WO2014155291A1 - Process and intermediates for the preparation of pregabalin - Google Patents
Process and intermediates for the preparation of pregabalin Download PDFInfo
- Publication number
- WO2014155291A1 WO2014155291A1 PCT/IB2014/060140 IB2014060140W WO2014155291A1 WO 2014155291 A1 WO2014155291 A1 WO 2014155291A1 IB 2014060140 W IB2014060140 W IB 2014060140W WO 2014155291 A1 WO2014155291 A1 WO 2014155291A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- alkyl
- acid
- formula
- compound
- aminomethyl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- FNEOZWRFOAPNGO-UHFFFAOYSA-N CC(C)=CC(C(O)O1)=CC1=O Chemical compound CC(C)=CC(C(O)O1)=CC1=O FNEOZWRFOAPNGO-UHFFFAOYSA-N 0.000 description 4
- 0 CC(C)=CC=CN1CC*CC1 Chemical compound CC(C)=CC=CN1CC*CC1 0.000 description 3
- QNHBGZSPSCOCLM-UHFFFAOYSA-N CC(C)CC(C1)C(O)OC1=O Chemical compound CC(C)CC(C1)C(O)OC1=O QNHBGZSPSCOCLM-UHFFFAOYSA-N 0.000 description 2
- FSXXLBWHYCEOON-UHFFFAOYSA-N CC(C)=CC(C(OC(C)=O)O1)=CC1=O Chemical compound CC(C)=CC(C(OC(C)=O)O1)=CC1=O FSXXLBWHYCEOON-UHFFFAOYSA-N 0.000 description 1
- AYXYPKUFHZROOJ-UHFFFAOYSA-N CC(C)CC(CC(O)=O)CN Chemical compound CC(C)CC(CC(O)=O)CN AYXYPKUFHZROOJ-UHFFFAOYSA-N 0.000 description 1
- AYXYPKUFHZROOJ-ZETCQYMHSA-N CC(C)C[C@@H](CC(O)=O)CN Chemical compound CC(C)C[C@@H](CC(O)=O)CN AYXYPKUFHZROOJ-ZETCQYMHSA-N 0.000 description 1
- ZTDBWPYQWCQYQH-DUXPYHPUSA-N CNC(/C=C(\CO)/C(O)=O)N Chemical compound CNC(/C=C(\CO)/C(O)=O)N ZTDBWPYQWCQYQH-DUXPYHPUSA-N 0.000 description 1
- NHUPIYCNHLWUKC-UHFFFAOYSA-N CNC(CC(CO)C(O)=O)N Chemical compound CNC(CC(CO)C(O)=O)N NHUPIYCNHLWUKC-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P13/00—Preparation of nitrogen-containing organic compounds
- C12P13/001—Amines; Imines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07B—GENERAL METHODS OF ORGANIC CHEMISTRY; APPARATUS THEREFOR
- C07B53/00—Asymmetric syntheses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C227/00—Preparation of compounds containing amino and carboxyl groups bound to the same carbon skeleton
- C07C227/12—Formation of amino and carboxyl groups
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C227/00—Preparation of compounds containing amino and carboxyl groups bound to the same carbon skeleton
- C07C227/14—Preparation of compounds containing amino and carboxyl groups bound to the same carbon skeleton from compounds containing already amino and carboxyl groups or derivatives thereof
- C07C227/18—Preparation of compounds containing amino and carboxyl groups bound to the same carbon skeleton from compounds containing already amino and carboxyl groups or derivatives thereof by reactions involving amino or carboxyl groups, e.g. hydrolysis of esters or amides, by formation of halides, salts or esters
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C59/00—Compounds having carboxyl groups bound to acyclic carbon atoms and containing any of the groups OH, O—metal, —CHO, keto, ether, groups, groups, or groups
- C07C59/40—Unsaturated compounds
- C07C59/74—Unsaturated compounds containing —CHO groups
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D307/00—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom
- C07D307/02—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings
- C07D307/34—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D307/56—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D307/60—Two oxygen atoms, e.g. succinic anhydride
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D307/00—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom
- C07D307/02—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings
- C07D307/34—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D307/56—Heterocyclic compounds containing five-membered rings having one oxygen atom as the only ring hetero atom not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D307/66—Nitrogen atoms
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1096—Transferases (2.) transferring nitrogenous groups (2.6)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P13/00—Preparation of nitrogen-containing organic compounds
- C12P13/005—Amino acids other than alpha- or beta amino acids, e.g. gamma amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P17/00—Preparation of heterocyclic carbon compounds with only O, N, S, Se or Te as ring hetero atoms
- C12P17/02—Oxygen as only ring hetero atoms
- C12P17/04—Oxygen as only ring hetero atoms containing a five-membered hetero ring, e.g. griseofulvin, vitamin C
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C227/00—Preparation of compounds containing amino and carboxyl groups bound to the same carbon skeleton
- C07C227/04—Formation of amino groups in compounds containing carboxyl groups
- C07C227/06—Formation of amino groups in compounds containing carboxyl groups by addition or substitution reactions, without increasing the number of carbon atoms in the carbon skeleton of the acid
- C07C227/08—Formation of amino groups in compounds containing carboxyl groups by addition or substitution reactions, without increasing the number of carbon atoms in the carbon skeleton of the acid by reaction of ammonia or amines with acids containing functional groups
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C229/00—Compounds containing amino and carboxyl groups bound to the same carbon skeleton
- C07C229/02—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton
- C07C229/04—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated
- C07C229/06—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated having only one amino and one carboxyl group bound to the carbon skeleton
- C07C229/08—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated having only one amino and one carboxyl group bound to the carbon skeleton the nitrogen atom of the amino group being further bound to hydrogen atoms
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
Definitions
- the present invention relates to the manufacture of 5-hydroxy-4-(2-methylpropyl)-3,4- dihydro-5/-/-2-furanone, and derivatives thereof, for use in the manufacture of (S)-(+)-3- aminomethyl-5-methylhexanoic acid (Pregabahn).
- the invention further relates to an improved process for the conversion of 5-hydroxy-4-(2-methylpropyl)-3,4-dihydro-5/-/-2- furanone into Pregabahn.
- Pregabahn is a ⁇ -amino acid that exhibits binding affinity to the human 00 2 6 calcium channel subunit.
- Pregabahn is the active agent in Lyrica®, which is approved for the treatment of epilepsy, neuropathic pain, fibromyalgia and generalized anxiety disorder. It exhibits anti-seizure activity, as discussed in U.S. Patent US 5,563, 175, and anti-nociceptive activity, as discussed in U.S. Patent US 6,001 ,876. It is hypothesised that the pharmacological activity of Pregabahn (II) is the result of binding to the alpha-2-delta ( ⁇ 2 ⁇ ) subunit of a calcium channel. Pregabahn (II) is also described as having utility in other conditions, such as physiological conditions associated with psychomotor stimulants, inflammation, gastrointestinal damage, alcoholism, insomnia, and various psychiatric disorders, including anxiety, depression, mania, and bipolar disorder.
- Pregabahn A number of methods for manufacturing Pregabahn have been disclosed. 5-Hydroxy-4- (2-methylpropyl)-3,4-dihydro-5/-/-2-furanone (l A ) has been identified as a useful precursor.
- compound (l A ) in common with a number of the other compounds discussed herein, can be considered to be the cyclized isomer of a 4- oxobutanoic acid derivative.
- Derivatives of 4-oxobutanoic acid can exist as either the open-chain form, or as the cyclic form.
- the ester (XIII) is prepared from 4-methylpentanal (III) by alkylation with an appropriate haloacetate in the presence of diisobutylamine.
- the precursor (l A ) is made either by ester hydrolysis of ester (XIII) or by condensation of 4-methylpentanal (III) with glyoxylic acid (IV) and subsequent reduction of the double bond.
- the use of an enzyme- mediated reduction is also suggested as a way of introducing the desired stereochemistry.
- Pregabalin (II) Still further improved syntheses of Pregabalin (II) are sought. It is especially desirable to provide a process which is cost effective and safe. In particular, it is important to provide a synthesis of Pregabalin (II) which can be carried out on a commercial scale, which uses readily available, inexpensive and safe starting materials and reagents, and which avoids the need for difficult separations.
- the present invention provides improved methods for the manufacture of 5-hydroxy-4- (2-methylpropyl)-3,4-dihydro-5/-/-2-furanone (l A ), and intermediates that are useful in these improved methods.
- the invention provides a compound according to formula (VI)
- the invention provides a compound according to formula (VI) wherein R is selected from:
- (C 3 -Cio)cycloalkyl which may optionally be substituted with 1, 2 or 3 groups independently selected from halo, (Ci-C3)alkyl, and (Ci-C3)alkyloxy, (C3-Cio)cycloalkyl(Ci-C6)alkyl, wherein the cycloalkyi group may optionally be substituted with 1, 2 or 3 groups independently selected from halo, (d- C 3 )alkyl, and (Ci-C 3 )alkyloxy,
- aryl which may optionally be substituted with 1, 2 or 3 groups independently selected from halo, (Ci-C3)alkyl, and (Ci-C3)alkyloxy,
- aryl(Ci-C 6 )alkyl wherein the aryl group may optionally be substituted with 1, 2 or 3 groups independently selected from halo, (Ci-C 3 )alkyl, and (d- C 3 )alkyloxy,
- R 1 is selected from:
- (C 3 -Cio)cycloalkyl which may optionally be substituted with 1, 2 or 3 groups independently selected from halo, (Ci-C 3 )alkyl, and (Ci-C 3 )alkyloxy, (C3-Cio)cycloalkyl(Ci-C6)alkyl, wherein the cycloalkyl group may optionally be substituted with 1, 2 or 3 groups independently selected from halo, (d-
- aryl which may optionally be substituted with 1, 2 or 3 groups independently selected from halo, (Ci-C3)alkyl, and (Ci-C3)alkyloxy, and
- aryl(Ci-C 6 )alkyl wherein the aryl group may optionally be substituted with 1, 2 or
- R 2 is selected from:
- (C 3 -Cio)cycloalkyl which may optionally be substituted with 1, 2 or 3 groups independently selected from halo, (Ci-C 3 )alkyl, and (Ci-C 3 )alkyloxy,
- aryl which may optionally be substituted with 1, 2 or 3 groups independently selected from halo, (Ci-C 3 )alkyl, and (Ci-C 3 )alkyloxy, and
- aryl(Ci-C 6 )alkyl wherein the aryl group may optionally be substituted with 1, 2 or
- the invention provides a compound according to embodiment A1E1 wherein R is hydrogen such that the compound of formula (VI) is 5- hydroxy-4-(2-methyl-1-propenyl)-5/-/-2-furanone according to formula (VI A ).
- R* is a chiral (C5-C 15) hydrocarbon group.
- the invention provides a compound according to embodiment A1 E3 wherein R* is selected from (R)- or (S)-a-methylbenzyl, (R)- or (S)-1 - (l -naphthyl)ethyl, (R)- or (S)-1 -(2-naphthyl)ethyl, menthyl and bornyl, such that the com
- the invention provides a compound according to embodiment A1 E1 wherein R is R 1 -C(0)- or R 2 -S0 2 - and R 1 and R 2 are chiral (C 5 -C 15 ) hydrocarbon groups.
- the vention provides a compound of formula (IX)
- the compound of formula (IX) may exist as either the (E)- or (Z)-geometric isomer, or as a mixture of the two geometric isomers.
- the invention provides a compound of formula (IX) wherein: n is 1 and M + is selected from Li + , Na + , K + , Rb + , NH 4 + , ((Ci -C 3 )alkyl)NH 3 + , ((Ci - C 3 )alkyl) 2 NH 2 + , ((Ci -C 3 )alkyl) 3 NH + and ((Ci -C 3 )alkyl) 4 N + ; or
- n 2 and M 2+ is selected from Mg 2+ , Ca 2+ and Zn 2+ .
- the invention provides a compound according to embodiment A2E1 wherein n is 1 and M + is selected from NH 4 + and ((Ci -C 3 )alkyl)NH 3 + .
- the invention provides a compound according to embodiment A2E1 wherein n is 1 and M + is selected from Li + , Na + and K + .
- the invention provides a compound of formula (VII).
- the invention provides a compound of formula (VII) wherein -X- represents a single bond, -CH 2 -, -0-; -NH-,-N((Ci -C 3 )alkyl)-, -N(benzyl)-, or
- the invention provides a compound according to embodiment A3E1 selected from:
- the invention provides a compound of formula (VIII).
- the invention provides a compound of formula (VIII) wherein -Y- represents a single bond, -CH 2 - -0-; -NH-, -N((Ci -C 3 )alkyl)-, -N(benzyl)-, or
- the invention provides a compound according to embodiment A4E1 selected from:
- the invention provides a process for the manufacture of the compound of formula (VI A ) comprising the step of treating a compound of formula (VII) with water in the presence of an acid catalyst.
- the invention provides a process for the manufacture of the compound of formula (VI A ), comprising the steps of:
- -X- represents a single bond, -CH 2 - -0-, -NH-, -N((Ci -C 3)alkyl)- -N(benzyl)-, or
- the invention provides a process according to embodiment A5E1 wherein the compound of formula (VII) from step (a) is isolated prior to hydrolysis step (b).
- the invention provides a process according to embodiment A5E1 wherein hydrolysis step (b) is carried out directly following step (a) such that the compound of formula (VII) or (VII B ) is not isolated prior to hydrolysis step
- the invention provides a process according to embodiments A5E1 , A5E2 or A5E3 wherein the compound of formula (VII) is prepared by treating a compound of formula (VIII)
- -Y- represents a single bond, -CH 2 - -0-; -NH- -N((Ci -C 3 )alkyl)-, -N(benzyl)-, or
- the invention provides a process for the manufacture of a compound of formula (VI) wherein R is other than hydrogen, R 1 -C(O)-, and R 2 -SO 2 - comprising the step of treating a compound of formula (VI A ) with an alcohol R-OH in the presence of an acid catalyst.
- the invention provides a process for the manufacture of a compound of formula (VI) wherein R is other than hydrogen, R 1 -C(O)-, and R 2 -SO 2 - comprising the steps of:
- the invention provides a process for the manufacture of a compound of formula (VI) wherein R is other than hydrogen, R 1 -C(O)-, and R 2 -SO2- comprising the step of treating acompound of formula (VII) with an alcohol R-OH in the presence of stoichiometric acid.
- the invention provides a process for the manufacture of a compound of formula (VI) wherein R is other than hydrogen, R 1 -C(O)-, and R 2 -SO2- comprising the steps of:
- the invention provides a process for the manufacture of a compound of formula (VI) wherein R is R 1 -C(O)-, comprising the step of treating a compound of formula (VI A ) with an acid chloride R 1 -C(O)-CI or acid anhydride (R 1 - C(O)) 2 O.
- the invention provides a process for the manufacture of a compound of formula (VI) wherein R is R 1 -C(O)-, comprising the steps of:
- the invention provides a process for the manufacture of a compound of formula (VI) wherein R is R 2 -S0 2 - comprising the step of treating a compound of formula (VI A ) with a sulfonyl chloride R 2 -S0 2 -Cl.
- the invention provides a process for the manufacture of a compound of formula (VI) wherein R is R 2 -S0 2 -, comprising the steps of:
- the invention provides a process for the manufacture of an enamine derivative of 4-methyl-2-pentenal.
- the invention provides a process for the manufacture of an enamine derivative of 4-methyl-2-pentenal comprising reacting acetaldehyde with isobutyraldehyde in the presence of a suitable amine.
- the invention provides a process according to embodiment A10E1 wherein the suitable amine is a secondary amine.
- the invention provides a process according to embodiment A10E2 wherein the secondary amine is selected from: ((Ci -C 4 )alkyl) 2 NH, pyrrolidine, piperidine, morpholine, piperazine, N-methylpiperazine, N-ethylpiperazine and N-benzylpiperazine.
- the invention provides a process according to embodiment A10E3 wherein the secondary amine is selected from pyrrolidine, piperidine, morpholine, and piperazine.
- the invention provides a process according to any of embodiments A10E1 , A10E2, A10E3 and A10E4 wherein the reaction is performed in the presence of an acid catalyst.
- the invention provides a process according to any of embodiments A10E1 , A10E2, A10E3, A10E4 and A10E5 wherein the isobutyraldehyde is combined with the suitable amine before addition of the acetaldehyde.
- the invention provides a process according to any of embodiments A10E1 , A10E2, A10E3, A10E4 and A10E5 wherein the isobutyraldehyde and acetaldehyde are added to the reaction vessel simultaneously.
- the invention provides a process for the manufacture of 3- aminomethyl-5-methylhexanoic acid (II).
- the invention provides a process for the manufacture of 3- aminomethyl-5-methylhexanoic acid (II) or a pharmaceutically acceptable salt thereof, comprising the steps:
- the invention provides a process according to embodiment A11 E1 wherein the 3-aminomethyl-5-methylhexanoic acid (II) is (S)-3- aminomethyl-5-methylhexanoic acid ((S)-ll)
- step (a) comprises a process according to embodiments A5E1 , A5E2, A5E3 or A5E4 as described above.
- step (b) comprises the steps:
- n 1 and M + is selected from Li + , Na + , K + , Rb + , NH 4 + , ((Ci -C 3 )alkyl)NH 3 + , ((d - C 3 )alkyl) 2 NH 2 + , ((Ci -C 3 )alkyl) 3 NH + and ((Ci -C 3 )alkyl) 4 N + ; or
- n 2 and M 2+ is selected from Mg 2+ , Ca 2+ and Zn 2+ ;
- step (b) comprises the steps:
- R * is a chiral (Cs-Ci5)hydrocarbon group
- the invention provides a further process for the manufacture of 3-aminomethyl-5-methylhexanoic acid (II).
- the invention provides a process for the manufacture of 3- aminomethyl-5-methylhexanoic acid (II) or a pharmaceutically acceptable salt thereof, comprising the steps:
- n 1 and M + is selected from NH 4 + and ((Ci -C 3 )alkyl)NH 3 +
- the invention provides a process according to embodiment A12E1 wherein the 3-aminomethyl-5-methylhexanoic acid (II) is (S)-3- aminomethyl-5-methylhexanoic acid ((S)-ll)
- step (a) comprises a process according to embodiments A5E1 , A5E2, A5E3 or A5E4 as described above.
- the invention provides a further process for the manufacture of 5-hydroxy-4-(2-methylpropyl)-3,4-dihydro-5/-/-2-furanone (l A ).
- the invention provides a further process for the manufacture of 5-hydroxy-4-(2-methylpropyl)-3,4-dihydro-5/-/-2-furanone (l A ) which comprises the steps of:
- the invention provides a process according to embodiment A13E1 wherein the carbon-carbon double bond is reduced to provide 3- isobutyl-2-oxopentanedioic acid (XV) or its cyclised isomer (XV A )
- the invention provides a process according to embodiment A13E1 wherein the a-keto acid functional group is decarboxylated to provide 3-formyl- -methyl-3-pentenoic acid (XVI or its cyclised isomer (XVI A )
- the invention provides a process according to embodiment A13E1 wherein the a-keto acid functional group is decarboxylated and the carbon-carbon double bond is reduced simultaneously.
- the invention provides a process according to embodiments A13E1 , A13E2, A13E3 or A13E4 wherein the decarboxylation is carried out in the presence of a decarboxylase enzyme.
- the invention provides a process according to embodiments A13E1 , A13E2, A13E3, A13E4 or A13E5 wherein the reduction of the carbon-carbon double bond is carried out in the presence of an enoate reductase enzyme.
- the invention provides a compound selected from:
- the invention provides a process for the manufacture of (S)-3- aminomethyl-5-methylhexanoic -ll)
- the invention provides a process for converting (R)-3- aminomethyl-5-methylhexanoic acid into (S)-3-aminomethyl-5-methylhexanoic acid comprising treating the (R)-3-aminomethyl-5-methylhexanoic acid with a transaminase enzyme or an amine oxidase/imine reductase enzyme.
- the invention provides a process for increasing the proportion of (S)-3-aminomethyl-5-methylhexanoic acid in a mixture of (R)- and (S)-3-aminomethyl-5- methylhexanoic acid comprising treating the mixture with a transaminase enzyme or an amine oxidase/imine reductase enzyme.
- the invention provides a transaminase enzyme that is useful for the conversion of 5-hydroxy-4-(2-methylpropyl)-3,4-dihydro-5/-/-2-furanone (l A ) into Pregabalin.
- the invention provides a transaminase enzyme having an amino acid sequence that has at least 95% homology to the amino acid sequence MNKPQSWEARAETYSLYGFTDMPSLHX 27 RGTWVTHGEGPYX 4 VDVX 45 GRRYLDAN SGLYNMVAGFDHKGLIDAAKAQYERFPGYHSFFGRMSDQTVMLSEKLVEVSPFDSGR VFYTNSGSEANDTMVKMLWFLHAAEGKPQKRKILTRX 47 NAYHGVTAVSASMTGX 63 P X 65 NSVFGLPLPGFVHLX 80 CPHYWRYGEEGETEEQFVARLARELEETIQREGADTIAG FFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPD AIISSKNLTAGFFPVGAVILGPELX 304 KRLETAIEAIEEFPHGFTAX 324 GHPVGCAIALKAID WMNE
- X 27 is selected from glutamine (Q) and glutamic acid (E);
- X 41 is selected from isoleucine (I) and valine (V);
- X 45 is selected from asparigine (N) and histidine (H);
- X 147 is selected from asparigine (N) and glutamine (Q);
- X 163 is selected from leucine (L) and methionine (M);
- X 165 is selected from tyrosine (Y) and histidine (H);
- X 180 is selected from threonine (T); glycine (G) and serine
- X 304 is selected from alanine (A) and serine (S);
- X 324 is selected from glycine (G) and serine (S);
- X 401 is selected from lysine (K) and glutamic acid (E);
- ⁇ 408 is selected from threonine (T) and glutamine (Q);
- ⁇ 415 is selected from serine (S) and alanine (A);
- X 416 is selected from proline (P) and alanine (A);
- X 417 is selected from leucine (L) and methionine (M);
- X 424 is selected from cysteine (C) and serine (S).
- the invention provides a transaminase enzyme according to embodiment A18E1 having the amino acid sequence of SEQ ID NO. 1.
- the invention provides a transaminase enzyme according to embodiment A18E1 or A18E2 wherein:
- X 27 is glutamic acid (E);
- X 147 is glutamine (Q);
- X 165 is histidine (H); X 304 is serine (S);
- X 324 is glycine (G);
- X 401 is lysine (K);
- X 408 is glutamine (Q);
- X 416 is alanine (A);
- X 417 is methionine (M).
- X 424 is serine (S).
- the invention provides a transaminase according to embodiment A18E2 having an amino acid sequence selected from:
- the invention provides a process for the manufacture of (S)-3- aminomethyl-5-methylhexanoic acid ((S)-ll)
- alkyl means a straight-chain or branched-chain saturated aliphatic hydrocarbon radical containing the specified number of carbon atoms.
- alkyl radicals include methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, fe/f-butyl, neopentyl and n-hexyl.
- alkoxy means a group made up of an alkyl group as defined above connected to an oxygen atom.
- alkoxy groups include methoxy, ethoxy and isopropoxy.
- alkoxy-alkyl means a straight-chain or branched-chain saturated aliphatic hydrocarbon radical in which an alkoxy group is substituted for an alkyl hydrogen atom.
- An example of an alkoxy-alkyl group is 2-methoxyethyl.
- haloalkyl means an alkyl group as defined above wherein one or more hydrogen atoms are replaced by fluorine, chlorine, bromine or iodine. When more than one hydrogen atom is replaced, the replacing halogen atoms may be the same or different. Examples of haloalkyl groups include fluoromethyl, difluoromethyl, trifluoromethyl, chlorodifluoromethyl, 2,2,2-trifluoroethyl and 3-bromopropyl.
- aryl means a phenyl or naphthyl group.
- aryl-alkyl means a straight-chain or branched-chain saturated aliphatic hydrocarbon radical in which an aryl group is substituted for an alkyl hydrogen atom.
- An example of an aryl-alkyl group is benzyl.
- cycloalkyl means a saturated monocyclic or polycyclic carbocyclic ring containing the specified number of carbon atoms. Examples of monocyclic cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl and cyclohexyl. Examples of polycyclic cycloalkyl groups include bicyclo[2,2,1 ]heptyl and bicyclo[3,2, 1 ]octyl.
- substitution with reference to an alkyl or aryl group means that a hydrogen atom of the alkyl or aryl group may be replaced by one of the groups listed. The substitution may be made at any position within the alkyl or aryl group. When the optional substitution is with "one or more groups” then any number of hydrogen atoms of the alkyl or aryl group, up to a maximum equal to the number of hydrogens present in the alkyl or aryl group, may be replaced, and each replacement is independent of the others.
- Enantiomeric excess is a measure, for a given sample, of the excess of one enantiomer in excess of its antipode and is expressed as a percentage. Enantiomeric excess is defined as:
- Reductive amination with an amine donor in the presence of a transaminase enzyme can provide enantiomerically enriched 3-aminomethyl-5-methylhexanoic acid.
- Suitable amine donors are primary amines such as mono-alkylamines, particularly isopropylamine, and ⁇ -amino acids.
- reaction of (l A ) with a suitable amine dehydrogenase/ imine reductase in the presence of ammonia can also be a suitable route to pregabalin.
- a co-factor such as NADH or NADPH may be needed in a stoichiometric amount, or a second oxidoreductase, such as formate dehydrogenase, may be included to recycle the co- factor.
- dihydrofuranone (l A ) has a defined stereochemistry at the C-4 position
- this stereochemistry may be preserved during the reductive amination reaction.
- Pregabalin has the (S)-stereochemistry it may be preferred to have this stereochemistry already present in the dihydrofuranone.
- the dihydrofuranone (l A ) may be used as in racemic form.
- the desired stereoisomer of the product may then be obtained either by carrying out the reductive amination reaction under conditions that allow for the stereoselective formation of a single enantiomer, such as by carrying out the transformation in the presence of a transaminase enzyme, or by subjecting the product to a separate resolution step, such as by crystallization with a chiral acid or base.
- the dihydrofuranone (l A ) may be conveniently prepared in racemic or enantiomerically enriched form using the methods set out below.
- the dihydrofuranone (l A ) is prepared by reduction of 5-hydroxy-4-(2- methyl-1 -propenyl)-5H-2-furanone (VI A ).
- Suitable catalysts include homogeneous and heterogeneous catalysts.
- the catalyst typically comprises a transition metal such as palladium, platinum, rhodium, ruthenium or nickel, or a salt or oxide thereof.
- Heterogeneous catalysts include finely divided metals and substrate-supported metals and metal oxides, where the substrate may be carbon, silica, alumina or any other suitable inert material.
- Homogeneous catalysts include phosphine ligand complexes of transition metals. When the phosphine ligand is chiral then the catalyst is chiral. When an achiral catalyst is used, then the product is the racemic dihydrofuranone (l A ).
- a chiral catalyst may provide the dihydrofuranone (l A ) in an enantioselective manner.
- the selectivity of the hydrogenation reaction, and the overall yield, maybe improved when the reaction is carried out in an alkaline medium. Without being bound by theory, it is thought that in the presence of a base the furanone exists predominantly as the ring-opened salt (IX).
- Any suitable base may be used provided that it does not interfere with the hydrogenation process, such as by poisoning the catalyst.
- suitable bases include alkali (such as Li, Na, K and Rb) and alkaline earth metal (such as Ca and Mg) oxides, hydroxides, carbonates and bicarbonates.
- Other metal salts, such as zinc salts, may also be used.
- Alkali metal salts may be preferred due to their good solubility and/or low toxicity.
- Amine bases such as ammonia, and primary, secondary and tertiary amines may be used to prepare ammonium salts. Tetra-alkylammonium hydroxide may also be used, leading to the formation of tetra-alkylammonium salts.
- the dihydrofuranone (l A ) is recovered, after the hydrogenation reaction, by treatment of this salt with a suitable acid.
- the salt may be converted directly to 3- aminomethyl-5-methylhexanoic acid (II) by treatment with a transaminase or amine oxidase/imine reductase enzyme.
- the use of the isopropylammonium salt in combination with a transaminase enzyme is a preferred example.
- Furanones of formula (VI) wherein R is other than hydrogen may also be reduced by hydrogenation.
- R is an alkyl, haloalkyl, alkoxyalkyi alkenyl, cycloalkyi, cycloalkyl-alkyl, aryl or aryl-alkyl group
- these furanones may be prepared from the compound of formula (VI A ) by reaction with an alcohol R-OH in the presence of an acid catalyst.
- R 1 -C(O)- the furanones may be prepared from the compound of formula (VI A ) by reaction with an acid anhydride (R 1 -C(O)) 2 O or acid chloride R 1 -C(O)- Cl, optionally in the presence of a base, for example a tertiary amine.
- R 2 - SO 2 - the furanones may be prepared from the compound of formula (VI A ) by reaction with a sulfonyl chloride R 2 -SO 2 -CI, optionally in the presence of a base, for example a tertiary amine.
- the dihydrofuranone of formula (l A ) can be generated from the reduction product by treatment with acid (where R is an alkyl, haloalkyl, alkoxyalkyi alkenyl, cycloalkyi, cycloalkyl-alkyl, aryl or aryl-alkyl group) or base (where R is R 1 -C(O)- or R 2 -SO 2 -).
- a chiral R group may provide a chiral hydrogenation product without the need for a chiral catalyst.
- Suitable chiral alcohols may include a-aryl alcohols such as 1 -phenylethanol and 1 - naphthylethanol, as well as terpene alcohols such as menthol and borneol.
- Hydrogenation of derivative (VI B ) may proceed in an enantioselective manner, and treatment of the resulting product with a suitable acid and in the presence of water then provides the dihydrofuranone (l A ) in chiral form.
- the furanone (VI A ) may be prepared from a compound of formula (VII)
- -X- represents a single bond, -CH 2 -, -O-, -NH-, -N((Ci-C 3 )alkyl)-, -N(benzyl)- or
- the compound of formula (VII) can be treated with water in the presence of an acid catalyst.
- Suitable acids include mineral acids such as sulphuric acid.
- the compound of formula (VII) can be treated with an alcohol R-OH to provide directly a compound of formula (VI) wherein R is an alkyl, haloalkyl, alkoxyalkyl alkenyl, cycloalkyl, cycloalkyl-alkyl, aryl or aryl-alkyl group.
- the compounds of formula (VII) can be prepared by the reaction of a dienam formula (VIII).
- -Y- represents a single bond, -CH 2 - -O-; -NH-, -N((Ci -C 3 )alkyl)-, -N(benzyl)-, or
- condensation of isobutyraldehyde and acetaldehyde in the presence of a suitable amine such as pyrrolidine, piperidine or morpholine with catalytic acid in a solvent such as acetonitrile provides the dienamine derivatives (VIII).
- Y single bond, CH 2 , O, N(alkyl), N(benzyl)
- the compound of formula (VIII) wherein Y is NH may be obtained by using mono- protected piperazine as the amine, followed by a deprotection step.
- Acyclic secondary amines such as diethylamine and di-isopropylamine may also be used, but cyclic secondary amines are preferred.
- both the acetaldehyde and the isobutyraldehyde are initially converted to their enamine derivatives.
- the more basic isobutyraldehyde enamine is converted to its iminium ion.
- This electrophilic species reacts preferentially with the less sterically hindered nucleophile, which is the acetaldehyde enamine - this ensures reaction the desired way around.
- the method of the present invention is more economical and more amenable to scale- up than the literature methods of effecting this 'umpolung' of normal acetaldehyde reactivity, in which acetaldehyde is converted to an O-silylated enol derivative and coupled with the isobutyraldehyde under Mukiyama aldol conditions,
- both coupling partners are activated simultaneously - electronic and steric effects directing the observed reactivity pattern.
- the other advantage is that the product dienamine is the desired 'activated' form of 4-methyl-2-pentenal for reaction with glyoxylic acid to form the desired 5-aminofuranones (VII).
- dienamine derivatives of formula (VIII) may be isolated and purified, or alternatively they can be treated directly with glyoxylic acid (or its hydrate), which provides furanone derivative (VII) directly.
- the furanone derivatives (VII) may be isolated and purified. Treatment with aqueous acid then provides furanone (VI A ).
- the dihydrofuranone (I) is prepared from 3-isobutylidene- 2-oxopentanedioic acid (XII), which is readily obtained by the condensation of isobutyraldehyde with 2-oxopentanedioic acid (a-ketoglutaric acid) (XIV).
- Conversion of diacid (XII) to dihydrofuranone (I) requires a decarboxylation step and a reduction step. These two process steps may be carried out separately, in which case either the decarboxylation step or the reduction step may be the first step, or the two processes may be carried out simultaneously.
- the reduction step is carried out first, the intermediate (XV) will be produced.
- the decarboxylation step is carried out first the intermediate (XVI) will be produced.
- the reduction step may be carried out chemically, such as by hydrogenation, but is preferably achieved using an enzyme-mediated reduction, such as by treating with an enoate reductase enzyme.
- the decarboxylation step is preferably performed by treating the compound with a decarboxylase enzyme.
- the enzyme may be an isolated enzyme, including an enzyme immobilized on a carrier, it may be a partially isolated enzyme preparation such as a cell homogenate, or it may be a non-isolated enzyme, in which case a whole-cell preparation is used.
- Cells may include those which express the desired enzyme naturally, and cells that have been manipulated so as to express the desired enzyme.
- the enzyme-mediated reductive amination of the compound of formula (l A ) is reversible, and so treatment of 3-aminomethyl-5-methylhexanoic acid (II) with a transaminase enzyme or an amine oxidase/imine reductase enzyme can lead to the formation of the dihydrofuranone (l A ).
- the ring-opened isomer of this is compound (l B ), which is epimerizable. In view of this, it is possible to convert ((R)-ll) into ((S)-ll), or to increase the optical purity of a mixture of ((R)-ll) and ((S)-ll) using such an enzyme.
- Isobutyraldehyde 46.90g, 0.65mol, 1 .43eq. was stirred in acetonitrile (300ml_). Morpholine (56.63g, 0.65mol, 1 .43eq.) followed by pTsOH (8.63g, 0.1 equiv) were slowly added at room temperature to the isobutyraldehyde solution. A solution of acetaldehyde (20g, 0.454mol) in acetonitrile (100ml_) was added drop-wise over 1 hr with internal temperature monitoring at 50°C.
- aqueous phase was extracted with ethyl acetate (100ml_) and combined organics washed with brine and evaporated to a thick oil which solidified on standing (89.0g, 67% assay by qNMR, 60% yield).
- Isobutyraldehvde (102.90g, 1 .43mol) was stirred in acetonitrile (600ml_). Morpholine (124.3g, 1 .43mol) followed by pTsOH (19.0g, 0.1 equiv) were slowly added at room temperature to the isobutyraldehyde solution. A solution of acetaldehyde (44.05g, LOmol) in acetonitrile (150ml_) was added drop-wise over 1 hr with internal temperature monitoring at 50°C. After complete addition the mixture was stirred for 30m in at 50°C and then cooled to ⁇ 10°C.
- a solution of piperazine (43. Og, 0.5mol) and 4-toluenesulfonic acid monohydrate (4.4g, 0.023mol) in acetonitrile (600ml_) was prepared. This solution was heated to 50°C and isobutyraldehyde (100ml_, 1 .10mol) added over 10 minutes. The solution went red- orange in colour and a transient white precipitate occurred.
- a solution of acetaldehyde (30.8g, 0.70mol) in acetonitrile (30 ml_) was then added via syringe pump over 3h at 50°C. A suspension was formed which was stirred at 50°C for 0.5h.
- This reaction can also be conducted in isopropanol, acetonitrile-water, toluene-water or in heptane water with similar yields.
- Tosic acid (6.5g, 0.03mol) was charged to a solution of piperazine (59g, 0.69 mol) in acetonitrile (240ml_). The reaction was heated to 50°C and agitated until dissolution of solids was observed, before addition of isobutyraldehyde (138ml_, 1.51 mol). The reaction was held at 50°C before a solution of acetaldehyde (60ml_; 1.07mol) in acetonitrile (30m L) was charged to the vessel over 3hrs via syringe pump.
- reaction was stirred for a further 30 minutes before a 50% w/w solution of glyoxylic acid in water (148g, 1 .0 mol) was added over 5min to the reaction mixture followed by water (50ml). The reaction was then heated to 70°C for 2h, then to 50°C overnight. The reaction was then cooled to 5°C and held for 30 minutes.
- glyoxylic acid in water 148g, 1 .0 mol
- Another flask (50ml_) was charged with acetaldehyde (30.8g, 39ml_, 0.7mol) and placed in an ice-water bath (0-2°C).
- the acetaldehyde flask was connected to the 3-necked flask by cannula via septa.
- a stream of argon was then passed through the acetaldehyde flask at the rate which ensures that the addition of the acetaldehyde was complete within 3 h.
- Piperazine (236.6g) was charged to a clean 3L dry vessel fitted with thermometer, addition funnel (100ml_) and reflux condenser.
- pTsOH (25.3g) was charged to vessel followed by acetonitrile (550m L). The agitator was started and the vessel was inerted with nitrogen. Isobutyraldehyde (150ml_, 27% of the total charge) was charged to the agitated piperazine / pTsOH slurry and a temperature rise to ca 43°C was observed. The white suspension was then heated to 50°C (+/- 5°C).
- a pre-mixed chilled solution of isobutyraldehyde (400m L, 73% of total charge) and chilled acetaldehyde (260m L) were charged to a clean, dry 1 L vessel and this mixture was maintained in an ice bath.
- the isobutyraldehyde / acetaldehyde mixture was charged to the contents of the 3L vessel in 100ml_ aliquots over 5-6h at 50°C.
- the contents of the reaction flask changed from a white suspension to a wine red solution and finally an orange suspension during the addition of the acetaldehyde. After complete addition the suspension was agitated at 50°C for ca. 0.5 to 1 .0h.
- Aqueous glyoxylic acid (50% wt/wt) solution was charged to the suspension over 10-15 min and the temperature rose to ca 75°C.
- 5,5'-(Piperazine-1 ,4-diyl)bis(4-(2-methylprop- 1 -en-1 -yl)furan-2(5/-/)-one) was observed to crystallise from solution.
- the suspension was stirred at 70°C (+/ 5°C) for 6h, then cooled with stirring to ambient.
- the batch was then cooled to -5 to 0°C for and held for 3-4h before the suspension was filtered and the cake washed with chilled methanol (1 x 500ml_) then 2 x 500ml_ of methanol at ambient temperature.
- the washed product was dried in a vacuum oven at 40-50°C to constant weight to afford 474g of 98% pure 5,5'-(piperazine-1 ,4-diyl)bis(4-(2-methylprop-1 -en-1 - yl)furan-2(5H)-one) (70%).
- a 10% w/w aqueous solution of sulphuric acid (412g) was charged to a vessel containing 5,5'-(piperazine-1 ,4-diyl)bis(4-(2-methylprop-1 -en-1 -yl)furan-2(5/-/)- one) (60g, 0.167mol).
- the contents were agitated and then heated to reflux.
- the reaction was held at reflux until the starting material was consumed, which was determined by dissolution.
- the batch was cooled to 35°C at which point the target compound began to crystallise.
- the slurry was further cooled to 0-5°C and then transferred to a filter.
- Example 34 The material of example 34 was hydrogenated under similar conditions to those outlined in Example 13 to give a >90% yield of 5-acetoxy-4-(2-methylpropyl)-3,4-dihydro-2(5/-/)- furanone as a 1 :1 mixture of diastereomers.
- the product is accompanied by ca. 5% of 4-(2-methylpropyl)-3,4-dihydrofuran-2(5/-/)-one.
- the product can be hydrolysed as in Example 30 to give yields of 5-hydroxy-4-(2-methylpropyl)-3,4-dihydro-5/-/-2-furanone/ 3-formyl-5-methylhexanoic acid.
- a 2L round bottom was charged 300g a-ketoglutaric acid and 450ml_ of ice water. With stirring and cooling 314g of potassium hydroxide in 450m L water was charged keeping the pot temperature less than 25°C. Reactor was placed under nitrogen and isobutyraldehyde was added at 0.2mL/min over 50hrs. The resulting two phase yellow solution was separated and washed with 100ml_ MTBE. The lower aqueous phase pH was adjusted to 3.2-3.4 and was concentrated to 1/3 volume at 65°C under vacuum.
- PubMed was used to search the literature for decarboxylase enzymes with a broad spectrum of activity.
- the KEGG (Kyoto Encyclopedia of Genes and Genomes) program was used to search for microbial decarboxylases with activity on compounds somewhat similar in structure to 3-(2-methylpropyl)-2-oxopentanedioic acid or 3-isobutylidene-2- oxopentanedioic acid. Seven classes of decarboxylases were chosen for investigation based on reports of activity on compounds with some structural similarity.
- the decarboxylase classes were glutamate decarboxylase, diaminopimelate decarboxylase, indolepyruvate decarboxylase, branched-chain a-keto acid decarboxylase, aromatic-L- amino-acid decarboxylase, lysine decarboxylases and benzoylformate decarboxylase. Forty one sequences of genes for proven, or putative decarboxylase enzymes were selected. The genes were codon optimized for expression in E.
- Each E. coli strain containing the cloned decarboxylase gene was grown overnight in LB broth with the appropriate antibiotic.
- a small amount (50 ⁇ _ - 100 ⁇ _) of the overnight seed culture was used to inoculate 4.0ml_ of Terrific Broth medium with appropriate antibiotics in 20mm diameter culture tubes.
- the cultures were grown in a shaking incubator at 32°C and 300rpm. After 5h of growth IPTG was added to 0.4mM final concentration to induce the enzyme expression. The cultures were returned to the incubator and grown for an additional 19h.
- Recombinant decarboxylase enzymes were tested for decarboxylation of 3-(2- methylpropyl)-2-oxopentanedioic acid (XV) and 3-isobutylidene-2-oxopentanedioic acid (XII) using E. coli cells prepared as described in Example 22.
- Reactions (1 ml_) were carried out at 37°C in potassium phosphate buffer (100mM, pH 6.4) with decarboxylase (60mg wet cells), 50mM 3-(2-methylpropyl)-2-oxopentanedioic acid or 3-isobutylidene- 2-oxopentanedioic acid, ThDP (0.1 mM), and MgS0 4 (2.5mM).
- Decarboxylation of 3-(2- methylpropyl)-2-oxopentanedioic acid and 3-isobutylidene-2-oxopentanedioic acid was determined by a UPLC assay.
- the derivatized samples were diluted with 0.5ml_ of acetonitrile, filtered and analyzed by UPLC on a Agilent Eclipse Plus C18 column (100mm x 3.0mm, 1 .8pm) eluted with 0.1 % trifluoroacetic acid in watenacetonitrile (55:45, v/v) at 1 .1 ml_/min.
- the column was maintained at 40°C and the effluent was monitored at 360nm and ES + mass spectroscopy.
- the aqueous decants were washed with 50ml_ MTBE with minimum agitation.
- the pH of the aqueous phase was adjusted to 4 and filtered through celite.
- the filtrate was extracted with minimum agitation three times with 50ml_ MTBE.
- the MTBE was dried over anhydrous sodium sulfate and concentrated to a thick red oil. This oil was extracted with several portions of hot hexanes; the combined hexanes were cooled to ⁇ 0° and the resulting crystals were isolated and dried in air to give 3-formyl-5- methylhex-3-enoic acid as a white solid (0.6g).
- the DNA sequence corresponding to the gene for Lycopersicon escuientum (tomato) 12-oxophytodienoate reductase 1 was retrieved from the Genbank database (accession number AC Q9XG54) and was synthesized by GeneArt (Germany). The sequence was codon optimized for expression in E. coli, and was subcloned into an E. coli expression plasmid pSTRC18 (Pfizer Inc. , USA). The protein sequence is shown below.
- the OPR1 expression construct was transformed into BL21 (DE3) E. coli (Stratagene, Agilent Technologies, Santa Clara, CA, USA) as directed and overnight cultures were incubated in LB + streptomycin media.
- the LB culture was used to inoculate expression cultures (LB, M9Y, or TB), which were incubated at 37°C (210rpm) After the culture reached a suitable biomass concentration (OD 1 at /4600), IPTG was added (1 mM) and cultures were incubated for another 20 h (30°C, 210 rpm). The cells were harvested by centrifugation (4000 x g, 30 min, 4°C) and stored at -20 °C.
- the BLASTP program was used to search the NCBI non-redundant protein sequences database for gene sequences related to 12-Oxophytodienoate reductase (OPR1 ) from Lycopersicon escuientum. Thirty eight sequences for related genes were selected, codon optimized for expression in E.coli, and subcloned into the pET28b(+) E. coli expression plasmid (Novagen, EMD Chemicals, Gibbstown, NJ, USA). The OPR1 related expression constructs were transformed into BL21 (DE3) E. coli (Stratagene, Agilent Technologies, Santa Clara, CA, USA) as directed and overnight cultures were grown in LB + kanamycin media.
- OPR1 12-Oxophytodienoate reductase
- the LB cultures were used to inoculate expression cultures grown in Overnight Express Instant TB Medium (Novagen, EMD Chemicals, Gibbstown, NJ, USA). Cultures were incubated for 20h at 30°C, and the cells were harvested by centrifugation (4000 x g, 30m in, 4°C) and stored at -20 °C. Lycopersicon esculentum (tomato) 12-Oxophytodienoate Reductase 1 protein sequence:
- Recombinant enoate reductases were tested for reduction of (E)-3-formyl-5-methylhex- 3-enoic acid using E. coli cells prepared as described in Example 25. Reactions (0.5ml_) were carried out at 30°C in potassium phosphate buffer (100mM, pH 7.0) with E. coli cells (100mg wet cells/mL), NADPH (10mM), NADH (10mM) and (E)-3-formyl-5- methylhex-2-enoic acid (10mM). After 16 h, acetonitrile (0.5ml) was added to each reaction and the resulting mixtures were centrifuged (2000rpm x 5min).
- enoate reductases were evaluated for reduction of (E)-3-formyl-5- methylhex-3-enoic acid with NAD + and formate dehydrogenase.
- Enoate reductases were expressed in E. coli cells as described in Example 25.
- Formate dehydrogenase was expressed in E. coli cells as follows: The pET26b formate dehydrogenase expression construct was transformed into BL21 (DE3) E. coli (Stratagene, Agilent Technologies, Santa Clara, CA, USA) as directed and overnight cultures were grown in LB + kanamycin media.
- the LB cultures were used to inoculate expression cultures grown in Overnight Express Instant TB Medium + kanamycin (Novagen, EMD Chemicals, Gibbstown, NJ, USA). Cultures were incubated for 20 h at 30°C, and the cells were harvested by centrifugation (4000 x g, 30 min, 4°C) and stored at -20 °C.
- a variant (D74M) of oxophytodienoate reductase 3 (Accession number Q9FEW9) was expressed in E coli cells as follows: QuikChange Site-directed Mutagenesis kit from Stratagene (La Jolla, CA,USA) was used to create oxophytodienoate reductase 3 variant D74M as directed.
- reaction mixtures were acidified with 0.025ml_ of 4N HCI and extracted with 1 ml_ of ethyl acetate.
- enoate reductases were evaluated for reduction of (E)-3-formyl-5- methylhex-3-enoic acid with NADP + and Lactobacillus brevis alcohol dehydrogenase (X- zyme).
- Enoate reductases were expressed in E. coli cells as described in Example 25.
- a variant (D74M) of oxophytodienoate reductase 3 (OPR3) was prepared as described in Example 27.
- Reactions (0.5ml_) were carried out at 30°C in potassium phosphate buffer (100mM, pH 7.0) with enoate reductases (40mg wet cells/mL), Lactobacillus brevis alcohol dehydrogenase (32U/ml_), NADP + (0.02mM), 2-propanol (3 vol%) and (E)-3-formyl-5-methylhex-2-enoic acid (20mM).
- reaction mixtures were acidified with 0.025ml_ of 4N HCI and extracted with 1 ml_ of ethyl acetate.
- a reaction vessel was charged with 7.5ml_ potassium phosphate buffer (0.1 M, pH 7.0), 8.4mg NADP + , 0.2ml_ Lactobacillus brevis alcohol dehydrogenase (32U/ml_, X-zyme), 0.3ml_ 2-propanol, pentaerythritol tetranitrate reductase (2ml_ of a 200mg/ml_ suspension of E. coli cells in potassium phosphate buffer), and 156mg of (E)-3-formyl-5- methylhex-3-enoic acid, and agitated at 40°C.
- reaction mixture was centrifuged and the supernatant was adjusted to pH 2 with 4N HCI and extracted with ethyl acetate (2 x 10ml_).
- ethyl acetate extract was dried over anhydrous magnesium sulfate, filtered and concentrated under reduced pressure to give 141 mg of colorless oil (89% yield).
- Pregabalin was evaluated with various recombinant transaminases.
- Recombinant co-transaminases from Vibrio fluvialis, Rhodobacter sphaeroides, and Paracoccus denitrificans were expressed in E. coli as follows: The pET28b co-transaminase expression constructs were transformed into BL21 (DE3) E. coli (Stratagene, Agilent Technologies, Santa Clara, CA, USA) as directed and overnight cultures were grown in LB + kanamycin media.
- the LB cultures were used to inoculate expression cultures grown in Overnight Express Instant TB + kanamycin Medium (Novagen, EMD Chemicals, Gibbstown, NJ, USA). Cultures were incubated for 20 h at 30°C, and the cells were harvested by centrifugation (4000 x g, 30 min, 4°C) and stored at -20°C.
- reaction samples (0.5mL) were carried out at 30°C in potassium phosphate buffer (100mM, pH 7.0), pyridoxal phosphate (2mM), isopropylamine (150mM), 3-formyl-5-methylhexanoic acid (50mM) and co-transaminase (40mg wet cells/mL) from Vibrio fiuviaiis, Rhodobacter sphaeroides, or Paracoccus denitrificans. After 24h, reaction samples (0.1 mL) were diluted with 0.4mL acetonitrile:water (1 : 1 , v/v).
- V. fiuviaiis co-transaminase (Accession number AEA39183) were expressed in E. coli as follows: QuikChange Site- directed Mutagenesis kits from Stratagene (La Jolla, CA, USA) was used to create V. fiuviaiis aminotransferase variants as directed. Primers were ordered from Integrated DNA Technologies (Coralville, IA, USA). The pET28b co-transaminase expression constructs were transformed into BL21 (DE3) E.
- coli (Stratagene, Agilent Technologies, Santa Clara, CA, USA) as directed and overnight cultures were grown in LB + kanamycin media.
- the LB cultures were used to inoculate expression cultures grown in Overnight Express Instant TB + kanamycin Medium (Novagen, EMD Chemicals, Gibbstown, NJ, USA). Cultures were incubated for 20h at 30°C, and the cells were harvested by centrifugation (4000 x g, 30m in, 4°C) and stored at -20°C.
- reaction samples (0.5mL) were carried out at 30°C in potassium phosphate buffer (100mM, pH 7.0) with pyridoxal phosphate (2mM), isopropylamine (300mM), 3-formyl-5- methylhexanoic acid (100mM) and V. fiuviaiis co-transaminase wild-type or variants (40mg wet cells/mL).
- reaction samples (0.1 mL) were diluted with 0.4m L acetonitrile:water (1 : 1 , v/v).
- Vfat 888 Vfat 888
- coli (Stratagene, Agilent Technologies, Santa Clara, CA, USA) as directed and overnight cultures were grown in LB + kanamycin media.
- the LB cultures were used to inoculate expression cultures grown in Overnight Express Instant TB + kanamycin Medium (Novagen, EMD Chemicals, Gibbstown, NJ, USA). Cultures were incubated for 20h at 30°C, and the cells were harvested by centrifugation (4000 x g, 30min, 4°C) and stored at -20°C.
- Reactions (0.5mL) were carried out at 30°C in potassium phosphate buffer (100mM, pH 7.0) with pentaerythntol tetranitrate reductase (40mg wet cells/mL), Lactobacillus brevis alcohol dehydrogenase (32U/ml_), NADP + (0.02mM), 2-propanol (3 vol%), pyridoxal phosphate (2 mM), isopropylamine (100mM), (E)-3-formyl-5-methylhex-2-enoic acid (20mM) and co-transaminase (40mg wet cells/mL) from Vibrio fiuviaiis, Rhodobacter sphaeroides, or Paracoccus denitrificans.
- potassium phosphate buffer 100mM, pH 7.0
- pentaerythntol tetranitrate reductase 40mg wet cells/mL
- reaction samples (0.1 ml_) were diluted with 0.1 mL acetonitrile:water (1 : 1 , v/v). Aliquots (0.1 ml_) of the diluted reaction samples were treated with saturated aqueous sodium bicarbonate (0.01 mL) and Marfey's reagent (/V-a-(2,4-dinitro-5-fluorophenyl)alaninamide, 0.4mL of 5g/L solution in acetonitrile) at 40°C. After 1 h, the derivatization reactions were quenched with 0.1 mL 1 N aqueous hydrochloric acid.
- V. fluvialis aminotransferase Reduction of (E)-3-formyl-5-methylhex-3-enoic acid to 3-formyl-5-methylhexanoic acid with pentaerythntol tetranitrate reductase and in-situ conversion to pregabalin was evaluated with variants of V. fluvialis aminotransferase.
- Variants of V. fluvialis co- transaminase accesion number AEA39183
- the pET28b co-transaminase expression constructs were transformed into BL21 (DE3) E. coli (Stratagene, Agilent Technologies, Santa Clara, CA, USA) as directed and overnight cultures were grown in LB + kanamycin media.
- the LB cultures were used to inoculate expression cultures grown in Overnight Express Instant TB + kanamycin Medium (Novagen, EMD Chemicals, Gibbstown, NJ, USA). Cultures were incubated for 20h at 30°C, and the cells were harvested by centrifugation (4000 x g, 30m in, 4°C) and stored at -20°C.
- Reactions (0.5mL) were carried out at 30°C in potassium phosphate buffer (100mM, pH 7.0) with pentaerythntol tetranitrate reductase (40mg wet cells/mL), Lactobacillus brevis alcohol dehydrogenase (32U/mL), NADP + (0.1 mM), 2-propanol (3 vol%), pyridoxal phosphate (2mM), isopropylamine (300mM), (E)-3-formyl-5-methylhex-2-enoic acid (100mM) and V. fluvialis co-transaminase wild-type or variants (40mg wet cells/mL).
- reaction samples (0.02mL) were diluted with 0.18mL acetonitrile:water (1 : 1 , v/v). Aliquots (0.1 mL) of the diluted reaction samples were treated with saturated aqueous sodium bicarbonate (0.01 mL) and Marfey's reagent (/V-a-(2,4-dinitro-5- fluorophenyl)alaninamide, 0.4mL of 5 g/L solution in acetonitrile) at 40°C. After 1 h, the derivatization reactions were quenched with 0.1 mL 1 N aqueous hydrochloric acid.
- Vibrio fiuviaiis co-transaminase were expressed in E. coli as follows:
- the pET28b co-transaminase expression constructs were transformed into BL21 (DE3) E. coli (Stratagene, Agilent Technologies, Santa Clara, CA, USA) as directed and overnight cultures were grown in LB + kanamycin media.
- the LB cultures were used to inoculate expression cultures grown in Overnight Express Instant TB + kanamycin Medium (Novagen, EMD Chemicals, Gibbstown, NJ, USA). Cultures were incubated for 20 h at 30°C, and the cells were harvested by centrifugation (4000 x g, 30 min, 4°C) and stored at -20°C.
- the genes for the Pseudomonas putida benzoylformate decarboxylase, Enterobacter cloacae pentaerythritol tetranitrate reductase, Lactobacillus brevis alcohol dehydrogenase, and Vibrio fiuviaiis co-transaminase were cloned into expression vector pDSTRC52 (Pfizer Inc. , USA) and put into the expression strain E. coli BDG62 (Pfizer Inc. , USA). The culture was grown and enzyme production was induced as described in Example 22. Enzyme expression was determined by polyacrylamide gel electrophoresis using Novex gels and stains (Invitrogen Corporation Carlsbad, California).
- Reactions (1 .0ml_) were carried out at 40°C in phosphate buffer (100mM, pH 6.4) with P. putida decarboxylase, V. fiuviaiis transaminase, L. brevis alcohol dehydrogenase, E. cloacae pentaerythritol tetranitrate reductase, and NADP (0.1 mM) in one cell. 200 ⁇ _ 1 M 3-isobutylidene-2-oxopentanedioic acid, 100 ⁇ _ 1 mM ThDp + 25mM MgS04, 40 ⁇ _ 50mM PLP, 30 ⁇ _ isopropanol, 250 ⁇ _ 2M isopropylamine.
- the derivatized reaction samples were filtered and analyzed by UPLC (column: Agilent Eclipse Plus C18 column (100mm x 3.0mm, 1 .8 ⁇ ) eluted with 0.1 % trifluoroacetic acid in watenacetonitrile (60:40, v/v) at 1 .3ml_/min.
- the column was maintained at 30°C and the effluent was monitored at 340nm and ES + mass spectroscopy.
- the reaction yielded a small amount of Pregabalin of which 82% was the desired S-isomer.
- the genes for the Pseudomonas putida benzoylformate decarboxylase and Vibrio fiuviaiis co-transaminase were cloned into expression vector pDSTRC52 (Pfizer Inc., USA) and put into the expression strain E. coli BDG62 (Pfizer Inc., USA). The culture was grown and enzyme production was induced as described in Example 22. Enzyme expression was determined by polyacrylamide gel electrophoresis using Novex gels and stains (Invitrogen Corporation Carlsbad, California).
- Reactions (2.0ml_) were carried out at 40°C in phosphate buffer (100mM, pH 6.4) with 500 ⁇ _ of culture (42.5mg dry cell weight) from a 24 hour fermentation tanks with P. putida decarboxylase and V. fiuviaiis co-transaminase cloned in one plasmid, 400 ⁇ _ 0.5M 3-(2-methylpropyl)-2-oxopentanedioic acid, 200ul_ 10 x ThDP (final 0.1 mM) and MgS0 4 (final 2.5mM), 80 ⁇ _ 50mM PLP (final 2mM), 300 ⁇ _ 2M isopropylamine (final 0.3M).
- the derivatized reaction samples were filtered and analyzed by UPLC (column: Agilent Eclipse Plus C18 column (100mm x 3.0mm, 1 .8 ⁇ ) eluted with 0.1 % trifluoroacetic acid in watenacetonitrile (60:40, v/v) at 1 .3ml_/min.
- the column was maintained at 30°C and the effluent was monitored at 340nm and ES + mass spectroscopy.
- the reaction yielded 100 ⁇ g/mL of Pregabalin of which 65% was the desired S-isomer.
- Transaminase enzyme solution (12.5g), PLP (35mg), DIW (15ml_) and 4.0M isopropylamine.
- HCI aq soln (7.5ml_, 30mmol) were charged to a 100ml_ flask and warmed to 45°C.
- the hydrolysis reaction was added in one portion followed by DIW (6 ml_, used as a vessel rinse).
- the pH of the reaction was adjusted to 7.25 using neat isopropylamine and the reaction was stirred at 45°C until reaction completion.
- the reaction mixture was then heated to an internal temperature of 55°C and the pH adjusted to 4.0 using 95% formic acid.
- Darco carbon (125mg) was added and the mixture was allowed to cool to room temperature before cooling on ice/water for 20 minutes.
- Transaminase enzyme solution (12.5g), PLP (35mg), DIW (15ml_) and 4.0M isopropylamine.HCI solution (7.5ml_, 30mmol) were charged to a 100ml_ flask and warmed to 45°C.
- the hydrolysis reaction (see above) was added in one portion followed by DIW (6ml_, used as a vessel rinse).
- the pH of the reaction was adjusted to 7.25 using neat isopropylamine and the reaction was stirred at 45°C.
- Transaminase enzyme solution (10.4g), PLP (30mg), DIW (12.5ml_) and aq 4.0M isopropylamine.
- HCI aq soln (6.3ml_, 30mmol) were charged to a 100ml_ flask and warmed to 45°C.
- the hydrolysis reaction was added in one portion followed by DIW (5m L, used as a vessel rinse).
- the pH of the reaction was adjusted to 7.25 using neat isopropylamine and the reaction was stirred at 45°C.
- the reaction mixture was heated to an internal temperature of 55°C and adjusted to pH 4.0 using 95% formic acid.
- Darco carbon (125mg) was added and the mixture was allowed to cool to room temperature before being cooled on ice/water for 20 minutes.
- X 27 is selected from glutamine (Q) and glutamic acid (E);
- X 41 is selected from isoleucine (I) and valine (V);
- X 45 is selected from asparigine (N) and histidine (H);
- X 147 is selected from asparigine (N) and glutamine (Q);
- X 163 is selected from leucine (L) and methionine (M);
- X 165 is selected from tyrosine (Y) and histidine (H);
- X 180 is selected from threonine (T);
- X 304 is selected from alanine (A) and serine (S);
- X 324 is selected from glycine (G) and serine (S);
- X 401 is selected from lysine (K) and glutamic acid (E);
- X 408 is selected from threonine (T) and glutamine (Q
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Engineering & Computer Science (AREA)
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Enzymes And Modification Thereof (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Furan Compounds (AREA)
- Low-Molecular Organic Synthesis Reactions Using Catalysts (AREA)
- Steroid Compounds (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (20)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020157026688A KR20150121202A (ko) | 2013-03-27 | 2014-03-25 | 프레가발린의 제조를 위한 방법 및 중간체 |
| SG11201506998XA SG11201506998XA (en) | 2013-03-27 | 2014-03-25 | Process and intermediates for the preparation of pregabalin |
| HK16101742.1A HK1213882B (en) | 2013-03-27 | 2014-03-25 | Process and intermediates for the preparation of pregabalin |
| RU2015138545A RU2628298C2 (ru) | 2013-03-27 | 2014-03-25 | Способ и промежуточные соединения для получения прегабалина |
| CA2905411A CA2905411A1 (en) | 2013-03-27 | 2014-03-25 | Process and intermediates for the preparation of pregabalin |
| DK14717080.7T DK2978748T3 (en) | 2013-03-27 | 2014-03-25 | Process and intermediates for the preparation of pregabalin |
| AU2014240833A AU2014240833B2 (en) | 2013-03-27 | 2014-03-25 | Process and intermediates for the preparation of pregabalin |
| ES14717080.7T ES2630128T3 (es) | 2013-03-27 | 2014-03-25 | Procedimiento e intermedios para la preparación de pregabalina |
| US14/775,979 US20160024540A1 (en) | 2013-03-27 | 2014-03-25 | Process and Intermediates for the Preparation of Pregabalin |
| SI201430236A SI2978748T1 (sl) | 2013-03-27 | 2014-03-25 | Postopek in intermediati za pripravo pregabalina |
| EP14717080.7A EP2978748B1 (en) | 2013-03-27 | 2014-03-25 | Process and intermediates for the preparation of pregabalin |
| JP2016504807A JP2016516744A (ja) | 2013-03-27 | 2014-03-25 | プレガバリンの調製のための方法および中間体 |
| BR112015024859A BR112015024859A2 (pt) | 2013-03-27 | 2014-03-25 | processo e intermediários para a preparação de pregabalina |
| CN201480018083.5A CN105051022B (zh) | 2013-03-27 | 2014-03-25 | 用于制备普瑞巴林的方法和中间体 |
| BR122017006144A BR122017006144A2 (pt) | 2013-03-27 | 2014-03-25 | enzima transaminase e processo para a fabricação de ácido (s)-3-aminometil-5-metil-hexanoico |
| MX2015013589A MX2015013589A (es) | 2013-03-27 | 2014-03-25 | Proceso e intermediario para la preparacion de pregabalina. |
| IL241438A IL241438A0 (en) | 2013-03-27 | 2015-09-10 | Process and intermediates for the preparation of pregabalin |
| ZA2015/06798A ZA201506798B (en) | 2013-03-27 | 2015-09-14 | Process and intermediates for the preparation of pregabalin |
| AU2016203782A AU2016203782B2 (en) | 2013-03-27 | 2016-06-07 | Process and intermediates for the preparation of pregabalin |
| CY20171100622T CY1118945T1 (el) | 2013-03-27 | 2017-06-13 | Μεθοδος και ενδιαμεσα για την παρασκευη πρεγκαμπαλινης |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361805786P | 2013-03-27 | 2013-03-27 | |
| US61/805,786 | 2013-03-27 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014155291A1 true WO2014155291A1 (en) | 2014-10-02 |
Family
ID=50483187
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2014/060140 Ceased WO2014155291A1 (en) | 2013-03-27 | 2014-03-25 | Process and intermediates for the preparation of pregabalin |
Country Status (21)
| Country | Link |
|---|---|
| US (1) | US20160024540A1 (enExample) |
| EP (2) | EP3216863A1 (enExample) |
| JP (1) | JP2016516744A (enExample) |
| KR (1) | KR20150121202A (enExample) |
| CN (3) | CN105051022B (enExample) |
| AU (2) | AU2014240833B2 (enExample) |
| BR (2) | BR122017006144A2 (enExample) |
| CA (1) | CA2905411A1 (enExample) |
| CY (1) | CY1118945T1 (enExample) |
| DK (1) | DK2978748T3 (enExample) |
| ES (1) | ES2630128T3 (enExample) |
| HU (1) | HUE034834T2 (enExample) |
| IL (1) | IL241438A0 (enExample) |
| MX (1) | MX2015013589A (enExample) |
| PL (1) | PL2978748T3 (enExample) |
| PT (1) | PT2978748T (enExample) |
| RU (2) | RU2017125261A (enExample) |
| SG (1) | SG11201506998XA (enExample) |
| SI (1) | SI2978748T1 (enExample) |
| WO (1) | WO2014155291A1 (enExample) |
| ZA (1) | ZA201506798B (enExample) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016075082A1 (en) | 2014-11-10 | 2016-05-19 | Sandoz Ag | Stereoselective reductive amination of alpha-chiral aldehydes using omega-transaminases for the synthesis of precursors of pregabalin and brivaracetam |
| WO2016140799A1 (en) * | 2015-03-03 | 2016-09-09 | Ark Diagnostics, Inc. | Pregabalin immunoassays |
| EP3638688A1 (en) | 2017-06-14 | 2020-04-22 | Codexis, Inc. | Engineered transaminase polypeptides for industrial biocatalysis |
| US12037623B2 (en) | 2018-07-09 | 2024-07-16 | Merck, Sharp & Dohme LLC | Enzymatic synthesis of 4′-ethynyl nucleoside analogs |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2385983B1 (en) | 2009-01-08 | 2017-12-20 | Codexis, Inc. | Transaminase polypeptides |
| CN111004102B (zh) * | 2019-12-23 | 2022-11-04 | 万华化学集团股份有限公司 | 一种制备光学活性香茅醛的方法及用于该方法的催化剂 |
| CN118772033A (zh) * | 2024-06-11 | 2024-10-15 | 中国科学院成都生物研究所 | 一种普瑞巴林三聚体的合成方法 |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB834100A (en) | 1957-10-26 | 1960-05-04 | Eastman Kodak Co | Improvements in the preparation of mixed aldols |
| US5563175A (en) | 1990-11-27 | 1996-10-08 | Northwestern University | GABA and L-glutamic acid analogs for antiseizure treatment |
| US6001876A (en) | 1996-07-24 | 1999-12-14 | Warner-Lambert Company | Isobutylgaba and its derivatives for the treatment of pain |
| WO2003093220A1 (en) * | 2002-04-30 | 2003-11-13 | Warner-Lambert Company Llc | Process for preparing highly functionalized y-butyrolactams and y-amino acids |
| WO2008127646A2 (en) | 2007-04-11 | 2008-10-23 | Dsm Ip Assets B.V. | Transaminase-based processes for preparation of pregabalin |
| WO2010081053A2 (en) * | 2009-01-08 | 2010-07-15 | Codexis, Inc. | Transaminase polypeptides |
| WO2011086565A1 (en) | 2010-01-15 | 2011-07-21 | Lupin Limited | Method for preparation of enantiomerically enriched and/or racemic gamma-amino acids |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4239636A (en) * | 1978-10-23 | 1980-12-16 | Exxon Research & Engineering Co. | Thio-bis-(alkyl lactone acid esters) and thio-bis-(hydrocarbyl diacid esters) are useful additives for lubricating compositions |
| JPH06107597A (ja) * | 1992-03-12 | 1994-04-19 | Noguchi Kenkyusho | (R)−α−ヒドロキシ−β,γ−不飽和エステルの製造法 |
| US5268387A (en) * | 1992-04-24 | 1993-12-07 | Allergan, Inc. | Pharmaceutical compositions and method for administering 3 and 4-substituted 2(5H)-furanones to a mammal for inhibiting bone loss |
| JP2000500172A (ja) * | 1995-11-07 | 2000-01-11 | ミネソタ・マイニング・アンド・マニュファクチャリング・カンパニー | 開始剤系とそれを用いて製造した接着剤組成物 |
| SE9801992D0 (sv) * | 1998-06-04 | 1998-06-04 | Astra Ab | New 3-aryl-2-hydroxypropionic acid derivative I |
| US20070066846A1 (en) * | 2005-04-11 | 2007-03-22 | Asher Maymon | Process for making (S)-Pregabalin |
| MX2008002019A (es) * | 2005-08-11 | 2008-04-16 | Vertex Pharma | Moduladores del regulador de conductancia transmembrana de fibrosis quistica. |
| KR100846419B1 (ko) * | 2007-08-10 | 2008-07-15 | 한국과학기술원 | 프레가발린의 신규한 제조 방법 |
| CN101362696A (zh) * | 2008-09-27 | 2009-02-11 | 开原亨泰精细化工厂 | 3-氨甲基-5-甲基己酸即混旋普瑞巴林的制备新方法 |
-
2014
- 2014-03-25 CN CN201480018083.5A patent/CN105051022B/zh not_active Expired - Fee Related
- 2014-03-25 CN CN201710882505.9A patent/CN107556273A/zh active Pending
- 2014-03-25 ES ES14717080.7T patent/ES2630128T3/es active Active
- 2014-03-25 US US14/775,979 patent/US20160024540A1/en not_active Abandoned
- 2014-03-25 BR BR122017006144A patent/BR122017006144A2/pt not_active IP Right Cessation
- 2014-03-25 CN CN201710882572.0A patent/CN107746834A/zh active Pending
- 2014-03-25 KR KR1020157026688A patent/KR20150121202A/ko not_active Abandoned
- 2014-03-25 RU RU2017125261A patent/RU2017125261A/ru not_active Application Discontinuation
- 2014-03-25 EP EP17162642.7A patent/EP3216863A1/en not_active Withdrawn
- 2014-03-25 SG SG11201506998XA patent/SG11201506998XA/en unknown
- 2014-03-25 EP EP14717080.7A patent/EP2978748B1/en not_active Not-in-force
- 2014-03-25 MX MX2015013589A patent/MX2015013589A/es unknown
- 2014-03-25 HU HUE14717080A patent/HUE034834T2/en unknown
- 2014-03-25 DK DK14717080.7T patent/DK2978748T3/en active
- 2014-03-25 PT PT147170807T patent/PT2978748T/pt unknown
- 2014-03-25 PL PL14717080T patent/PL2978748T3/pl unknown
- 2014-03-25 RU RU2015138545A patent/RU2628298C2/ru not_active IP Right Cessation
- 2014-03-25 CA CA2905411A patent/CA2905411A1/en not_active Abandoned
- 2014-03-25 JP JP2016504807A patent/JP2016516744A/ja active Pending
- 2014-03-25 SI SI201430236A patent/SI2978748T1/sl unknown
- 2014-03-25 AU AU2014240833A patent/AU2014240833B2/en not_active Ceased
- 2014-03-25 WO PCT/IB2014/060140 patent/WO2014155291A1/en not_active Ceased
- 2014-03-25 BR BR112015024859A patent/BR112015024859A2/pt not_active IP Right Cessation
-
2015
- 2015-09-10 IL IL241438A patent/IL241438A0/en unknown
- 2015-09-14 ZA ZA2015/06798A patent/ZA201506798B/en unknown
-
2016
- 2016-06-07 AU AU2016203782A patent/AU2016203782B2/en not_active Ceased
-
2017
- 2017-06-13 CY CY20171100622T patent/CY1118945T1/el unknown
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB834100A (en) | 1957-10-26 | 1960-05-04 | Eastman Kodak Co | Improvements in the preparation of mixed aldols |
| US5563175A (en) | 1990-11-27 | 1996-10-08 | Northwestern University | GABA and L-glutamic acid analogs for antiseizure treatment |
| US6001876A (en) | 1996-07-24 | 1999-12-14 | Warner-Lambert Company | Isobutylgaba and its derivatives for the treatment of pain |
| WO2003093220A1 (en) * | 2002-04-30 | 2003-11-13 | Warner-Lambert Company Llc | Process for preparing highly functionalized y-butyrolactams and y-amino acids |
| WO2008127646A2 (en) | 2007-04-11 | 2008-10-23 | Dsm Ip Assets B.V. | Transaminase-based processes for preparation of pregabalin |
| WO2010081053A2 (en) * | 2009-01-08 | 2010-07-15 | Codexis, Inc. | Transaminase polypeptides |
| WO2011086565A1 (en) | 2010-01-15 | 2011-07-21 | Lupin Limited | Method for preparation of enantiomerically enriched and/or racemic gamma-amino acids |
Non-Patent Citations (1)
| Title |
|---|
| KIENZLE, F. ET AL., HELV. CHIM. ACTA, vol. 68, no. 5, 1985, pages 1133 - 39 |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016075082A1 (en) | 2014-11-10 | 2016-05-19 | Sandoz Ag | Stereoselective reductive amination of alpha-chiral aldehydes using omega-transaminases for the synthesis of precursors of pregabalin and brivaracetam |
| WO2016140799A1 (en) * | 2015-03-03 | 2016-09-09 | Ark Diagnostics, Inc. | Pregabalin immunoassays |
| US9958464B2 (en) | 2015-03-03 | 2018-05-01 | Ark Diagnostics, Inc. | Pregabalin immunoassays |
| US11703514B2 (en) | 2015-03-03 | 2023-07-18 | Ark Diagnostics, Inc. | Pregabalin immunoassays |
| EP3638688A1 (en) | 2017-06-14 | 2020-04-22 | Codexis, Inc. | Engineered transaminase polypeptides for industrial biocatalysis |
| EP3638688A4 (en) * | 2017-06-14 | 2021-07-07 | Codexis, Inc. | MODIFIED TRANSAMINASE POLYPEPTIDES INTENDED FOR INDUSTRIAL BIOCATALYSIS |
| US11359183B2 (en) | 2017-06-14 | 2022-06-14 | Codexis, Inc. | Engineered transaminase polypeptides for industrial biocatalysis |
| US12297462B2 (en) | 2017-06-14 | 2025-05-13 | Codexis, Inc. | Engineered transaminase polypeptides for industrial biocatalysis |
| US12037623B2 (en) | 2018-07-09 | 2024-07-16 | Merck, Sharp & Dohme LLC | Enzymatic synthesis of 4′-ethynyl nucleoside analogs |
Also Published As
| Publication number | Publication date |
|---|---|
| DK2978748T3 (en) | 2017-07-24 |
| BR122017006144A2 (pt) | 2019-09-03 |
| CN107556273A (zh) | 2018-01-09 |
| CA2905411A1 (en) | 2014-10-02 |
| CN105051022B (zh) | 2017-10-27 |
| ZA201506798B (en) | 2019-05-29 |
| MX2015013589A (es) | 2016-06-23 |
| BR112015024859A2 (pt) | 2017-10-10 |
| PL2978748T3 (pl) | 2017-09-29 |
| PT2978748T (pt) | 2017-07-06 |
| SI2978748T1 (sl) | 2017-07-31 |
| IL241438A0 (en) | 2015-11-30 |
| CN107746834A (zh) | 2018-03-02 |
| JP2016516744A (ja) | 2016-06-09 |
| RU2015138545A (ru) | 2017-05-03 |
| KR20150121202A (ko) | 2015-10-28 |
| AU2016203782A1 (en) | 2016-06-23 |
| AU2014240833B2 (en) | 2016-07-07 |
| HUE034834T2 (en) | 2018-03-28 |
| CN105051022A (zh) | 2015-11-11 |
| RU2628298C2 (ru) | 2017-08-15 |
| CY1118945T1 (el) | 2018-01-10 |
| RU2017125261A (ru) | 2019-01-31 |
| SG11201506998XA (en) | 2015-10-29 |
| EP3216863A1 (en) | 2017-09-13 |
| US20160024540A1 (en) | 2016-01-28 |
| EP2978748A1 (en) | 2016-02-03 |
| ES2630128T3 (es) | 2017-08-18 |
| HK1213882A1 (zh) | 2016-07-15 |
| AU2014240833A1 (en) | 2015-10-01 |
| AU2016203782B2 (en) | 2017-06-01 |
| EP2978748B1 (en) | 2017-05-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2016203782B2 (en) | Process and intermediates for the preparation of pregabalin | |
| WO2016068108A1 (ja) | ε-カプロラクタムの製造方法 | |
| Reznikov et al. | Enantioselective synthesis of γ-aminobutyric acid derivatives by Ni (II)-catalyzed reaction of diethyl malonate with nitroalkenes | |
| JP6370712B2 (ja) | cis−5−ヒドロキシ−2−ピペリジンカルボン酸誘導体の製造方法およびcis−5−ヒドロキシ−2−ピペリジンカルボン酸の精製方法 | |
| Hélaine et al. | Synthesis of 4, 4‐disubstituted L‐glutamic acids by enzymatic transamination | |
| US9394235B2 (en) | Optical resolution methods for bicyclic compounds using enzymes | |
| JP2011236212A (ja) | スタチンの調製方法 | |
| CA2998303A1 (en) | Method for producing .sigma.-caprolactam | |
| Pirrung et al. | Kinetic mechanism and reaction pathway of Thermus thermophilus isopropylmalate dehydrogenase | |
| ME00005B (me) | Dobijanje gama-aminokiselina sa afinitetom za alfa-delta protein | |
| JP2003096068A (ja) | 3−ヒドロキシ−γ−ブチロラクトンの製造法 | |
| HK1213882B (en) | Process and intermediates for the preparation of pregabalin | |
| WO2012025861A1 (en) | Process for the preparation of ( s ) - 3 - cyano - 5 - methylhexanoic acid derivatives adn of pregabalin | |
| HK1205192B (en) | Optical resolution method for bicyclic compound using enzyme |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201480018083.5 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14717080 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 241438 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14775979 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2905411 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2015/013589 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2016504807 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20157026688 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REEP | Request for entry into the european phase |
Ref document number: 2014717080 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014717080 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2014240833 Country of ref document: AU Date of ref document: 20140325 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2015138545 Country of ref document: RU Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015024859 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112015024859 Country of ref document: BR Kind code of ref document: A2 Effective date: 20150928 |