)
- COPD Chronic Obstructive Pulmonary Disease
- XG-102 SEQ ID NO: 1 1
- COPD Chronic Obstructive Pulmonary Disease
- XG- 102 SEQ ID NO: 1 1
- the protocol of bleomycin induced inflammation and fibrosis has been described before in the literature.
- the aim of the Experiment was to investigate the effect of XG-102 (SEQ ID NO: 1 1 ) by subcutaneous (s.c.) route on neutrophil recruitment in broncho alveolar lavage (BAL) and lung in bleomycin induced inflammation and fibrosis:
- the test compound XG-102 (SEQ ID NO: 1 1 ) at two doses and vehicle control were given s.c. with a single intranasal administration of bleomycin and mice were analyzed after 1 and 10 days.
- the animals used in the model were 1 0 C57BL/6 mice (8 weeks old) per group.
- the experimental groups included vehicle, 0.00 ⁇ mg/kg XG- 102 (SEQ ID NO: 1 1 ) and 0.1 mg/kg XG-102 (SEQ ID NO: 1 1 ), and the treatment consisted of repeated sub-cutaneous administration of XG-1 02 (SEQ ID NO: 1 1 ), prior to bleomycin administration then every 3 days.
- Acute lung inflammation at 24h was monitored by BAL lavage, cytology, cell counts, and lung myeloperoxidase activity. The effect of the compound was compared with vehicle controls. Lung fibrosis was assessed histologically using hematoxylin and eosin staining at day 10 after the single dose of bleomycin.
- Bleomycin sulfate in saline (10 mg/kg body weight) from Bellon Laboratories (Montrouge, France) or saline were given through the airways by nasal instillation in a volume of 40 ⁇ under light ketamine-xylasine anesthesia.
- the route for bleomycin induced inflammation was subcutaneous (s.c.) route, and administration occurred as a single dose.
- the route for bleomycin induced fibrosis was subcutaneous (s.c.) route, and administration occurred 3 times in 1 0 days.
- Total cell count was determined in BAL fluid using a Malassez hemocytometer. Differential cell counts were performed on cytospin preparations (Cytospin 3, Thermo Shandon) after staining with MGG Diff-quick (Dade Behring AG). Differential cell counts were made on 200 cells using standard morphological criteria. TNF measurement
- TNF level in BALF was determined using EL1SA assay kits (Mouse DuoSet, R&D system, Minneapolis, USA) according to manufacturer's instructions. Results are reported as pg/ml. MPO-measurement
- MPO-levels were measured upon administration of XG-1 02. MPO was not significantly induced after bleomycin in this experiment. Furthermore, XG-102 had no effect on MPO levels in the lung. Histology
- Bleomycin (BLM) induced acute lung inflammation Groups Vehicle, XG-1 02 (SEQ ID NO: 1 1 ) 0.001 mg/kg and XG-102 (SEQ ID NO: 1 1 ) 0.1 mg/kg
- XG-102 reduces significantly the neutrophil recruitment and the number of total cells recruited during the inflammatory stage.
- MPO Myeloperoxidase plays an important role in host defense systems. This 140 kDa protein, composed of two heavy chains of 53kDa and two light chains of 1 5 kDa, was first discovered in the 1960s. The release of MPO from the granules of neutrophils and monocytes in response to the activation of leukocytes allows the conversion of hydrogen peroxide and chloride ions into hypochlorous acid (HOCI), a strong oxidizing agent. Although MPO serves an important purpose in the defense system, various studies show that MPO also plays a role in several inflammatory conditions, wherein an elevated MPO level e.g. has been linked to coronary artery diseases. Furthermore, tissue MPO levels reflect the state of activation of neutrophils and gives an indication on neutrophil tissue infiltration.
- HOCI hypochlorous acid
- the experiment was additionally performed in a fibrosis model.
- XG-102 (SEQ ID NO: 1 1 ) reduced significantly the lymphocyte recruitment and the number of total cells recruited during the inflammatory stage characterised at this point by the lymphocytes recruitment.
- XG-102 (SEQ ID NO: 1 1 ) administered 3 times at the I dose of 0,001 mg/kg decreases the Bleomycin-induced later inflammation, particular the lymphocytes recruitment observed at this time. Moreover, the test substance administered 3 times at this dose attenuates the Bleomycin-induced fibrosis. Less extended fibrotic areas with a more conserved lung structure could be observed.
- Example 14 Determining the activity of all-D retro-inverso IB(s) Peptides and variants thereof in the treatment of Alzheimer's disease
- mice were treated every two or three weeks up to 4 months and i n the end of the treatment period behavior was evaluated in the Morris Water Maze.
- CSF and blood were collected.
- ⁇ 40 and ⁇ 42 levels were determined in four different brain homogenate fractions as well as in CSF of Tg mice. Plaque load was quantified in the cortex and the hippocampus of 8 Tg animals per treatment group.
- Animals were subjected to administration of vehicle or XG-1 02 (SEQ ID NO: 1 1 ) in two different concentrations beginning at 5 months of age and continued for up to 4 months with subcutaneous (s.c.) applications every second or third week.
- All animals which were used for the present study had dark eyes and were likely to perceive the landmarks outside the MWM pool. However, it had to be excluded that seeing abilities of an animal were poor, which was controlled in the visible platform training, the so called pretest, before treatment start for all animals including reserves enclosed to the study. In case a seeing handicap for a specific animal would have been affirmed, the mouse would have been excluded from the study.
- mice were individually identified by ear markings. They were housed in individual ventilated cages (IVCs) on standardized rodent bedding supplied by Rettenmaier®. Each cage contained a maximum of five mice. Mice were kept according to the JSW Standard Operating Procedures (SOP GEN011) written on the basis of international standards. Each cage was identified by a colored card indicating the study number, sex, the individual registration numbers (IRN) of the animals, date of birth, as well as the screening date and the treatment group allocation. The temperature during the study was maintained at approximately 24°C and the relative humidity was maintained at approximately 40 - 70 %. Animals were housed under a constant light-cycle (12 hours light/dark). Normal tap water was available to the animals ad libitum.
- the Morris Water Maze (MWM) task was conducted in a black circular pool of a diameter of 100 cm. Tap water was filled in with a temperature of 22+1 °C and the pool was virtually divided into four sectors. A transparent platform (8 cm diameter) was placed about 0.5 cm beneath the water surface. During the whole test session, except the pretest, the platform was located in the southwest quadrant of the pool. One day before the 4 days lasting training session animals had to perform a so called "pre-test" (two 60 sec lasting trials) to ensure that the seeing abilities of each animal were normal. Only animals that fulfilled this task were enclosed to the MWM testing. In the MWM task each mouse had to perform three trials on four consecutive days. A single trial lasted for a maximum of maximum one minute.
- mice had the chance to find the hidden, diaphanous target. If the animal could not find a "way" out of the water, the investigator guided to or placed the mouse on the platform. After each trial mice were allowed to rest on the platform for 10-1 5 sec. During this time, the mice had the possibility to orientate in the surrounding. Investigations took place under dimmed light conditions, to prevent the tracking system from negative influences (Kaminski; PCS, Biomedical Research Systems). On the walls surrounding the pool, posters with black, bold geometric symbols (e.g. a circle and a square) were fixed which the mice could use the symbols as landmarks for their orientation.
- One swimming group per trial consisted of five to six mice, so that an intertrial time of about five to ten minutes was ensured.
- Isofluran, Baxter Standard inhalation anesthesia
- each mouse was placed in dorsal recumbence, thorax was opened and a 26-gauge needle attached to a 1 cc syringe was inserted into the right cardiac ventricular chamber. Light suction was applied to the needle and blood was collected into EDTA and consequently used to obtain plasma.
- blood samples from each mouse were spun at 1 ,750 rpm (700g) for 1 0 minutes in a centrifuge (GS - 6R Beckman) using a rotor with swing buckets (GH - 3.8 Beckman). Plasma was frozen and stored at -20°C until further analysis. After blood sampling transgenic mice were intracardially perfused with 0.9% sodium chloride. Brains were rapidly removed the cerebellum was cut off.
- mice The right hemispheres of all mice were immersion fixed in freshly produced 4% Paraformaldehyde/PBS (pH 7.4) for one hour at room temperature. Thereafter brains were transferred to a 1 5% sucrose PBS solution for 24 hours to ensure cryoprotection. On the next day brains were frozen in isopentane and stored at -80°C until used for histological investigations (SOP MET042). The left hemispheres were weighed and frozen in liquid nitrogen and stored at -80°C for biochemical analysis.
- SDS SDS (2.5 ml).
- the pellet out of the SDS fraction was suspended in 70 % formic acid (0.5ml) prior to subsequent centrifugation.
- Samples of the four brain homogenate fraction (TBS, Triton X-100, SDS, and FA) were used for ⁇ ⁇ _ 4 ⁇ and ⁇ . 42 determination with ELISA technique.
- ELISA test kits were purchased from The Genetics Company , Switzerland (SOP MET062). It could be assumed that TBS and Triton X-100 solubilize monomeric to oligomeric structures. Polymers like protofibrils and water insoluble fibrils could be dissolved in SDS and FA. In this regard the investigation of all four fractions also provides insight in A polymerization status.
- Brain tissues of all Tg animals investigated were handled in exactly the same way to avoid bias due to variation of this procedure. From brain halves of 24 Tg mice (8 of each group) 20 cryo-sections per layer (altogether 5 layers), each 10 ⁇ thick (Leica CM 3050S) were sagittally cut and 5 (one from each layer) were processed and evaluated for quantification of plaque load. The five sagittal layers corresponded with the Figures 104 to 105, 1 07 to108, 1 1 1 to 1 12, 1 1 5 to 1 16 and 1 18 to 1 19 according to the morphology atlas "The Mouse Brain" from Paxinos and Franklin (2nd edition).
- the first layer was specified by the requirement to include the whole hippocampus with it's regions CA1 , CA2, CA3, GDlb and GDmb. Immunoreactivity was quantitatively evaluated in the hippocampus and in the cortex using the monoclonal human ⁇ -specific antibody 6E1 0 (Signet) as well as ThioflavinS staining. Remaining brain hemispheres or tissue not used were saved and stored at JSW CNS until the end of the project.
- mice were enclosed to study. From these mice 12 animals died due to unknown reason before the treatment period was finished. ii) Behavioral Results
- test compound XG-102 SEQ ID NO: 1 1
- mice treated with the low dose of the test compound XG-102 SEQ ID NO: 1 1
- CSF ⁇ Levels SEQ ID NO: 1 1
- ⁇ 1 -40 and ⁇ - 42 levels were significantly decreased in CSF compared to vehicle group.
- ⁇ _ 40 and ⁇ . 4 2 p-values were p ⁇ 0.01 for the high dosage (10 mg/kg) and ⁇ 0.05 for the lose dosage of XG-102 (SEQ ID NO: 2) (see Figure 12).
- Plaque load was quantified with two different methods. On the one hand an IHC staining with 6E1 0 primary directed against AA1 -1 7 of the human amyloid peptide was performed, on the other hand a ThioflavinS staining marking beta-sheet structures and cores of mature, neuritic plaques was carried out. First of all, measured region areas, cortex and hippocampus, were highly constant throughout all groups, indicating that problems in the cutting and IHC procedures can be excluded and to a certain degree also a treatment induced atrophy (changes of >5% would be detectable with this method).
- 6E10 and ThioflavinS quantifications revealed a selective reduction of beta-sheet structures in the center of the plaques after XG-1 02 (SEQ ID NO: 1 1 ) treatment, whereas human amyloid remained uninfluenced from treatment or slightly increased.
- cortical 6E10 IR plaque load was increased versus vehicle in the 1 0 mg/kg XG-102 (SEQ ID NO: 1 1 ) treated mice, however, significance level was reached for the number of hippocampal plaques.
- Figures 13 and 14 show, in contrast to 6E1 0 IHC, that XG-102 (SEQ ID NO: 1 1 ) treatment led to a negatively dose dependent reduction of the number of hippocampal ThioflavinS positive plaques, as well as area percentage (number of plaques: p ⁇ 0.05 for 10mg/kg, p ⁇ 0.01 for 0.1 mg/kg XG-102 (SEQ ID NO: 1 1 )).
- Example 1 5 Determining the activity of all-D retro-inverso IB(s) Peptides and variants thereof in the treatment of Diabetes Type 2
- Example 15 is designed to determine the activity of IB(s) peptides and all-D retro-inverso IB(s) peptides and variants thereof in the treatment of Diabetes Type 2, particularly to determine the effect of chronic treatment with XG-102 (SEQ ID NO: 1 1 ) in the db/db mice model of type 2 diabetes by evaluating fasting blood glucose levels every third day (28 days)
- XG-102 (SEQ ID NO: 1 1 ) was dissolved in the vehicle.
- the formulations (concentrations of 0.33 and 3.3 mg/ml, corresponding to the doses of 1 and 10 mg/kg, respectively) were prepared according to the procedure detailed below. Concentrations were calculated and expressed taking into account test items purity and peptide content (multiplier coefficient was 1 .346).
- ⁇ Preparation of a stock solution the freeze-dried test compound XG- 102 (SEQ ID NO: 1 1 ) is thawed for one hour minimum and prepared as a stock solution in the vehicle at 1 mM (corresponding to 3.823 mg/mL). Aliquots are prepared for each treatment day and stored at approximately -80°C. Dilutions of this stock solution to the required concentrations are performed on each treatment day;
- the powder Prior to solubilisation, the powder was stored at -20°C.
- the stability of the stock solution is 3 months at approximately -80°C; the stability of the diluted formulations for animal dosing is 24 hours at room temperature. Unused diluted material could be stored for up to 7 days if kept at 4-8°C.
- mice Following 8 days of acclimatization the mice were treated daily at 08.00 AM for 21 days by SC dosing 8 hours prior to lights out at 04.00 PM according to the outline groups. Then, on study day 21 dosing of the highest concentration of XG-102 (SEQ ID NO: 2) (10 mg/kg) was stopped, whereas daily dosing of vehicle control and XG- 102 (SEQ ID NO: 2) (1 mg/kg) were continued until day study 28.
- Groups 1 +3 (day 1 1 1 ): The following organs were excised and weighed: inguinal subcutaneous fat, epididymal fat, retroperitoneal fat, brain, liver, kidney, spleen and heart. All organs described above were samples in 4% PFA for possible future histo-pathological examination. Also, pancreas ⁇ en b/oc) was sampled for possible stereological and imunohistochemical analysis, and eyes were sampled for possible later analysis of retinopathy. Group 2 (day 28): No tissues or plasma were collected.
- XG-102 (SEQ ID NO: 1 1 ), 10 mg/kg, appears to lead to a significant decrease in blood glucose levels and therefore, XG- 102 (SEQ ID NO: 1 1 ) appears to be a promising new tool for treating diabetes and elevated blood glucose levels.
- Example 1 6 Safety, tolerability and pharmacokinetics of a single intravenous infusion of 1 0, 40 and 80 pg/kg XG-1 02 (SEP I D No.: 1 1 ) administered to healthy male volunteers i n a randomized, double blind, placebo control led, dose escalating Phase I study
- the primary objective of the study was to assess the safety and tolerability of XG-1 02 following intravenous (iv) infusion of single escalating doses of XG-1 02 to healthy male volunteers.
- the secondary objective of the study was to assess the pharmacokinetics of XG- 1 02 following iv infusion of single escalating doses of XG-1 02 to healthy male volunteers. Doses were administered as a 60 minute iv infusion. For control purposes, placebo iv infusion was administered to control subjects.
- a total of 24 subjects (healthy male subjects in the age of 1 8 to 45), in 3 groups of 8. 24 subjects entered and completed the study. Data for all subjects were included in the safety analyses; data for al l subjects who received XG-1 02 were included in the pharmacokinetic analyses.
- XG-102 was safe and well tolerated when administered as single iv doses of 10, 40 or 80 pg/kg to healthy male subjects.
- the incidence of adverse events in subjects who received XG- 102 was similar to the incidence in subjects who received placebo. There were no clinically significant findings in clinical laboratory data, vital signs, ECGs, physical examinations or ocular examinations (fundus and IOP).
- XG-102 intravenous infusion After the end of XG-102 intravenous infusion, its plasma concentrations quickly decreased, leading to values below the lower limit of quantification by at most 2 hours after the start of 10 pg/kg XG-102 iv infusions, 3 hours after the start of 40 pg/kg XG-102 iv infusions and by at most 7 hours after the start of 80 pg/kg XG-102 intravenous infusions.
- the measured a and MRT values are short, with geometric mean values per dose level ranging from 0.36 to 0.65 hours and from 0.76 to 1 .02 hours, respectively.
- the AUCo iast of XG-102 increases in a more than linear proportion with dose in the tested dose range, with non-overlapping 90% confidence intervals for its geometric mean dose normalized values between the 40 pg/kg and the 80 pg/kg dose and only limited overlap between the 90% confidence intervals for its geometric mean dose normalized values between the 10 pg/kg and the 40 pg/kg.
- the Cmax of XG-102 appears to increase in a more than linear proportion with dose from 40 to 80 pg/kg.
- the geometric mean dose normalized Cmax in the 80 pg kg dose group is higher than and outside the 90% confidence intervals for the geometric mean dose normalized Cmax in the other dose groups, but the 90% confidence intervals for the geometric mean dose normalized Cmax overlap among all dose levels.
- the intersubject variability of XG-102 pharmacokinetic parameters was moderate in subjects treated with 10 and 40 pg/kg doses (CV% of the geometric mean for most parameters approximately in the 1 5-30% range, exception was t and total V ss at the 10 pg/kg dose group), but higher in the 80 pg/kg dose group, in the approximately 29-44% range, other than for MRT (14.7%).
- This higher variability may be either an effect of the low sample size or a consequence of the observed non-linearities which are clearer at this dose.
- Example 1 7 Use of XG-102 (SEP ID No.: 1 1 ) to improve porcine islet isolation outcomes
- the object was to evaluate the ability of XG-102 to (a) block the massive activation of JNK that occurs during islet isolation leading to cell stress and death; (b) reduce islet death, resulting to improvements in islet viability post-isolation, using the porcine model.
- Porcine islet isolation results in a dramatic activation of JN K first observed in tissue samples ⁇ 20 min after the initiation of the islet isolation procedure (Figure 33).
- Analysis of existing data demonstrates that the addition of the Xigen XG-1 02 JNK inhibitor at the pancreas level during procurement and transfer to the isolation lab and in islet isolation solutions (10 micromolar concentration) during isolation blocks the activation of JNK (Figure 34), reduces the relative expression of the c-fos gene ( Figure 35), and has a statistically significant and important effect on the viabi lity of freshly isolated islets as measured by OCR/DNA ( Figure 36) and ATP/ protein [total cell protein] ( Figure 37). Comparisons were always made with paired untreated controls originating from the same pancreas donor.
- the porcine model is relevant for the following reasons: (1 ) The size of the porcine pancreas is closer to that of a human pancreas than a rat or cani ne pancreas; (2) Porci ne islets are considered a viable option for future clinical islet xenotransplantation - therefore improvements in porcine islet isolation, which are critically needed can ultimately be clinically relevant.
- Human pancreata for clinical islet allo-transplantation originating from brain-dead donors are typically not subjected to WIT but have 8-12 hrs of CIT (time needed for transportation from the procurement hospital to the isolation lab).
- Example 1 8 Efficacy of XG-102 (SEP ID No. 1 1 ) in Reducing the Choroidal Neovascularization using the Rat Argon Laser-Induced Choroidal Neovascularization Model.
- the aim of this example was to determine whether two intravitreous admi nistrations of XG-1 02 at two doses resulted in a decrease of choroidal neovascularization in a rat model of laser-induced choroidal neovascularization (ChNV). That model allows to make predections on the potential use of a test compound for the treatment of age-related macular degeneration.
- XG-1 02 3 000 pg/ml (equivalent to 1 5 pg/eye) and 300 pg/ml (equivalent to 1 .5 pg/eye).
- Kenacort ® Retard 4% triamcinolone acetonide as control reference.
- Control Vehicle Saline (0.9% NaCI).
- Rat Rat. This is the species most commonly used in this experimental model
- Weight 1 75 - 200 g (on ordering).
- Test item, reference and vehicle (5 ⁇ ) were intravitreously injected in the right eyes dose regimen was on Day 0 and Day 7. The injection was performed under an operating microscope.
- the intravitreal injections scheduled on Day 0 were done following the induction of neovascularization, under the same anesthesia.
- the intravitreal injection was located in the supratemporal area at pars plana and performed using a 30G-needle mounted on a 10 ⁇ Hamilton. The filled syringe was then mounted into the UltraMicroPump III to achieve accurate injection in microliter range.
- the body weight of all animals was recorded before the start of study then once a week.
- Day 21 no relevant difference between test item, vehicle and untreated groups was observed.
- the animals gained: + 53 g (+ 29%) and + 62 g (+ 34%) for XG-102 at 300 pg/ml and 3000 pg/ml, respectively, versus + 56 g (+ 31 %) and + 59 g (+ 34%) for the vehicle group and untreated group, respectively.
- Fluorescein angiography was performed on Days 14 and 21 using an HRA. After anesthesia by an intramuscular injection of a mix xylazine/ ketamine and pupillary dilation, 250 ⁇ /100 g (body weight) of a 10% sodium fluorescein was injected subcutaneously using a 26G insulin syringe, and fluorescein photos were recorded 10 minutes after dye injection. This study was carried out on forty (40) Brown Norway rats. Argon laser was used to induce ChNV in the right eyes. The development of ChNV was evaluated by fluorescein angiography (FA). Treatments (test, reference and control items) were made by intravitreous administration on Days 0 and 7 after induction. Angiography was performed 10 min after fluorescein (tracer) injection, on Days 14 and 21 after induction. The grading was based on the highest intensity of fluorescein in each lesion and it was not determined by the size of the leakage area.
- Results were expressed as the group mean score per time-point and by incidence of the number of spots at a given intensity score for each treatment and at each of both time-points.
- the Mann and Whitney test was used to determine if there was a statistically significant difference in the FA score between treated and control group. The statistical significance was attributed when p ⁇ 0.05 was obtained with Mann and Whitney-U test.
- Figure 39 A shows the intensity of fluorescein leakage (mean score ⁇ SD). and Figure 39 B illustrates the proportion of leaking spots in test item-treated eyes at both time-points. Figures 39 C and 39 D illustrate the percentage of leaking spots (score > 0) and of maximum leaking spot (score of 3) respectively
- the leakage of fluorescein on the angiograms was evaluated by two examiners in a masked fashion and graded as follows: Score 0, no leakage; Score 1 , slightly stained; Score 2, moderate stained; Score 3, strongly stained. If the two scores assigned to a particular lesion did not coincide, the higher score was used for analysis.
- the proportion of leaking spots compared to vehicle group at Day 21 was unchanged as shown by 31 % of leaking spots for Kenacort ® retard versus 94% for vehicle.
- the induced eyes showed consistent fluorescein leakage 14 and 21 Days after laser injury.
- XG-102 at both doses did not show a relevant reduction of the vascular leakage compared to vehicle.
- a reduction of the proportion of spots with a score 3 was recorded for 300 pg/ml and 3000 pg/ml XG-102 groups on Day 14 as shown by 66% and 12% of score 3 for low and high XG-102 concentration respectively, compared to 90% of spots scored by 3 for vehicle group.
- XG-102 intravitreously administered at 300 and 3000 pg/ml inhibited the vascular leakage 7 days (Day 14 of the study) after the last administration.
- Example 19 Effects of XG-102 on Adriamycin-induced nephropathy
- the object of that example was to study the effects of XG-102 on inflammatory kidney disease, nephropathy.
- Adriamycin treatment induces glomerular disease in rat and mice mimicking human focal segmental and glomerular sclerosis (FSGS).
- FSGS focal segmental and glomerular sclerosis
- tubular and interstitial inflammatory lesions occur during the disease course, partly due to heavy proteinuria.
- kidney disease progresses to terminal renal failure within eight weeks.
- Podocyte injury is one of the initial steps in the sequences leading to glomerulosclerosis.
- the aim of the study was to investigate whether XG-102 could prevent the development of renal lesions and the renal failure.
- XG-102 (control NaCI 0,9%) were administered to rats i.v.. In total 50 rats were treated, whereby 3 groups (of 10 rats) received XG-102 (low dose (20 pg/kg), medium dose (200 pg/kg) and high dose (2000 pg/kg). All of these three groups (and the placebo group) were treated with 10 mg/kg Adriamycin on day 0. A fifth group of 10 animals did not receive any adriamycin and was treted by the NaCI control. Histological preparations were provided at day 8, 14, 29 and 41 .
- Sprague-Dawley rats (Charles River) were used (divided into 4 groups of ten rats). Nephropathy has been induced by a single intravenous injection of Adriamycin 10 mg/kg on Day 0.
- XG-102 (SEQ ID NO: 1 1 ; 2 mg/kg; in NaCI 0.9%) was administered intravenously in the tail vein on Day 0. The administration volume has been 0.2 ml.
- Results were expressed in the form of individual and summarized data tables using Microsoft Excel® Software. Numerical results were expressed as mean ⁇ standard error of the mean (SEM). Due to the small number of animal tested, no statistical analyses was performed. Effect of XG-102 on renal function during the progression of the disease:
- XG-102 -treated rats exhibited an urea serum level below 1 0 mmol/l throughout the course of the disease (Figure 48 B).
- the renal function of rats treated with XG- 102 alone was similar to 0.9% NaCl-treated rats.
- ADR-induced structural changes were evaluated under light microscope. Saline-treated control rats showed morphologically normal glomeruli and tubules. On Day 8, light microscopic examination showed some areas with focal segmental glomerulosclerosis and proteinaceous casts in the ADR nephrosis group. In contrast, although some tubules were filled with proteins in XG-102 -treated rats, glomeruli exhibited a normal architecture with absence or discrete mesangial hypercellularity, while the tubular structures and interstitium did not display pathological changes (Figure 49). By Day 14, ADR treated rats exhibited progressive glomerulosclerosis, hyaline deposits, tubular di lation and cast formation.
- XG-1 02 prevents the progression of glomerular and tubulointerstitial injuries induced by ADR. Moreover, this molecule preserves renal function.
- Example 20 Effects of XG-1 02 on puromycine aminonucleoside (PAN)-induced nephropathy
- PAN Puromycin aminonucleoside
- MCD mi nimal change disease
- FSGS focal segmental glomerulosclerosis
- Intraperitoneal administration of PAN in rats results in a rapid development of nephritic syndrome, characterized by proteinuria, hypoalbuminemia and hypercholesterolemia (acute phase).
- This is a well-established animal model of human MCD.
- the pathological lesions of focal segmental glomerulosclerosis have been observed in chronic PAN nephrosis induced by repeated intraperitoneal PAN injections (Nakajima, T., Kanozawa, K., & Mitarai, T. (201 0). Effects of edaravone against glomerular injury in rats with chronic puromycin aminonucleoside nephrosis. I Saitama medical university, 37[ )).
- PAN causes direct DNA damage via the production of reactive oxygen species ( OS) and tissue damages, including glomerulosclerosis and interstitial fibrosis (Hewitson TD, 2012) in the chronic phase.
- OS reactive oxygen species
- tissue damages including glomerulosclerosis and inter
- Control rats received an equal amount of saline i.p at day 0 and at day 14.
- XG-102 or its vehicle NaCI 0.9%) were administered into the tail vein (i. v.) once a week (Groups 1 to 5) starting from first PAN injection at day 0 for a total of 7 injections at day 0, 7, 14, 21 , 28, 35 and 42.
- XG-102 was administered into the tail vein (i. v.) once a week starting from day 21 for a total of 4 injections at day 21 , 28, 35 and 42 after PAN injection at day O.
- XG-102 powder has been dissolved in the vehicle NaCI 0.9% at the highest concentration to be tested. The highest concentration then represented the stock solution for the lower concentrations. Each stock solution has been filter (0.2 pm) sterilized. The lower concentration solutions to be administered were prepared by diluting the filtered stock solution in saline (0.9% NaCI) depending on the volume for i. v. injection.
- Group PAN i.p.
- Treatment i. v.
- Kidney samples have been fixed in formal in solution 10% (Sigma Aldrich, France) for 24-72 h, in particular 48 h, then embedded in paraffin. Three sections (3 to 5 pm) were made per block. The slides were stained by hematoxylin/eosin (HE), PAS-methenamine si lver and Sirius Red for histological evaluation of morphological alterations, glomerulosclerosis and interstitial fibrosis quantification, respectively. All the sl ides were digitalized at X20 using Nanozoomer 2.0 HT from Hamamatsu (Japan). H istological preparation and imaging has been performed by Histalim (Montpell ier, France).
- Plasma creatinine and urea have been quantified using an ABX Pentra 400 Clinical Chemistry analyzer (HORIBA) by the Phenotypage platform of Genotoul (Ranguei l Hospital, Toulouse, France). Results are expressed by semi-quantitative scoring fol lowing to expert histopathologist evaluation. For the histological examination of glomerulosclerosis glomerular changes have been evaluated using a semi quantitative scoring system as described by Nakaj ima, T., Kanozawa, K., & Mitarai, T. (2010). Effects of edaravone against glomerular injury i n rats with chronic puromycin aminonucleoside nephrosis. I Saitama medical university, J 1 ), which is hereby incorporated by reference.
- the degree of glomerular injury was assessed in 25 glomeruli per kidney section (2 sections per animal) for a total of 50 glomeruli per animal. Degree of injury in individual glomeruli was graded using a scale from 0 to 4, based on the percentage of glomerular involvement.
- Score 1 lesions in up to 25% of the glomerulus
- Score 3 lesions between 50-75% of the glomerulus
- XG-102 has (i) a preventive effect in that 7 iv injections at the dose of 2 and 4 mg/kg significantly reduced PAN-induced glomerulosclerosis in term of severity of lesions (glomerular injury score) but also significantly decreased glomerular damage incidence (percentage of injured glomeruli) and that (ii) XG- 102 has a curative effect in that 4 /Vinjections of XG-102 at the dose of 4 mg/kg, starting from day 21 post-PAN administration lead to a strong effect on glomerulosclerosis in term of both severity of lesions (glomerular injury score) and of glomerular damage incidence (percentage of injured glomeruli).
- Example 21 Effects of chronic administration of XG-102 in a rat model of diabetic nephropathy
- the aim of this study has been to evaluate the effects of chronic administration of the JNK inhibitor peptide, XG-102 (1 , 2, 4 mg/kg, weekly intravenous administration for 9 weeks), in a rat model of diabetic nephropathy. Losartan has been used as a positive control.
- Rats Seventy-four male Sprague-Dawley rats (200-250g; including 4 spare animals) from Charles River (Margate, Kent) were used. Rats were housed in pairs in polypropylene cages with free access to a high fat diet (D12492 60% of kcal derived from fat) and tap water at all times. The diet has been purchased from Research Diets, New Jersey, USA. All animals have been maintained at 21 ⁇ 4°C and 55+20% humidity on a normal light (lights on: 07:00 - 1 9:00). The study schedule is shown in Figure 54. Animals have been housed in pairs throughout the study. For a 3-week period, during which time they have been weighed weekly (food and water will be weighed twice during the third week only (i.e.
- Each pair of animals has been administered the same treatment (i.e. both vehicle-treated or both will be STZ-treated).
- animals For the 7-day period post STZ dose, animals have been weighed daily and food and water intake determined twice weekly.
- animals For the remaining study duration, animals have been weighed and water and food intake assessed twice weekly (always on the day of intravenous dosing and typically on water refill day(s)).
- animals based on body weight and available food and water intake post STZ, animals have been allocated in groups B-F as detailed below in light of differences in dosing regimen.
- Dosing has been for 9 weeks in duration (9 administrations in total, see Figure 54). Animals in groups F and G have been weighed and dosed daily at approximately 09:00. Animals in groups A-E have been dosed once weekly by the intravenous route (as detailed on Figure 54). In all groups, food and water intake have been determined twice weekly (on the day of iv dosing and on water refill days. Blood glucose has been determined monthly. Samples were collected as detailed previously by glucometer (One Touch Ultra2). Blood samples have been taken in the freely fed state (beginning at approx. 09:00). Animals have been dosed immediately afterwards by the respective route to a timed schedule.
- each animal has been placed in a metabolism cage with free access to food and water for a 24h period.
- the glass urine collectors have been placed in a polystyrene container (Sca- online, UK) which was filled with ice. Due to the anticipated increase in daily urine volume with STZ, urine has been collected (and stored refrigerated) at intervals (e.g. 8 hourly) to ensure that twenty four hours total urine volume for each metabolic cage can be recorded. The aliquots at each time point have been pooled so that a single 24h sample per animal is collected. Ten aliquots of 300 ⁇ of pooled 24h urine have been taken and frozen at -80°C.
- the glomerular filtration rate (GFR) of the animals has been assessed using the FITC-inulin method. This was performed based on the method of Stridh, S., Sallstrom, J. et al (2009): "C-Peptide Normalizes Glomerular Filtration Rate in Hyperfiltrating Conscious Diabetic Rats" Oxygen Transport to tissue XXX. Advances in experimental medicical and biology. 645:21 9-25, which is hereby incorporated by reference. Specifically, FITC-inulin (1 .5%) has been dissolved in saline and filtered through a 0.45 pm syringe filter.
- the solution has been dialysed in 2000 ml of saline at 4 °C overnight using a 1000 Da cut-off dialysis membrane (Spectra Por 6 from Fisher UK) and protected from light.
- the dialysed inulin has been filtered through a 0.22 pm syringe filter before use.
- Each animal has been dosed with 1 ml (1 5 mg) of FITC-inulin via the tail vein (i.e. intravenously).
- a blood sample 80 pi
- Each blood sample underwent centrifugation in a cooled centrifuge and the plasma sample dispensed into a clean aliquot vial for subsequent determination of fluorescence at 496 nm excitation and 520 nm emission.
- kidney tissues For the wax blocks, all tissues have been prepared using a Tissue Tek VIP processor (using graded alcohols to dehydrate and xylene as a clearant). The blocks have then been impregnated with paraffin histo-wax prior to embedding in fresh histo-wax. Kidney tissues were sectioned at approximately 4-5pm and stained using methods for Haematoxylin and Eosin (H&E) and periodic acid Schiff (PAS). Subsequently, slides will be sent for assessment by a pathologist (e.g. to Harlan Laboratories Ltd. UK). The pathologist evaluated all slides stained by H&E and PAS for glomerular sclerosis, tubule atrophy and interstitial expansion semi-quantitatively using a "+, ++, +++" system (or similar).
- H&E Haematoxylin and Eosin
- PAS periodic acid Schiff
- XG-102 has been dosed in the volume 1 ml/kg in commercially available sterile saline. To this end, XG-102 has been formulated prior to the first dosing by the addition of sterile saline, whereby the highest dose has been formulated (4 mg/ml) and the lower doses were prepared by dilution of this 4 mg/ml stock. Aliquots were then prepared for each dosing session and stored frozen (-80 °C, stabi lity 3 months at -80°C) until use. On the morning of dosi ng each aliquot has been removed from the freezer and al lowed to thaw at room temperature prior to dosing (e.g. 30 minutes).
- the thawed solution has been mixed by inversion prior to dosing. All dosing was completed as soon as possible after thawing but in all cases within 8 hours since the test item is stable in saline at room temperature at concentrations of 1 0 pg/ml - 50 mg/ml for 8 hours. Sterile polypropylene plastics (including pipette tips) have been used. The stock solution will be fi lter sterilised (0.2 pm) prior to use and prior to dilution to lower doses. Losartan potassium has been purchased from a Chemical supplier (e.g. Tocris UK) and prepared for dosing each morning in a vehicle of 1 % methyl cel lulose at a volume of 5 ml/kg. Dosing factors have been applied where appropriate.
- results have been expressed as body weights, change in body weight per week for the first 4 weeks and per 4 weeks thereafter, and over the entire drug admi nistration period, % reduction in body weight at the end of the study and drug treatment compared to the control group, food and water intakes, cumulative food intake and average food and water intakes per week for the first 4 weeks and per 4 weeks thereafter and over the duration of the feeding study.
- Urine creatinine, glucose, urea, total protein and electrolytes have been expressed as treatment group means ⁇ SEM. Analysis has been by general linear model with treatment and cohort as factors. Appropriate transformations and/or robust regression techniques may have been used to reduce the influence of outliers. Suitable multiple comparison tests (two-tailed) have been used to compare each group to the appropriate STZ vehicle group. Kidney weights have been analysed by general linear model with treatment and cohort as factors and Day 1 body weight as a covariate. To determi ne effects in addition to effects caused by changes in body weight, analysis has been by general linear model with treatment and cohort as factors and terminal body weight as a covariate. A log transformation and/or robust regression techniques has been used if appropriate. Appropriate multiple comparison techniques has been used to compare each group to the appropriate STZ vehicle group. For the pathology assessment, each treatment has been compared to the appropriate STZ vehicle group by exact Wilcoxon rank sum tests.
- GFR has been calculated as Dose of FITC inulin / AUCo ⁇ .
- the AUC (of FITC inulin concentration) has been calculated by the log-linear trapezoidal rule (Stridh) with extrapolation of the 2 to 5 min line to 0 min and linear regression of log-transformed data during a terminal phase from 24 to 80 min. Calculated GFR values were analysed by two- way analysis of variance with treatment and cohort as factors. A log transformation and/or robust regression techniques has been used if appropriate.
- mice dosed iv have been analysed separately from animals dosed po, as dosing by different routes during the baseline week may affect the baseline values used as covariates.
- the non-STZ group has been excluded from all analyses described above. Separate analyses have been performed for comparisons to the non-STZ group, including all groups in the analysis, but using baseline covariates before treatment with STZ, rather than those during the week before dosing. In all analyses, a p value of less than 0.05 will be considered to be statistically significant.
- Example 22 Evaluation of the dose-response to XG-1 02 in islet isolation/transplantation
- Example 1 7 it has shown that intravascular addition of XG-1 02 (1 0 ⁇ ) to the preservation solution flushed into the porcine pancreas at the time of procurement has a significant impact on islet cell viability and functionality, assessed by oxygen consumption rate (OCR), and ATP concentration, and correlates with a decrease in JNK activation and c- fos gene expression.
- OCR oxygen consumption rate
- ATP ATP
- Noguchi et al have used a different inhibitor and added it at the same molar concentration into the pancreatic duct immediately after procurement. Porcine and human pancreases were used. They showed a similar effect on islet viability assessed by ATP concentration, but also an impact in vivo on diabetes reversal after transplantation under the kidney capsule of diabetic mice.
- the purpose of the present set of experiments has been to determine the dose-response curve of XG-102 and the optimal concentration at which to utilize it in islet isolation.
- a rodent model has been utilized. While differences between human and rodent pancreas and islets are acknowledged, this model was selected because of its straightforwardness and high cost-efficiency.
- the purpose of these experiments being solely the determination of the optimal dose of XG-1 02 required, the rat model appears as valid. Since the major purpose is JNK inhibition in human pancreases for the improvement of clinical allogeneic islet transplantation outcome, intraductal injection of the inhibitor has been done in these experiments. This is in effect the most likely way that the compound will be used in the clinical setting.
- islets of Langerhans have been isolated from Lewis rats by a classic enzymatic method using collagenase. Isolation has been carried out either immediately after animal sacrifice or after a 1 5-minute period of warm ischemia. JNK activation has been assessed by western blot at the end of the isolation process. JNK activation has been assessed on unprocessed rat pancreases as negative controls. Experiments have been done on 3 rats for each condition of ischemia plus 1 for the negative control, and repeated 3 times. This represents a total of 21 Lewis rats.
- XG-102 at the same molar concentration or vehicle has been used throughout the isolation procedure in the various washing or purification solutions utilized, and in the culture medium. Isolated islets have been cultured overnight in RPMI-based culture medium. For each set of experiments, the following XG-102 concentrations have been utilized: 1 ⁇ , 3 ⁇ , 10 ⁇ , 50 ⁇ and 100 ⁇ . Three animals have been utilized in each group for each concentration, and experiments have been repeated 2-3 times depending on results. This represents a total of 60-90 Lewis rats. Islet yields have been determined. The following assessments of islet viability has been performed: JNK activation, OCR, ATP concentration, caspase release, etc..
- pancreatic islets As shown in Figure 57, to study the effects of XG-1 02 on function and viability of rat pancreatic islets have been isolated islets from 15 min ischemia rat and from no ischemia rat.
- a static insulin secretion test (basal or stimulated using glucose) has been performed directly after islet isolation and 18 h after culture at 37°C. It can be observed that isolation affects islet function. Indeed basal insulin secretion was higher in islets used directly after isolation compared to islets incubated during 1 8h whatever the conditions. These high basal levels reflect a distress of islet. However after culture, ischemia and inhibitor XG-102 had no impact on islet function in this experiment.
- Example 23 Efficacy of XG-102 (SEP ID No. 1 1 ) in a Rat Laser-Induced Choroidal Neovascularization (CNV) Model following subconjunctival Injections
- the objectives of this study were to determine the efficacy of XG-102, a JNK-inhibitor, when administered by subconjunctival injections to rats in a model of laser-induced choroidal neovascularization (CNV).
- CNV laser-induced choroidal neovascularization
- this model allows predictions about a potential use of a compound for the treatment of age-related macular degeneration (AMD).
- AMD age-related macular degeneration
- the subconjunctival route of administration has been selected for the present study, because it is another preferred route for the administration in humans.
- the following experimental groups have been assigned:
- the vehicle control 0.9% NaCI, has been administered as received.
- Triamcinolone acetonide 4% serves as "Reference Item 2" and has also been administered as received.
- XG-1 02 preparation a stock solution equal to the highest dose level has been prepared in vehicle, 0.9% Sodium Chloride for Injection, and sterile filtered through a 0.22 pm polyvinylidene difluoride (PVDF) filter. The lower dose levels have been prepared by directly diluting the stock solution. Dose formulations have been prepared once at appropriate concentrations to meet dosage level requirements. All dilutions have been prepared by directly diluting the stock solution with vehicle.
- Two dosing aliquots (Days 1 and 8) have been prepared and stored in a freezer set to maintain -20°C. Aliquot(s) of each dose level have been thawed at ambient temperature on each day of dosing and the solution maintained at room temperature for no longer than 6 hours.
- the alternate animals have been used as replacements on the study within 3 days. On arrival, animals have been individually housed until randomization. Following randomization, animals have been group housed (up to 3 animals of the same dosing group together) in stainless steel perforated floor cages equipped with an automatic watering valve. Animals have been separated during designated procedures/activities. PMI Nutrition International Certified Rodent Chow No. 5CR4 (14% protein) has been provided ad libitum throughout the study, except during designated procedures. Municipal tap water after treatment by reverse osmosis and ultraviolet irradiation has been freely available to each animal via an automatic watering system (except during designated procedures).
- CNV Laser-Induced Choroidal Neovascularization
- a 4-spot pattern have been made between the major retinal vessels around the optic disc of each eye using an 81 0 nm diode laser at an initial power setting of 300 mW (laser power may be increased for bubble formation), an initial spot size of 80 ⁇ and a duration of 0.1 seconds.
- Laser parameters have been adjusted as required to ensure rupture of Bruch's membrane (correlated with bubble formation). In the event that rupture of Bruch's membrane is not confirmed for a particular spot, this has been documented. In this case or in the case of hemorrhage, an additional spot may be added if considered appropriate by the veterinary ophthalmologist. Any notable events, such as retinal hemorrhage were documented for each laser spot. If hemorrhage is too severe, the animal has been excluded from the study and replaced. Hydration of the eyes has been maintained with a saline solution and/or carboxymethylcellulose sodium 1 .0% during the procedure, as necessary.
- Vehicle control, test item or reference item will be administered by subconjunctival injection to the left and right eyes of each animal on Days 1 and 8 as indicated in the Experimental Design above.
- the animals have been anesthetized (isoflurane) for the dose administration, which has been performed by a board-certified veterinary ophthalmologist.
- Topical antibiotics gentamicin ophthalmic solution
- mydriatic drops (1 % tropicamide and/or 2.5% phenylephrine
- mydriatic drops (1 % tropicamide and/or 2.5% phenylephrine
- Angiography images JPEG or BMP
- JPEG or BMP Angiography images
- the Grading Procedure the Images have been selected at an appropriate focus level for grading. (More than 1 image/eye may be needed in order to grade all laser spots.)
- the angiograms have been graded independently by 2 scientific personnel and the grade for each of the laser spots has been recorded. Following completion of the grading by each person, the grades have been compared and any discrepancy has been reviewed by both parties, and a grade agreed upon and documented.
- the grading scale will be from 0-4 as indicated below:
- 0 no leakage (only laser scar or very diffuse small hyper-fluorescent area visible).
- Provantis Dose administration, bodyweight, food consumption, clinical observations, incidence of clinical observations, clinical biochemistry, hematology, coagulation, urinalysis, ophthalmology and gross pathology
- Example 24 Inhibitory effects of the INK inhibitor XG-102 on the inflammatory response in a rat periodontitis model
- the aim of this study is to investigate the influence of XG-102 (SEQ ID NO: 1 1 ) on inflammation induced in a periodontitis model in the rat.
- mice 30 rats are used in this study (divided into 4 groups of ten rats).
- Experimental periodontitis is induced by a ligature placed around the 1 st molar (one molar per animal) on Day 0.
- One dose of 2 or 4 mg/kg is administered intragingivally (IGV).
- IGF intragingivally
- Periodontitis inflammation aspect are analyzed by macroscopic observation of gingival tissue. Plaque index and gingival inflammation index are measured as periodontal clinical indices.
- inflammatory cells quantification of inflammatory cells is performed by histomorphometric measurements.
- inflammatory protein levels the level of inflammatory proteins (p-JNK, TNF, IL-1 , IL-10, MMP-8, MMP-9) are measured from gingival tissue homogenates.
- tissue destruction bone tissue destruction is evaluated on 3 animals per group by radiological analysis (micro-CT). Periodontal complex destruction is evaluated by histological analysis.
- bone trabecular measurements thickness, separation
- micro-CT radiological analysis
- bacterial population in dental pockets are identified by DNA probes (real time PCR) on 9 periodontopathogens.
- DNA probes real time PCR
- measurements of total collagen amount are performed using Polarized-light microscopy.
- the collagen l/collagen III ratio is evaluated by histomorphometrical analysis.
- Example 25 Effects of XG-1 02 (SEP ID No. 1 1 ) in a Diabetic Retinopathy Prevention Study in the Streptozotocin Treated Rat (IVT)
- the objective of this study was to determine the ability of XG-1 02 to prevent diabetic retinopathy when administered by intravitreal injections to streptozotocin (STZ)-treated (hyperglycemic) rats.
- a stock solution equal to the highest dose level was prepared in vehicle, 0.9% Sodium Chloride for Injection, and steri le filtered through a 0.22 pm polyvinylidene difluoride (PVDF) filter.
- the lower dose levels were prepared by directly diluting the stock solution.
- Dose formulations were prepared once at appropriate concentrations to meet dosage level requirements. All dilutions were prepared by directly diluting the stock solution with vehicle.
- Three dosing aliquots (Days 1 , 8 and 15) were prepared and stored in a freezer set to maintain -20°C. Aliquot(s) of each dose level were thawed at ambient temperature on each day of dosing and the solution maintained at room temperature for no longer than 6 hours.
- Brown Norway rats 60 male Brown Norway rats were received from Charles River Labs, Inc., Portage, II. The animals were approximately 8 weeks old and weighed between 1 66 and 228 g. The Brown Norway rat was chosen as the animal model for this study as it is an accepted species for use in the STZ-induced diabetic retinopathy model. The total number of animals used in this study was considered to be the minimum required to properly characterize the effects of the Test Items. This study has been designed such that it didnot require an unnecessary number of animals to accomplish its objectives. A minimum acclimation period of 20 days was allowed between animal receipt and the start of treatment in order to accustom the animals to the laboratory environment. Animals were assigned to groups by a stratified randomization scheme designed to achieve similar group mean body weights.
- Inducing Agent Groups 2 to 4, Day -7
- one vial of STZ per animal was reconstituted within 3 minutes of injection with 1 .5 mL of Steri le Water for Injection, USP, to provide a concentration of 27.5 mg/mL
- the vial was inverted or swirled to dissolve STZ.
- the resultant solution was fi ltered via a 0.22 pm Millex-CV fi lter into a empty sterile appropriately labeled vial.
- the STZ 55 mg/kg was administered by intravenous injection on Day -7, within 3 minutes of formulation via a syringe.
- the dose volume was 2 mL/kg and the actual dose administration was based on the most recent practical body weight of each animal.
- the animals were restrained duri ng the injection.
- Test items or reference item were administered by intravitreal injection to the left and right eyes of each animal on Days 1 , 8 and 1 5 as indicated in the Experimental Design table.
- the animals were anesthetized (isoflurane) for the dose administration, which was performed by a board-certified veterinary ophthalmologist.
- Topical antibiotics gentamicin ophthalmic solution
- mydriatic drops (1 % tropicamide and/or 2.5% phenylephrine) were applied to each eye (further appl ications were performed when considered appropriate by the veterinary ophthalmologist).
- opacities were associated also with corneal vascularization.
- Other ocular findings were noted, but were generally of low incidence or sporadic across groups, and/or did not persist. These findings included, but were not limited to: multifocal/diffuse corneal opacities, vitreous air bubbles, focal/diffuse/multifocal vitreous opacities, and focal retina opacities.
- Streptozotocin was administered by i ntravenous injection to induce diabetic retinopathy in the rat.
- the intravitreal injection route was selected for the Test Items because this is the intended route of administration in humans.
- the dose levels were selected based on information obtained with previous proof of concept studies as well as MTD and toxicity studies using the IVT route of administration.
- the mydriatic used was 1 % tropicamide. Intraocular pressure was measured following each ophthalmology examination, once prestudy and on Day 22, using a TonoVetTM rebound tonometer. The pre-treatment tonometry readings were performed at the same times as anticipated for the final measurements to reduce diurnal variability.
- Electroretinogram evaluations were performed once pretreatment and on Days 6, 1 3, and 20, prior to fluorescein angiography Animals were dark-adapted overnight prior to ERG recording and then anesthetized with an intramuscular injection of 75 mg/kg ketamine and 7.5 mg/kg xylazine. Tropicamide (1 %) was applied to each eye prior to the test (further applications were administered if considered necessary). The eyelids were retracted by means of a lid speculum, and a contact lens or gold loop electrode was placed on the surface of each eye. A needle electrode was placed cutaneously under each eye (reference) and on the head, posterior to the brow or at the base of the tai l (ground). Carboxymethylcellulose (1 %) drops were applied to the interior surface of the contact lens electrodes prior to placing them on the eyes. Each ERG occasion consisted of the following series of scotopic single flash stimuli :
- Fluorescein angiography evaluations were performed once pretreatment and on Days 7, 14, and 21 , following electroretinography. An isoflurane/oxygen mix was used prior to and during the procedure as the anesthesia. The mydriatic agent, 1 % tropicamide, was used as necessary. Hydration of the eyes was maintained by irrigation with saline solution, as needed. 0.2 mL of 1 0% Sodium Fluorescein Injection U.S. P. was administered via rapid tail vein injection, followed by a 0.5 mL saline flush. Still images of the fundus were recorded from both eyes between 10-15 minutes following the fluorescein injection. Images were taken from the right eye first, followed by the left.
- a topical bland ophthalmic ointment was administered to the eyes following the angiographies. Images were evaluated qualitatively for vascular integrity/diffuse leakage. Blood Glucose Level Determination were once pre-STZ treatment, Day -6 (the day following STZ administration) and three times per week thereafter (all animals). Additional blood glucose measurements may have been performed as required to monitor animal health status. Levels were determined by glucometer using blood drops taken from the tail vein. Values were measured in mmol/L and converted into mg/dL by multiplying by 1 8 for reporting purposes. Urine Glucose Level Determination was weekly, beginning Week -1 , following overnight collection. Animals had access to food and water during the collection period.
- Urine glucose was measured by the Clinical Laboratory department using the P800 analyzer, from the abdominal aorta after isoflurane anesthesia. When possible, the animals were euthanized rotating across dose groups such that similar numbers of animals from each group, including controls were necropsied at similar times throughout the day.
- necropsy examination included evaluation of the carcass and musculoskeletal system; all external surfaces and orifices; cranial cavity and external surfaces of the brain; and thoracic, abdominal, and pelvic cavities with their associated organs and tissues.
- Necropsy procedures were performed by qual ified personnel with appropriate training and experience in animal anatomy and gross pathology. A veterinary pathologist, or other suitably qualified person, was available. Representative samples of the tissues identified below were col lected from all animals and preserved in 1 0% neutral buffered formalin, unless otherwise indicated.
- the following Table includes a summary of amplitudes for all ERG stimuli by occasion (pretreatment, and Days 6, 13 and 20, respectively). The values represent the group mean and standard deviation (below):
- Example 26 Effects of XG-102 (SEP ID No. 1 1 ) in a Diabetic Reti nopathy Prevention Study in the Streptozotocin Treated Albino Rat (subconjunctival)
- the objective of this study was determine the abi lity of XG-1 02 to prevent diabetic retinopathy when administered by weekly subconjunctival injection to streptozotocin (STZ)- treated (hyperglycemic) rats for 3 weeks.
- Naive Long Evans rats were used (42 male animals; 1 0 weeks of age, at time of dosing; Charles River, St. Constant, QC).
- the Long Evans rat was chosen as the animal model for this study as it is an accepted species for use in the STZ-induced diabetic retinopathy model.
- the total number of animals to be used in this study is considered to be the minimum required to properly characterize the effects of the test item and has been designed such that it does not require an unnecessary number of animals to accomplish its objectives.
- studies in laboratory animals provide the best avai lable basis for extrapolation to humans. Acceptable models which do not use live animals currently do not exist. Projected release of alternates wi ll be Day 4. Animals will be housed in stainless-steel cages.
- PMI Nutrition International Certified Rodent Chow No. 5CR4 (1 4% protein) was provided daily in amounts appropriate for the size and age of the animals.
- Steri le vials containing 0.0412 g of inducing agent (STZ) wil l be pre-weighed, sealed and transferred to the dosing room for administration to Groups 2 to 5 animals and selected spares on Day -7.
- a duplicate set of empty, appropriately labeled sterile vials wil l be provided.
- the reconstituted STZ solution will be filtered into these vials for dosing.
- the Test Item, XG-1 02 was prepared using the provided correction factor.
- a stock solution equal to the highest dose level was prepared in vehicle, 0.9% Sodium Chloride for Injection, and steri le filtered through a 0.22 pm polyvinylidene difluoride (PVDF) filter.
- PVDF polyvinylidene difluoride
- the lower dose levels were prepared by directly di luting this stock solution with saline. Dosing aliquots were prepared and stored in a freezer set to mai ntain -20°C. Aliquot(s) of each dose level were thawed at ambient temperature on each day of dosing and the solutions maintained at room temperature for no longer than 6 hours. The vehicle, 0.9% Sodium Chloride for Injection, was administered as received.
- One vial of STZ per animal was reconstituted within 3 minutes of injection with 1 .5 mL of Sterile Water for Injection, USP, to provide a concentration of 27.5 mg/mL The vial was inverted or swirled to dissolve the STZ.
- the reconstituted STZ solution was filtered via a 0.22 pm Mi llex-GV filter into empty sterile vials for dosing.
- STZ was administered by intravenous injection on Day -7, within 3 minutes of formulation via a syringe.
- the dose volume was 2 mL/kg and the actual dose administration was based on the most recent practical body weight of each animal.
- the animals wil l be restrained during the injection.
- STZ-treated animals were considered diabetic if the blood glucose level is > 250 mg/dL.
- Test item or vehicle were administered by subconjunctival injection to the left and right eyes of each animal on Days 1 , 8 and 1 5 and again on Day 24 (Rep 1 ), Day 23 (Rep 2 and 3), Day 22 (Rep 4) and Day 34 (Rep 1 ) Day 33 (Rep 2 and 3) and Day 32 (Rep 4).
- the animals were anesthetized (isoflurane) for the dose administration, which was performed by a board-certified veterinary ophthalmologist.
- Topical antibiotics (0.3% tobramycin ointment) was applied to both eyes twice on the day before treatment, following the injection and at least once on the day following the injection.
- mydriatic drops (1 % tropicamide and/or 2.5% phenylephrine) were applied to each eye (further applications may be performed as considered appropriate by the veterinary ophthalmologist).
- animals were maintained under anesthesia with isoflurane/oxygen gas.
- the conjunctivae were flushed with 0.9% Sodium Chloride for Injection USP.
- a 29-gauge, 1 /2-inch needle attached to a 0.5 cc Terumo insulin syringe was used for each subconjunctival injection (one syringe/group/treatment).
- Test items or reference item were administered into the eyes of each animal at a dose volume of 50 ⁇ /eye.
- Ophthalmic examinations were performed once prestudy and again on Day 37 (Rep 1 ), Day 36 (Rep 2 and 3) and Day 35 (Rep 4). All animals were subjected to funduscopic (indirect ophthalmoscopy) and biomicroscopic (slit lamp) examinations. The mydriatic used will be 1 % tropicamide. Intra- ocular pressure was measured once prestudy and on Day 37 (Rep 1 ), Day 36 (Rep 2 and 3) and Day 35 (Rep 4). The pre-treatment tonometry readings were performed at the same times as anticipated for the final measurements to reduce diurnal variability. Intraocular pressure was measured following the ophthalmology examinations, using a TonoVetTM rebound tonometer.
- Electroretinogram evaluations were performed once pretreatment and on Days 7, 14, 21 , and Day 36 (Rep 1 ), Day 35 (Rep 2 and 3) and Day 34 (Rep 4). Animals were dark-adapted overnight prior to ERG recording and then anesthetized with an intramuscular injection of 75 mg/kg ketamine and 7.5 mg/kg xylazine. Tropicamide (1 %) was applied to each eye prior to the test (further applications may be administered if considered necessary). The eyelids were retracted by means of a lid speculum, and a contact lens or gold loop electrode was placed on the surface of each eye. A needle electrode was placed cutaneously under each eye (reference) and on the head posterior to the brow or at the base of the tail (ground). Carboxymethylcellulose (1 %) drops were applied to the interior surface of the contact lens electrodes prior to placing them on the eyes.
- the animals were adapted to background light at approximately 25 to 30 cd/m 2 for a period of approximately 5 minutes (a longer time period is acceptable), followed by an average of 20 sweeps of photopic white flicker at 1 Hz, then 20 sweeps of photopic flicker at 29 Hz.
- Waveforms were analyzed for a- and b-wave amplitudes and latency and oscillatory potentials 1 through 4 from the 0 dB scotopic stimulus will be filtered and analyzed for amplitude and latency.
- Indocyanin Green angiography evaluations were performed once pretreatment (Day -2 or -1 ) and on Days 8, 1 5, 22, and Day 35 (Rep 1 ), Day 34 (Rep 2 and 3) and Day 33 (Rep 4).
- An isoflurane/oxygen mix was used prior to and during the procedure as the anesthesia.
- the mydriatic agent used was 1 % tropicamide as necessary. Hydration of the eyes was maintained by irrigation with saline solution, as needed.
- 0.2 mL of 0.5% Indocyanin Green was administered via rapid tail vein injection, followed by a 0.5 mL saline flush. Still images of the fundus were recorded from both eyes between 10-15 minutes following the ICG injection. Images were taken from the right eye first, followed by the left.
- a topical bland ophthalmic ointment was administered to the eyes following the angiographies. Images were evaluated qualitatively for vascular integrity/diffuse leakage. Blood glucose level were measured once pre-STZ treatment, on Day -6 (the day following STZ administration) and again on Day -1 . Additional blood glucose measurements may be performed as required to monitor animal health status. Levels were determined by glucometer using blood drops taken in the tail vein. Values were measured in mmol/L and converted into mg/dL by multiplying by 18 for reporting purposes.
- Example 27 A randomized, double-blind, parallel group, controlled, multicentre trial to assess the efficacy and safety of a single sub-conjunctival injection of XG-102, compared to dexamethasone eye drops in post-surgery intraocular inflammation (Clinical Phase II)
- arachidonic acid is metabolized by cyclooxygenase (COX) to prostaglandins (PG) which are the most important lipid-derived mediators of inflammationi .
- COX cyclooxygenase
- PG prostaglandins
- Surgical trauma causes a trigger of the arachidonic acid cascade which in turn generates PGs by activation of COX-1 and COX-2.
- Phospholipids in the cell membrane are the substrate for phospholipase A to generate arachidonic acid from which a family of chemically distinct PGs and leukotriens are produced2.
- the 'golden standard' for the treatment of ocular inflammation are topical corticosteroids and/or Non-Steroidal Anti-inflammatory Drugs (NSAIDs).
- Side effects reported with (short-term) corticosteroid use include cataract formation, increased Intra Ocular Pressure (IOP), increased susceptibility to viral infections and retardation of the corneal epithelial and stromal wound healing3, 4.
- IOP Intra Ocular Pressure
- prolonged treatment with corticosteroids have been known to induce systemic side effects such as glucose impairment, hypertension, development of glaucoma, visual acuity defects, loss of visual field, and posterior subcapsular cataract formation5.
- XG-102 is a protease-resistant peptide that selectively inhibits c-Jun N- terminal Kinase (INK) activity in a non-Adenosine Triphosphate (ATP) competitive manner.
- XG-102 is a 31 D-amino acids JNK inhibitor peptide with all amino acids except glycine (which is achiral) in the D-configuration. This choice was made to increase the resistance of the compound to proteases, which usually degrade peptides soon after their administration.
- the previous trial was an open label, single-center, dose escalation / dose finding study which was designed to assess the safety and tolerability of a single sub-conjunctival injection of XG- 1 02, administered in addition to the 'usual' post-op anti-inflammatory therapy in patients with post-surgery or post-traumatic intraocular inflammation.
- the XG-102 doses which were investigated were 45, 90, 450 and 900 pg. In total, 20 patients (5 patients in each dose group) were enrolled in this study.
- the conclusion of the previous study was that XG-102, administered as a sub-conjunctival injection in patients with recent post-surgery or trauma intraocular inflammation was safe and well tolerated.
- the objectives of the SDD-1002-035 study were to evaluate the efficacy and safety of a single sub-conjunctival injection of XG-102 90 or 900 pg administered within maximally 3 hours after the end of the surgical procedure compared to dexamethasone eye drops administered 4 times/day for 21 days in post-operative intraocular inflammation.
- the primary objective of the SDD-1002-035 study was to evaluate if a single sub-conjunctival injection of 900 pg XG-102 is non-inferior to treatment with dexamethasone eye drops administered 4 times/day for 21 days in the evolution of post-operative intraocular inflammation.
- the primary outcome was evaluated by the mean anterior chamber cells grade at day 28 post-administration of the subconjunctival injection of study treatment comparing XG-102 900 pg with dexamethasone eye drops.
- the secondary objectives were to evaluate the effect of a single sub-conjunctival injection of either 90 pg or 900 pg XG-102 compared to dexamethasone eye drops (4 times/day, administered for 21 days) on:
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Diabetes (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Biomedical Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Physical Education & Sports Medicine (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Hematology (AREA)
- Dermatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Ophthalmology & Optometry (AREA)
- Epidemiology (AREA)
- Zoology (AREA)
- Endocrinology (AREA)
- Urology & Nephrology (AREA)
- Pain & Pain Management (AREA)
- Psychiatry (AREA)
- Rheumatology (AREA)
- Obesity (AREA)
- Marine Sciences & Fisheries (AREA)
- Toxicology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
Priority Applications (28)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020157034160A KR20160023669A (ko) | 2013-06-26 | 2014-06-26 | 다양한 질병의 치료를 위한 jnk 신호 전달 경로의 세포 투과성 펩타이드 억제자의 새로운 용도 |
| EP14734003.8A EP3013353B1 (en) | 2013-06-26 | 2014-06-26 | Cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of cystitis |
| JP2016522321A JP2016523274A (ja) | 2013-06-26 | 2014-06-26 | 種々の疾患を処置するためのjnkシグナル伝達経路の新規の細胞透過性ペプチド阻害剤の使用 |
| CN201480030666.XA CN105307670A (zh) | 2013-06-26 | 2014-06-26 | Jnk信号转导途径的细胞渗透肽抑制剂用于治疗多种疾病的新用途 |
| ES14734003T ES2870085T3 (es) | 2013-06-26 | 2014-06-26 | Inhibidores peptídicos permeables a células de la ruta de transducción de señales de JNK para el tratamiento de la cistitis |
| CA2903275A CA2903275A1 (en) | 2013-06-26 | 2014-06-26 | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| PL14734003T PL3013353T3 (pl) | 2013-06-26 | 2014-06-26 | Przenikające do komórki inhibitory peptydowe szlaku przekazywania sygnału jnk do leczenia zapalenia pęcherza |
| EA201501080A EA201501080A1 (ru) | 2013-06-26 | 2014-06-26 | Новое применение обладающих способностью проникать в клетку пептидных ингибиторов пути трансдукции сигнала jnk для лечения различных заболеваний |
| AU2014301631A AU2014301631A1 (en) | 2013-06-26 | 2014-06-26 | New use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases |
| US14/891,067 US10624948B2 (en) | 2013-06-26 | 2014-06-26 | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases |
| HK16112683.9A HK1224225A1 (zh) | 2013-06-26 | 2014-06-26 | Jnk信号转导途径的细胞渗透肽抑制剂用於治疗多种疾病的新用途 |
| PCT/EP2014/002724 WO2015197098A1 (en) | 2014-06-26 | 2014-10-08 | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| EP15732533.3A EP3160489B9 (en) | 2014-06-26 | 2015-06-26 | Cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of cystitis |
| KR1020177002555A KR20170021349A (ko) | 2014-06-26 | 2015-06-26 | 다양한 질병의 치료를 위한 jnk 신호 전달 경로의 세포 투과성 펩타이드 억제자의 새로운 용도 |
| JP2016575155A JP2017520571A (ja) | 2013-06-26 | 2015-06-26 | 様々な疾患の処置のためのjnkシグナル伝達経路の細胞透過性ペプチド阻害剤の新規使用 |
| MX2016017308A MX2016017308A (es) | 2013-06-26 | 2015-06-26 | Nuevo uso de inhibidores de peptido permeables a celulas de la ruta de transduccion de señal jnk para el tratamiento de varias enfermedades. |
| CN201580034014.8A CN106714821B (zh) | 2014-06-26 | 2015-06-26 | Jnk信号转导途径的细胞穿透肽抑制剂用于治疗多种疾病的新用途 |
| US15/321,893 US20170137481A1 (en) | 2013-06-26 | 2015-06-26 | Use of Cell-Permeable Peptide Inhibitors of the JNK Signal Transduction Pathway for the Treatment of Various Diseases |
| SG11201609335RA SG11201609335RA (en) | 2014-06-26 | 2015-06-26 | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| BR112016029413A BR112016029413A2 (pt) | 2013-06-26 | 2015-06-26 | utilização de inibidores peptídicos permeáveis às células da via de transdução do sinal da jnk para o tratamento de várias doenças |
| AU2015281361A AU2015281361A1 (en) | 2014-06-26 | 2015-06-26 | New use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases |
| PCT/EP2015/001294 WO2015197194A2 (en) | 2014-06-26 | 2015-06-26 | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| PL15732533.3T PL3160489T3 (pl) | 2013-06-26 | 2015-06-26 | Przenikające do komórki inhibitory peptydowe szlaku przekazywania sygnału jnk do leczenia zapalenia pęcherza moczowego |
| ES15732533T ES2949982T3 (es) | 2014-06-26 | 2015-06-26 | Inhibidores peptídicos permeables en células de la ruta de transducción de señales de JNK para el tratamiento de la cistitis |
| CN202110758186.7A CN113509541A (zh) | 2014-06-26 | 2015-06-26 | Jnk信号转导途径的细胞穿透肽抑制剂用于治疗多种疾病的新用途 |
| CA2947508A CA2947508A1 (en) | 2014-06-26 | 2015-06-26 | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| US15/516,943 US11779628B2 (en) | 2013-06-26 | 2015-10-08 | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases |
| JP2020005107A JP7165693B2 (ja) | 2014-06-26 | 2020-01-16 | 様々な疾患の処置のためのjnkシグナル伝達経路の細胞透過性ペプチド阻害剤の新規使用 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EPPCT/EP2013/001881 | 2013-06-26 | ||
| PCT/EP2013/001881 WO2014206427A1 (en) | 2013-06-26 | 2013-06-26 | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| EP2013001896 | 2013-06-27 | ||
| EPPCT/EP2013/001896 | 2013-06-27 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2014206563A2 true WO2014206563A2 (en) | 2014-12-31 |
| WO2014206563A3 WO2014206563A3 (en) | 2015-03-19 |
Family
ID=51033122
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2014/001736 Ceased WO2014206563A2 (en) | 2013-06-26 | 2014-06-26 | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
Country Status (14)
| Country | Link |
|---|---|
| US (1) | US10624948B2 (enExample) |
| EP (1) | EP3013353B1 (enExample) |
| JP (3) | JP2016523274A (enExample) |
| KR (1) | KR20160023669A (enExample) |
| CN (1) | CN105307670A (enExample) |
| AU (1) | AU2014301631A1 (enExample) |
| BR (1) | BR112016029413A2 (enExample) |
| CA (1) | CA2903275A1 (enExample) |
| EA (1) | EA201501080A1 (enExample) |
| ES (1) | ES2870085T3 (enExample) |
| HK (1) | HK1224225A1 (enExample) |
| MX (1) | MX2016017308A (enExample) |
| PL (1) | PL3013353T3 (enExample) |
| WO (1) | WO2014206563A2 (enExample) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2017520569A (ja) * | 2013-06-26 | 2017-07-27 | ザイジェン インフラメーション エルティーディー | 様々な疾患の処置のためのjnk阻害剤分子の新規使用 |
| CN107531768A (zh) * | 2015-01-23 | 2018-01-02 | 鹿特丹伊拉斯谟大学医疗中心 | 抗衰老化合物及其用途 |
| CN113633662A (zh) * | 2021-07-02 | 2021-11-12 | 中山大学附属口腔医院 | 线粒体移植在治疗牙周炎中的应用 |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9150618B2 (en) | 2010-10-14 | 2015-10-06 | Xigen Inflammation Ltd. | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases |
| WO2013091670A1 (en) | 2011-12-21 | 2013-06-27 | Xigen S.A. | Novel jnk inhibitor molecules for treatment of various diseases |
| WO2014206427A1 (en) | 2013-06-26 | 2014-12-31 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| WO2015197097A1 (en) | 2014-06-26 | 2015-12-30 | Xigen Inflammation Ltd. | New use for jnk inhibitor molecules for treatment of various diseases |
| WO2014206563A2 (en) | 2013-06-26 | 2014-12-31 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| CN109303782A (zh) * | 2018-10-24 | 2019-02-05 | 厦门大学 | Jnk-in-8在制备干性年龄相关性黄斑变性的神经保护剂中的应用 |
| WO2021046652A1 (en) | 2019-09-12 | 2021-03-18 | The University Of British Columbia | Inhibiting zd17-jnk interaction as a therapy for acute myocardial infarction |
| KR102151133B1 (ko) * | 2019-12-27 | 2020-09-02 | 주식회사 인투앱 | 프로피오니박테리움 아크네스에 특이적으로 결합하는 신규한 항체 및 이의 용도 |
| JP7740715B2 (ja) * | 2020-07-06 | 2025-09-17 | 学校法人東京薬科大学 | ペプチドおよびそれを含む複合体 |
| KR102273163B1 (ko) * | 2020-09-10 | 2021-07-05 | 주식회사 파이안바이오테크놀로지 | 혈소판 유래 미토콘드리아의 수득 방법 및 이의 용도 |
| CN117147251B (zh) * | 2023-08-16 | 2024-04-26 | 四川大学 | 一种人类离体牙髓组织透明化方法 |
Family Cites Families (148)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IT1195304B (it) | 1981-12-22 | 1988-10-12 | Anic Spa | Metodo per la preparazione di gem-diammino derivati n-monoacilati |
| US4631211A (en) | 1985-03-25 | 1986-12-23 | Scripps Clinic & Research Foundation | Means for sequential solid phase organic synthesis and methods using the same |
| US4698327A (en) | 1985-04-25 | 1987-10-06 | Eli Lilly And Company | Novel glycopeptide derivatives |
| IT1190389B (it) | 1985-09-19 | 1988-02-16 | Eniricerche Spa | Esapeptidi ad attivita' ipotensiva |
| US5169933A (en) | 1988-08-15 | 1992-12-08 | Neorx Corporation | Covalently-linked complexes and methods for enhanced cytotoxicity and imaging |
| IT1227907B (it) | 1988-12-23 | 1991-05-14 | Eniricerche S P A Milano Sclav | Procedimento per la sintesi di peptidi retro-inversi e nuovi intermediin tale procedimento |
| US5804604A (en) | 1989-12-21 | 1998-09-08 | Biogen, Inc. | Tat-derived transport polypeptides and fusion proteins |
| US6316003B1 (en) | 1989-12-21 | 2001-11-13 | Whitehead Institute For Biomedical Research | Tat-derived transport polypeptides |
| US5674980A (en) | 1989-12-21 | 1997-10-07 | Biogen Inc | Fusion protein comprising tat-derived transport moiety |
| US5840313A (en) | 1990-09-27 | 1998-11-24 | Syntello Vaccine Development Kb | Peptides for use in vaccination and induction of neutralizing antibodies against human immunodeficiency virus |
| WO1992018138A1 (en) | 1991-04-10 | 1992-10-29 | The General Hospital Corporation | Mammalian gap-43 compositions and methods of use |
| US5994108A (en) | 1991-11-05 | 1999-11-30 | Board Of Regents, The University Of Texas System | Mutant TAR virus and transdominant tat mutants as pharmacological agents |
| US5350835A (en) | 1991-11-05 | 1994-09-27 | Board Of Regents, University Of Texas | Cellular nucleic acid binding protein and uses thereof in regulating gene expression and in the treatment of aids |
| AU671450B2 (en) | 1992-03-20 | 1996-08-29 | Baylor College Of Medicine | A DNA transporter system and method of use |
| DE69333434T2 (de) | 1992-04-03 | 2005-03-03 | The Regents Of The University Of California, Oakland | Selbstorganisierendes system zur verabreichung von polynukleotiden enthaltend ein amphiphatisches peptid |
| EP0673385A4 (en) | 1992-08-13 | 1995-11-29 | Gen Hospital Corp | COMPOSITIONS CONCERNING GAP-43 MAMMALS AND METHODS OF USE. |
| EP0903408A3 (en) | 1992-08-21 | 2005-11-02 | Biogen, Inc. | Tat-derived transport polypeptide |
| CN1091138A (zh) | 1992-08-27 | 1994-08-24 | 迪金研究有限公司 | 疫苗 |
| US5545551A (en) | 1992-08-28 | 1996-08-13 | Mt. Sinai School Of Medicine Of The City University Of New York | Cloning and expression of pur protein |
| WO1994023751A1 (de) | 1993-04-14 | 1994-10-27 | Boehringer Mannheim Gmbh | Nukleinsäure-transferpeptide und deren verwendung zur einschleusung von nukleinsäuren in eukaryontische zellen |
| WO1995014772A1 (en) | 1993-11-12 | 1995-06-01 | Kenichi Matsubara | Gene signature |
| US5595756A (en) | 1993-12-22 | 1997-01-21 | Inex Pharmaceuticals Corporation | Liposomal compositions for enhanced retention of bioactive agents |
| US5807746A (en) | 1994-06-13 | 1998-09-15 | Vanderbilt University | Method for importing biologically active molecules into cells |
| EP0767833A1 (en) | 1995-04-25 | 1997-04-16 | Baxter International Inc. | Composition containing collagenase and chymopapain for isolating hepatocytes and pancreatic islet cells |
| DE69637147T2 (de) | 1995-07-28 | 2008-03-06 | Marie Curie Cancer Care | Transportproteine und deren verwendungen |
| CA2232750A1 (en) | 1995-09-21 | 1997-03-27 | Innapharma, Inc. | Peptides and peptidomimetics inhibiting the oncogenic action of p21 ras |
| IE80466B1 (en) | 1995-11-10 | 1998-07-29 | Elan Corp Plc | Peptides which enhance transport across tissues and methods of identifying and using the same |
| US5877282A (en) | 1996-09-20 | 1999-03-02 | Bristol-Myers Squibb Company | Peptide inhibitors of nuclear protein translocation having nuclear localization sequences and methods of use thereof |
| US6187817B1 (en) | 1996-10-03 | 2001-02-13 | Southern Illinois University School Of Medicine | Therapeutic use of d-methionine to reduce the toxicity of platinum-containing anti-tumor compounds |
| US6361938B1 (en) | 1996-11-08 | 2002-03-26 | Elan Corporation, Plc | Peptides which enhance transport across tissues and methods of identifying and using the same |
| AU7410998A (en) | 1996-11-26 | 1998-06-22 | Johns Hopkins University, The | Ligand detection system and methods of use thereof |
| US5989814A (en) | 1997-04-01 | 1999-11-23 | Reagents Of The University Of California | Screening methods in eucaryotic cells |
| US5880261A (en) | 1997-04-03 | 1999-03-09 | Waeber; Gerard | Transcription factor Islet-Brain 1 (IB1) |
| WO1998047913A2 (en) | 1997-04-18 | 1998-10-29 | The University Of Medicine And Dentistry Of New Jersey | Inhibition of hiv-1 replication by a tat rna-binding domain peptide analog |
| US6043083A (en) | 1997-04-28 | 2000-03-28 | Davis; Roger J. | Inhibitors of the JNK signal transduction pathway and methods of use |
| AU755154B2 (en) | 1997-05-15 | 2002-12-05 | Cytogen Corporation | Random peptides that bind to gastro-intestinal tract (GIT) transport receptors and related methods |
| CA2291074C (en) | 1997-05-21 | 2008-04-01 | The Board Of Trustees Of The Leland Stanford Junior University | Composition and method for enhancing transport across biological membranes |
| FR2767323B1 (fr) | 1997-08-12 | 2001-01-05 | Synt Em | Peptides lineaires derives de peptides antibiotiques, leur preparation et leur utilisation pour vectoriser des substances actives |
| EP0897002A3 (en) | 1997-08-14 | 2001-10-04 | Smithkline Beecham Plc | U62317, a protein having a JNK-binding domain |
| AU9402898A (en) | 1997-09-26 | 1999-04-23 | Washington University | Cell death agonists |
| US6420031B1 (en) | 1997-11-03 | 2002-07-16 | The Trustees Of Princeton University | Highly transparent non-metallic cathodes |
| CA2306870A1 (en) | 1997-10-20 | 1999-04-29 | David Michael Goldstein | Bicyclic kinase inhibitors |
| US6270956B1 (en) | 1997-12-11 | 2001-08-07 | The Salk Institute For Biological Studies | Transcriptional coactivator that interacts with Tat protein and regulates its binding to TAR RNA, methods for modulating Tat transactivation, and uses therefor |
| EP0947524A1 (en) | 1998-03-30 | 1999-10-06 | Upither B.V. | Novel peptides for the treatment of autoimmune diseases |
| US6248558B1 (en) | 1998-03-31 | 2001-06-19 | Vanderbilt University | Sequence and method for genetic engineering of proteins with cell membrane translocating activity |
| US20020042423A1 (en) | 1998-04-29 | 2002-04-11 | John R. Richert | Methods for identifying compounds that bind to hla molecules and use of such compounds as hla-agonists or antagonists |
| CA2327354A1 (en) | 1998-05-13 | 1999-11-18 | Incyte Pharmaceuticals, Inc. | Human apoptosis associated proteins |
| US6811992B1 (en) | 1998-05-14 | 2004-11-02 | Ya Fang Liu | Method for identifying MLK inhibitors for the treatment of neurological conditions |
| WO1999058561A1 (fr) | 1998-05-14 | 1999-11-18 | Pasteur Merieux Serums & Vaccins | Mimotopes du virus de l'hepatite c |
| AU4289399A (en) | 1998-06-18 | 2000-01-05 | Dnavec Research Inc. | Nucleic acid transfer phage |
| CA2328457A1 (en) | 1998-06-20 | 1999-12-29 | Washington University | Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy |
| US8038984B2 (en) | 1998-06-20 | 2011-10-18 | Washington University | Membrane-permeant peptide complexes for treatment of sepsis |
| US6589503B1 (en) | 1998-06-20 | 2003-07-08 | Washington University | Membrane-permeant peptide complexes for medical imaging, diagnostics, and pharmaceutical therapy |
| HK1043801A1 (zh) | 1998-08-28 | 2002-09-27 | 格莱风科学公司 | 精确长度的聚酰胺链、其制备方法和其与蛋白质的缀合物 |
| CN1329034C (zh) | 1998-09-25 | 2007-08-01 | 赛福伦公司 | 预防/治疗感觉毛细胞和耳蜗神经元损伤的药物 |
| US20020090696A1 (en) | 1998-12-08 | 2002-07-11 | Miller Carol A. | Treating neurological disorders using human apoptosis inhibiting protein |
| US6656474B1 (en) | 1999-01-15 | 2003-12-02 | Regeneron Pharmaceuticals, Inc. | Methods of using a neurotrophin and its analogues for the treatment of gastrointestinal hypomotility disorders |
| US6673908B1 (en) | 1999-02-22 | 2004-01-06 | Nuvelo, Inc. | Tumor necrosis factor receptor 2 |
| JP2003506071A (ja) | 1999-05-28 | 2003-02-18 | アポプトシス テクノロジー,アイエヌシー. | アポトーシスを制御する化合物および方法ならびにアポトーシスを制御する化合物を製造およびスクリーニングする方法 |
| US7510824B2 (en) | 1999-06-02 | 2009-03-31 | Nono Inc. | Method of screening peptides useful in treating traumatic injury to the brain or spinal cord |
| WO2000075118A1 (en) | 1999-06-03 | 2000-12-14 | Vertex Pharmaceuticals Incorporated | INHIBITORS OF c-JUN N-TERMINAL KINASES (JNK) |
| DK1102785T3 (da) | 1999-06-07 | 2013-05-13 | Arrowhead Res Corp | Sammensætninger til lægemiddeltilførsel ved anvendelse af pH-følsomme molekyler |
| US6669951B2 (en) | 1999-08-24 | 2003-12-30 | Cellgate, Inc. | Compositions and methods for enhancing drug delivery across and into epithelial tissues |
| MXPA02001857A (es) | 1999-08-24 | 2003-07-14 | Cellgate Inc | Composiciones y metodos para incrementar la entrega de drogas a traves y dentro de tejidos epiteliales. |
| US20030104622A1 (en) | 1999-09-01 | 2003-06-05 | Robbins Paul D. | Identification of peptides that facilitate uptake and cytoplasmic and/or nuclear transport of proteins, DNA and viruses |
| EP1210362A2 (en) | 1999-09-01 | 2002-06-05 | University Of Pittsburgh Of The Commonwealth System Of Higher Education | Identification of peptides that facilitate uptake and cytoplasmic and/or nuclear transport of proteins, dna and viruses |
| US6610820B1 (en) * | 1999-10-12 | 2003-08-26 | University Of Lausanne | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
| US20040082509A1 (en) | 1999-10-12 | 2004-04-29 | Christophe Bonny | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
| US20030108539A1 (en) | 2000-02-14 | 2003-06-12 | Christophe Bonny | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
| US8183339B1 (en) | 1999-10-12 | 2012-05-22 | Xigen S.A. | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
| JP2003523323A (ja) | 1999-12-06 | 2003-08-05 | ザ ジェネラル ホスピタル コーポレーション | 膵臓幹細胞および移植におけるその使用 |
| JP2003517023A (ja) | 1999-12-16 | 2003-05-20 | バイオジェン インコーポレイテッド | 中枢神経系の虚血性損傷または出血性損傷を、抗α4インテグリンアンタゴニストを用いて処置する方法 |
| JP4624639B2 (ja) | 2000-06-16 | 2011-02-02 | ジーランド ファーマ アクティーゼルスカブ | 短い荷電ペプチド鎖によってn及び/又はc末端が修飾されたペプチド |
| US6586403B1 (en) | 2000-07-20 | 2003-07-01 | Salpep Biotechnology, Inc. | Treating allergic reactions and inflammatory responses with tri-and dipeptides |
| US6897231B2 (en) | 2000-07-31 | 2005-05-24 | Signal Pharmaceuticals, Inc. | Indazole derivatives as JNK inhibitors and compositions and methods related thereto |
| US7033597B2 (en) | 2000-10-13 | 2006-04-25 | Université de Lausanne | Intracellular delivery of biological effectors |
| JP4387669B2 (ja) | 2000-10-13 | 2009-12-16 | ザイジェン エス.アー. | 新規なトランスポーターペプチド配列による生物学的エフェクターの細胞内送達 |
| EP1333846B1 (en) | 2000-10-17 | 2012-04-18 | Diabcell Pty Limited | Preparation and xenotransplantation or porcine islets |
| US20030077826A1 (en) | 2001-02-02 | 2003-04-24 | Lena Edelman | Chimeric molecules containing a module able to target specific cells and a module regulating the apoptogenic function of the permeability transition pore complex (PTPC) |
| EP1364949A4 (en) | 2001-02-02 | 2005-11-23 | Takeda Pharmaceutical | JNK INHIBITOR |
| AU2002240312A1 (en) | 2001-02-08 | 2002-08-19 | Pankaj Paranjp | Enhanced oral and transcompartmental delivery of therapeutic or diagnostic agents using polymer conjugates |
| MXPA03007358A (es) | 2001-02-16 | 2004-12-13 | Cellgate Inc | Transportadores que contienen porciones de arginina separadas. |
| DE10117281A1 (de) | 2001-04-06 | 2002-10-24 | Inst Molekulare Biotechnologie | Peptid zur Diagnose und Therapie der Alzheimer-Demenz |
| WO2002081504A2 (en) | 2001-04-06 | 2002-10-17 | Thomas Jefferson University | Multimerization of hiv-1 vif protein as a therapeutic target |
| US20060216706A1 (en) | 2001-07-17 | 2006-09-28 | Tang Y T | Proteins associated with cell growth, differentiation, and death |
| AU2002337142B2 (en) | 2001-09-19 | 2007-10-11 | Aventis Pharma S.A. | Indolizines as kinase protein inhibitors |
| JP2005525096A (ja) | 2002-01-09 | 2005-08-25 | ユニバーシティ オブ ローザンヌ | Jnkシグナル伝達経路の細胞浸透性ペプチドインヒビター |
| CA2478338A1 (en) | 2002-03-08 | 2003-09-18 | Signal Pharmaceuticals, Inc. | Combination therapy for treating, preventing or managing proliferative disorders and cancers |
| US20040034084A1 (en) * | 2002-05-24 | 2004-02-19 | Celgene Corporation | Methods for using JNK inhibitors for treating or preventing disease-related wasting |
| WO2003102151A2 (en) * | 2002-05-30 | 2003-12-11 | Celgene Corporation | Modulating cell differentiation and treating myeloprolifertive disorders with jnk/mkk inhibitors |
| SE0201863D0 (en) | 2002-06-18 | 2002-06-18 | Cepep Ab | Cell penetrating peptides |
| JP2004066595A (ja) | 2002-08-05 | 2004-03-04 | Canon Finetech Inc | 記録装置およびレジストレーション用パターンの記録方法 |
| BR0314603A (pt) | 2002-09-20 | 2005-07-26 | Alcon Inc | Uso de inibidores da sìntese de citoquina para o tratamento de distúrbios de olhos secos |
| ATE350480T1 (de) | 2002-10-11 | 2007-01-15 | Imvision Gmbh | Moduläre antigen-transporter moleküle (mat- moleküle) zur modulierung von immunreaktionen, zugehörige konstrukte, verfahren und verwendungen |
| ZA200503242B (en) * | 2002-10-24 | 2006-10-25 | Celgene Corp | Treatment of pain with JNK inhibitors |
| AU2003286611A1 (en) | 2002-10-24 | 2004-05-13 | Sangstat Medical Corporation | Cytomodulating peptides and methods for treating neurological disorders |
| US20050019366A1 (en) | 2002-12-31 | 2005-01-27 | Zeldis Jerome B. | Drug-coated stents and methods of use therefor |
| US7166692B2 (en) | 2003-03-04 | 2007-01-23 | Canbrex Bio Science Walkersville, Inc. | Intracellular delivery of small molecules, proteins, and nucleic acids |
| EP1599475A2 (en) | 2003-03-06 | 2005-11-30 | Eisai Co., Ltd. | Jnk inhibitors |
| EP1629105B1 (en) | 2003-04-29 | 2010-09-01 | AVI BioPharma, Inc. | Compositions for enhancing transport and antisense efficacy of nucleic acid analog into cells |
| US20050048995A1 (en) | 2003-08-25 | 2005-03-03 | Motorola, Inc. | System and method for controlling the operating characteristics of a buffer |
| KR100685345B1 (ko) | 2004-03-27 | 2007-02-22 | 학교법인조선대학교 | 세포사 유도 펩타이드 |
| WO2005097116A1 (en) | 2004-04-08 | 2005-10-20 | Applied Research Systems Ars Holding N.V. | Composition comprising a jnk inhibitor and cyclosporin |
| WO2006021458A2 (en) | 2004-08-27 | 2006-03-02 | Gpc Biotech Ag | Pyrimidine derivatives |
| US20060094753A1 (en) * | 2004-10-29 | 2006-05-04 | Alcon, Inc. | Use of inhibitors of Jun N-terminal kinases for the treatment of glaucomatous retinopathy and ocular diseases |
| US7803824B2 (en) * | 2004-10-29 | 2010-09-28 | Alcon, Inc. | Use of inhibitors of Jun N-terminal kinases to treat glaucoma |
| US20100256041A1 (en) | 2004-11-12 | 2010-10-07 | Christophe Bonny | Conjugate Molecule Compounds With Enhanced Cell Uptake Activity |
| EP1656951A1 (en) | 2004-11-12 | 2006-05-17 | Xigen S.A. | Conjugates with enhanced cell uptake activity |
| EP1661912A1 (en) | 2004-11-29 | 2006-05-31 | Xigen S.A. | Fusion protein comprising a BH3-domain of a BH3-only protein |
| EP1676574A3 (en) | 2004-12-30 | 2006-07-26 | Johnson & Johnson Vision Care, Inc. | Methods for promoting survival of transplanted tissues and cells |
| CN101142215A (zh) * | 2005-01-13 | 2008-03-12 | 西格诺药品有限公司 | 卤代芳基取代的氨基嘌呤、其组合物及其治疗方法 |
| US20060223807A1 (en) | 2005-03-29 | 2006-10-05 | University Of Massachusetts Medical School, A Massachusetts Corporation | Therapeutic methods for type I diabetes |
| JP2008540345A (ja) | 2005-04-29 | 2008-11-20 | セルジーン・コーポレーション | 1−(5−(1h−1,2,4−トリアゾール−5−イル)(1h−インダゾール−3−イル))−3−(2−ピペリジルエトキシ)ベンゼンの固体形態 |
| US20070015779A1 (en) | 2005-04-29 | 2007-01-18 | John Griffin | Compositions and treatments for inhibiting kinase and/or hmg-coa reductase |
| US20070003531A1 (en) | 2005-06-30 | 2007-01-04 | University Of Connecticut | Methods for improving immunotherapy by enhancing survival of antigen-specific cytotoxic T lymphocytes |
| US8080517B2 (en) | 2005-09-12 | 2011-12-20 | Xigen Sa | Cell-permeable peptide inhibitors of the JNK signal transduction pathway |
| WO2007031098A1 (en) | 2005-09-12 | 2007-03-22 | Xigen S.A. | Cell-permeable peptide inhibitors of the jnk signal transduction pathway |
| WO2008006046A1 (en) | 2006-07-06 | 2008-01-10 | Case Western Reserve University | Ceramide composition and use thereof in treatment of ocular diseases |
| EP1884521A1 (en) | 2006-07-31 | 2008-02-06 | Xigen S.A. | Fusion peptide for inhibiting interaction of neuronal NMDA receptor (NMDAR) and NMDAR interacting proteins |
| US20080051410A1 (en) * | 2006-08-02 | 2008-02-28 | Northwestern University | Protein Kinase Targeted Therapeutics |
| BRPI0717035B8 (pt) | 2006-09-08 | 2021-05-25 | Hoffmann La Roche | moduladores de benzotriazol cinase |
| US8063012B2 (en) | 2006-09-19 | 2011-11-22 | Phylogica Limited | Neuroprotective peptide inhibitors of AP-1 signaling and uses therefor |
| GB0702259D0 (en) * | 2007-02-06 | 2007-03-14 | Eisai London Res Lab Ltd | 7-azaindole derivatives |
| BRPI0911518A2 (pt) | 2008-04-29 | 2017-06-13 | Pharnext | novas aproximações terapêuticas para o tratamento da doença de alzheimer e doenças relacionadas através de uma modulação de resposta ao estresse de célula |
| CN105664136A (zh) | 2008-05-07 | 2016-06-15 | 加利福尼亚大学董事会 | 眼表润滑的治疗性补充和富集 |
| WO2009143865A1 (en) * | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| WO2009143864A1 (en) * | 2008-05-30 | 2009-12-03 | Xigen S.A. | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases |
| US20100183633A1 (en) | 2008-12-04 | 2010-07-22 | University Of Massachusetts | Interleukin 6 and tumor necrosis factor alpha as biomarkers of jnk inhibition |
| WO2010072228A1 (en) | 2008-12-22 | 2010-07-01 | Xigen S.A. | Novel transporter constructs and transporter cargo conjugate molecules |
| EP2381934A2 (en) | 2008-12-23 | 2011-11-02 | Carmel - Haifa University Economic Corp Ltd. | Improving cognitive function |
| US8450363B2 (en) | 2009-02-06 | 2013-05-28 | Elan Pharmaceuticals, Inc. | Inhibitors of Jun N-terminal kinase |
| EA201171188A1 (ru) | 2009-03-30 | 2012-05-30 | Сантен Фармасьютикал Ко., Лтд. | Профилактическое или терапевтическое средство против болезни сетчатки и способ профилактики или лечения болезни сетчатки с использованием jnk (c-jun-аминоконцевая киназа)-ингибиторного пептида, а также применение указанного пептида |
| CN102471319B (zh) * | 2009-08-10 | 2014-06-18 | 霍夫曼-拉罗奇有限公司 | Jnk的抑制剂 |
| CN104043126A (zh) | 2009-10-22 | 2014-09-17 | 霍夫曼-拉罗奇有限公司 | 轴突变性的调节 |
| US20130190244A1 (en) | 2009-12-31 | 2013-07-25 | Stealth Peptides International, Inc. | Methods for performing a coronary artery bypass graft procedure |
| BR112012030814A2 (pt) * | 2010-06-04 | 2019-09-24 | Hoffmann La Roche | inibidores de jnk |
| WO2011160653A1 (en) * | 2010-06-21 | 2011-12-29 | Xigen S.A. | Novel jnk inhibitor molecules |
| US9150618B2 (en) | 2010-10-14 | 2015-10-06 | Xigen Inflammation Ltd. | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory eye diseases |
| ES2575226T3 (es) | 2010-10-14 | 2016-06-27 | Xigen Inflammation Ltd. | Péptidos permeables celulares inhibidores de la ruta de transducción de la señal JNK para su uso en el tratamiento de la uiveítis |
| US8471027B2 (en) | 2011-04-06 | 2013-06-25 | Hoffmann-La Roche Inc. | Adamantyl compounds |
| KR20140099526A (ko) | 2011-11-30 | 2014-08-12 | 자이겐 인플라메이션 리미티드 | 안구 건조증의 치료를 위한 jnk 신호 전달 경로의 세포-투과성 펩타이드 억제자의 용도 |
| WO2013091670A1 (en) | 2011-12-21 | 2013-06-27 | Xigen S.A. | Novel jnk inhibitor molecules for treatment of various diseases |
| WO2014206426A1 (en) | 2013-06-26 | 2014-12-31 | Xigen Inflammation Ltd. | New use for jnk inhibitor molecules for treatment of various diseases |
| WO2015197193A2 (en) | 2014-06-26 | 2015-12-30 | Xigen Inflammation Ltd. | New use for jnk inhibitor molecules for treatment of various diseases |
| WO2014206427A1 (en) | 2013-06-26 | 2014-12-31 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| WO2014206563A2 (en) | 2013-06-26 | 2014-12-31 | Xigen Inflammation Ltd. | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases |
| JP2015197193A (ja) | 2014-04-02 | 2015-11-09 | トヨタ自動車株式会社 | 車両用無段変速機の油圧制御装置 |
| CN107969126A (zh) | 2015-06-26 | 2018-04-27 | 埃克西金炎症有限公司 | Jnk信号转导通路的细胞穿透肽抑制剂用于治疗轻度认知损害的新用途 |
-
2014
- 2014-06-26 WO PCT/EP2014/001736 patent/WO2014206563A2/en not_active Ceased
- 2014-06-26 US US14/891,067 patent/US10624948B2/en active Active
- 2014-06-26 HK HK16112683.9A patent/HK1224225A1/zh unknown
- 2014-06-26 PL PL14734003T patent/PL3013353T3/pl unknown
- 2014-06-26 KR KR1020157034160A patent/KR20160023669A/ko not_active Withdrawn
- 2014-06-26 ES ES14734003T patent/ES2870085T3/es active Active
- 2014-06-26 AU AU2014301631A patent/AU2014301631A1/en not_active Abandoned
- 2014-06-26 CA CA2903275A patent/CA2903275A1/en not_active Abandoned
- 2014-06-26 EA EA201501080A patent/EA201501080A1/ru unknown
- 2014-06-26 EP EP14734003.8A patent/EP3013353B1/en active Active
- 2014-06-26 JP JP2016522321A patent/JP2016523274A/ja not_active Withdrawn
- 2014-06-26 CN CN201480030666.XA patent/CN105307670A/zh active Pending
-
2015
- 2015-06-26 BR BR112016029413A patent/BR112016029413A2/pt not_active IP Right Cessation
- 2015-06-26 MX MX2016017308A patent/MX2016017308A/es unknown
- 2015-06-26 JP JP2016575155A patent/JP2017520571A/ja not_active Withdrawn
-
2019
- 2019-12-17 JP JP2019226998A patent/JP2020055866A/ja active Pending
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2017520569A (ja) * | 2013-06-26 | 2017-07-27 | ザイジェン インフラメーション エルティーディー | 様々な疾患の処置のためのjnk阻害剤分子の新規使用 |
| CN107531768A (zh) * | 2015-01-23 | 2018-01-02 | 鹿特丹伊拉斯谟大学医疗中心 | 抗衰老化合物及其用途 |
| JP2018508196A (ja) * | 2015-01-23 | 2018-03-29 | エラスムス ユニバーシティ メディカルセンター ロッテルダムErasmus University Medical Center Rotterdam | 抗老化化合物及びその使用 |
| US11723947B2 (en) | 2015-01-23 | 2023-08-15 | Erasmus University Medical Center Rotterdam | Anti-senescence compounds and uses thereof |
| CN113633662A (zh) * | 2021-07-02 | 2021-11-12 | 中山大学附属口腔医院 | 线粒体移植在治疗牙周炎中的应用 |
| CN113633662B (zh) * | 2021-07-02 | 2023-09-26 | 中山大学附属口腔医院 | 线粒体移植在治疗牙周炎中的应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| ES2870085T3 (es) | 2021-10-26 |
| JP2020055866A (ja) | 2020-04-09 |
| MX2016017308A (es) | 2017-05-01 |
| BR112016029413A2 (pt) | 2017-10-17 |
| WO2014206563A3 (en) | 2015-03-19 |
| EP3013353A2 (en) | 2016-05-04 |
| AU2014301631A1 (en) | 2015-08-27 |
| US10624948B2 (en) | 2020-04-21 |
| HK1224225A1 (zh) | 2017-08-18 |
| EP3013353B1 (en) | 2021-04-21 |
| KR20160023669A (ko) | 2016-03-03 |
| PL3013353T3 (pl) | 2021-09-20 |
| CN105307670A (zh) | 2016-02-03 |
| JP2017520571A (ja) | 2017-07-27 |
| JP2016523274A (ja) | 2016-08-08 |
| US20160199444A1 (en) | 2016-07-14 |
| CA2903275A1 (en) | 2014-12-31 |
| EA201501080A1 (ru) | 2016-07-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10624948B2 (en) | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases | |
| US9006185B2 (en) | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases | |
| US11779628B2 (en) | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases | |
| JP7165693B2 (ja) | 様々な疾患の処置のためのjnkシグナル伝達経路の細胞透過性ペプチド阻害剤の新規使用 | |
| AU2009253347A1 (en) | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of chronic or non-chronic inflammatory digestive diseases | |
| WO2015197098A1 (en) | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases | |
| WO2016055160A2 (en) | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases | |
| HK40057869A (en) | New use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various diseases | |
| AU2013263786A1 (en) | Use of cell-permeable peptide inhibitors of the JNK signal transduction pathway for the treatment of various diseases | |
| HK1175102B (en) | Use of cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of various cardiovascular diseases |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201480030666.X Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14734003 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2014301631 Country of ref document: AU Date of ref document: 20140626 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2903275 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 242357 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14891067 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 20157034160 Country of ref document: KR Kind code of ref document: A Ref document number: 2016522321 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201501080 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014734003 Country of ref document: EP |