WO2014175690A1 - 자가 절단 카세트를 포함하는 단백질 정제방법 및 이의 용도 - Google Patents

자가 절단 카세트를 포함하는 단백질 정제방법 및 이의 용도 Download PDF

Info

Publication number
WO2014175690A1
WO2014175690A1 PCT/KR2014/003639 KR2014003639W WO2014175690A1 WO 2014175690 A1 WO2014175690 A1 WO 2014175690A1 KR 2014003639 W KR2014003639 W KR 2014003639W WO 2014175690 A1 WO2014175690 A1 WO 2014175690A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
tag
linker
fusion protein
self
Prior art date
Application number
PCT/KR2014/003639
Other languages
English (en)
French (fr)
Inventor
송병두
윤지선
최효정
김혜인
이응석
Original Assignee
(재) 스크립스코리아 항체연구원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020157030691A priority Critical patent/KR101808223B1/ko
Application filed by (재) 스크립스코리아 항체연구원 filed Critical (재) 스크립스코리아 항체연구원
Priority to US14/785,881 priority patent/US10077299B2/en
Priority to SG11201508732PA priority patent/SG11201508732PA/en
Priority to EP14787873.0A priority patent/EP2990423B1/en
Priority to CA2909513A priority patent/CA2909513C/en
Priority to CN201480033267.9A priority patent/CN105339391B/zh
Priority to AU2014258109A priority patent/AU2014258109B2/en
Priority to RU2015150335A priority patent/RU2639527C2/ru
Priority to JP2016510621A priority patent/JP6176392B2/ja
Priority to NZ713602A priority patent/NZ713602A/en
Publication of WO2014175690A1 publication Critical patent/WO2014175690A1/ko
Priority to IL242147A priority patent/IL242147B/en
Priority to US16/100,080 priority patent/US20190077846A1/en

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034—Isolating an individual clone by screening libraries
    • C12N15/1093—General methods of preparing gene libraries, not provided for in other subgroups
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/52—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/14—Extraction; Separation; Purification
    • C07K1/16—Extraction; Separation; Purification by chromatography
    • C07K1/22—Affinity chromatography or related techniques based upon selective absorption processes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/41—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a Myc-tag
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/42—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a HA(hemagglutinin)-tag
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/50—Fusion polypeptide containing protease site
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/22—Cysteine endopeptidases (3.4.22)
    • C12Y304/2207—Sortase A (3.4.22.70)

Definitions

  • the present invention provides a self-cleaving fusion protein comprising amino acid sequence of interest protein, peptide consisting of amino acid sequence of LPXTG, solutease A cleavage functional domain and tag, nucleic acid encoding the same, expression vector comprising nucleic acid of the present invention, And it relates to a cell transformed with the expression vector of the present invention.
  • the present invention relates to a method for purifying a target protein comprising culturing the lysed and purified the transformed cells, and a method for producing a therapeutic antibody-drug conjugate using the method.
  • the desired protein required by humans can be produced by expressing the desired protein by culturing cells transformed with the vector expressing it.
  • such proteins may be expressed in eukaryotic cells, prokaryotic cells, and the like, and in particular cases, in transformed plants or transformed animals.
  • a method of expressing in a transgenic animal that secretes milk, obtaining a target protein through the transgenic animal's milk, and the like have been attempted.
  • the desired protein can be isolated and purified from cell culture or milk.
  • the method of using a tag for purification is one of very high efficiency among various protein purification techniques, and the tag used is largely divided into a peptide tag and a protein tag.
  • Peptide tags are composed of short amino acids, typically his-tag (his-tag, histidine-tag), and especially hexahistidine tag (Hishistidine tag, His6-tag) are used. Histidine peptides have a specific chemical affinity with nickel, so that the fusion protein containing the tag can be purified to high purity by a column containing nickel.
  • the protein tag is a tag including the corresponding domain and the like in order to use the features of the domain of the protein binding to a specific component.
  • GST-tag Glutathione S-transferase-tag
  • GST tags can be purified with high purity by a column with glutathione fixation medium, which is a substrate of GST.
  • the tag fusion-expressed to the target protein for protein purification as described above has a risk that it may interfere with the structure or function of the target protein itself, and a method for obtaining the target protein from which the tag is cut has been devised.
  • the conventional method required a process of first obtaining a protein including a tag, cutting the tag, and purifying only the target protein again. During this process the desired protein was lost and the amount of protein finally obtained was reduced, and the cost and time for that process was excessive.
  • the advantages of the protein purification method using the tag but the method of minimizing the loss of the target protein in the tag cutting process and a method that can be purified protein in a short time.
  • Existing protein purification method using Soltease A is to prepare a recombinant expression vector containing a polynucleotide encoding the tag-sortase A (60 ⁇ 206 AA) -LPXTG-target protein to express the protein in the host cell, the host Binding the cell lysate to a tag binding column; Removing impurities; Injecting and reacting a solution comprising calcium and / or triglycine; By obtaining the protein, it is possible to purify the protein and remove the tag at once by using a single column.
  • the conventional method using such a Soltease A cleavage functional domain has a problem of low purification efficiency depending on the target protein.
  • the present invention completes the present invention by confirming that a higher protein yield than the conventional method can be obtained by applying a linker between the aromatic composition to bind the Soltaze A cleavage functional domain and the Soltaze A and the cleavage sequence. It was.
  • Another object of the present invention to provide a cell transformed with the expression vector.
  • FIG. 1 is a structural diagram (I) of an existing fusion protein in which the target protein is present at the carboxyl terminus, and a structural diagram (II to IV) of the fusion protein of the present invention in which the target protein is present at the amino terminus and the linker is varied in length. .
  • FIG. 2 is a structural diagram of a fusion protein with added (I) or helical linker (II) added for optimization of the peptide linker.
  • FIG. 3 is a structural diagram of a fusion protein with the addition of a charge linker (CH linker or AH linker) for optimization of the peptide linker.
  • CH linker or AH linker charge linker
  • Figure 4 is a structural diagram of the length of the linker, whether the linker is added, the fusion protein with different tags.
  • FIG. 5 is a diagram illustrating a purification method using a conventional Soltaze A self-cutting cassette.
  • Figure 6 is a diagram stained with Coomassie blue SDS-PAGE gel to confirm the expression of the fusion protein when the expression vector in various types.
  • FIG. 7 is a view confirming the expression of the protein (A) and the purification of the cleaved target protein (anti-Myc) (5, 6 lanes of B) when using the conventional purification method using the Soltaze A self-cutting cassette.
  • FIG. 8 is a diagram illustrating a purification method using the Soltaise A self-cutting cassette according to the present invention.
  • FIG. 9 shows expression vectors containing the Soltaze A autologous cleavage cassette of the present invention and varying in linker length (7, 18, 20 AA) to various E. coli host cells (Origami2 (DE3), and BL21 (DE3)). It is a diagram confirming the expression level of the fusion protein by transformation.
  • LB laoding sample
  • CP purified protein
  • FIG. 11 is a diagram comparing yields of cleaved proteins by varying the presence and concentration of calcium and triglycine in order to optimize the cleavage-buffer.
  • FIG. 12 is a diagram confirming the expression and binding degree of the fusion protein when the spiral linker is added.
  • FIG. 13 shows 7 A.A between the Soltaize A cleavage functional domain and the tag.
  • FIG. It is a diagram confirming the expression and binding degree of the fusion protein in the case of adding a flexible linker (2-1 or 2-2) and not (1).
  • FIG. 14 is a diagram confirming the expression, binding and purification degree of the fusion protein to which the charge linker (CH linker or AH linker) is added.
  • fusion protein comprising a conventional Soltaze A cleavage cassette, ie, a fusion protein (C-terminal) comprising a target protein at the carboxyl terminus and a fusion protein comprising a Soltaze A cleavage cassette of the present invention, ie, a target protein. It is a diagram confirming the expression, binding and purification degree of the fusion protein (N-terminal) included in the amino terminal.
  • 16 is a diagram analyzing the concentration (A) and reaction time (B) of the triglycine-biotin conjugate in order to establish the optimum conditions for conjugation of the drug to the protein of interest.
  • ADC therapeutic antibody-drug conjugate
  • a self-cleaving fusion protein comprising a target protein, a peptide consisting of an amino acid sequence of LPXTG, a Soltase A cleavage functional domain and a tag.
  • the self-cleaving fusion protein of the invention may preferably comprise a peptide linker further between the peptide consisting of the LPXTG amino acid sequence and the Soltease A cleavage functional domain.
  • target protein refers to any protein that needs to be obtained in high purity or in bulk for a specific purpose, and includes, without limitation, naturally occurring protein, variant protein, or novel recombinant protein.
  • the protein of interest may be a protein that is required to be obtained in high purity or in large quantities for industrial, medical, or academic reasons, and preferably may be a recombinant protein for medical or research purposes, more preferably a polymer protein, a sugar protein, It may be selected from the group consisting of cytokines, growth factors, blood products, vaccines, hormones, enzymes and antibodies. Even more preferably, the protein of interest may be all or part of the light or heavy chain of the antibody, most preferably the light chain variable region (V L ) or heavy chain variable region (V H ) of the antibody.
  • peptide consisting of the amino acid sequence of LPXTG means a peptide consisting of the amino acid sequence of Leucine-Proline-any amino acid-Threonine-Glycine, which is a protein Recognition sequence of sortase A having a cleavage function.
  • Soltease A recognizes the LPXTG sequence and cleaves between threonine and glycine, thus splitting into a portion containing LPXT and a portion containing G.
  • X in the peptide consisting of the amino acid sequence of LPXTG, X may be any amino acid, for example, X may be glutamic acid (E).
  • Sportase A is a protein having a function of attaching a surface protein to the cell wall of Gram-positive bacteria, the free carboxyl group and the cell wall of threonine formed by cleaving between threonine and glycine of the LPXTG sequence It is known to play a role of binding free amino groups such as pantaglycin of peptidoglycan.
  • Soltase A Soratase A, or Srt A may be mixed with not only whole proteins but also cleavage functional domains of Soltase A.
  • Any Solitase A cleavage functional domain can be used in the present invention.
  • the corresponding Soltize A may be of bacterial origin, for example derived from Staphylococcus aureus, S. aureus, and more preferably, the Soltize A cleavage functional domain is SEQ ID NO: It may be composed of the amino acid sequence of 8.
  • a "tag” is a constant amino acid sequence, peptide, or even a protein domain, which is inserted for the purpose of labeling or obtaining a protein from a recombinant protein, and a method of protein purification using a tag is very high efficiency among protein purification techniques.
  • the tag is largely divided into a peptide tag and a protein tag.
  • the tag is, for example, polyhistidine tag (polyhistidine tag), GST tag (glutathione-S-transferase tag), HA tag (Hemagglutinin tag), FLAG tag, Myc tag, maltose binding protein tag (maltose binding protein tag ), Chitin binding protein tag and fluorescent tag
  • polyhistidine tag polyhistidine tag
  • GST tag glutthione-S-transferase tag
  • HA tag Hemagglutinin tag
  • FLAG tag Myc tag
  • maltose binding protein tag maltose binding protein tag
  • Chitin binding protein tag and fluorescent tag may be selected from the group consisting of, but not limited to, preferably a poly histidine peptide tag, more preferably 6 to 12 histidine It may be a peptide tag, and most preferably it may be a poly histidine peptide tag having 10 histidines.
  • the tag serves to attach the entire fusion protein linked thereto to the column that binds the tag. Through this it is possible to obtain the desired protein ultimately included in the fusion protein.
  • a "self-cleaving fusion protein” means that a domain having a cleavage function and a recognition sequence recognized by the domain are simultaneously included in a fusion protein, and when a certain condition is reached, the cleavage functional domain is activated to identify a recognition sequence within the same protein. It means a protein that is recognized and cleaved. In the present invention, it may be a fusion protein including a cleavage functional domain derived from Soltaize A and LPXTG recognized by the domain, and may further include other components.
  • self-cleaving cassette refers to a domain set including a domain having a cleavage function and a recognition sequence recognized and cleaved by the domain, and preferably, a cleavage functional domain derived from Solteide A and LPXTG recognized by the domain. It may be a domain set including.
  • a “peptide linker” in the present invention is a peptide used for physicochemical distance or linkage between domains within a fusion protein.
  • the fusion protein of the invention may comprise a linker between Soltaze A and LPXTG peptide.
  • Natural linkers, flexible linkers, helical linkers, charge linkers (positive or negatively charged linkers), coiled coil linkers, and the like can be used for this.
  • the amino acid of the amino acid sequence is indicated by the amino acid single letter abbreviation used conventionally in the art.
  • the flexible linker basically shows the flexible movement because amino acids present in the linker do not repel or accumulate with each other.
  • Spiral linker in the present invention may include a general formula of A (EAAK) m A (m is 2 to 5), (H 4 ) 2 linker (LEA (EAAAK) 4 ALEA (EAAAK) 4AL, SEQ ID NO: 50 AA) May be 1).
  • the charge linker may be a linker having a positive charge or a negative charge
  • the positive charge linker may be a CH linker (TRARLSKELQAAQARLGADMEDVCGRLVQYRG, SEQ ID NO: 2)
  • the negative charge linker may be an AH linker (KEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSA).
  • Coiled coil linker is a linker having a helical three-dimensional structure and having the ability to bind with other coiled coil domains or linkers and may be one of SEQ ID NOs: 9 to 16 or SEQ ID NOs: 48 to 55.
  • the peptide linker may be a flexible linker, and may have an S c (SG 4 ) 1 (GGSSRSS) G d S e form (SEQ ID NO: 4).
  • C is 0 to 5
  • d is 0 to 5
  • e is 0 to 5
  • l is 0 to 10 in S c (SG 4 ) 1 (GGSSRSS) G d S e .
  • the length of the peptide linker is not important, and the length of the linker may vary depending on the protein of interest for accessibility with the active site, but preferably 19 to 40 amino acids, more preferably 19 to It may be composed of 25 amino acids. Most preferably, it may be a peptide linker consisting of the amino acid sequence of SEQ ID NO: 7.
  • linker optimization was performed by varying the length of the linker, the number and type of linkers in order to confirm the effect of the linker on the yield of the target protein.
  • the helical linker was inserted between the Soltease A cleavage functional domain and the tag to confirm the effect on the yield of the desired protein (Examples 5-3, Figures 12 and 14). ). Specifically, when the helical linker is inserted between the Soltease A cleavage functional domain and the tag further with the flexible linker (20 AA) between the LPXTG recognition sequence and the Soltease A cleavage functional domain remaining, the fusion protein is It could be confirmed that it is hardly bound to (FIG. 12).
  • charge linkers may be used to link the flexible linker (20 AA) between the LPXTG recognition sequence and the Soltaze A cleavage functional domain. Even when inserted between the Soltase A cleavage functional domain and the tag while remaining, it was hardly bound to the column and little cleavage protein was found (FIG. 14).
  • the self-cleaving fusion protein of the present invention may be composed of the amino acid sequence of SEQ ID NO: 17 or 18. It includes an antibody variable region as a target protein, and includes an LPETG recognition sequence, a peptide linker, a Soltease A cleavage functional domain (60-206 A.A.), and a column binding tag (His9) sequentially from the amino terminus.
  • the present invention provides a nucleic acid comprising a nucleotide sequence encoding a self-cleaving fusion protein of the present invention.
  • the nucleotide sequence encoding the fusion protein of the present invention may be a nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 17 or 18, preferably, may be the nucleotide sequence of SEQ ID NO: 56 or 57.
  • the present invention provides an expression vector comprising the nucleic acid.
  • the "expression vector” refers to a vector operably linked to a promoter or the like to express a specific gene in a specific prokaryotic or eukaryotic host cell.
  • the backbone of the vector may vary depending on the host cell.
  • the backbone may be a vector expressable in E. coli, and more preferably, a pET21b, pLIC, or pET23a vector (Novagen).
  • the present invention provides a cell transformed with the expression vector of the present invention.
  • the cells to be transformed are also called host cells, and may be eukaryotic or prokaryotic. In the present invention, it may be preferably Escherichia coli, and more preferably E. coli Origami2 (DE3) or E. coli BL21 (DE3).
  • the expression vectors of the present invention were transformed and expressed using Origami2 (DE3) or BL21 (DE3) as a host cell (Fig. 9). As can be seen in Figure 9 there was no significant difference in the expression pattern between Origami2 and BL21.
  • the present invention provides a method for purifying a target protein comprising culturing the cells of the present invention to obtain cell lysates and purifying the target protein from the cell lysates.
  • purifying the protein of interest from the cell lysate comprises injecting the cell lysate into a column that binds to a tag present in the fusion protein; Washing the column; Equilibrating with a cleavage-buffer comprising at least one selected from the group consisting of calcium and triglycine and cleavage reaction; And obtaining the cleavage-buffer from the column to obtain the desired protein from which the tag has been removed.
  • “column” is a device that functions to separate and / or purify a specific component, protein, or compound while injecting a mixture solution containing the specific component, protein, or compound, and particularly, in the present invention.
  • Compounds, components, proteins, etc., which have the property of binding to a specific tag contained in the protein are fixed in the column to attach, separate, and purify the tagged proteins in the column.
  • the tag included in the fusion protein is a histag (tag containing histidine)
  • a Ni-NTA column using a nickel binding property may be used.
  • the tag included in the fusion protein is GST, glutathione is fixed. Columns can be used.
  • cleavage-buffer means a buffer for activating a cleavage functional domain, and in particular, a buffer for activating Saltase A.
  • the cleavage-buffer may be one comprising calcium and / or triglycine, preferably at least triglycine.
  • the cleavage-buffer may preferably include 0.1 to 10 mM of calcium and 0.1 to 10 mM of triglycine, more preferably 0.2 to 5 mM of calcium and 0.2 to 5 mM of triglycine. .
  • the yield of cleaved protein was confirmed by varying the presence or absence of calcium or triglycine and concentration conditions.
  • the yield of cleaved protein by the cleavage-buffer in which the concentration of one of calcium and triglycine was fixed at 5 mM and the other was mixed at concentrations of 0, 0.2, 1, 5 mM was compared with the negative control without both.
  • therapeutic antibody-drug conjugate is composed of three components including a drug, an antibody and a linker (linker) connecting the antibody and the drug
  • the therapeutic antibody-drug Binding technology is a method of delivering drugs to tumor cells using antibodies that specifically bind to specific antigens expressed on the surface of cancer cells.
  • the therapeutic antibody-drug conjugates can be prepared using the present invention. Specifically, a self-cleaving cassette including 'antibody-linker-saltase' at the amino terminal, and calcium and / or triglycine must be present in order for Soltaze A to recognize the cleavage sequence (LPXTG) and perform a cleavage function. And the drug is connected to the C-terminus of the derivative triglycine which induces this cleavage.
  • GGG-drug which connects drug to triglycine C-terminus
  • it is used for cleavage reaction of self-cutting cassette including the constructed 'antibody-linker-saltase' It can be prepared in the form of 'antibody-liker-LPETGGG-drug' by an optimized cleavage reaction.
  • the drug that can be used in the therapeutic antibody-drug conjugate of the present invention includes any compound, part or group having a cytotoxic or cytostatic effect,
  • a chemotherapeutic agent that can function as a microtubulin inhibitor, mitosis inhibitor, topoisomerase inhibitor, or DNA intercalator;
  • micro RNA miRNA
  • siRNA siRNA
  • shRNA capable of inhibiting the expression of certain oncogenes
  • drugs include maytansinoids, auristatins, dolastatins, tricortesenes, CC1065 (cytotoxic compounds), calicheamicins and other enedyne antibiotics, taxanes, anthracyclines, methotrexate, adriamycin, binddesin, vinca Alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin, daunomycin and its stereoisomers, isomers, homologues or derivatives, and other intercalating enzymes And fragments thereof such as nucleolytic enzymes, antibiotics, and toxins (enzymatically active toxins or small molecule toxins of bacterial, fungal, plant or animal origin) and various antitumor such as cisplatin, CPT-11, doxorubicin, paclitaxel and docetaxel Or anticancer agents, and the like,
  • the yield of cleavage protein was determined by varying the presence or absence of triglycine-biotin and concentration conditions.
  • concentration of triglycine-biotin was mixed at concentrations of 0, 10 nM, 100 nM, 500 nM, 1 ⁇ M, 10 ⁇ M, 100 ⁇ M, 500 ⁇ M, 1 mM to compare target protein yield by cleavage-buffer with the negative control.
  • the cleavage-buffer preferably contains 0.1 to 10 mM of calcium, and triglycine-drug (GGG-drug) is preferably reacted, including 500 nM to 1 mM, but is not limited thereto.
  • the time for conjugating the wood protein and triglycine-drug (GGG-drug) is preferably 4 to 16 hours, but is not limited thereto.
  • the target protein is preferably an antibody against cancer cell surface antigens, but is not limited thereto.
  • composition of PCR reaction solution and PCR execution conditions for obtaining various genes used in the present invention and preparing a vector are as follows.
  • the PCR reaction solution was 5 ⁇ l of 2.5 mM dNTP mix, 10 ⁇ l of 5X PrimeSTAR buffer, 1 ⁇ l of 100 ⁇ M forward and reverse primers, 1 ⁇ l of 100 ng / uL template DNA, 0.5 ⁇ l of 2.5U / uL PrimeSTAR polymerase, and distilled water. A total of 50 ⁇ l was prepared, including 31.5 ⁇ l.
  • the prepared PCR reaction solution was subjected to a two-step PCR of 29 cycles of 10 seconds at 98 ° C and 1 minute at 68 ° C. PCR completed samples were stored at 4 °C.
  • primer 1_sfi (5'-ccgtg gcc cag gcg gcc GCA AGC AGC GGC CTG AAC GAC ATC TTC GAG GCC-3 ': SEQ ID NO: 19) or primer 1 (5'-ATGT CAT ATG GCA AGC AGC GGC CTG AAC GAC ATC Biotin acceptor peptide using TTC GAG GCC-3 ': SEQ ID NO: 20), and primer 2 (5'-CTG CAT TTC GTG CCA CTC GAT CTT CTG GGC CTC GAA GAT GTC GTT-3': SEQ ID NO: 21) DNA sequence encoding a) was amplified by PCR.
  • Primer 3 (5'-ATC GAG TGG CAC GAA ATG CAG GCT AAG CCG CAG ATT CCG-3 ': SEQ ID NO: 22) and Primer 4 (5'-GCC GGT CTC GGG AAG CTT CTT GAC CTC GGT AGC GAC AAA-3' : DNA sequence encoding the 60-206th amino acid sequence of SrtA (GenBank Accession No. AF162687) derived from Staphylococcus aureus (S.aureus ) was amplified by PCR using SEQ ID NO: 23).
  • Primer 5 (5'-CAG TAA GCT TCC CGA GAC CGG CGA TAT CCA GAT GAC TCA GAGC-3 ': SEQ ID NO: 24)
  • Primer 6 (5'-ACT CGA ACC CGC CGT ACG TTT TAT CTC TAC CTT TGT-3' : Secondary DNA sequence encoding LPETG-target (VL) was amplified by PCR using SEQ ID NO: 25) and template target (VL).
  • the resulting DNA fragment was cleaved with NdeI and NotI , ligated into a pET23a vector (Novagen) that induces expression of the target protein into the cytoplasm, and cleaved with SfiI, followed by the fusion protein BAP-sortase-LPETG-target-myc (Fig. I) of 1) was ligated with pCom3x, a vector that induces expression into periplasm.
  • primer 8 (5'-ATG TCA TAT GGA CAT TCA GAT GAC ACA GAGT-3 ': SEQ ID NO: 27) and primer 9 (5'-ggaaccaccgccggtctcgggaag AAG ATC TTC TTC ACT AAT TAAC-3': SEQ ID NO: 28)
  • DNA sequence encoding the target-LPETG-linker (7 AA) to which the linker (7 AA) (GGSSRSS: SEQ ID NO: 5) was linked was amplified by PCR.
  • Primer 8 and Primer 10 (5'-GGA AGA TCT AGA GGA ACC ACC CCC ACC ACC GCC CGA GCC ACC GCC ACC GGA TGA GCC GGT CTC GGG AAG AAG AT-3 ': SEQ ID NO: 29) and the PCR product target-LPETG
  • the DNA sequence encoding the target-LPETG-linker (18 AA) to which the linker (18 AA) (SSGGGGSGGGGGGSSRSS: SEQ ID NO: 6) was linked was amplified by PCR using a linker (7 AA).
  • Primer 11 (5'-gag acc ggc ggt ggt tcc tct aga tct tcc cag gct aag ccg cag att-3 ': SEQ ID NO: 30) and primer 12 (5'-taat GC GGC CGC tta atgatggtg ATG GTG ATG ATG ATG ATGGC- 3 ': SEQ ID NO: 31) was used to amplify the DNA sequence encoding the linker (7 AA) -SrtA (60-206) by PCR.
  • Linker (20 AA) (SSGGGGSGGGGGGSSRSSGS: SEQ ID NO: 7) linked using primer 15 (5'-GGT TCC TCT AGA TCT TCC GGA AGC cag gct aag ccg cag att-3 ': SEQ ID NO: 34) and primer 14 DNA sequences encoding 20 AA) -SrtA (60-206) were amplified by PCR.
  • Primer 15, Primer 16 (5'-ATG ATG ATG GCG AGA GCT ACG GCT GCT GCC GCC CTT GAC CTC GGT AGC GAC AAA GA-3 ': SEQ ID NO: 35) and Primer 17 (5'-TAA TGC GGC CGC TTA ATG ATG Linker (20 AA) (SSGGGGSGGGGGGSSRSSGS: SEQ ID NO: 7) is linked to the N terminus using GTG ATG GTG ATG ATG ATG ATG GCG AGA GCT ACG GCT-3 ': SEQ ID NO: 36 and linker (7 AA) (GGSSRSS: sequence DNA sequence encoding linker (20 AA) -SrtA (60-206) -linker (7 AA) linked to No. 5) at the C terminus was amplified by PCR.
  • GGSSRSS sequence DNA sequence encoding linker (20 AA) -SrtA (60-206) -linker (7 AA) linked to No. 5
  • the linker (20 AA) (SSGGGGSGGGGGGSSRSSGS: SEQ ID NO: 7) was added to the N terminus by PCR using primer 15 and primer 20 (5'-GTG CCC GCG TCT TGA CCT CGG TAG CGA CAA AGA TCTT-3 ': SEQ ID NO: 39). Amplify the DNA sequence linked and encoding the TRA- of the N terminus of the CH linker (32 AA) and primer 21 (5'- GCT GTC CAA GGA GCT GCA GGC GGC GCA GGC CCG GCT GGG CGC GGA CAT G-3 ': sequence No.
  • primer 22 (5'-GCG GTA CTG CAC CAG GCG GCC GCA CAC GTC CTC CAT GTC CGC GCC CAG CCGG-3 ': SEQ ID NO: 41) and primer 23 (5'-GAG GTC AAG ACG CGG GCA CGG CTG TCC AAG GAG CTG CAG-3 ': SEQ ID NO: 42) and Primer 24 (5'-TAA T GC GGC CGC TTA ATG ATG CTG ATG GTG ATG GCC GCG GTA CTG CAC CAG GC-3': SEQ ID NO: 43) Amplify the CH linker moiety and linker (20 AA) -SrtA (20 AA) (SSGGGGSGGGGGGSSRSSGS: SEQ ID NO: 7) linked to the N terminus and CHL linker (32 AA) (TRARLSKELQAAQARLGADMEDVCGRLVQYRG: SEQ ID NO: 2) linked to the C terminus 60 DNA sequences encoding CHL linker (32
  • Linker 20 AA (SSGGGGSGGGGGGSSRSSGS: SEQ ID NO: 11) is linked to the N terminus using Primer 15 and Primer 25 (5'-CGG ATC ACC CTT GAC CTC GGT AGC GAC AAA GAT CTT-3 ': SEQ ID NO: 44) Amplify the DNA sequence encoding the KEQ- of the N terminus of the AH linker (45 AA) and primer 27 (5'- GAG GTC AAG GGT GAT CCG AAA GCT GAC AAC AAA TTC-3 ': SEQ ID NO: 45) and primer 27 ( 5'-GTG ATG ATG ATG GTG AGC TTT TGG TGC TTG TGC ATC AT-3 ': SEQ ID NO: 46) was used to amplify the AH linker using the pIG20 vector as a template.
  • AH linker (45 AA) (KEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSAN LLAEAKKL: SEQ ID NO: 3) is a DNA sequence encoding a linker (20 AA) -SrtA (60-206) -AHL linker (45 AA) linked to the C terminus.
  • target (VL) -LPETG-linker (7 AA) -Sortase-H9 (II in FIG. 1) was prepared by primer 8, primer 12 and the PCR product (target-LPETG-linker (7 AA) and linker (7 AA). It was amplified by overlapping PCR using a mixture of) -SrtA).
  • the gene encoding target (VL) -LPETG-linker (18 AA) -Sortase-H9 (III in FIG. 1) was prepared by primer 8, primer 14 and the PCR product (target-LPETG-linker (18 AA) and linker (18). It was amplified by overlapping PCR using a mixture of AA) -SrtA).
  • the gene encoding target (VL) -LPETG-linker (20 AA) -Sortase-H9 (IV in FIG. 1) was prepared by primer 8, primer 14 and the PCR product (target-LPETG-linker (20 AA) and linker (20). It was amplified by overlapping PCR using a mixture of AA) -SrtA).
  • the gene encoding target (VL) -LPETG-linker (20 AA) -Sortase-linker (7 AA) -H9 was selected from primer 8, primer 17 and the PCR product (target-LPETG-linker (20). Amplification by overlapping PCR using a mixture of AA) and linker (20 AA) -SrtA-linker (7 AA)).
  • the gene encoding target (VL) -LPETG-linker (20 AA) -Sortase- (H4) 2L linker (50 AA) -H9 (II of FIG. 2) was selected from primer 8, primer 19 and the PCR product (target-LPETG). Amplification by overlapping PCR using a mixture of linker (20 AA) and linker (20 AA) -SrtA- (H4) 2L linker (50 AA)).
  • the gene encoding target (VL) -LPETG-linker (20 AA) -Sortase-CHL linker (32 AA) -H9 (I of FIG. 3) was selected from primer 8, primer 24 and the PCR product (target-LPETG-linker ( Amplification by overlapping PCR using a mixture of 20 AA) and a linker (20 AA) -SrtA-CHL linker (32 AA).
  • the gene encoding target (VL) -LPETG-linker (20 AA) -Sortase-AHL linker (45 AA) -H9 (II of FIG. 3) was selected from primer 8, primer 28 and the PCR product (target-LPETG-linker ( Amplification by overlapping PCR using a mixture of 20 AA) and a linker (20 AA) -SrtA-AHL linker (45 AA)).
  • the resulting DNA fragment is cleaved with NdeI and NotI and the fusion proteins target-LPETG-other linker-Sortase-R9, target-LPETG-other linker-Sortase-H6, or target-LPETG-other linker-Sortase-H9 It was ligated with the pET23a vector (Novagen) which is the expressing vector.
  • the fusion proteins target-LPETG-different linker-Sortase-R9, target-LPETG-different linker-Sortase-H6, or target-LPETG-different linker-Sortase-H9 are the target and LPETG-different linker-Sortase-R9, LPETG- There is a HindIII site between sequences encoding another linker-Sortase-H6, or LPETG-other linker-Sortase-H9.
  • the supernatant of the lysate was loaded into 5 ml Ni-NTA (GE) column and with 20-fold column volume buffer A (50 mM Tris-Cl, pH 8.0, 150 mM NaCl, 30 mM imidazole, and 5 mM BME). After washing, washed with 5-fold column volume of buffer B (50 mM Tris-Cl, pH 8.0, 150 mM NaCl). After washing, aliquote of protein-bound resin was equilibrated with cleavage buffer (Buffer B containing 5 mM CaCl 2 and 5 mM tri-Gly), and then reacted at 25 ° C. for 1 hour.
  • buffer A 50 mM Tris-Cl, pH 8.0, 150 mM NaCl
  • buffer B 50 mM Tris-Cl, pH 8.0, 150 mM NaCl
  • cleavage buffer Buffer B containing 5 mM CaCl 2 and 5 mM tri-Gly
  • FIGS. 5 and 8 show a process for purifying a fusion protein in which Sortase A is bound to the existing C terminus of I of FIG. 1
  • FIG. 8 shows a process for purifying a fusion protein in which Sortase A is bound to the N-terminal of the present invention. Giving.
  • Protein purity was analyzed by Coomassie blue staining SDS-PAGE gel. In addition, the expression and purification of some samples were confirmed by Western blotting.
  • Example 2 Expression from the cell lysate obtained by Example 2 from host cells (E. coli, E. coli ) transformed with expression vectors obtained by inserting the fusion proteins corresponding to I of FIG. 1 into pET21b, pET23a, and pLIC It was confirmed. This was purified by binding to the Ni-NTA (GE) column through Example 3, and confirmed the protein bound to the column.
  • host cells E. coli, E. coli
  • the expression and purification were confirmed by Western blotting using Coomassie blue staining and Myc tag bound to the target protein.
  • the fusion protein purification efficiency was compared when the position of the target protein is different from the N terminal and the C terminal. This was confirmed through the experiment according to Example 2 and Example 3.
  • Example 2dml For cells obtained through the above Example 2dml method by transforming the vector expressing the fusion proteins corresponding to II to IV of Figure 1 in Origami2 (DE3) or BL21 (DE3) and incubated in LB, SB or dYT medium The expression was confirmed in the seafood. This was purified by binding to a Ni_NTA (GE) column as disclosed in Example 3, and confirmed the protein bound to the column.
  • GE Ni_NTA
  • the expression and purification were confirmed by coomassie blue staining and the target protein was Western blotting using HA tag antibody in the case of V H , myc tag antibody in the case of V L.
  • linker 7 A.A.
  • Linker (GGSSRSS, SEQ ID NO: 5), and 18 A.A.
  • the linker SSGGGGSGGGGGGSSRSS, SEQ ID NO: 6
  • the weak tag protein CP lane, cleaved protein lane, 15 kDa position
  • 20 A.A In the linker (SSGGGGSGGGGGGSSRSSGS, SEQ ID NO: 7) it can be seen that a large amount of the detagged protein is obtained.
  • the linker When the linker is present in the C-terminal part as well as the N-terminal part of the Sortase A domain, it was compared using a fusion protein in which a linker was additionally inserted between the Sortase A domain and the His tag.
  • the difference between (1) and (2) is the difference between presence or absence of linker (7 A.A., GGSSRSS) after Sotase A. Expression of the two fusion proteins and the degree of column binding were confirmed by coomassie blue staining.
  • the linker consisting of a large number of glycine and serine and one arginine was replaced with various kinds of linkers that can reduce interference between domains, thereby confirming column binding or yield.
  • the binding rate was confirmed by expressing the fusion protein having the structure of I and II of FIG. 2 using AA, SEQ ID NO: 1).
  • the fusion protein is overexpressed, but it can be seen that hardly binds to the column. It was confirmed that the helical linker used in the fusion protein did not have an effect of increasing the binding rate.
  • Soltase A requires calcium and / or triglycine for the cleavage function to recognize the cleavage sequence (LPXTG).
  • LPXTG cleavage sequence
  • the negative control group was not able to observe the cleaved protein at all (about 15 kDa), when either of the cleavage protein was observed.
  • the amount of cleaved protein obtained when the concentration of calcium to 5 to 5 mM and triglycine was adjusted to 0 to 5 mM showed little difference, whereas the concentration of triglycine to 5 to 5 was included.
  • Fig. 11B When adjusted to mM it can be seen that less cleaved protein is obtained when the triglycine is not included (Fig. 11B). However, once triglycine entered, there was little difference in the amount of cleaved protein obtained.
  • triglycine contained in the cleavage-buffer plays an important role in the cleavage function of the solutes, and the difference in concentration does not mean much.
  • the optimal concentration condition of triglycine required for efficient drug conjugation was established.
  • Bioglycine with triglycine-fused biotin was used, and the concentration was 0, 10 nM, 100 nM, 500 nM, 1 ⁇ M, 10 ⁇ M, 100 ⁇ M, 500 ⁇ M, and 1 mM, respectively.
  • the conjugation of the target protein with biotin was compared with the negative control.
  • Negative control was used three conditions (1: 50mM Tris buffer, pH8.0 / 2: 50mM Tris buffer, pH8.0 + 500 ⁇ M triglycine-biotin / 3: reaction buffer).
  • the target protein-biotin conjugation was confirmed by Western blot using the Myc tag bound to the target protein and the total concentration of the target protein.
  • the streptavidin was used to confirm the conjugation reaction between the target protein and biotin.
  • Optimal reaction time conditions were analyzed using the concentration of triglycine-biotin established in Example 7-1.
  • the concentration of the target protein was fixed at two concentrations of 500 ⁇ M and 1 mM, and the reaction time was 0, 30 minutes, 1, 2, 3, 4, 6 hours and 16 hours, and then the conjugate of the target protein and biotin was negatively controlled. Compared.
  • the fusion protein having the structure of the target protein-LPETG-linker (20 AA) -Sortase-tag has a very high yield with excellent column binding ability and excellent Sortase A self-cleaving activity. It can be seen that the therapeutic antibody-drug conjugate used was prepared.
  • the present invention relates to a self-cleaving fusion protein comprising a self-cleaving cassette consisting of a peptide consisting of the amino acid sequence of LPXTG, which is a recognition sequence thereof, and a Soltease A cleavage functional domain, and furthermore, a process for purifying and removing a tag of interest.
  • This is very useful in that it can be completed in one purification process.
  • the position of the target protein at the amino terminus enhances the column binding ability and the self-cleaving ability of the fusion protein, the high purity of the tagged protein can be obtained, and the purification and tag removal process through the cut-buffer.
  • This one-step process is widely used in various fields that require high purity and large amount of protein in that the time and effort required for purification is drastically reduced, and in one step, the loss of obtained protein is reduced.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Analytical Chemistry (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

본 발명은 아미노 말단에서부터 목적 단백질, LPXTG의 아미노산 서열로 이루어지는 펩타이드, 솔테이즈 A 절단 기능 도메인 및 태그의 순서로 포함하는 자가절단 융합 단백질, 이를 코딩하는 핵산, 본 발명의 핵산을 포함하는 발현벡터, 및 본 발명의 발현벡터로 형질전환된 세포에 관한 것이다. 또한, 본 발명은 상기 형질전환된 세포를 배양하여 용해 및 정제하는 단계를 포함하는 목적 단백질의 정제방법에 관한 것이다. 본 발명은 솔테이즈 A 절단 기능 도메인과 이의 인식 서열인 LPXTG의 아미노산 서열로 구성되는 펩타이드로 이루어진 자가 절단 카세트를 포함하는 자가 절단 융합 단백질에 관한 것으로, 목적 단백질의 정제 및 태그 제거 과정을 별도의 과정이 아닌 한 번의 정제 과정으로 완료할 수 있다는 점에서 매우 유용하다. 특히, 목적 단백질의 위치가 아미노 말단에 존재함으로써 융합 단백질의 컬럼 결합 능력과 자가 절단 능력을 높인 점, 태그가 제거된 목적 단백질을 고순도로 얻을 수 있는 점, 절단-버퍼를 통해 정제 및 태그 제거 과정이 한 번의 과정으로 완료되어 정제에 필요한 시간 및 노력이 획기적으로 감소되는 점, 및 한 번의 단계로 이루어지기 때문에 수득 단백질의 손실이 감소되는 점에서 고순도 및 대량의 단백질이 필요한 다양한 분야에서 널리 이용될 수 있다. 특히, 치료용항체-약물 결합체 제조에 유용하다.

Description

자가 절단 카세트를 포함하는 단백질 정제방법 및 이의 용도
본 발명은 아미노 말단에서부터 목적 단백질, LPXTG의 아미노산 서열로 이루어지는 펩타이드, 솔테이즈 A 절단 기능 도메인 및 태그의 순서로 포함하는 자가절단 융합 단백질, 이를 코딩하는 핵산, 본 발명의 핵산을 포함하는 발현벡터, 및 본 발명의 발현벡터로 형질전환된 세포에 관한 것이다. 또한, 본 발명은 상기 형질전환된 세포를 배양하여 용해 및 정제하는 단계를 포함하는 목적 단백질의 정제방법 및 상기 방법을 이용한 치료용 항체-약물 결합체의 제조방법에 관한 것이다.
최근 유전공학 및 생물학의 발전으로 특정 단백질을 대량으로 생산 또는 수득하여 각종 산업 및 질병의 치료 등에 사용하고자 하는 시도가 많이 있다. 이에 따라, 원하는 단백질을 수득하기 위한 단백질 조합 기술, 대량 생산 기술 및 정제 기술 등이 중점적으로 개발되고 있다.
종종 사람들이 필요로 하는 목적 단백질은 이를 발현하는 벡터로 형질전환된 세포를 배양하여 원하는 단백질을 발현시켜 생산될 수 있다. 경우에 따라서 이러한 단백질은 진핵세포, 원핵세포 등에서 발현될 수 있으며, 특별한 경우에는 형질전환된 식물이나 형질전환된 동물에서 발현될 수 있다. 예를 들어, 젖을 분비하는 형질전환된 동물에서 발현되어, 형질전환 동물의 젖을 통하여 목적 단백질을 수득하는 등의 방법 등이 시도되고 있다. 이 경우, 세포 배양물 또는 젖으로부터 원하는 단백질을 분리 정제할 수 있다.
별도의 분비를 통한 목적 단백질 수득 방법이 없는 동·식물이나 미생물에서 단백질을 발현시키는 경우에는 우선 저장기관이나 세포 내부로부터 단백질을 추출하는 과정이 필요하게 된다. 이러한 형질전환 세포로부터 목적 단백질을 수득하는 작업은 용이하지 않다. 이에 따라, 수득을 용이하기 위하여 목적 단백질을 천연형이 아닌 태그(tag)를 포함하는 형태로 재조합하는 방법이 많이 사용되고 있다.
정제를 위하여 태그(tag)를 이용하는 방법은 다양한 단백질 정제 기술 중 굉장히 높은 효율성을 나타내는 방법 중 하나로, 이때 사용되는 태그는 크게 펩타이드 태그와 단백질 태그로 나뉜다. 펩타이드 태그는 짧은 아미노산으로 이루어진 것으로 대표적으로는 히스 태그(his-tag, histidine-tag)이 있으며, 특히 헥사히스티딘 태그(hexahistidine tag, His6-tag)이 많이 사용된다. 히스티딘 펩타이드는 니켈과 특이적인 화학적 친화력을 가지고 있어, 해당 태그를 포함하는 융합 단백질은 니켈을 포함하는 컬럼에 의해 높은 순도로 정제될 수 있다. 단백질 태그는 특정 성분에 결합하는 단백질의 도메인이 가진 특징 등을 이용하기 위하여 해당 도메인 등을 포함하는 태그이다. 대표적으로는 GST-태그(Glutathione S-transferase-tag)가 있다. GST 태그는 GST의 기질인 글루타치온 고정 매개체로 하는 컬럼에 의해 높은 순도로 정제될 수 있다.
상기와 같은 단백질 정제를 위해 목적 단백질에 융합 발현된 태그는 목적 단백질 자체의 구조나 기능을 방해할 수 있는 위험이 존재하여, 이러한 태그를 잘라낸 목적 단백질을 수득하기 위한 방법이 고안되고 있다. 다만, 기존의 방법은 1차로 태그를 포함하는 단백질을 수득한 다음, 태그를 자르는 과정, 및 다시금 목적 단백질만을 정제하는 과정이 필요했다. 이러한 과정동안 목적 단백질은 소실되고 최종 수득되는 단백질의 양이 줄어들며, 해당 과정을 위한 비용 및 시간 또한 과다하였다. 이에 태그를 이용한 단백질 정제 방법의 장점은 남기면서, 태그를 자르는 과정에서의 목적 단백질의 소실을 최소화하고 빠른 시간 안에 단백질을 정제할 수 있는 방법이 필요하였다.
이러한 배경하에, 자가 절단의 기능을 갖는 솔테이즈 A(Sortase A) 단백질의 절단 기능 도메인과 해당 도메인에 의해 인식되는 절단 부위 서열을 이용한 단백질 정제 방법이 개발되었다(Mao H et al., Protein Expr. Purif. 2004; 37(1):253-63). 솔테이즈 A(SrtA, 60-206 A.A.)는 효소로서, 칼슘과 트리글라이신이 존재하는 환경에서 절단 부위 서열(LPXTG, X는 임의의 아미노산) 부위를 인식하여 트레오닌(threonine, T)과 글라이신(glycine, G) 사이를 자르는 촉매반응을 일으킨다. 기존의 솔테이즈 A를 이용한 단백질 정제 방법은 태그-sortase A(60~206 A.A.)-LPXTG-목적 단백질을 코딩하는 폴리뉴클레오티드를 포함하는 재조합 발현 벡터를 제조하여 숙주세포에서 단백질을 발현시킨 후, 숙주세포 분쇄물을 태그 결합 컬럼에 결합시키는 단계; 불순물 제거하는 단계; 칼슘 및/또는 트리글라이신 포함 용액을 주입하고 반응시키는 단계; 단백질을 수득하는 단계에 의해, 단 한번의 컬럼 사용으로 한번에 단백질 정제와 태그 제거를 할 수 있는 방법이다. 그러나, 이러한 솔테이즈 A 절단 기능 도메인을 이용한 기존의 방법은 목적 단백질에 따라, 정제 효율이 낮은 문제점이 있었다.
이에 따라, 본 발명에서는 솔테이즈 A 절단 기능 도메인을 결합시키는 방향 구성 및 솔테이즈 A와 절단 서열 사이에 링커 적용을 통해 기존의 방법보다 월등한 단백질 수득율을 얻을 수 있음을 확인함으로써, 본 발명을 완성하였다.
발명의 요약
본 발명의 목적은 아미노 말단에서부터 목적 단백질, LPXTG의 아미노산 서열로 이루어지는 펩타이드, 솔테이즈 A(Sortase A) 절단 기능 도메인 및 태그의 순서로 포함하는 자가 절단 융합 단백질을 제공하는데 있다.
본 발명의 다른 목적은 상기 융합 단백질을 코딩하는 뉴클레오티드 서열을 포함하는 핵산 및 상기 핵산을 포함하는 발현벡터를 제공하는데 있다.
본 발명의 또 다른 목적은 상기 발현벡터로 형질전환된 세포를 제공하는데 있다.
도 1은 목적 단백질이 카복실 말단에 존재하는 기존 융합 단백질에 대한 구조도(I), 목적 단백질이 아미노 말단에 존재하고 링커의 길이를 다양하게 한 본 발명 융합 단백질의 구조도(II ~ IV)이다.
도 2는 펩타이드 링커의 최적화를 위해 가용성 링커를 추가(I)하거나 나선형 링커를 추가(II)한 융합 단백질의 구조도이다.
도 3은 펩타이드 링커의 최적화를 위해 전하성 링커(CH 링커 또는 AH 링커)를 추가한 융합 단백질의 구조도이다.
도 4는 링커의 길이, 링커의 추가 여부, 태그를 달리한 융합 단백질의 구조도이다.
도 5는 기존 솔테이즈 A 자가 절단 카세트를 이용한 정제 방법을 도식화한 도면이다.
도 6은 발현벡터를 여러 종류로 하였을 때 융합 단백질의 발현을 확인하는 SDS-PAGE 젤을 코마시 블루 염색한 도면이다.
도 7은 기존 솔테이즈 A 자가 절단 카세트를 이용한 정제 방법을 이용하였을 때 단백질의 발현(A) 및 절단된 목적 단백질(anti-Myc)의 정제 여부(B의 5, 6 lane)를 확인한 도면이다.
도 8은 본 발명의 솔테이즈 A 자가 절단 카세트를 이용한 정제 방법을 도식화한 도면이다.
도 9는 본 발명의 솔테이즈 A 자가 절단 카세트를 포함하고 링커의 길이를 다양하게(7, 18, 20 A.A.) 한 발현 벡터를 다양한 대장균 숙주세포(Origami2(DE3), 및 BL21(DE3))에 형질전환하여 융합 단백질의 발현 정도를 확인한 도면이다.
도 10은 다양한 링커를 가진 본 발명의 발현벡터로 형질전환된 세포를 LB(L), SB(S), 2xYT(Y) 배지로 배양하여 발현(LS, laoding sample), 결합(FT, flow through; BP, bound protein) 및 정제(CP, cleaved protein) 정도를 확인한 도면이다.
도 11은 절단-버퍼를 최적화하기 위하여 칼슘 및 트리글라이신의 유무 및 농도를 다양하게 하여 절단 단백질의 수득율을 비교한 도면이다.
도 12는 나선형 링커를 추가한 경우에 융합 단백질의 발현 및 결합 정도를 확인한 도면이다.
도 13은 솔테이즈 A 절단 기능 도메인과 태그 사이에 7 A.A. 가요성 링커를 추가한 경우(2-1 또는 2-2)와 아닌 경우(1)의 융합 단백질의 발현 및 결합 정도를 확인한 도면이다.
도 14는 전하성 링커(CH 링커 또는 AH 링커)를 추가한 융합 단백질의 발현, 결합 및 정제 정도를 확인한 도면이다.
도 15는 기존 솔테이즈 A 절단 카세트를 포함하는 융합 단백질, 즉 목적 단백질을 카복실 말단에 포함하는 융합 단백질(C-terminal)과 본 발명의 솔테이즈 A 절단 카세트를 포함하는 융합 단백질, 즉 목적 단백질을 아미노 말단에 포함하는 융합 단백질(N-terminal)의 발현, 결합 및 정제 정도를 확인한 도면이다.
도 16은 목적단백질에 약물을 접합시키기 위한 최적조건 확립을 위하여, 트리글라이신-비오틴 결합체의 농도(A) 및 반응시간(B)을 분석한 도면이다.
도 17은 ‘항체-링커-솔테이즈’가 포함된 자가절단 카세트를 포함하는 융합 단백질과 트리글라이신-약물(GGG-drug)의 접합 반응을 절단버퍼 내에서 수행하여 치료용항체-약물 결합체(ADC, antibody-drug conjugate)를 제조하는 것에 관한 도면이다.
발명의 상세한 설명 및 바람직한 구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로, 본 명세서에서 사용된 명명법 및 이하에 기술하는 실험 방법은 본 기술분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명에서는, 상기 목적을 달성하기 위한 하나의 양태로서, 목적 단백질, LPXTG의 아미노산 서열로 이루어지는 펩타이드, 솔테이즈 A(Sortase A) 절단 기능 도메인 및 태그를 포함하는 자가 절단 융합 단백질을 제공한다.
구체적으로는, 본 발명의 자가 절단 융합 단백질은
(i) 목적 단백질;
(ii) 하기 서열식 I의 펩타이드:
서열식 I
L-P-X-T-G;
(iii) 솔테이즈 A(Sortase A) 절단 기능 도메인; 및
(iv) 태그를 포함하며, 상기 (i) 내지 (iv)는 융합 단백질의 아미노 말단으로부터 카복실 말단 순서로 존재하며, 상기 서열식 I에서 L은 류신(Leucine)이고, P는 프롤린(Proline)이며, X는 임의의 아미노산이고, T는 트레오닌(Threonine)이며, G는 글리신(Glycine)이다.
기존 솔테이즈 A 절단 기능 도메인를 포함하는 자가 절단 융합 단백질은 목적 단백질을 카복실 말단에 포함하고 있었으나, 목적 단백질에 따라 정제 수율이 매우 낮은 경우가 있었다. 본 발명은 목적 단백질을 솔테이즈 A의 아미노 말단에 위치시킴으로써, 융합 단백질의 컬럼 결합 및 절단 효율이 현저하게 향상되어 목적 단백질의 정제 수율이 월등히 증가함을 확인하였다(도 15).
본 발명의 자가 절단 융합 단백질은 바람직하게는 LPXTG 아미노산 서열로 이루어지는 펩타이드와 솔테이즈 A 절단 기능 도메인 사이에 추가로 펩타이드 링커를 포함하는 것일 수 있다.
본 발명에서 “목적 단백질”은 특정 목적에 의해서 높은 순도 또는 대량으로 수득할 필요가 있는 임의의 단백질을 말하며, 이에는 천연형 단백질, 변이체 단백질, 또는 신규 재조합 단백질 등이 제한없이 포함된다. 목적 단백질은 산업적, 의료적, 학문적 이유 등으로 높은 순도로 또는 대량으로 수득이 요구되는 단백질일 수 있으며, 바람직하게는 의약용 또는 연구용 재조합 단백질일 수 있으며, 더욱 바람직하게는 고분자 단백질, 당 단백질, 사이토카인, 성장인자, 혈액제제, 백신, 호르몬, 효소 및 항체로 이루어진 군에서 선택된 것일 수 있다. 더욱더 바람직하게는 목적 단백질은 항체의 경쇄 또는 중쇄의 전부 또는 일부분일 수 있으며, 가장 바람직하게는 항체의 경쇄 가변영역(VL) 또는 중쇄 가변영역(VH)일 수 있다.
본 발명에서 “LPXTG의 아미노산 서열로 이루어지는 펩타이드”는 류신(Leucine)-프롤린(Proline)-임의의 아미노산-트레오닌(Threonine)-글라이 신(Glycine)의 아미노산 서열로 이루어진 펩타이드를 의미하며, 이는 단백질 절단 기능을 갖는 솔테이즈 A(Sortase A)의 인식 서열이다. 곧, 솔테이즈 A는 LPXTG 서열을 인식하여 트레오닌과 글라이신 사이를 절단하고, 이에 따라 LPXT를 포함하는 부분과 G를 포함하는 부분으로 나눠지게 된다. 본 발명에서 LPXTG의 아미노산 서열로 이루어지는 펩타이드에서 X는 임의이 아미노산일 수 있으며, 예를 들어 상기 X는 글루탐산(Glutamic Acid, E)일 수 있다.
본 발명에서 "솔테이즈 A(Sortase A, Srt A)"는 그램 양성균의 세포벽에 표면 단백질을 부착시키는 기능을 가진 단백질로, LPXTG 서열의 트레오닌과 글라이신 사이를 절단하여 이렇게 생긴 트레오닌의 유리 카복실기와 세포벽의 펩티도글리칸의 팬타글리신 등의 유리 아미노기를 결합시키는 역할을 하는 것으로 알려져 있다.
기본적으로 LPXTG 서열을 인식하여 절단하는 기능을 갖는 펩티다아제(peptidase)이다. 본 발명에서 솔테이즈 A, Soratase A 또는 Srt A 등은 전체 단백질뿐만 아니라, 솔테이즈 A의 절단 기능 도메인과 혼용될 수 있다. 본 발명에서는 임의의 솔테이즈 A 절단 기능 도메인을 사용할 수 있다. 바람직하게는 해당 솔테이즈 A는 박테리아 유래일 수 있으며, 예를 들어, 스타필로코커스 아우레우스(Staphylococcus aureus, S.aureus)유래일 수 있고, 더욱 바람직하게는 솔테이즈 A 절단 기능 도메인은 서열번호 8의 아미노산 서열로 구성되는 것일 수 있다.
본 발명에서 "태그(tag)"는 재조합 단백질에서 단백질을 표지 또는 수득하기 위한 목적으로 삽입되는 일정한 아미노산 서열, 펩타이드 또는 나아가 단백질 도메인 등이며, 태그를 이용한 단백질 정제 방법은 단백질 정제 기술 중 굉장히 높은 효율성을 나타내는 방법 중 하나로, 이때 사용되는 태그는 크게 펩타이드 태그와 단백질 태그로 나뉜다. 본 발명에서 태그는 예를 들어, 폴리 히스티딘 태그(polyhistidine tag), GST 태그(glutathione-S-transferase tag), HA 태그(Hemagglutinin tag), FLAG 태그, Myc 태그, 말토오스 결합 단백질 태그(maltose binding protein tag), 키틴 결합 단백질 태그(Chitin binding protein tag) 및 형광 태그로 이루어진 군 중에서 선택된 것일 수 있으나, 제한되지는 않으며, 바람직하게는 폴리 히스티딘 펩타이드 태그일 수 있고, 더욱 바람직하게는 히스티딘이 6 내지 12개인 펩타이드 태그일 수 있으며, 가장 바람직하게는 히스티딘이 10개인 폴리 히스티딘 펩타이드 태그일 수 있다.
상기 태그는 이와 연결되어있는 전체 융합 단백질을 태그와 결합하는 컬럼에 부착시키는 역할을 한다. 이를 통해서 궁극적으로 융합 단백질에 포함되어 있는 목적 단백질을 수득할 수 있다.
본 발명에서 "자가 절단 융합 단백질"이란, 한 융합 단백질 내에 절단 기능을 갖는 도메인과 그 도메인이 인식하여 절단하는 인식 서열이 동시에 포함되어 일정한 조건이 되면 절단 기능 도메인이 활성화되어 같은 단백질 내의 인식 서열을 인식하여 절단하게 되는 단백질을 의미한다. 본 발명에서는 솔테이즈 A 유래의 절단 기능 도메인과 해당 도메인이 인식하는 LPXTG를 포함하는 융합 단백질일 수 있으며, 그 밖에도 다른 구성을 추가로 포함할 수 있다.
본 발명에서 "자가 절단 카세트"란 절단 기능을 갖는 도메인과 그 도메인이 인식하여 절단하는 인식 서열을 포함하는 도메인 세트를 뜻하며, 바람직하게는 솔테이즈 A 유래의 절단 기능 도메인과 해당 도메인이 인식하는 LPXTG를 포함하는 도메인 세트일 수 있다.
본 발명에서 "펩타이드 링커"는 융합 단백질 내에서 도메인과 도메인 사이에 물리 화학적 거리를 두거나, 혹은 연결을 위하여 사용되는 펩타이드이다. 본 발명의 융합 단백질은 솔테이즈 A와 LPXTG 펩타이드 사이에 링커를 포함할 수 있다. 이에는 천연 링커, 가요성 링커(flexible linker), 나선형 링커(helical linker), 전하성 링커(양전하 또는 음전하성 링커), 또는 coiled coil 링커 등이 사용될 수 있다. 본 발명에서 가요성 링커는 일반적으로 (GaSb)n의 형태를 포함하고 있으며(a=1 내지 10, b= 1 내지 10, n= 1 내지 10), 특히 (G4S)서열을 포함하는 것일 수 있다.
본 발명에서 아미노산 서열의 아미노산은 당업계에서 관용적으로 쓰이는 아미노산 일문자 약어로 표기한다. 가요성 링커는 기본적으로 링커에 존재하는 아미노산끼리 서로 반발하거나 집적하는 성질이 없어 유연한 움직임을 보일 수 있다. 본 발명에서 나선형 링커는 A(EAAK)mA(m은 2~5)의 일반식을 포함할 수 있으며, 50 A.A.인 (H4)2 링커(LEA(EAAAK)4ALEA(EAAAK)4AL, 서열번호 1)일 수 있다. 본 발명에서 전하성 링커는 양전하 또는 음전하를 가지는 링커일 수 있으며, 양전하 링커는 CH 링커(TRARLSKELQAAQARLGADMEDVCGRLVQYRG, 서열번호 2)일 수 있고, 음전하 링커는 AH 링커 (KEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKL, 서열번호 3)일 수 있다.
Coiled coil 링커는 나선형 삼차원 구조를 가지면서 다른 coiled coil 도메인 또는 링커와 결합할 수 있는 능력을 가진 링커로 서열번호 9 내지 16 또는 서열번호 48 내지 55 중 하나일 수 있다.
바람직하게는 본 발명에서 펩타이드 링커는 가요성 링커일 수 있으며, Sc(SG4)l(GGSSRSS)GdSe 형태(서열번호 4)를 갖는 것일 수 있다. 상기 Sc(SG4)l(GGSSRSS)GdSe에서 c는 0 내지 5이고, d는 0 내지 5 이며, e는 0 내지 5이고, l은 0 내지 10이다. 본 발명에서 펩타이드 링커의 길이는 중요하지 않으며, 활성 부위와의 접근성을 위하여 목적 단백질에 따라 링커의 길이는 변할 수 있으나, 바람직하게는 19 내지 40개의 아미노산으로 이루어진 것일 수 있으며 더욱 바람직하게는 19 내지 25개 아미노산으로 이루어진 것일 수 있다. 가장 바람직하게는 서열번호 7의 아미노산 서열로 구성된 펩타이드 링커일 수 있다.
본 발명의 구체적인 일 실시예에서는 목적 단백질이 항체 가변영역일 경우, 목적 단백질의 수득율에 링커가 미치는 영향을 확인하기 위하여 링커의 길이, 링커의 갯수 및 종류에 변화를 주어 링커 최적화를 실험하였다.
링커의 길이를 7 A.A.(서열번호 5), 18 A.A.(서열번호 6) 및 20 A.A.(서열번호 7)로 달리하여 목적 단백질의 수득율을 비교한 결과(실시예 5-1, 도 9 및 도 10), 링커가 20 A.A.인 경우에 목적 단백질 수득율이 증가하는 것을 확인하였다.
한편, LPXTG 인식 서열과 솔테이즈 A 절단 기능 도메인 사이에 있는 링커에 더하여 솔테이즈 A 절단 기능 도메인과 태그 사이에 링커를 추가하여 도메인 사이의 방해(interference)를 감소시키는 것(도 2)이 목적 단백질의 수득율에 미치는 영향을 비교하였다(실시예 5-2). 구체적으로는, (1) 목적 단백질(VH)-LPETG-링커(20 A.A.)-Sortase A-히스태그의 구조를 갖는 융합 단백질을 발현하는 벡터로 형질전환한 경우와 (2) 목적 단백질(VH)-LPETG-링커(20 A.A.)-Sortase A-링커(7 A.A.)-히스태그의 구조를 갖는 융합 단백질을 발현하는 벡터로 형질전환한 경우를 비교하였다(도 13). (1)의 경우에는 컬럼에 결합하는 것을 확인할 수 있으나(Bound proteins), (2)의 컬럼에 결합한 단백질은 거의 찾아볼 수 없었다. 즉, Sortase A의 C 말단에 링커를 추가하는 것은 융합 단백질의 컬럼 결합을 증가시키지 못하였다.
링커의 종류에 관하여 상기 나열한 바 있는, 나선형 링커, 전하성 링커를 솔테이즈 A 절단 기능 도메인과 태그 사이에 삽입하여 목적 단백질의 수득율에 미치는 영향을 확인하였다(실시예 5-3, 도 12 및 도 14). 구체적으로는 나선형 링커를 LPXTG 인식 서열과 솔테이즈 A 절단 기능 도메인 사이에 있는 가요성 링커(20 A.A.)는 잔존시킨 채로 추가로 솔테이즈 A 절단 기능 도메인과 태그 사이에 삽입한 경우에 융합 단백질이 컬럼에 거의 결합되지 않는 것을 확인할 수 있었다(도 12).
또한, 전하성 링커들, 양전하성 링커(CH 링커, 서열번호 2) 또는 음전하성 링커(AH 링커, 서열번호 3)를 LPXTG 인식 서열과 솔테이즈 A 절단 기능 도메인 사이에 있는 가요성 링커(20 A.A.)는 잔존시킨 채로 추가로 솔테이즈 A 절단 기능 도메인과 태그 사이에 삽입한 경우에도 컬럼에 거의 결합되지 않으며 절단 단백질이 거의 발견되지 않았다(도 14).
본 발명의 자가 절단 융합 단백질은 서열번호 17 또는 18의 아미노산 서열로 구성되는 것일 수 있다. 이는 목적 단백질로 항체 가변영역을 포함하고, LPETG 인식 서열, 펩타이드 링커, 솔테이즈 A 절단 기능 도메인(60~206 A.A.)와 컬럼 결합용 태그(His9)를 아미노 말단에서부터 순차적으로 포함하는 것이다.
본 발명에서는 또 하나의 양태로서, 본 발명의 자가 절단 융합 단백질을 코딩하는 뉴클레오티드 서열을 포함하는 핵산을 제공한다. 본 발명의 융합 단백질을 코딩하는 뉴클레오티드 서열은 서열번호 17 또는 18의 아미노산 서열을 암호화하는 뉴클레오티드 서열일 수 있으며, 바람직하게는, 서열번호 56 또는 57의 뉴클레오티드 서열일 수 있다.
또 하나의 양태로서, 본 발명은 상기 핵산을 포함하는 발현벡터를 제공한다.
본 발명에서 "발현벡터"는 특정 원핵 또는 진핵 숙주 세포내에서 특정 유전자를 발현시키기 위해 프로모터 등이 동작 가능하도록 연결된 벡터를 의미한다. 이는 숙주세포에 따라 벡터의 백본(backbone)이 달라질 수 있으며, 본 발명에서는 대장균에서 발현가능한 벡터일 수 있으며, 더욱 바람직하게는 pET21b, pLIC, pET23a 벡터 (Novagen)일 수 있다.
또 하나의 양태로서, 본 발명은 본 발명의 발현벡터로 형질전환된 세포를 제공한다.
형질전환의 목적이 되는 세포를 이른바 숙주세포라고 하기도 하며, 이에는 진핵 세포 또는 원핵 세포를 불문한다. 본 발명에서는 바람직하게는 대장균(Escherichia coli)일 수 있으며, 더욱 바람직하게는 E.coli Origami2(DE3) 또는 E.coli BL21(DE3)의 대장균 균주일 수 있다.
본 발명의 구체적인 실시예에 따르면, 본 발명의 발현벡터들을 Origami2(DE3) 또는 BL21(DE3)를 숙주세포로 하여 형질전환하고 발현되는 양상을 비교하였다(도 9). 도 9에서 확인할 수 있듯이 Origami2와 BL21 사이에 발현 양상에는 큰 차이가 없었다.
또 하나의 양태로서, 본 발명은 본 발명의 세포를 배양하여 세포 용해물(Cell lysates)을 얻는 단계 및 세포 용해물로부터 목적 단백질을 정제하는 단계를 포함하는 목적 단백질의 정제방법을 제공한다.
또한, 바람직하게는 상기 세포 용해물로부터 목적 단백질을 정제하는 단계는 세포 용해물을 융합 단백질에 존재하는 태그와 결합하는 컬럼에 주입하는 단계; 컬럼을 세척하는 단계; 칼슘 및 트리글라이신으로 이루어진 군 중에서 선택된 하나 이상을 포함하는 절단-버퍼로 평형화시키고 절단 반응시키는 단계; 및 컬럼으로부터 절단-버퍼를 수득하여 태그가 제거된 목적 단백질을 수득하는 단계를 포함하는 것일 수 있다.
본 발명에서 "컬럼"은 특정 성분, 단백질, 화합물들을 포함하는 혼합물 용액을 주입하여 내부를 통과하는 동안 특정 성분, 단백질, 화합물을 분리 및/또는 정제하는 기능을 하는 기구로서, 본 발명에서는 특히 융합 단백질에 포함된 특정 태그와 결합하는 특성을 가진 화합물, 성분, 단백질 등이 컬럼 내에 고정되어 태그를 가지고 있는 단백질들을 컬럼 내에 부착시키고 분리?정제하는 기능을 한다. 융합 단백질에 포함된 태그가 히스태그(히스티딘 포함 태그)인 경우에는 니켈에 결합하는 특성을 이용한 Ni-NTA 컬럼이 사용될 수 있으며, 융합 단백질에 포함된 태그가 GST인 경우에는 글루타치온(Glutathione)을 고정한 컬럼이 사용될 수 있다.
본 발명에서 "절단-버퍼"는 절단 기능 도메인을 활성화시키는 버퍼를 의미하며, 특히 솔테이즈 A를 활성화시키는 버퍼를 의미한다. 절단-버퍼는 칼슘 및/또는 트리글라이신을 포함하는 것일 수 있으며, 바람직하게는 적어도 트리글라이신을 포함하는 것일 수 있다. 또한, 절단-버퍼는 바람직하게는 칼슘 0.1 내지 10 mM 및 트리글라이신 0.1 내지 10 mM을 포함하는 것일 수 있으며, 더욱 바람직하게는 칼슘 0.2 내지 5 mM 및 트리글라이신 0.2 내지 5 mM을 포함하는 것일 수 있다.
본 발명의 구체적인 일 실시예에서는, 절단 반응의 최적 조건을 확인하기 위하여, 칼슘 또는 트리글라이신의 유무와 농도 조건을 달리하여 절단 단백질 수득율을 확인하였다. 칼슘과 트리글라이신중 하나의 농도를 5 mM로 고정하고 나머지 하나를 0, 0.2, 1, 5 mM의 농도로 혼합한 절단-버퍼에 의한 절단 단백질 수득율을 둘 모두를 넣지 않은 음성 대조군과 비교하였다. 음성 대조군에서는 절단 단백질을 전혀 관찰할 수 없었고(약 15 kDa), 둘 중 하나라도 들어간 경우에는 절단 단백질을 관찰할 수 있었으며, 일정량의 트리글라이신을 포함하고 칼슘의 농도를 조절한 경우에는 수득되는 절단 단백질의 양이 차이가 거의 없는데에 비하여, 일정량의 칼슘을 포함하고 트리글라이신의 농도를 조절한 경우에는 트리글라이신을 포함하지 않은 경우에 절단 단백질이 적게 수득되는 것을 확인하였다. 절단-버퍼에 포함된 트리글라이신이 솔테이즈의 절단 기능에 중요한 역할을 한다는 것을 확인한 것이다.
본 발명에서 “치료용항체-약물 결합체(ADC, antibody-drug conjugate)”는 약물, 항체 그리고 항체와 약물을 연결하는 링커(linker)를 포함하는 세가지 구성요소로 구성되어 있으며, 치료용항체-약물 결합체 기술은 암세포의 표면에 발현된 특정 항원에 특이적으로 결합하는 항체를 사용하여 약물을 종양세포에 전달하는 방법이다.
본 발명을 이용하여 이러한 치료용항체-약물 결합체를 제조할 수 있다. 구체적으로 아미노 말단에 ‘항체-링커-솔테이즈’가 포함된 자가절단 카세트를 구축하고, 솔테이즈 A가 절단서열(LPXTG)를 인식하여 절단기능을 수행하기 위해서는 칼슘 및/또는 트라이글라이신이 있어야 하는데, 이 절단을 유도하는 유도체 트라이글라이신의 C-말단에 약물을 연결하여 반응시킨다. 트라이글라이신 C-말단에 약물을 연결한 ‘트라이글라이신-약물(GGG-drug)’을 제조 또는 합성한 후, 구축된 ‘항체-링커-솔테이즈’가 포함된 자가절단 카세트의 절단반응에 이용하면, 최적화된 절단 반응에 의해 ‘항체-링커-약물(antibody-liker-LPETGGG-drug)’의 형태로 제조될 수 있다.
구체적으로, 본 발명의 치료용항체-약물 결합체에 사용될 수 있는 약물은 세포독성 또는 세포증식 억제 효과를 갖는 임의의 화합물, 부분 또는 기를 포함하며,
(i) 마이크로투불린 억제제, 유사분열 억제제, 토포이소머라아제 억제제, 또는 DNA 인터컬레이터로서 기능할 수 있는 화학요법제;
(ii) 효소적으로 기능할 수 있는 단백질 독소;
(iii) 특정 암유전자(oncogene)의 발현을 억제시킬 수 있는 마이크로 RNA (miRNA), siRNA, shRNA; 및
(iv) 방사선동위원소 등이 포함된다.
이러한 약물에는 마이탄시노이드, 아우리스타틴, 돌라스타틴, 트리코테센, CC1065(세포독성화합물), 칼리케아미신 및 다른 에네디인 항생제, 탁산, 안트라시클린, 메토트렉세이트, 아드리아미신, 빈데신, 빈카 알카로이드(빈크리스틴, 빈블라스틴, 에토포시드), 독소루비신, 멜팔란, 미토마이신 C, 클로람부실, 다우노루비신, 다우노마이신 및 그의 입체이성질체, 동배체, 동족체 또는 유도체, 기타 삽입제인 효소 및 그의 단편, 예를 들어 핵산 분해 효소, 항생제, 및 독소(세균, 진균, 식물 또는 동물 기원의 효소적 활성 독소 또는 소분자 독소) 및 시스플라틴, CPT-11, 독소루비신, 파클리탁셀 및 도세탁셀 등의 각종 항종양 또는 항암제 등이 포함되나, 이들로 한정되지는 않는다.
본 발명의 구체적인 일 실시예에서는, 치료용항체-약물 결합체의 제조를 위한 절단 반응의 최적 조건을 확인하기 위하여, 트리글라이신-비오틴의 유무와 농도 조건을 달리하여 절단 단백질 수득율을 확인하였다. 트리글라이신-비오틴의 농도를 0, 10nM, 100nM, 500nM, 1μM, 10μM, 100μM, 500μM, 1mM의 농도로 혼합하여 절단-버퍼에 의한 목적 단백질 수득율을 음성 대조군과 비교하였다. 음성 대조군에서는 목적 단백질과 비오틴의 접합을 전혀 관찰할 수 없었고(약 45 kDa), 500μM 및 1mM의 농도에서 많은 양의 접합반응을 관찰할 수 있었다. 상기 확립된 트리글라이신-비오틴의 농도를 이용하여 절단 반응의 최적 반응시간 조건을 확인하였다. 반응시간을 0. 30분, 1, 2, 3, 4, 6시간 및 16시간으로 반응시킨 후, 목적 단백질과 비오틴 접합체의 수득율을 음성 대조군과 비교하였다. 4 내지 16시간 반응시킨 접합반응에서 많은 양의 트리글라이신-비오틴을 관찰할 수 있었다.
또한, 절단-버퍼는 칼슘 0.1 내지 10 mM을 포함하는 것이 바람직하며, 트리글라이신-약물(GGG-drug)은 500nM 내지 1mM을 포함하du 반응시키는 것이 바람직하나, 이에 한정되는 것은 아니다. 목저 단백질과 트리글라이신-약물(GGG-drug)을 접합시키는 시간은 4 내지 16 시간인 것이 바람직하나, 이에 한정되는 것은 아니다.
목적 단백질은 암세포 표면 항원에 대한 항체인 것이 바람직하나, 이에 한정되는 것은 아니다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예 1: 발현 벡터의 제조
1-1: PCR 반응액 및 조건
본 발명에서 이용하는 각종 유전자를 수득하고 벡터를 제조하기 위한 PCR 반응액의 조성과 PCR 수행 조건은 하기와 같다.
먼저, PCR 반응액은 2.5mM dNTP mix 5㎕, 5X PrimeSTAR 완충액 10㎕, 100μM 정·역방향 프라이머 각각 1㎕씩, 100 ng/uL의 주형 DNA 1㎕, 2.5U/uL PrimeSTAR 중합효소 0.5㎕ 및 증류수 31.5㎕를 포함하여 총 50㎕로 제조하였다.
상기 제조한 PCR 반응액을 98℃에서 10초, 68℃에서 1분인 사이클을 29번 반복하는 two-step PCR을 진행하였다. PCR 완료된 샘플은 4℃에 보관하였다.
1-2: BAP-sortase-LPETG-target(VL) 제조
먼저, 프라이머 1_sfi (5’-ccgtg gcc cag gcg gcc GCA AGC AGC GGC CTG AAC GAC ATC TTC GAG GCC-3’: 서열번호 19) 또는 프라이머 1 (5’-ATGT CAT ATG GCA AGC AGC GGC CTG AAC GAC ATC TTC GAG GCC-3’: 서열번호 20), 및 프라이머 2 (5’-CTG CAT TTC GTG CCA CTC GAT CTT CTG GGC CTC GAA GAT GTC GTT-3’: 서열번호 21)를 이용하여 BAP(biotin acceptor peptide)를 코딩하는 DNA 서열을 PCR로 증폭하였다.
프라이머 3 (5’-ATC GAG TGG CAC GAA ATG CAG GCT AAG CCG CAG ATT CCG-3’: 서열번호 22) 및 프라이머 4 (5’-GCC GGT CTC GGG AAG CTT CTT GAC CTC GGT AGC GAC AAA-3’: 서열번호 23)를 이용하여 스타필로코커스 아우레우스(Staphylococcus aureus, S.aureus) 유래 SrtA(GenBank Accession No. AF162687)의 60 내지 206번째 아미노산 서열을 코딩하는 DNA 서열을 PCR로 증폭하였다.
프라이머 5 (5’-CAG TAA GCT TCC CGA GAC CGG CGA TAT CCA GAT GAC TCA GAGC-3’: 서열번호 24), 프라이머 6 (5’-ACT CGA ACC CGC CGT ACG TTT TAT CTC TAC CTT TGT-3’: 서열번호 25) 및 주형 표적 (VL)을 이용하여 LPETG-target (VL)을 코딩하는 2차 DNA 서열을 PCR로 증폭하였다.
그 후, 상기 3가지 PCR 산물을 함께 혼합한 후, 프라이머 1_sfi 또는 프라이머 1 및 프라이머 7 (5’-taatggccggcctggcc GCG GCC GCT TAA AGA TCT TCT TCA CTA ATT AACTT-3’: 서열번호 26)을 사용하여 SrtAc-LPETG 및 표적 (target)을 코딩하는 서열 사이에 HindIII site가 있는 융합 단백질인 BAP-SrtA-kLPETG-target(VL)을 코딩하는 DNA 서열을 PCR로 증폭하였다.
결과로 나온 DNA 단편을 NdeI 및 NotI으로 절단하고, 목적 단백질을 cytoplasm으로 발현 유도하는 pET23a 벡터 (Novagen)에 라이게이션하고, SfiI으로 절단 후, 융합 단백질인 BAP-sortase-LPETG-target-myc(도 1의 Ⅰ)을 periplasm으로 발현 유도하는 벡터인 pCom3x으로 라이게이션하였다.
1-3: Target(VL)-kLPETG-링커-Sortase-H9 제조
프라이머 8 (5’-ATG TCA TAT GGA CAT TCA GAT GAC ACA GAGT-3’: 서열번호 27) 및 프라이머 9 (5’-ggaaccaccgccggtctcgggaag AAG ATC TTC TTC ACT AAT TAAC-3’: 서열번호 28)를 이용하여, 링커(7 A.A.) (GGSSRSS: 서열번호 5)가 연결된 target-LPETG-링커(7 A.A.)를 코딩하는 DNA 서열을 PCR로 증폭하였다.
프라이머 8 및 프라이머 10 (5’-GGA AGA TCT AGA GGA ACC ACC CCC ACC ACC GCC CGA GCC ACC GCC ACC GGA TGA GCC GGT CTC GGG AAG AAG AT-3’: 서열번호 29) 및 상기 PCR 산물인 target-LPETG-링커(7 A.A.)를 이용하여 링커(18 A.A.) (SSGGGGSGGGGGGSSRSS: 서열번호 6)가 연결된 target-LPETG-링커(18 A.A.)를 코딩하는 DNA 서열을 PCR로 증폭하였다.
프라이머 11 (5’-gag acc ggc ggt ggt tcc tct aga tct tcc cag gct aag ccg cag att-3’: 서열번호 30) 및 프라이머 12 (5’-taat GC GGC CGC tta atgatggtg ATG GTG ATG ATG ATG ATGGC-3’: 서열번호 31)를 이용하여 링커(7 A.A.)-SrtA(60-206)를 코딩하는 DNA 서열을 PCR로 증폭하였다.
프라이머 13 (5’-gtggttcctctagatcttcc TCG AAG GTC GCG GGA TAT ATT-3’: 서열번호 32) 및 프라이머 14 (5’-taatggccggcctggcctta atgatggtg ATG GTG ATG ATG ATG ATG GC-3’: 서열번호 33)를 이용하여 링커(18 A.A.)-SrtA(60-206)를 코딩하는 DNA 서열을 PCR로 증폭하였다.
프라이머 15 (5’-GGT TCC TCT AGA TCT TCC GGA AGC cag gct aag ccg cag att-3’: 서열번호 34) 및 프라이머 14를 이용하여 링커(20 A.A.) (SSGGGGSGGGGGGSSRSSGS: 서열번호 7)가 연결된 링커(20 A.A.)-SrtA(60-206)를 코딩하는 DNA 서열을 PCR로 증폭하였다.
프라이머 15, 프라이머 16(5’-ATG ATG ATG GCG AGA GCT ACG GCT GCT GCC GCC CTT GAC CTC GGT AGC GAC AAA GA-3’: 서열번호 35) 및 프라이머 17 (5’-TAA TGC GGC CGC TTA ATG ATG GTG ATG GTG ATG ATG ATG ATG GCG AGA GCT ACG GCT-3’: 서열번호 36)를 이용하여 링커(20 A.A.) (SSGGGGSGGGGGGSSRSSGS: 서열번호 7)가 N 말단에 연결되고 링커(7 A.A.)(GGSSRSS: 서열번호 5)가 C 말단에 연결된 링커(20 A.A.)-SrtA(60-206)-링커(7 A.A.)를 코딩하는 DNA 서열을 PCR로 증폭하였다.
프라이머 15, 프라이머 18(5’- ACG ACG ACG ACG GCG CTC CAG TGC CTT AGC AGC GGC TTC CTT AGC AGC AGC CTC CTT AGC AGC TGC TTC TTT CGC TGC GGC TTC CGC TTC CAA CGC TTT C-3’: 서열번호 37) 및 프라이머 19(5’- TAA TGC GGC CGC TTA ACG GCG ACG ACG GCG ACG ACG ACG ACG GCG CTC CAG T-3’: 서열번호 38)를 이용하여 링커(20 A.A.) (SSGGGGSGGGGGGSSRSSGS: 서열번호 11)가 N 말단에 연결되고 (H4)2L 링커(50 A.A.)(서열번호 1)가 C 말단에 연결된 링커(20 A.A.)-SrtA(60-206)-(H4)2L 링커(50 A.A.)를 코딩하는 DNA 서열을 PCR로 증폭하였다.
프라이머 15 및 프라이머 20(5’-GTG CCC GCG TCT TGA CCT CGG TAG CGA CAA AGA TCTT-3’: 서열번호 39)를 이용하여 PCR로 링커(20 A.A.) (SSGGGGSGGGGGGSSRSSGS: 서열번호 7)가 N 말단에 연결되고 CH 링커(32 A.A.)의 N 말단의 TRA-를 코딩하는 DNA 서열을 증폭하고 프라이머 21 (5’- GCT GTC CAA GGA GCT GCA GGC GGC GCA GGC CCG GCT GGG CGC GGA CAT G-3’: 서열번호 40), 프라이머 22(5’-GCG GTA CTG CAC CAG GCG GCC GCA CAC GTC CTC CAT GTC CGC GCC CAG CCGG-3’ : 서열번호 41) 및 프라이머 23(5’- GAG GTC AAG ACG CGG GCA CGG CTG TCC AAG GAG CTG CAG-3’ : 서열번호 42) 및 프라이머 24(5’- TAA T GC GGC CGC TTA ATG ATG CTG ATG GTG ATG GCC GCG GTA CTG CAC CAG GC-3’: 서열번호 43)를 이용하여 CH 링커 부분을 증폭하고 링커(20 A.A.)(SSGGGGSGGGGGGSSRSSGS: 서열번호 7)가 N 말단에 연결되고 CHL 링커(32 A.A.)(TRARLSKELQAAQARLGADMEDVCGRLVQYRG: 서열번호 2)가 C 말단에 연결된 링커(20 A.A.)-SrtA(60-206)-CHL 링커(32 A.A.)를 코딩하는 DNA 서열을 프라이머 15, 24 및 상기 PCR 산물 (링커(20 A.A.)-SrtA(60-206)-CHL(TRA-)) 및 CHL 링커(32 A.A.) (TRARLSKELQAAQARLGADMEDVCGRLVQYRG: 서열번호 2)의 혼합물을 이용하여 overlapping PCR로 증폭하였다.
프라이머 15 및 프라이머 25(5’- CGG ATC ACC CTT GAC CTC GGT AGC GAC AAA GAT CTT -3’: 서열번호 44)를 이용하여 링커(20 A.A.) (SSGGGGSGGGGGGSSRSSGS: 서열번호 11)가 N 말단에 연결되고 AH 링커(45 A.A.)의 N 말단의 KEQ-를 코딩하는 DNA 서열을 증폭하고 프라이머 26 (5’- GAG GTC AAG GGT GAT CCG AAA GCT GAC AAC AAA TTC-3’: 서열번호 45) 및 프라이머 27 (5’- GTG ATG ATG ATG ATG GTG AGC TTT TGG TGC TTG TGC ATC AT-3’: 서열번호 46)을 이용하여 pIG20 vector를 template로 사용하여 AH 링커를 증폭하였다. AH 링커(45 A.A.) (KEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSAN LLAEAKKL: 서열번호 3)가 C 말단에 연결된 링커(20 A.A.)-SrtA(60-206)-AHL 링커(45 A.A.)를 코딩하는 DNA 서열을 프라이머 15, 프라이머 28(5’- TAA T GC GGC CGC TTA ATG ATG GTG ATG GTG ATG ATG ATG ATG GTG AGC TTT TGG-3’: 서열번호 47) 및 상기 PCR 산물 (링커(20 A.A.)-SrtA(60-206)-AHL(KEQ-)) 및 AHL 링커(45 A.A.) (KEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKL:서열번호 3)의 혼합물을 이용하여 overlapping PCR로 증폭하였다.
마지막으로, target(VL)-LPETG-링커(7 A.A.)-Sortase-H9 (도 1의 II)을 프라이머 8, 프라이머 12 및 상기 PCR 산물 (target-LPETG-링커(7 A.A.) 및 링커(7 A.A.)-SrtA)의 혼합물을 이용하여 overlapping PCR로 증폭하였다.
target(VL)-LPETG-링커(18 A.A.)-Sortase-H9 (도 1의 III)을 코딩하는 유전자를 프라이머 8, 프라이머 14 및 상기 PCR 산물 (target-LPETG-링커(18 A.A.) 및 링커(18 A.A.)-SrtA)의 혼합물을 이용하여 overlapping PCR로 증폭하였다.
target(VL)-LPETG-링커(20 A.A.)-Sortase-H9 (도 1의 IV)을 코딩하는 유전자를 프라이머 8, 프라이머 14 및 상기 PCR 산물 (target-LPETG-링커(20 A.A.) 및 링커(20 A.A.)-SrtA)의 혼합물을 이용하여 overlapping PCR로 증폭하였다.
target(VL)-LPETG-링커(20 A.A.)-Sortase-링커(7 A.A.)-H9 (도 2의 I)을 코딩하는 유전자를 프라이머 8, 프라이머 17 및 상기 PCR 산물 (target-LPETG-링커(20 A.A.) 및 링커(20 A.A.)-SrtA-링커(7 A.A.))의 혼합물을 이용하여 overlapping PCR로 증폭하였다.
target(VL)-LPETG-링커(20 A.A.)-Sortase-(H4)2L 링커(50 A.A.)-H9 (도 2의 II)을 코딩하는 유전자를 프라이머 8, 프라이머 19 및 상기 PCR 산물 (target-LPETG-링커(20 A.A.) 및 링커(20 A.A.)-SrtA-(H4)2L 링커(50 A.A.))의 혼합물을 이용하여 overlapping PCR로 증폭하였다.
target(VL)-LPETG-링커(20 A.A.)-Sortase-CHL 링커(32 A.A.)-H9 (도 3의 I)을 코딩하는 유전자를 프라이머 8, 프라이머 24 및 상기 PCR 산물 (target-LPETG-링커(20 A.A.) 및 링커(20 A.A.)-SrtA-CHL 링커(32 A.A.))의 혼합물을 이용하여 overlapping PCR로 증폭하였다.
target(VL)-LPETG-링커(20 A.A.)-Sortase-AHL 링커(45 A.A.)-H9 (도 3의 II)을 코딩하는 유전자를 프라이머 8, 프라이머 28 및 상기 PCR 산물 (target-LPETG-링커(20 A.A.) 및 링커(20 A.A.)-SrtA-AHL 링커(45 A.A.))의 혼합물을 이용하여 overlapping PCR로 증폭하였다.
결과로 나온 DNA 단편을 NdeI 및 NotI으로 절단하고, 융합 단백질인 target-LPETG-다른 링커-Sortase-R9, target-LPETG-다른 링커-Sortase-H6, 또는 target-LPETG-다른 링커-Sortase-H9을 발현하는 벡터인 pET23a 벡터 (Novagen)으로 라이게이션하였다.
융합 단백질인 target-LPETG-다른 링커-Sortase-R9, target-LPETG-다른 링커-Sortase-H6, 또는 target-LPETG-다른 링커-Sortase-H9은 표적 및 LPETG-다른 링커-Sortase-R9, LPETG-다른 링커-Sortase-H6, 또는 LPETG-다른 링커-Sortase-H9을 코딩하는 서열 사이에 HindIII site가 있다. 그 후, 발현을 위해서, 모든 유전자 작제물을 NdeI 및 HindIII로 절단하고, pET23a-LPETG-다른 링커-Sortase-R9, pET23a-LPETG-다른 링커-Sortase-H6, 또는 pET23a-LPETG-다른 링커-Sortase-H9에 라이게이션하였다.
실시예 2: 수용성 발현 확인
모든 발현 실험은 E. coli Origami2(DE3) 또는 BL21(DE3)을 이용하여 수행하였다. 100 ㎎/ℓ의 암피실린 및 0.5％ (w/v)의 글루코스를 포함하는 dYT 배지 (30㎖)에 단일 박테리아 콜로니를 접종하고, 37℃에서 밤새 배양하였다. LB, SB, 또는 dYT medium (100 ㎎/ℓ의 암피실린, 50 mM K2HPO4) 0.3ℓ에 전 배양 (preculture)를 접종하고 37℃에서 배양하였다 (배플이 있는 1ℓ플라스크, 1ℓ flask with baffles, 200 rpm). OD600 값이 0.6일때 IPTG를 최종 농도 0.5 mM이 되도록 첨가하여 발현을 유도하였다. 배양을 18시간 동안 18℃에서 유지하였다. 세포를 원심분리로 수집하고 (10,000rpm, 10분, 4℃), 30 ㎖의 50 mM Tris-HCl (pH 8.0) 및 150 mM NaCl으로 현탁하고, 초음파 (sonication)로 파쇄하였다. 조추출을 원심분리하고 (10,000rpm, 30분, 4℃), 상등액을 0.2 mm 필터로 여과하고, 하기 실시예 3의 Ni FF 크로마토그래피에 직접 적용하였다.
실시예 3: Ni-NTA 정제
용해물의 상등액을 5 ㎖의 Ni-NTA (GE) 컬럼에 로딩하고, 20배 컬럼 부피의 버퍼 A (50 mM Tris-Cl, pH 8.0, 150 mM NaCl, 30 mM 이미다졸, 및 5mM BME)로 세척 후, 5배 컬럼 부피의 버퍼 B (50 mM Tris-Cl, pH 8.0, 150 mM NaCl)로 세척하였다. 세척 후, 단백질-결합 레진의 aliquote를 절단 버퍼 (5 mM CaCl2 및 5mM tri-Gly를 포함하는 버퍼 B)로 평형화시킨 후, 25℃에서 1시간 동안 반응시켰다.
해당 과정은 도 5 및 도 8에 나타낸 도식도와 같이 진행된다. 도 5는 도 1의 I의 기존 C 말단에 Sortase A를 결합시킨 융합 단백질을 정제하는 과정을 보여주고 있으며, 도 8은 본 발명의 N 말단에 Sortase A를 결합시킨 융합 단백질을 정제하는 과정을 보여주고 있다.
단백질 순도는 SDS-PAGE 겔을 코마시블루 염색법으로 분석하였다. 또한, 일부 샘플에 대해서 발현 및 정제 여부를 웨스턴 블랏팅으로 확인하였다.
실시예 4: Sortase 융합 단백질 발현 및 정제 확인
상기 융합 단백질들의 구조면에서 목적 단백질을 기준으로 전체 융합 단백질의 N 말단 또는 C 말단에 목적단백질이 연결된 경우, 정제 효율의 변화를 확인하였다.
도 1의 I에 해당하는 융합 단백질을 pET21b, pET23a, 및 pLIC에 삽입하여 얻은 발현벡터로 형질전환한 숙주세포(대장균, E.coli)로부터, 상기 실시예 2에 의해 수득한 세포 용해물에서 발현 여부를 확인하였다. 이를 실시예 3을 통해 Ni-NTA(GE) 컬럼에 결합시켜 정제를 하고, 컬럼에 결합한 상태로 있는 단백질을 확인하였다.
상기 발현 및 정제는 코마시블루 염색과 목적 단백질에 결합되어 있는 Myc 태그를 이용하여 웨스턴 블랏팅을 통해 확인하였다.
도 6에서 볼 수 있듯이, 융합 단백질은 벡터를 불문하고 잘 발현되고 있으며, 도 7에서 볼 수 있듯이 C 말단에 목적 단백질을 포함하는 융합 단백질은 컬럼에 결합하지 못했으며, 더불어 정제 활성도 거의 확인할 수 없었다(도 7의 B 5, 6 lane).
목적 단백질의 위치가 정체효율에 미치는 영향을 확인하기 위하여, 목적 단백질의 위치가 N 말단과 C 말단으로 상이한 경우에 융합 단백질 정제 효율을 비교하였다. 이는 실시예 2 및 실시예 3에 따른 실험을 통하여 확인하였다.
도 15에서 확인할 수 있듯이, C 말단에 목적 단백질이 위치하는 경우에는 절단된 단백질이 발견되지 않았다(Cleaved). 그에 비하여, N 말단에 목적 단백질이 위치하는 경우에는 절단된 단백질이 매우 높은 순도로 존재하는 것을 확인 할 수 있었다. 이는 각 경우에 LS lane 및 FT lane(flow through lane)의 비교와 컬럼에 잔존하는 단백질(bound protein)을 통하여 확인할 수 있듯이 C 말단에 목적 단백질이 위치하는 경우에는 융합 단백질이 컬럼에 거의 결합을 하지 못하는 것에 비하여, N 말단에 목적 단백질이 위치하는 경우에는 융합 단백질의 결합율이 매우 높으며 결합된 단백질은 거의 절단되는 것을 확인할 수 있다.
실시예 5: 링커 최적화 실험
5-1: 링커의 길이 최적화
도 1의 II 내지 IV에 해당하는 융합 단백질을 발현하는 벡터를 Origami2(DE3) 또는 BL21(DE3)에 형질전환하고 이를 LB, SB 또는 dYT 배지에서 배양하여 상기 실시예 2dml 방법을 통해 수득한 세포 용해물에서 발현 여부를 확인하였다. 이를 실시예 3에 개시된 바와 같이 Ni_NTA(GE) 컬럼에 결합시켜 정제를 하고, 컬럼에 결합한 상태로 있는 단백질을 확인하였다.
상기 발현 및 정제는 코마시블루 염색과 목적 단백질은 VH의 경우에는 HA 태그 항체, VL의 경우에는 myc 태그 항체를 이용한 웨스턴 블랏팅을 통해 확인하였다.
도 9에서 확인할 수 있듯이 숙주세포(Origami2 또는 BL21) 간에 차이를 보이지 않고 잘 발현되는 것을 확인하였다.
또한, 도 10에서 확인할 수 있듯이 세포를 배양하는 배양액 간에 큰 차이를 보이지 않고 융합 단백질이 잘 발현되는 것을 볼 수 있다(LS lane, Loading sample lane, 33 kDa 위치). 또한, 컬럼에 결합된 단백질은 거의 전부가 절단되었다(모든 BP lane(bound protein lane)에 33 kDa 밴드 없음).
한편, 링커의 길이를 달리하였는바, 7 A.A. 링커(GGSSRSS, 서열번호 5), 및 18 A.A. 링커(SSGGGGSGGGGGGSSRSS, 서열번호 6)에서는 태그가 제거된 단백질(CP lane, cleaved protein lane, 15 kDa 위치)이 미약하게 존재하는 것을 확인할 수 있다. 반면, 20 A.A. 링커(SSGGGGSGGGGGGSSRSSGS, 서열번호 7)에서 태그가 제거된 단백질이 높은 순도로 다량 수득되는 것을 확인할 수 있다.
20 A.A. 링커를 포함하는 단백질이 7 A.A. 또는 18 A.A. 링커를 포함하는 단백질보다 목적단백질의 수득율이 현저히 높은 것의 원인으로, 먼저 발현량을 비교해 보면(LS lane), 7 A.A. 링커를 포함하는 경우에 비해서는 융합 단백질이 과발현되는 정도가 높은 것으로 확인되지만 18 A.A. 링커를 포함하는 경우는 발현 자체는 20 A.A. 링커를 포함하는 경우와 거의 차이가 없이 과발현이 일어나는 것을 확인할 수 있다. 그에 반하여, 각 경우에 LS lane 및 FT lane(flow through lane)을 비교하면 알 수 있듯이, 오직 20 A.A.의 경우에 두껍게 과발현된 융합 단백질(약 33kDa)의 밴드가 컬럼을 지나면서 FT lane에서는 사라지는 것으로 보아 융합 단백질이 컬럼에 부착되는 비율이 현저히 높은 것을 확인할 수 있었다. 이는 컬럼에 남은 태그를 포함하는 제거된 단백질 부분(BP lane, Bound protein lane, 20 kDa 위치)이 20 A.A.에서 현저히 높은 것을 통해서도 확인할 수 있었다.
이에 따라, 링커 20 A.A.가 자가절단 부위와 Sortase 사이에 삽입되는 구조가 목적단백질의 수득율을 현저히 높인다는 것을 확인하였다.
5-2: 링커의 추가에 따른 수득율 변화 여부
링커가 Sortase A 도메인의 N 말단 부분 말고도 C 말단 부분에도 존재할 경우 수득율에 변화가 있는지를 확인하기 위하여 Sortase A 도메인과 His 태그 사이에 링커를 추가로 삽입한 융합 단백질을 이용하여 비교하였다.
도 13에서는 (1) 목적 단백질(VH)-HA-LPETG-링커(20 A.A.)-Sortase A-His6의 구조를 갖는 융합 단백질을 발현하는 벡터로 형질전환한 경우와 (2) 목적 단백질(VH)-HA-LPETG-링커(20 A.A.)-Sortase A-링커(7 A.A.)-His6의 구조를 갖는 융합 단백질을 발현하는 벡터로 형질전환한 경우를 비교하였다.
(1)과 (2)의 차이는 Sotase A 뒤에 링커(7 A.A., GGSSRSS)의 유무의 차이이다. 두 융합 단백질의 발현, 및 컬럼 결합 정도는 코마시블루 염색을 통하여 확인하였다.
도 13에서 확인할 수 있듯이 1 또는 2의 경우에 모두 융합 단백질 부분(33kDa)에 강한 밴드가 생기는 것을 확인할 수 있었다. 그러나 1의 경우에는 미약하게나마 컬럼에 결합하는 것을 확인할 수 있으나(Bound proteins) 비교되는 2의 컬럼에 결합한 단백질은 거의 찾아볼 수 없었다. 즉, Sortase A의 C 말단에 링커(7 A.A.)를 추가하는 것은 융합 단백질의 컬럼 결합을 방해하였다.
5-3: 링커의 교체
상기 글리신(Glycine)과 세린(Serine) 다수와 하나의 알기닌(Arginine)으로 이루어진 링커들을 도메인 간에 간섭을 줄일 수 있는 여러 종류의 링커로 교체하여 이로 인한 컬럼 결합율 또는 수득율을 확인하였다.
먼저, 나선형 링커(helical linker)로 교체하였다. 나선형 링커는 A(EAAK)nA (n=2-5)의 일반식을 가지는 것을 사용하였으며, 특히 n이 4인 (H4)2 링커(LEA(EAAAK)4ALEA(EAAAK)4ALE, 50 A.A., 서열번호 1)를 이용하여 도 2의 Ⅰ및 II의 구조를 갖는 융합 단백질을 발현하여 결합율을 확인하였다.
도 12에서 볼 수 있듯이, 해당 융합 단백질은 과발현은 일어났으나 컬럼에 거의 결합하지 않는 것을 확인할 수 있다. 이를 통하여 해당 융합 단백질에 사용된 나선형 링커는 결합율을 증가시키는 효과를 가지지 못한 것으로 확인되었다.
다음으로 양전하성 링커(CHL, TRARLSKELQAAQARLGADMEDVCGRL VQYRG, 서열번호 2) 또는 음전하성 링커(AHL, KEQQNAFYEILHLPNLNEE QRNGFIQSLKDDPSQSANLLAEAKKL, 서열번호 3)로 교체하였다. 이들을 이용한 융합 단백질의 구조는 도 3의 I 및 II에 도식화되어 있다. 두 융합 단백질의 결합율 및 수득율을 확인하였다.
도 14에서 볼 수 있듯이, 해당 두 융합 단백질 중에서 양전하성 링커를 포함하는 경우에는(CHL, 도 14의 A), 발현이 매우 미약하게 이루어졌으며 컬럼에 결합하는 단백질은 거의 없었다. 반면, 음전하성 링커를 포함하는 경우에는(AHL, 도 14의 B), 어느 정도 과발현이 이루어졌으며, 컬럼에도 일정량 결합하는 것으로 보이나 절단된 단백질(Cleavage)이 거의 없는 것을 확인하였다. 이를 통하여 해당 융합 단백질에 사용된 전하성 링커는 결합율 또는 수득율을 증가시키는 충분한 효과를 가지지 못한 것으로 확인되었다.
실시예 6: 절단 반응 최적 조건화
솔테이즈 A가 절단 서열(LPXTG)를 인식하여 절단 기능을 하기 위해서는 칼슘 및/또는 트리글라이신(triglycine)이 있어야 하는 것으로 알려져 있다. 본 발명에서는 절단 반응의 최적 조건을 확인하기 위하여, 칼슘 또는 트리글라이신의 유무와 농도 조건을 달리하여 절단 단백질 수득율을 확인하였다.
구체적으로는, 칼슘과 트리글라이신중 하나의 농도를 5 mM로 고정하고 나머지 하나를 0, 0.2, 1, 5 mM의 농도로 혼합한 절단-버퍼에 의한 절단 단백질 수득율을 둘 모두를 넣지 않은 음성 대조군과 비교하였다.
도 11에서 확인할 수 있듯이, 음성 대조군에서는 절단 단백질을 전혀 관찰할 수 없었고(약 15 kDa), 둘 중 하나라도 들어간 경우에는 절단 단백질을 관찰할 수 있었다. 다만, 트리글라이신 5 mM을 포함하고 칼슘의 농도를 0 내지 5 mM로 조절한 경우에는 수득되는 절단 단백질의 양이 차이가 거의 없는데에 비하여, 칼슘 5 mM을 포함하고 트리글라이신의 농도를 0 내지 5 mM로 조절한 경우에는 트리글라이신을 포함하지 않은 경우에 절단 단백질이 적게 수득되는 것을 확인할 수 있다(도 11의 B). 그러나, 일단 트리글라이신이 들어간 경우에는 수득되는 절단 단백질의 양이 차이가 거의 없었다.
이는 곧, 절단-버퍼에 포함된 트리글라이신이 솔테이즈의 절단 기능에 중요한 역할을 한다는 것을 의미하며, 농도 차이는 큰 의미를 지니지 않음을 의미한다.
실시예 7: 치료용항체-약물 결합체 제조의 최적화
7-1: 농도 최적화
본 실시예에서는 효율적인 약물의 접합에 필요한 트리글라이신의 최적 농도조건을 확립하였다. 약물로는 트리글라이신이 융합된 비오틴을 사용하였고, 그 농도를 각각 0, 10nM, 100nM, 500nM, 1μM, 10μM, 100μM, 500μM, 1mM로 반응버퍼(50mM Tris 버퍼, pH8.0/ 150mM NaCl/ 5mM CaCl2)와 혼합하여 반응시킨 후, 목적 단백질과 비오틴의 접합을 음성대조군과 비교하였다. 음성대조군은 세가지 조건(1: 50mM Tris 버퍼, pH8.0/ 2: 50mM Tris 버퍼, pH8.0+500μM 트리글라이신-비오틴/ 3: 반응버퍼)을 사용하였다. 목적 단백질-비오틴의 접합반응은 웨스턴 블롯을 이용하여 목적 단백질에 결합되어 있는 Myc 태그를 이용하여 목적 단백질의 총 농도를 확인하였으며, 스트렙타아비딘을 이용하여 목적 단백질과 비오틴의 접합반응도를 확인하였다.
그 결과, 세가지 조건의 음성대조군에서는 목적 단백질과 비오틴의 접합(약 45kDa)이 전혀 관찰되지 않았고, 500μM 및 1mM의 트리글라이신-비오틴의 농도에서 포화된 접합반응을 관찰할 수 있었으며, 100μM의 트리글라이신-비오틴의 농도에서 많은 양의 접합반응을 관찰 할 수 있었으나, 500μM 및 1mM의 농도에서 보다는 반응도가 낮음을 확인할 수 있었다(도 16A).
7-2: 반응시간 최적화
상기 실시예 7-1에서 확립된 트라이글라이신-비오틴의 농도를 이용하여 최적 반응시간 조건을 분석하였다. 목적 단백질의 농도는 500μM 및 1mM의 두가지 농도로 고정하고, 시간을 0, 30분, 1, 2, 3, 4, 6시간 및 16시간으로 반응시킨 후, 목적 단백질과 비오틴의 접합을 음성대조군과 비교하였다.
실시예 7-1과 같이 웨스턴 블롯으로 분석한 결과, 음성대조군에서는 목적 단백질과 비오틴의 접합이 관찰되지 않았고, 500μM 트라이글라이신-비오틴의 농도에서는 4~6시간에서 많은 양의 접합반응이 관찰되었으며 16시간 접합반응에서 가장 좋은 효율을 나타냈다. 또한, 1mM 트라이글라이신-비오틴의 농도에서는 4~6시간 및 16시간 접합반응에서 모두 우수한 접합 효율을 확인할 수 있었다(도 16B)
상기 결과들을 종합하면, 목적 단백질-LPETG-링커(20 A.A.)-Sortase-태그의 구조를 가지는 융합 단백질이 우수한 컬럼 결합력 및 우수한 Sortase A 자가 절단 활성으로 매우 높은 수득율을 가진다는 것을 알 수 있으며, 이를 이용한 치료용항체-약물 결합체를 제조한 것을 알 수 있다.
본 발명은 솔테이즈 A 절단 기능 도메인과 이의 인식 서열인 LPXTG의 아미노산 서열로 구성되는 펩타이드로 이루어진 자가 절단 카세트를 포함하는 자가 절단 융합 단백질에 관한 것으로, 목적 단백질의 정제 및 태그 제거 과정을 별도의 과정이 아닌 한 번의 정제 과정으로 완료할 수 있다는 점에서 매우 유용하다. 특히, 목적 단백질의 위치가 아미노 말단에 존재함으로써 융합 단백질의 컬럼 결합 능력과 자가 절단 능력을 높인 점, 태그가 제거된 목적 단백질을 고순도로 얻을 수 있는 점, 절단-버퍼를 통해 정제 및 태그 제거 과정이 한 번의 과정으로 완료되어 정제에 필요한 시간 및 노력이 획기적으로 감소되는 점, 및 한 번의 단계로 이루어지기 때문에 수득 단백질의 손실이 감소되는 점에서 고순도 및 대량의 단백질이 필요한 다양한 분야에서 널리 이용될 수 있다. 특히, 치료용항체-약물 결합체 제조에 유용하다.
전자파일 첨부하였음.

Claims (33)

  1. (i) 목적 단백질;
    (ii) 서열식 I의 펩타이드;
    (iii) 솔테이즈 A(Sortase A) 절단 기능 도메인; 및
    (iv) 태그를 포함하는 융합 단백질로서, 상기 (i) 내지 (iv)는 융합 단백질
    의 아미노 말단으로부터 카복실 말단 순서로 존재하는 것인 융합 단백질:
    서열식 I
    L-P-X-T-G
    상기 서열식 I에서 L은 류신(Leucine)이고, P는 프롤린(Proline)이며, X는
    임의의 아미노산이고, T는 트레오닌(Threonine)이며, G는 글리신(Glycine)인 것이다.
  2. 제1항에 있어서, 상기 자가 절단 융합 단백질은 추가로 LPXTG 아미노산 서열로 이루어지는 펩타이드와 솔테이즈 A 절단 기능 도메인 사이에 펩타이드 링커를 포함하는 것인, 자가 절단 융합 단백질.
  3. 제1항에 있어서, 상기 X는 글루탐산(Glutamic Acid)인 것인, 자가 절단 융합 단백질.
  4. 제2항에 있어서, 상기 펩타이드 링커는 천연 링커, 가요성 링커(flexible
    linker), 나선형 링커(helical linker), 양전하성 링커, 음전하성 링커, 및 coiled coil 링커로 이루어진 군으로부터 선택되는 것인, 자가 절단 융합 단백질.
  5. 제2항에 있어서, 상기 펩타이드 링커는 Sa(SG4)n(GGSSRSS)GbSc의 아미노산 서열로 이루어진 것으로, 상기 Sa(SG4)n(GGSSRSS)GbSc의 아미노산 서열에서 S는 세린(Serine), G는 글라이신(Glycine), R은 알기닌(Arginine)이고, a는 0 내지 5이고, b는 0 내지 5 이며, c는 0 내지 5이고, n은 0 내지 10인 것인, 자가 절단 융합 단백질.
  6. 제2항에 있어서, 상기 펩타이드 링커는 19개 내지 40개 아미노산으로 이루어진 것인 자가 절단 융합 단백질.
  7. 제6항에 있어서, 상기 펩타이드 링커는 19개 내지 25개 아미노산으로 이루어진 것인 자가 절단 융합 단백질.
  8. 제2항에 있어서, 상기 펩타이드 링커는 서열번호 7인 아미노산 서열로 구성되는 것인 자가 절단 융합 단백질.
  9. 제1항에 있어서, 상기 솔테이즈 A는 스타필로코커스 아우레우스(Staphylococcus aureus, S.aureus) 유래 솔테이즈 A인 것인 자가 절단 융합 단백질.
  10. 제1항에 있어서, 상기 솔테이즈 A는 서열번호 8인 아미노산 서열로 구성되는 것인 자가 절단 융합 단백질.
  11. 제1항에 있어서, 상기 태그는 폴리 히스티딘 태그(poly-histidine tag), GST 태그(glutathione-S-transferase tag), HA 태그(Hemagglutinin tag), FLAG 태그, Myc 태그, 말토오스 결합 단백질 태그(maltose binding protein tag), 키틴 결합 단백질 태그(Chitin binding protein tag) 및 형광 태그로 이루어진 군 중에서 선택된 것인 자가 절단 융합 단백질.
  12. 제11항에 있어서, 상기 태그는 폴리 히스티딘 태그인 것인 자가 절단 융합 단백질.
  13. 제12항에 있어서, 상기 폴리 히스티딘 태그는 연속된 히스티딘 6 내지 12개 아미노산으로 이루어진 것인 자가 절단 융합 단백질.
  14. 제1항에 있어서, 상기 목적 단백질은 고분자 단백질, 당 단백질, 사이토카인, 성장인자, 혈액제제, 백신, 호르몬, 효소 및 항체로 이루어진 군에서 선택된 것인, 자가 절단 융합 단백질.
  15. 제1항에 있어서, 상기 목적 단백질은 항체의 경쇄 또는 중쇄의 전부 또는 일부분인 것인 자가 절단 융합 단백질.
  16. 제15항에 있어서, 상기 목적 단백질은 항체의 경쇄 가변영역 또는 중쇄 가변 영역인 것인 자가 절단 융합 단백질.
  17. 제1항에 있어서, 상기 자가 절단 융합 단백질은 서열번호 17 또는 18인 아미노산 서열로 구성되는 것인 자가 절단 융합 단백질.
  18. 제1항 내지 제17항의 융합 단백질을 코딩하는 뉴클레오티드 서열을 포함하는 핵산.
  19. 제18항의 핵산을 포함하는 발현벡터.
  20. 제19항의 발현벡터로 형질전환된 세포.
  21. 제20항에 있어서, 상기 세포는 진핵 세포 또는 원핵 세포인 것인 형질전환된 세포.
  22. 제21항에 있어서, 상기 세포는 대장균(Escherichia coli)인 것인 형질전환된 세포.
  23. 제22항에 있어서, 상기 대장균은 Origami2(DE3) 또는 BL21(DE3)인 것인 형질전환된 세포
  24. (1) 제20항의 세포를 배양하여 세포 용해물을 얻는 단계;
    (2) 세포 용해물로부터 목적 단백질을 정제하는 단계를 포함하는 목적 단백질의 정제방법.
  25. 제24항에 있어서, 상기 (2) 정제하는 단계는,
    (a) 세포 용해물을 융합 단백질에 존재하는 태그와 결합하는 컬럼에 주입하는 단계;
    (b) 컬럼을 세척하는 단계;
    (c) 칼슘 및 트리글라이신으로 이루어진 군 중에서 선택된 하나 이상을 포함하는 절단-버퍼로 평형화시키고 절단 반응시키는 단계;
    (d) 절단-버퍼를 수득하여 태그가 제거된 목적 단백질을 수득하는 단계로 이루어진 목적 단백질의 정제방법.
  26. 제25항에 있어서, 상기 (c) 단계에서 절단-버퍼는 적어도 트리글라이신을 포함하는 것인 목적 단백질의 정제방법.
  27. 제25항에 있어서, 상기 (c) 단계에서 절단-버퍼는 칼슘 0.1 내지 10 mM 및 트리글라이신 0.1 내지 10 mM을 포함하는 것인 목적 단백질의 정제방법.
  28. 제27항에 있어서, 상기 (c) 단계에서 절단-버퍼는 칼슘 0.2 내지 5 mM 및 트리글라이신 0.2 내지 5 mM을 포함하는 것인 목적 단백질의 정제방법.
  29. (1) 제1항의 융합 단백질과 트리글라이신-약물(GGG-drug)을 칼슘을 포함하는 절단-버퍼 내에서 반응시켜 목적 단백질에 트리글라이신-약물(GGG-drug)을 접합시키는 단계;
    (2) 절단-버퍼를 수득하여 태그가 제거된 목적 단백질과 트리글라이신-약물(GGG-drug) 접합체를 수득하는 단계를 포함하는 치료용항체-약물 결합체의 제조방법.
  30. 제29항에 있어서, 상기 (1) 단계에서 절단-버퍼는 칼슘 0.1 내지 10 mM을 포함하는 것인 치료용항체-약물 결합체의 제조방법.
  31. 제29항에 있어서, 상기 (1) 단계에서 트리글라이신-약물(GGG-drug)을 500 nM 내지 1 mM을 포함하는 것인 치료용항체-약물 결합체의 제조방법.
  32. 제29항에 있어서, 상기 (1) 단계에서 접합시키는 시간은 3 내지 16 시간인 것을 특징으로하는 치료용항체-약물 결합체의 제조방법.
  33. 제29항에 있어서, 상기 목적 단백질은 암세포 표면 항원에 대한 항체인 것을 특징으로 하는 치료용항체-약물 결합체의 제조방법.
PCT/KR2014/003639 2013-04-25 2014-04-25 자가 절단 카세트를 포함하는 단백질 정제방법 및 이의 용도 WO2014175690A1 (ko)

Priority Applications (12)

Application Number Priority Date Filing Date Title
CN201480033267.9A CN105339391B (zh) 2013-04-25 2014-04-25 包括自切割盒的蛋白质的精制方法及其应用
US14/785,881 US10077299B2 (en) 2013-04-25 2014-04-25 Method for refining protein including self-cutting cassette and use thereof
SG11201508732PA SG11201508732PA (en) 2013-04-25 2014-04-25 Method for refining protein including self-cutting cassette and use thereof
EP14787873.0A EP2990423B1 (en) 2013-04-25 2014-04-25 Method for refining protein including self-cutting cassette and use thereof
CA2909513A CA2909513C (en) 2013-04-25 2014-04-25 Method for refining protein including self-cutting cassette and use thereof
KR1020157030691A KR101808223B1 (ko) 2013-04-25 2014-04-25 자가 절단 카세트를 포함하는 단백질 정제 방법 및 이의 용도
AU2014258109A AU2014258109B2 (en) 2013-04-25 2014-04-25 Method for refining protein including self-cutting cassette and use thereof
NZ713602A NZ713602A (en) 2013-04-25 2014-04-25 Method for refining protein including self-cutting cassette and use thereof
JP2016510621A JP6176392B2 (ja) 2013-04-25 2014-04-25 自己切断カセットを含むタンパク質精製方法及びこれの用途
RU2015150335A RU2639527C2 (ru) 2013-04-25 2014-04-25 Способ очистки белка, включенного в саморасщепляющуюся кассету, и его применение
IL242147A IL242147B (en) 2013-04-25 2015-10-18 Method for refining protein including self-cutting cassette and use thereof
US16/100,080 US20190077846A1 (en) 2013-04-25 2018-08-09 Method for refining protein including self-cutting cassette and use thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20130046322 2013-04-25
KR10-2013-0046322 2013-04-25

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/785,881 A-371-Of-International US10077299B2 (en) 2013-04-25 2014-04-25 Method for refining protein including self-cutting cassette and use thereof
US16/100,080 Division US20190077846A1 (en) 2013-04-25 2018-08-09 Method for refining protein including self-cutting cassette and use thereof

Publications (1)

Publication Number Publication Date
WO2014175690A1 true WO2014175690A1 (ko) 2014-10-30

Family

ID=51792155

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2014/003639 WO2014175690A1 (ko) 2013-04-25 2014-04-25 자가 절단 카세트를 포함하는 단백질 정제방법 및 이의 용도

Country Status (12)

Country Link
US (2) US10077299B2 (ko)
EP (1) EP2990423B1 (ko)
JP (1) JP6176392B2 (ko)
KR (1) KR101808223B1 (ko)
CN (1) CN105339391B (ko)
AU (1) AU2014258109B2 (ko)
CA (1) CA2909513C (ko)
IL (1) IL242147B (ko)
NZ (1) NZ713602A (ko)
RU (1) RU2639527C2 (ko)
SG (1) SG11201508732PA (ko)
WO (1) WO2014175690A1 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109072212A (zh) * 2016-03-30 2018-12-21 豪夫迈·罗氏有限公司 改善的分选酶

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2777714A1 (en) 2013-03-15 2014-09-17 NBE-Therapeutics LLC Method of producing an immunoligand/payload conjugate by means of a sequence-specific transpeptidase enzyme
JP6895953B2 (ja) 2015-09-25 2021-06-30 エフ．ホフマン−ラ ロシュ アーゲーＦ． Ｈｏｆｆｍａｎｎ−Ｌａ Ｒｏｃｈｅ Ａｋｔｉｅｎｇｅｓｅｌｌｓｃｈａｆｔ ソルターゼａを利用してチオエステルを作製するための方法
JP6998863B2 (ja) 2015-09-25 2022-02-04 エフ．ホフマン－ラ ロシュ アーゲー 深共融溶媒におけるソルターゼａを利用したアミド基転移
EP3353291B1 (en) 2015-09-25 2021-06-09 F. Hoffmann-La Roche AG Novel soluble sortase a
AU2019265699A1 (en) * 2018-05-08 2021-01-07 Amgen Inc. Bispecific antibodies with cleavable C-terminal charge-paired tags
JP7416715B2 (ja) * 2018-11-07 2024-01-17 公益財団法人川崎市産業振興財団 ペプチド－核酸複合体
CN110357970A (zh) * 2019-07-10 2019-10-22 杭州纽龙日尚生物制品有限公司 一种易于纯化的人表皮生长因子融合蛋白及其核酸分子、一种人表皮生长因子制备方法
KR20240043837A (ko) * 2022-09-27 2024-04-04 크리포 주식회사 정제 태그와 알파-나선 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2009055837A (ja) * 2007-08-31 2009-03-19 Shionogi & Co Ltd タンパク質の固定化方法
US20090088372A1 (en) * 2006-03-22 2009-04-02 National Institute Of Immunology Novel Bioconjugates As Therapeutic Agent and Synthesis Thereof

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AT410798B (de) * 2001-01-26 2003-07-25 Cistem Biotechnologies Gmbh Verfahren zur identifizierung, isolierung und herstellung von antigenen gegen ein spezifisches pathogen
US20070148166A1 (en) * 2002-05-13 2007-06-28 Wu Madeline C S Scfvs in photosynthetic microbes
WO2005051976A2 (en) * 2003-11-20 2005-06-09 Ansata Therapeutics, Inc. Protein and peptide ligation processes and one-step purification processes
US8940501B2 (en) * 2009-01-30 2015-01-27 Whitehead Institute For Biomedical Research Methods for ligation and uses thereof
US20120282670A1 (en) * 2009-11-04 2012-11-08 Alnylam Pharmaceuticals, Inc. Compositions and methods for enhancing production of a biological product
CN103764665A (zh) 2011-06-28 2014-04-30 怀特黑德生物医学研究所 使用分选酶安装用于蛋白质连接的点击化学柄
US10309969B2 (en) * 2013-01-24 2019-06-04 Abtlas Co., Ltd. Protein combination-based FV library, and preparation method therefor
US9631218B2 (en) 2013-03-15 2017-04-25 The Trustees Of The University Of Pennsylvania Sortase-mediated protein purification and ligation
EP2777714A1 (en) 2013-03-15 2014-09-17 NBE-Therapeutics LLC Method of producing an immunoligand/payload conjugate by means of a sequence-specific transpeptidase enzyme

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090088372A1 (en) * 2006-03-22 2009-04-02 National Institute Of Immunology Novel Bioconjugates As Therapeutic Agent and Synthesis Thereof
JP2009055837A (ja) * 2007-08-31 2009-03-19 Shionogi & Co Ltd タンパク質の固定化方法

Non-Patent Citations (7)

* Cited by examiner, † Cited by third party
Title
ANTOS, J. M. ET AL.: "Lipid modification of proteins through sortase-catalyzed transpeptidation.", J. AM. CHEM. SOC., vol. 130, no. 48, 3 December 2008 (2008-12-03), pages 16338 - 16343, XP008152225 *
ANTOS, J. M. ET AL.: "Site-specific N- and C-terminal labeling of a single polypeptide using sortases of different specifcity.", J. AM. CHEM. SOC., vol. 131, no. 31, 12 August 2009 (2009-08-12), pages 10800 - 10801, XP055070582 *
DATABASE GENBANK [online] 10 October 2012 (2012-10-10), ILANGOVAN, U. ET AL.: "Structure Of Sortase", XP055288250, retrieved from NCBI Database accession no. 1IJA_A *
KOBASHIGAWA, Y. ET AL.: "Attachment of an NMR-invisible solubility enhancement tag using a sortase-mediated protein ligation method.", J. BIOMOL. NMR., vol. 43, no. 3, 13 January 2009 (2009-01-13), pages 145 - 150, XP019680283 *
MAO H ET AL., PROTEIN EXPR. PURIF, vol. 37, no. 1, 2004, pages 253 - 63
MAO, H.: "A self-cleavable sortase fusion for one-step purification of free recombinant proteins.", PROTEIN EXPR. PURIF., vol. 37, no. 1, September 2004 (2004-09-01), pages 253 - 263, XP004523963 *
PROFT, T.: "Sortase-mediated protein ligation: an emerging biotechnology tool for protein modification and immobilisation.", BIOTECHNOL. LETT., vol. 32, no. 1, 1 September 2009 (2009-09-01), pages 1 - 10, XP019766760 *

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109072212A (zh) * 2016-03-30 2018-12-21 豪夫迈·罗氏有限公司 改善的分选酶
US10900026B2 (en) 2016-03-30 2021-01-26 Hoffmann-La Roche Inc. Sortase
CN109072212B (zh) * 2016-03-30 2022-10-04 豪夫迈·罗氏有限公司 改善的分选酶
US11572552B2 (en) 2016-03-30 2023-02-07 Hoffmann-La Roche Inc. Sortase

Also Published As

Publication number Publication date
NZ713602A (en) 2016-09-30
US20160137720A1 (en) 2016-05-19
CA2909513C (en) 2018-10-09
US20190077846A1 (en) 2019-03-14
CN105339391A (zh) 2016-02-17
KR101808223B1 (ko) 2017-12-13
RU2015150335A (ru) 2017-05-31
CN105339391B (zh) 2021-01-01
EP2990423B1 (en) 2018-04-18
RU2639527C2 (ru) 2017-12-21
EP2990423A1 (en) 2016-03-02
CA2909513A1 (en) 2014-10-30
AU2014258109B2 (en) 2016-09-29
US10077299B2 (en) 2018-09-18
JP6176392B2 (ja) 2017-08-09
AU2014258109A1 (en) 2015-11-12
EP2990423A4 (en) 2016-10-26
SG11201508732PA (en) 2015-11-27
KR20160007509A (ko) 2016-01-20
JP2016519118A (ja) 2016-06-30
IL242147B (en) 2019-03-31

Similar Documents

Publication Publication Date Title
WO2014175690A1 (ko) 자가 절단 카세트를 포함하는 단백질 정제방법 및 이의 용도
AU2014230129B2 (en) Method of producing an immunoligand/payload conjugate by means of a sequence-specific transpeptidase enzyme
KR950000299B1 (ko) 융합 단백질의 제조방법
EP2075336B1 (en) Purification of recombinant proteins fused to multiple epitopes
Roy et al. Expressed protein ligation to probe regiospecificity of heterocyclization in the peptide antibiotic microcin B17
Liu et al. Single-step purification of recombinant proteins using elastin-like peptide-mediated inverse transition cycling and self-processing module from Neisseria meningitides FrpC
JPS59162887A (ja) 生長ホルモン放出因子ｇｒｆコ−ド構造遺伝子を含有する二本鎖ポリデオキシニユクレオチド
KR20210094895A (ko) 신규 펩타이드 태그, 이에 결합하는 항체 및 이들의 용도
CA3087218C (en) Biological synthesis of amino acid chains for preparation of peptides and proteins
WO2019231208A1 (ko) 폴리유비퀴틴 링커에 결합된 선형 다기능성 멀티머 생체분자 및 이의 용도
Groothuys et al. Chemoenzymatic synthesis of triazole-linked glycopeptides
WO2014014207A1 (en) Antibody for epitope tagging, hybridoma cell line and uses thereof
WO2020139031A1 (ko) Crispr-cas를 기반으로 하는 유전자 교정용 조성물
JPH10127295A (ja) リシントキシン
WO2023153761A1 (ko) 당사슬이 절단된 신규 항체를 유효성분으로 포함하는 암의 예방 또는 치료용 조성물
WO2024090815A1 (ko) 식물로부터 인유두종 바이러스 유사 입자의 생산
WO2021125917A1 (ko) Whep 도메인 융합에 의한 목적 단백질의 수용성 증진 방법
WO2020141930A1 (ko) 피에이치 의존적 막 투과성 펩타이드를 이용한 약물 운반체 및 그것과 약물의 복합체
WO2021045292A1 (ko) Crm197 단백질 발현 방법
RU1438240C (ru) РЕКОМБИНАНТНАЯ ПЛАЗМИДНАЯ ДНК РТNF 22, СОДЕРЖАЩАЯ ПОЛУСИНТЕТИЧЕСКИЙ ГЕН ФАКТОРА НЕКРОЗА ОПУХОЛИ ЧЕЛОВЕКА - ПРОМЕЖУТОЧНАЯ ПЛАЗМИДА ДЛЯ КОНСТРУИРОВАНИЯ РЕКОМБИНАНТНОЙ ПЛАЗМИДНОЙ ДНК pTNF 31, КОДИРУЮЩАЯ ПОЛИПЕПТИД СО СВОЙСТВАМИ ФАКТОРА НЕКРОЗА ОПУХОЛИ ЧЕЛОВЕКА, И ШТАММ БАКТЕРИЙ ESCHERICHIA COLI - ПРОДУЦЕНТ ПОЛИПЕПТИДА СО СВОЙСТВАМИ ФАКТОРА НЕКРОЗА ОПУХОЛИ ЧЕЛОВЕКА
WO2018106000A2 (ko) 헴중합효소와 헴 라이게이즈를 포함하는 효소복합체 및 이를 이용한 헤모조인의 제조방법
CN115850500A (zh) 一种抗传染性法氏囊病病毒vp2及鸡cr2的双特异性抗体
Esipov et al. Recombinant Thymosin α1
Baek et al. Construction of a new gene-fusion expression vector, pMONSTER
KR19980050578A (ko) 섬자리공 항바이러스성 단백질(pip)의 유전자를 이용한 pcr 클로닝벡터

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201480033267.9

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14787873

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2909513

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 242147

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 14785881

Country of ref document: US

Ref document number: 2014787873

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20157030691

Country of ref document: KR

Kind code of ref document: A

Ref document number: 2016510621

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2014258109

Country of ref document: AU

Date of ref document: 20140425

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2015150335

Country of ref document: RU

Kind code of ref document: A