WO2013024059A2 - Modified proteins and peptides - Google Patents
Modified proteins and peptides Download PDFInfo
- Publication number
- WO2013024059A2 WO2013024059A2 PCT/EP2012/065782 EP2012065782W WO2013024059A2 WO 2013024059 A2 WO2013024059 A2 WO 2013024059A2 EP 2012065782 W EP2012065782 W EP 2012065782W WO 2013024059 A2 WO2013024059 A2 WO 2013024059A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- dab
- variable domain
- amino acid
- immunoglobulin variable
- extension
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/42—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/02—Nasal agents, e.g. decongestants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
- A61P31/06—Antibacterial agents for tuberculosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/64—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the present invention relates to modified proteins and peptides that have reduced ability to bind to pre-existing antibodies.
- modified protein/peptide molecules can comprise C-terminal additions, extensions or tags and/or certain amino acid substitutions.
- modified protein/peptide molecules may comprise antigen binding molecules, such as antibodies, antibody fragments, and single variable domains e.g. human immunoglobulin (antibody) single variable domains, and also single variable domains derived from non-human sources such as llama or camel, e.g. a VHH including a NanobodyTM (e.g. as described in WO 94/04678 and WO 95/04079 inter alia).
- T e invention further relates to uses, formulations, compositions comprising such modified C-terminally extended and/or amino acid substituted molecules and also to methods of production and expression of these molecules.
- Naturally occurring autoantibodies exist in humans that can bind to proteins e.g. to host immunoglobulins or immunoglobulin fragments e.g. Rheumatoid factor (which bind epitopes in the Fc region of antibodies), anti-idiotype autoantibodies (which bind antibody variable/CDR regions) and anti-hinge autoantibodies (which bind the hinge region of the Ig constant domain in Fab fragments).
- Rheumatoid factor which bind epitopes in the Fc region of antibodies
- anti-idiotype autoantibodies which bind antibody variable/CDR regions
- anti-hinge autoantibodies which bind the hinge region of the Ig constant domain in Fab fragments.
- These autoantibodies may be part of a polyclonal repertoire of anti-immunoglobulin (Ig) autoantibodies with specificity to epitopes throughout the Ig molecule that are present in both humans and non-human primates.
- Ig anti-immunoglobulin
- RF rheumatoid factors
- the presence of anti-idiotypic autoantibodies that bind to variable CDR regions of IgG, and anti-hinge antibodies that react with cryptic epitopes in the C terminal hinge regions of Fab or F0Ab 2 fragments has also been observed.
- the functional role of these different anti-IgG autoantibodies remains uncertain.
- Rheumatoid factor and anti-hinge autoantibodies have been linked with certain pathological conditions, such as autoimmunity and certain infections while anti-idiotypic antibodies may confer protection from autoantibodies in certain autoimmune diseases. Furthermore, an immunoregulatory role for anti- IgG autoantibodies, has been proposed wherein these autoantibodies control the stimulation of autoreactive B cells and regulate immune responses to foreign antigens.
- Anti-hinge antibodies are anti-IgG autoantibodies that react with cleaved but not intact IgG. Their high prevalence in the normal human population implicates previous exposure to IgG fragments, possibly as a result of cleavage of IgG by bacterial or endogenous proteases.
- autoantibodies can also bind to proteins or peptides which are administered to a subject for treatment.
- Pre-existing antibodies which bind to molecules such as therapeutic proteins and peptides, administered to a subject can affect their efficacy and could result in administration reactions, hypersensitivity, altered neutralizing the molecule.
- existence of these antibodies may be less significant during drug treatment than in other instances.
- ADAs anti-drug antibodies
- VH and VL domain antibodies are derived from fully human framework sequences and although in silico predictions describe a markedly low incidence of potentially immunogenic peptides, it is possible that these domain antibodies may be immunogenic in humans i.e. they could elicit ADAs, and they could bind to pre-existing ADAs depending on both sequence dependent and sequence independent factors.
- VHH Camelid heavy chain
- molecules for therapy which comprise proteins, or peptides, for example antigen binding molecules, which have reduced ability to bind to pre-existing ADAs when administered to a subject, in particular a human subject
- a specific immunoassay was developed as described herein and validated to detect anti-drug antibodies to the VH dAb DOM1H-131-206 (amino acid sequence shown in SEQ ID NO 1) in humans.
- a panel of 60 healthy human donor serum samples was screened for background reactivity in the assay. It was determined that approximately 45% of serum samples from these subjects had detectable antibodies, which were able to bind to DOM1H-131-206.
- This reactivity appears specific to a neo epitope, or epitopes, within the VH dAb framework sequence, since the response was cross-reactive with the VH frameworks of dAbs binding various target antigens, but not with full human IgG.
- Pre-existing ADA to VL dAbs was also observed in serum samples from healthy human donors but to a lower extent than VH.
- the three dimensional conformation of the dAb C-terminus can be altered by the addition of further amino acid residues (C-terminal extension) and/or by substituting the amino acid residues present at one or more of positions 14, 41, 108, 110 and 112 in VH dAbs.
- the present invention thus provides modified molecules that have reduced ability to bind to (pre-existing) ADAs as compared to the unmodified molecule and are suitable for administration to a subject e.g. a human subject for therapy or prophylaxis.
- reduced ability to bind is meant that the molecule binds with a reduced affinity or reduced avidity to a pre-existing ADA.
- Such molecules comprise proteins, or peptides, for example antigen binding proteins, e.g. antibodies, antibody fragments, and single variable domains e.g. human immunoglobulin (antibody) single variable domains (VH or VL), and also single variable domains derived from non-human sources such as llama or Camelid, e.g.
- a Camelid VHH including a Nanobody TM (described for example in WO 94/04678 and WO 95/04079 inter alia).
- Said molecules comprise one or more modifications selected from: (a) a C-terminal addition, extension, deletion or tag, and/or (b) one or more amino acid framework substitutions.
- the modified molecules described herein and pharmaceutical compositions comprising these modified molecules can have an enhanced safety profile and fewer side effects than the unmodified molecules e.g. unmodified dAbs, which do not comprise a C terminal extension, addition, deletion or tag and/or other framework modification, to reduce pre-existing ADA binding.
- administration of the modified molecules described herein or of pharmaceutical compositions comprising these modified molecules can lead to modified immunogenicity and can also result in improved efficacy and an improved safety profile and e.g. can be advantageously used for repeat dosing to patients who could develop autoantibodies to the unmodified molecules e.g. dAbs.
- a single immunoglobulin variable domain which comprises one or more modifications selected from: (a) a C-terminal extension which comprises an amino acid extension of from one amino acid to 5 amino acids; or (b) one or more amino acid framework substitutions wherein at least one substitution is a substitution selected from: a P14A substitution, a P41A substitution and a L108A substitution.
- a C-terminal extension of from one to 4 amino acids is provided.
- said C-terminal extension comprises an amino acid which is alanine, and which has reduced binding to pre-existing ADAs compared to the unmodified single immunoglobulin variable domain (dAb).
- the C terminal extension can be an extension of 1-15 amino acids e.g. 1 to 8 amino acids or 1, 1-2, 1-3, 1-4, 1-5, 1-6, 1-7 amino acids.
- an extension of 1 to 8 amino acids, or 1, 1-2, 1-3, 1-4, 1-5, 1-6, 1-7 amino acids which comprises an alanine residue for example a single alanine extension, or an AS, AST, ASTK, ASTKG, ASTKGP extension.
- an extension of 1-5 amino acids is provided or an extension of 1-4 amino acids.
- the modified single immunoglobulin variable domain can also comprise an amino acid deletion.
- immunoglobulin variable domain can be selected from a human VH, or human VL dAb or a Camelid VHH.
- the C-terminal extension can be present as a direct fusion or a conjugate with the C terminus of the dAb.
- the invention provides a single immunoglobulin variable domain (dAb) wherein (i) said dAb is a human VH or a Camelid VHH and said C terminal extension comprises an amino acid extension selected from (a) A (b) AS, (c) AST (d) ASTK, (e) ASTKG (f) AAA or (g) T; and wherein (ii) said dAb is a human VL (such as a V kappa) and said C terminal extension comprises an amino acid extension selected from (a) AAA, (b) A (c) TV (d) T.
- dAb single immunoglobulin variable domain
- the invention also provides a single immunoglobulin variable domain (dAb) which monovalently binds to a target antigen, comprising:
- CDR complementarity determining
- n an integer independently selected from 0 or 1;
- p and q each represent 0 or 1 such that when p represents 1 q may be 0 or 1 and such that when p represents 0, q also represents 0;
- X may be present or absent, and if present represents an amino acid extension of 1 to 8 amino acids residues;
- n is 0 and/or the dAb ending in VTVS(S) n comprises one or more of said amino acid substitutions;
- p and/or q is 0, and/or the dAb ending in VEIKpRqX comprises one or more of said amino acid substitutions.
- KD refers to the equilibrium dissociation constant. A skilled person will appreciate that the smaller the KD numerical value, the stronger the binding. about ⁇ to about 50nM.
- said single immunoglobulin variable domain has a lower binding affinity and/or avidity for an anti-drug antibody (ADA) than an equivalent dAb wherein said equivalent dAb has the same sequence as said single immunoglobulin variable domain except that X is absent, n , P and q are 1 and there are no amino acid substitutions.
- said single immunoglobulin variable domain is one wherein said C terminal sequence consists of the sequence VTVSSX.
- said single immunoglobulin variable domain is one wherein said C terminal sequence consists of the sequence VEIKRX.
- said single immunoglobulin variable domain has one or more amino acid substitutions selected from the group consisting of: a P14A substitution, a P41A substitution, a L108A substitution, a T110A substitution and a S112A substitution.
- X is present, and is an extension of 1 to 8 amino acids or 1, 1-2, 1-3, 1-4, 1-5, 1-6, 1-7 amino acids, in particular an extension of 1 to 8 amino acids, or 1, 1-2, 1-3, 1-4, 1-5, 1-6, 1-7 amino acids which comprises an alanine residue, for example a single alanine extension, or an AS, AST, ASTK, ASTKG, ASTKGP extension.
- said dAb is a VH, or VL dAb or a Camelid VHH.
- the invention also provides an amino acid sequence which is any one of the unmodified single immunoglobulin variable domain (dAb) sequences described herein (for example SEQ ID NOs 1-6, 10-13) which is then modified to reduce binding to ADAs as described herein, for example an unmodified single immunoglobulin variable domain sequence described herein which is modified such that X is present, and is an extension of 1 to 8 amino acids, in particular an extension of 1 to 8 amino acids which comprises an alanine residue, for example a single alanine extension, or an AS, AST, ASTK, ASTKG, ASTKGP extension and/or said single immunoglobulin variable domain has one or more amino acid substitutions wherein said one or more amino acid substitutions are selected from the group consisting of a P14A substitution, a P41A substitution, a L108A substitution, a T110A substitution and a S112A substitution.
- dAb unmodified single immunoglobulin variable domain
- the invention provides a single immunoglobulin variable domain which is a human VH or a Camelid VHH and said C terminal extension comprises an amino acid extension selected from: (a) AS, (b) AST (c) ASTK, (d) ASTKG (e) AAA or (f) T or (g) ASTKGP , and/or wherein there is an amino acid deletion from the dAb ending in VTVS(S) n and said deletion is a -S deletion.
- the invention provides a single immunoglobulin variable domain which is a human VL e.g. V kappa, and wherein said C terminal extension comprises an amino acid extension selected from: (a) AAA (b) A (c) TV and (d) T, and/or wherein there is an amino acid deletion from the dAb ending in VEIKR and said deletion is a -R deletion.
- sequence for a VL dAb is VEIKRAAA or VEIKRT, antigen binding constructs comprising two dAbs separated by a single chain Fc region of an antibody, wherein each dAb is capable of binding to VEGF, are excluded.
- the dAbs modified to reduce binding to ADA as described herein e.g.
- VH, VL such as V kappa and VHH have a KD of binding to ADA which is 150% or more (e.g. 200%, 250%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650% or more) of the KD of an equivalent but unmodified single immunoglobulin variable domain (dAb) sequence.
- dAb modified as described herein to have reduced ADA binding and which has reduced binding to ADAs as determined using a confirmation assay as described in Example 2 and where said modified dAb has a mean % inhibition of signal which is less than 90%, e.g. less than 80%, e.g. less than 70%, e.g. less than 60% , e.g.
- control (unmodified) dAb has the same or similar sequence but is not modified to reduce ADA binding.
- the present invention also provides an immunoglobulin single variable domain (dAb) of the invention for use in a method of therapy, for example for use in a method of preventing side effects.
- dAb immunoglobulin single variable domain
- the dAb is an antagonist of the target e.g. a target selected from TNFa, TNF receptor, TNF receptor 1 (TNFR1), VEGF, IL-1R, IL-6R, IL-4, IL-5, IL-13, DC-SIGN, ASGPR, albumin, and TGF R2.
- the target is a receptor, or in particular a receptor which is polymeric or a receptor which dimerizes on activation, for example the TNF receptor.
- the dAb modified as described herein such that it has reduced binding to ADAs is to be used in a treatment regimen which involves repeated dosing.
- the invention provides a single immunoglobulin variable domain (dAb) wherein the target is TNFR1, and which is dAb selected from any of the following amino acid sequences identified as: (a) DOMlh-131-206 dAb with an extension of a single alanine at the C terminus (SEQ ID NO 16) ; (b) DOMlh-131-206 dAb with an extension of a single alanine at the C terminus and a P14A framework mutation (SEQ ID NO 17); (c) DOMlh-131-206 dAb with a P14A framework mutation (SEQ ID NO 18); (d) DOMlh-131-206 dAb with an ASTKG C terminus extension (SEQ ID NO 19); and (e) DOMlh-131-206 dAb with an ASTKG C terminus extension and a P14A amino acid framework mutation (SEQ ID NO 20).
- the invention also provides an (unmodified) dAb which is selected from a sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to any one of the amino acid sequences identified as: DOMlh-131-206 (SEQ ID NO 1), DOM lh-131-511 (SEQ ID NO 2), DOM lh-131-202 (SEQ ID NO 3) and which further comprises any including e.g. any of the modifications described herein which reduce binding to ADAs, e.g. a single alanine C- terminus extension.
- the invention also comprises any one of the molecules described herein (e.g.
- such molecules can be for example any one of the Vh- Vk dAb-Fc-dAbs in Example 12, or any of the mAbdAbs described herein e.g. in the examples herein.
- the invention provides an anti-IL13 dAb, for example a dAb with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to any one of the amino acid sequences identified as: (a) DOM10h-53-567 (SEQ ID NO 13) or (b) DT04-H- 033 (SEQ ID NO 12) ; and which amino acid sequence further comprises any of the modifications described herein which reduce binding to ADAs e.g. a single alanine C-terminus extension.
- the invention also provides an anti-TNFRldAb, for example a dAb with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to the amino acid sequences identified as: DOMlh-574-208 (SEQ ID NO 10); and which further comprises any of the modifications described herein which reduce binding to ADAs, e.g. a single alanine C- terminus extension.
- the invention also provides an anti-TNFRldAb-VL fusion, for example with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to the amino acid sequences identified as: DOMlh-574-208-VL fusion (SEQ ID NO 11) ; and which further comprises any of the modifications described herein which reduce binding to ADAs e.g. a single (or a triple) alanine extension present at the C-terminus of the fusion molecule.
- the invention also provides a mAbdAb which is an anti-IL13mAb: IL-4 V kappa dAb which further comprises any of the modifications described herein which reduce binding to ADAs ;
- the mAbdAb can comprise a heavy chain sequence with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to the amino acid sequences identified as: mAb-VL 735 heavy chain molecule SEQ ID NO 30 ; and a light chain sequence identified as 735 light chain sequence SEQ ID NO 31; and which further comprises any of the modifications described herein which reduce binding to ADAs e.g. a single (or a triple) alanine extension.
- the invention also provides a mAbdAb which is an anti-IL13mAb: IL-4 V kappa dAb designated mAb-VL 15014 modified to reduce binding to ADAs as described herein, wherein the mAbdAb comprises (a) a heavy chain-linker-V kappa sequence with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to the amino acid sequences identified as SEQ ID NO 32; and (b) a light chain sequence with an amino acid sequence # , , , , , , , , ,
- the invention also provides a mAbdAb which is an anti-IL13mAb: IL-4 V kappa dAb designated mAb-VL 15019 modified to reduce binding to ADAs as described herein, wherein the mAbdAb comprises (a) a heavy chain-linker-V kappa sequence with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to the amino acid sequences identified as SEQ ID NO 34; and (b) a light chain sequence with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to the amino acid sequences identified as SEQ ID NO 35.
- the invention also provides a mAbdAb which is an anti-IL13mAb: IL-4 V kappa dAb designated mAb-VL 15020 modified to reduce binding to ADAs as described herein, wherein the mAbdAb comprises (a) a heavy chain-linker-V kappa sequence with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to the amino acid sequences identified as SEQ ID NO 36; and (b) a light chain sequence with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to the amino acid sequences identified as SEQ ID NO 37.
- the invention also provides a mAbdAb which is an anti-IL13mAb: IL-4 V kappa dAb designated mAb-VL 15021 modified to reduce binding to ADAs as described herein, wherein the mAbdAb comprises (a) a heavy chain-linker-V kappa sequence with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to the amino acid sequences identified as SEQ ID NO 38; and (b) a light chain sequence with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to the amino acid sequences identified as SEQ ID NO 39.
- the invention also provides a VHH sequence with any one of the modifications described herein to reduce binding to ADAs, for example a VHH with an amino acid sequence that is 100%, 99.5%, 99%, 98%, 97%, 96%, 95%, 90%, 85% or 80% identical to any one of the amino acid sequences identified as SEQ ID NO 7-9.
- the invention also provides nucleic acids encoding any one of the dAbs of the invention e.g. any one of the nucleic acids described herein e.g. any one of the nucleic acid sequences shown in Figure 9 (SEQ ID NOs 21-23) or Figure 10 (SEQ ID NOs 24-29).
- the invention provides a nucleic acid (SEQ ID NO 22) which encodes the DOMlh-131-206 dAb with an extension of a single alanine at the C-terminus, a vector comprising the nucleic acid (SEQ ID NO 22) and it also provides also a host cell, e.g.
- an E.coli host cell expressing the nucleic acid (SEQ ID NO 22), or a vector such as the PaveOll (from Fujifilm Diosynth) expressing SEQ ID NO 22.
- a method of producing the DOMlh-131-206 dAb with an extension of a single alanine at the C- terminus which comprises maintaining a host cell such as E.coli comprising a vector such as PaveOll (or nucleic acid) encoding nucleic acid (SEQ ID NO 22) under conditions suitable for expression of the extended dAb thereby producing the polypeptide. . .
- compositions comprising a dAb according to any aspect or embodiment of the invention e.g. in combination with a pharmaceutically or physiologically acceptable carrier(s), excipient(s) or diluents(s).
- the invention further provides uses of the dAbs of the invention for therapy or medicine and uses to treat or prevent diseases or disorders.
- anti-TNFRl dAbs with reduced ADA binding e.g. the DOMlh-131-206 dAb modified as described herein to reduce ADA binding (e.g. those with amino acid sequences shown in Figure 8a-8e: SEQ ID NOS 16-20).
- the invention provides use of the DOMlh-131-206 dAb with a C terminal alanine extension (SEQ ID NO 16) for use in therapy or medicine or as a medicament, e.g. to treat or prevent an inflammatory disease or disorder or a respiratory or pulmonary disease or disorder such as Acute lung injury (ALI) and Acute Respiratory Distress syndrome (ARDS) and complications thereof.
- ALI Acute lung injury
- ARDS Acute Respiratory Distress syndrome
- the invention also provides nucleic acids encoding the dAbs of the invention with reduced ADA binding and vectors and host cells comprising these nucleic acids. Also provided are methods of producing the dAbs of the invention comprising expressing the encoding vectors and nucleic acids in host cells e.g. microbial host cells such as E.coli.
- the invention provides formulations comprising the dAbs of the invention with reduced ADA binding, for example nebulisable formulations for pulmonary delivery.
- nebulisers or inhaler devices comprising the dAbs of the invention e.g. any one of the anti-TNFRl dAbs e.g. those with amino acid sequences shown in Figure 8a-8e: SEQ ID NOS 16-20, for example the DOMlh-131-206 dAb with a C terminal alanine extension (SEQ ID NO 16).
- the invention provides the unmodified DOMlh-131-206 dAb (SEQ ID NOl) or the DOMlh-131-206 dAb modified in any of the ways described herein to reduce ADA binding e.g the DOMlh-131-206 dAb with an extension of a single alanine at the C-terminus (SEQ ID NO 16), to treat an inflammatory skin disorder e.g. psoriasis.
- Another aspect of the disclosure is a method of treating psoriasis in a human comprising the steps of a) identifying a human with psoriasis; and b) administering a therapeutically effective amount of a domain antibody (e.g. the unmodified DOMlh-131-206 dAb (SEQ ID NOl) or the DOMlh-131-206 dAb modified in any of the ways described herein to reduce ADA binding e.g the DOMlh-131-206 dAb with an extension of a single alanine at the C-terminus (SEQ ID NO 16) to a psoriatic plaque on the human with psoriasis; whereby the psoriasis is treated.
- a domain antibody e.g. the unmodified DOMlh-131-206 dAb (SEQ ID NOl) or the DOMlh-131-206 dAb modified in any of the ways described herein to reduce ADA binding e.g the DOMlh-13
- the domain antibody can be the unmodified DOMlh-131-206 dAb (SEQ ID NOl) or the DOMlh-131-206 dAb modified in any of the ways described herein to reduce ADA binding e.g the DOMlh-131-206 dAb with an extension of a single alanine at the C-terminus (SEQ ID NO 16).
- the invention also provides a tool mAb (for example the tool mAb as described in Example 19 and with the amino acid sequence given in Figure 6: SEQ ID NOs 14 and 15).
- the tool mAb was generated using standard mouse monoclonal antibody technology i.e. mice were immunised with DOM 1H-131-206 (SEQ ID NOl), spleens were collected and hybridoma cell lines were generated, the hybridomas expressing antibody were then cloned and the resulting antibody isolated and sequenced using standard techniques.
- the tool mAb is one which binds to the VH dAb framework and thereby reduces binding of the VH dAbs to ADAs.
- the tool mAb appears to bind to a similar epitope on the VH framework to the human anti-VH ADA.
- the tool mAb can be useful for example it can be used to test modified dAbs (VH, VHH,) and to determine which modifications to the dAb prevent or reduce binding of the dAb to the tool mAb. Modifications to the VH dAbs which prevent binding to the tool mAb will also prevent or reduce binding of VH dAbs to the ADAs.
- the invention provides any dAbs which are modified (e.g. by any of the modifications described herein) to prevent or reduce binding to the tool mAb.
- the invention also provides a method of using a tool mAb (for example the tool mAb described in Example 19 and with the amino acid sequence given in Example 19 and also in Figure 6: SEQ ID NOs 14 and 15) in an assay to test dAbs e.g. modified dAbs (e.g. (VH, VHH), e.g. any of those described herein e.g.
- a tool mAb for example the tool mAb described in Example 19 and with the amino acid sequence given in Example 19 and also in Figure 6: SEQ ID NOs 14 and 15
- modified dAbs e.g. (VH, VHH), e.g. any of those described herein e.g.
- the dAbs e.g. (VH, VHH) are modified to reduce binding to the tool mAb as described herein and have a KD of binding to the tool mAb which is 150% or more (e.g. 200%, 250%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650% or more) of the KD of an equivalent dAb sequence which has not been modified.
- the invention also provides any dAbs identified by this screening assay.
- the invention also provides use of the tool mAb (for example the tool mAb described in Example 19 and with the amino acid sequence given in Figure 6: SEQ ID NOs 14 and 15) in an assay method to quantify how much dAb (e.g. VH, VHH), is present in a tissue sample or plasma sample.
- dAb e.g. VH, VHH
- Figure 1 shows Frequency of pre-existing anti-drug antibodies in sera of a panel of healthy human subjects
- Figure 2 shows amino acid sequences of unmodified anti-TNFRl dAbs identified as (a) (unmodified) DOM 1H-131-206 (SEQ ID NO 1) (b) (unmodified) DOM 1H-131-511 (SEQ ID NO 2) (c) .
- Figure 3 shows a model crystal structure of DOMlH-131-206 with residues highlighted that impact on ADA binding when mutated. Modelling of surface residues was undertaken and the resulting mutants were screened in the ADA assay for binding to pre-existing ADAs (e.g. as described in Example 2). Residues indicated as 14 and "C term" were found to have a strong impact on ADA binding when mutated, residues indicated as 112, 110, 108 and 41 were found to have a moderate impact on ADA binding when mutated and residues indicated as 13, 11, 91, 43, 44, 83 and 84 were found to have a weak impact on ADA binding when mutated.
- Figure 4 Shows the abrogation of binding to ADAs caused by the addition of a single alanine amino acid residue extension to VHH clones 2(d), 2(e) and 2(f).
- Figure 5 shows levels of binding to ADA s and of V H dAbs or V L dAbs or molecules comprising these dAbs.
- Figure 6a and 6b shows the amino acid sequences of the tool mAb (M2.3G10.1G06), figure 6a shows the light chain sequence (SEQ ID NO 14) ; and figure 6b shows the heavy chain sequence.
- the CDRs are shown underlined in the figure (SEQ ID NO 15) .
- Figure 7 shows competition assay signal (x-axis) in the presence of serum samples from subjects with a range of pre-existing anti-VH ADA signal. Serum from a range of human donors with preexisting anti-VH ada competes with anti-VH mAb M2.3G10.1G06 for binding to DOM 1H-131-206 resulting in inhibition of competition assay signal.
- Figure 8 shows the amino acid sequences of modified TNFR1 dAbs identified as : (a) DOMlh-131- 206 dAb with an extension of a single alanine (SEQ ID NO 16) ; (b) DOMlh-131-206 dAb with an extension of a single alanine and a P14A framework mutation (SEQ ID NO 17) ; (c) DOMlh-131- .
- Figure 9 shows the nucleic acid sequences of TNFR1 dAbs (a) DOMlh-131-206 dAb (SEQ ID NO 21) (b) DOMlh-131-206 dAb with an extension of a single alanine at the C terminus (SEQ ID NO 22) (c) DOMlh-131-206 dAb with a C terminus extension of ASTKG (SEQ ID NO 23) .
- Figure 10 shows the nucleic acid sequences encoding (a) VHH sequence having the amino acid sequence shown in Figure 2d (SEQ ID NO 24) (b) VHH sequence having the amino acid sequence shown in Figure 2e (SEQ ID NO 25); (c) VHH sequence having the amino acid sequence shown in Figure 2f (SEQ ID NO 26) , (d) VHH sequence which is a bispecific format, having an IL6R binding module linked by GGGGSGGGS to a human serum albumin binding module with an extension of a single alanine (SEQ ID NO 27), (e) VHH sequence with the amino acid sequence shown in 2e further comprising an extension of a single alanine (SEQ ID NO 28), (f) VHH sequence with amino acid sequence shown in 2f further comprising an extension of a single alanine (SEQ ID NO 29) .
- Figure 11 shows amino acid sequences of mAb:VL dAbs (IL-13mAb: IL-4Vkappa dAb molecules): (a) mAb-VL 735 molecule (IL-13mAb: IL-4Vkappa dAb) (SEQ ID NOs 30 and 31) , (b) mAb-VL 150154 (SEQ ID NOs 32 and 33), (c) mAb-VL 15019 (SEQ ID NOs 34 and 35), (d) ) mAb-VL 15020 (SEQ ID NOs 36 and 37), (e) mAb-VL 15021 (SEQ ID NOs 38 and 39).
- Figure 12 shows amino acid sequences of (a) DMS30045: DOM15-26-597 dAb N-(VEPKSSDK linker) & C-terminal K-044-085 dAb ((TGLDSP)x4) (SEQ ID NO 40), (b) DMS30046: DMS1576 with C- terminal K-044-085 dAb ((TGLDSP)x4) (SEQ ID NO 41), (c) DMS30047 (contains modified C terminus) : DOM15-26-597 dAb N-(VEPKSSDK linker) & C-terminal K-044-085 dAb minus C-term R ((TGLDSP)x4) (SEQ ID NO 42) , (d) DMS30048 (contains modified C terminus): DOM15-26-597 dAb N-(VEPKSSDK linker) & C-terminal K-044-085 dAb +A ((TGLDSP)x4) (SEQ ID NO 43), (e) DMS30049 (
- Affinity is the strength of binding of one molecule, e.g. an antigen binding protein of the invention, to another, e.g. its target antigen, at a single binding site.
- the binding affinity of an antigen binding protein to its target may be determined by standard equilibrium methods (e.g. enzyme-linked immunoabsorbent assay (ELISA) or radioimmunoassay (RIA)), or kinetics (e.g. BIACORETM analysis).
- epitope refers to that portion of the antigen that makes contact with a particular binding domain of the antigen binding protein e.g. dAb.
- An epitope may be linear or conformational/discontinuous.
- a conformational or discontinuous epitope comprises amino acid residues that are separated by other sequences, i.e. not in a continuous sequence in the antigen's primary sequence. Although the residues may be from different regions of the peptide chain, they are in close proximity in the three dimensional structure of the antigen.
- a conformational or discontinuous epitope may include residues from different peptide chains. Particular residues comprised within an epitope can be determined through computer modelling programs or via three-dimensional structures obtained through methods known in the art, such as X-ray crystallography.
- a dAb conjugate refers to a composition comprising a dAb to which a further molecule is chemically conjugated by means of a covalent or noncovalent linkage, preferably a covalent linkage.
- covalent linkage could be through a peptide bond or other means such as via a modified side chain.
- the noncovalent bonding may be direct (e.g., electrostatic interaction, hydrophobic interaction) or indirect (e.g., through noncovalent binding of complementary binding partners (e.g., biotin and avidin), wherein one partner is covalently bonded to drug and the complementary binding partner is covalently bonded to the dAbTM).
- complementary binding partners When complementary binding partners are employed, one of the binding partners can be covalently bonded to the drug directly or through a suitable linker moiety, and the complementary binding partner can be covalently bonded to the dAbTM directly or through a suitable linker moiety.
- a dAb fusion refers to a fusion protein that comprises a dAb and a polypeptide drug.
- the dAb and the polypeptide drug are present as discrete parts (moieties) of a single continuous polypeptide chain.
- Fragments may be "free-standing" or comprised within a larger polypeptide of which they form a part or region as a single continuous region in a single larger polypeptide.
- mAbdAb refers to a monoclonal antibody linked to a further binding domain, in particular a single variable domainsuch as a domain antibody.
- a mAbdAb has at least two antigen binding sites, at least one of which is from a domain antibody, and at least one is from a paired VH/VL domain.
- Such mAbdAbs are described for example in WO 2009/068649.
- peptide refers to about two to about 50 amino acids that are joined together via peptide bonds.
- polypeptide or “protein” refers to at least about 50 amino acids that are joined together by peptide bonds. Polypeptides and proteins generally comprise tertiary structure and fold into functional domains.
- single chain Fc region of an antibody refers to a single heavy chain Fc region of an IgG, such as an IgGl, IgG2, IgG3, iGG4 or IgG4PE, or an IgA antibody.
- a single heavy chain Fc region may comprise one or more of the CHI, CH2 and CH3 constant region antibody domains, for example all three constant region antibody domains or just the CH2 and CH3 domains.
- the single heavy chain FC region of an antibody may further comprise a hinge region of an antibody (such a region normally found between the CHI and CH2 domains).
- “functional” describes a polypeptide or peptide that has biological activity, such as specific binding activity.
- the term “functional polypeptide” includes an antibody or antigen-binding fragment thereof that binds a target antigen through its antigen-binding site.
- target ligand refers to a ligand which is specifically or selectively bound by a polypeptide or peptide.
- a polypeptide is an antibody, antigen-binding fragment thereof, or immunoglobulin single variable domain
- the target ligand can be any desired antigen or epitope. Binding to the target antigen is dependent upon the polypeptide or peptide being functional.
- an antibody refers to IgG, IgM, IgA, igD or IgE or a fragment (such as a Fab,
- F(ab 2 / Fv / disulphide linked Fv, scFv, closed conformation multispecific antibody, disulphide-linked scFv, diabody) whether derived from any species naturally producing an antibody, or created by recombinant DNA technology; whether isolated from serum, B-cells, hybridomas, transfectomas, yeast or bacteria.
- immunoglobulin single variable domain refers to an antibody variable domain
- An immunoglobulin single variable domain can be present in a format ⁇ e.g., homo- or . _ _ _ domains are not required for antigen binding by the single immunoglobulin variable domain ⁇ i.e., where the immunoglobulin single variable domain binds antigen independently of the additional variable domains).
- a “domain antibody” or “dAb” is the same as an "immunoglobulin single variable domain” as the term is used herein.
- a “single immunoglobulin variable domain” is the same as an "immunoglobulin single variable domain” as the term is used herein.
- a “single antibody variable domain” is the same as an "immunoglobulin single variable domain” as the term is used herein.
- An immunoglobulin single variable domain is in one embodiment a human antibody variable domain, but also includes single antibody variable domains from other species such as rodent (for example, as disclosed in WO 00/29004, the contents of which are incorporated herein by reference in their entirety), nurse shark and Camelid WW dAbs.
- Camelid VHH are immunoglobulin single variable domain polypeptides that are derived from species including camel, llama, alpaca, dromedary, and guanaco, which produce heavy chain antibodies naturally devoid of light chains.
- the VHH may be humanized.
- human dAbs which have been modified so as to be not fully human, for example modifications which are made to reduce aggregation, including mutation of the same residues which are Camelid motifs.
- An unmodified immunoglobulin single variable domain for example a dAb that binds a target, comprises three complementarity determining regions (CDRs) within a framework structure.
- CDRs complementarity determining regions
- a dAb includes all of CDR3 and terminates in framework 4 residue at its C-terminus.
- a VH dAb terminates in residues LVTVSS at its C-terminus.
- a VHH dAb terminates in residues VTVSS at its C-terminus.
- a VL dab terminates in VEIKR at its C terminus.
- a “modified dAb” is a dAb as described herein which additionally has a modification which alters the three dimensional conformation of the dAb C-terminus.
- a modified dAb includes a dAb which comprises C-terminal additions, extensions or tags and/or certain amino acid substitutions as disclosed herein.
- the present invention also provides a single immunoglobulin variable domain (or a molecules comprising a dAb e.g. a mAbdAb) as described above which has a lower binding affinity and/or avidity (e.g. which has a KD of binding to ADA which is 150% or more (e.g. 200%, 250%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650% or more of the KD of an equivalent sequence) for an anti-drug antibody than an equivalent dAb (or molecule comprising the dAb) which equivalent dAb has the same sequence except that X is absent, nfP and q are 1 and there are no framework mutations.
- a dAb e.g. a mAbdAb
- a lower binding affinity and/or avidity e.g. which has a KD of binding to ADA which is 150% or more (e.g. 200%, 250%, 300%, 350%, 400%, 450%,
- a dAb for example DOM 1H-131-206 (SEQ ID NO 1) when then modified such that it is extended to contain X, for example a C-terminal single alanine extension, or is modified to remove the C terminal serine, or is modified by a substitution in the framework of one or more of residues 14, 41, 108, 110 and/or 112 (or any combination of such - .
- DOM 1H-131-206 (SEQ ID NO 1) without any such modifications. This may be determined using surface Plasmon resonance e.g. on a Biacore TM using standard techniques. The skilled person will understand that the lower the KD value the stronger the binding.
- dAb modified as described herein to have reduced ADA binding and which has reduced binding to ADAs as determined using a confirmation assay as described in EExample 2 and where said modified dAb has a mean % inhibition of signal which is less than 90%, e.g. less than 80%, e.g. less than 70%, e.g. less than 60% , e.g. less than 50%, e.g. less than 40%, e.g. less than 30%, e.g. less than 20% , e.g. less than 10% , in comparison with a control dAb which has around 98%-100% inhibition of signal, said control (unmodified) dAb has the same or similar sequence but is not modified to reduce ADA binding.
- a pre-existing ADA is an ADA already present in the subject to which the drug is to be administered.
- a pre-existing ADA may be present in a naive subject (i.e. a subject to which the drug has never been administered before).
- a “domain” is a folded protein structure which has tertiary structure independent of the rest of the protein. Generally, domains are responsible for discrete functional properties of proteins, and in many cases may be added, removed or transferred to other proteins without loss of function of the remainder of the protein and/or of the domain.
- a “single antibody variable domain” is a folded polypeptide domain comprising sequences characteristic of antibody variable domains. It therefore includes complete antibody variable domains and modified variable domains, for example, in which one or more loops have been replaced by sequences which are not characteristic of antibody variable domains, or antibody variable domains which have been truncated or comprise N- or C- terminal extensions, as well as folded fragments of variable domains which retain at least the binding activity and specificity of the full-length domain.
- dose refers to the quantity of fusion or conjugate administered to a subject all at one time (unit dose), or in two or more administrations over a defined time interval.
- dose can refer to the quantity of fusion or conjugate administered to a subject over the course of one day (24 hours) (daily dose), two days, one week, two weeks, three weeks or one or more months (e.g., by a single administration, or by two or more administrations).
- the interval between doses can be any desired amount of time.
- “Monovalent” means binding to one epitope.
- half-life refers to the time taken for the serum or plasma concentration of the fusion or conjugate to reduce by 50%, in vivo, for example due to degradation and/or clearance or sequestration by natural mechanisms.
- the compositions of the invention are stabilized in vivo and their half-life increased by binding to serum albumin molecules e.g. human serum albumin (HSA) which resist degradation and/or clearance or sequestration.
- serum albumin molecules e.g. human serum albumin (HSA) which resist degradation and/or clearance or sequestration.
- serum albumin molecules are naturally occurring proteins which themselves have a long half-life in vivo.
- hydrodynamic size refers to the apparent size of a molecule (e.g., a protein molecule, ligand) based on the diffusion of the molecule through an aqueous solution.
- the diffusion, or motion of a protein through solution can be processed to derive an apparent size of the protein, where the size is given by the "Stokes radius” or “hydrodynamic radius” of the protein particle.
- the “hydrodynamic size” of a protein depends on both mass and shape (conformation), such that two proteins having the same molecular mass may have differing hydrodynamic sizes based on the overall conformation of the protein.
- sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%, or at least 40%, or at least 50%, or at least 60%, or at least 70%, 80%, 90%, 100% of the length of the reference sequence.
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- amino acid or nucleic acid “homology” is equivalent to amino acid or nucleic acid “identity”
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- Amino acid and nucleotide sequence alignments and homology, similarity or identity, as defined herein may be prepared and determined using the algorithm BLAST 2 Sequences, using default parameters (Tatusova, T. A. eta/., FEMS Microbiol Lett, ⁇ 74:187-188 (1999).
- the invention relates to isolated and/or recombinant nucleic acids encoding the compositions of the invention that are described herein.
- Nucleic acids referred to herein as "isolated” are nucleic acids which have been separated away from other material ⁇ e.g., other nucleic acids such as genomic DNA, cDNA and/or RNA) in its original environment ⁇ e.g., in cells or in a mixture of nucleic acids such as a library).
- An isolated nucleic acid can be isolated as part of a vector ⁇ e.g., a plasmid).
- Nucleic acids referred to herein as "recombinant” are nucleic acids which have been produced by recombinant DNA methodology, including methods which rely upon artificial recombination, such as cloning into a vector or chromosome using, for example, restriction enzymes, homologous recombination, viruses and the like, and nucleic acids prepared using the polymerase chain reaction (PCR). . .
- composition of the invention comprises a (one or more) recombinant nucleic acid or expression construct comprising nucleic acid(s) encoding a composition of the invention as described herein, e.g. a dAb modified to reduce binding to ADAs.
- a method of preparing a composition of the invention as described herein comprising maintaining a recombinant host cell e.g. mammalian or microbial, of the invention under conditions appropriate for expression of the fusion polypeptide. The method can further comprise the step of isolating or recovering the fusion, if desired.
- a nucleic acid molecule ⁇ i.e., one or more nucleic acid molecules) encoding a molecule of the invention can be introduced into a suitable host cell to create a recombinant host cell using any method appropriate to the host cell selected ⁇ e.g., transformation, transfection, electroporation, infection), such that the nucleic acid molecule(s) are operably linked to one or more expression control elements ⁇ e.g., in a vector, in a construct created by processes in the cell, integrated into the host cell genome).
- the resulting recombinant host cell can be maintained under conditions suitable for expression ⁇ e.g., in the presence of an inducer, in a suitable animal, in suitable culture media supplemented with appropriate salts, growth factors, antibiotics, nutritional supplements, etc.), whereby the encoded peptide or polypeptide is produced.
- the encoded peptide or polypeptide can be isolated or recovered ⁇ e.g., from the animal, the host cell, medium, milk). This process encompasses expression in a host cell of a transgenic animal (see, e.g., WO 92/03918, GenPharm International).
- the molecules of the invention as described herein can also be produced in a suitable in vitro expression system, e.g. by chemical synthesis or by any other suitable method.
- molecules of the invention generally bind to their target ligands with high affinity.
- the molecules of the invention e.g. modified dAbs with reduced binding to ADAs, can be expressed in E ?// ' or in Pichia species (e.g., P. pastoris).
- the dAb is secreted in £ coli or in Pichia species (e.g., P. pastoris); or in mammalian cell culture (e.g. CHO, or HEK 293 cells).
- the molecules described herein can be secretable when expressed in £ coli or in Pichia species or mammalian cells they can be produced using any suitable method, such as synthetic chemical methods or biological production methods that do not employ £ coli or Pichia species.
- nucleic acid encoding the dAbs of the invention e.g. the TNFR1 dAbs described herein, can be cloned into a suitable expression vector e.g. PaveOll (from Fujifilm Diosynth) and then expressed in a microbial vector such as E.coli.
- the dAb e.g. the VH, VL or VHH
- the dAb can be modified to prevent binding to ADAs such that the modification comprises a tag present at the C terminus.
- This tag can be present as a fusion or conjugate with the molecule.
- the tag can be any tag known in the art for example affinity tags such as myc-tags, FLAG tags, his-tags, chemical modification such as PEG, or protein domains such as the antibody Fc domain.
- affinity tags such as myc-tags, FLAG tags, his-tags, chemical modification such as PEG, or protein domains such as the antibody Fc domain.
- the present invention can be any tag known in the art for example affinity tags such as myc-tags, FLAG tags, his-tags, chemical modification such as PEG, or protein domains such as the antibody Fc domain.
- the present invention can be any tag known in the art for example affinity tags such as myc-tags, FLAG tags, his-tags, chemical modification such as PEG, or protein domains such as the
- the invention also provides a molecule e.g. dAb (such as a VH or VL or a VHH) which comprises a modified framework which reduces pre-existing ADA binding for example a dAb (such as a VHH, VH or VL) which comprises an amino acid substitution at any one of positions 14, 41, 108, 110, or 112.
- dAb such as a VHH, VH or VL
- these substitutions can be one or more modifications selected from: P14A, P14K, P14Q, P14T, P41A, L108A, L108 Q, T110A and S112A.
- the dAb (e.g. the VHH, VH or VL) comprises one or more modifications selected from: P14A, P14K, P14Q, P14T, P41A, L108A, T110A and S112A; and can further comprise any of the C terminal extensions, additions, deletion or tags as described above.
- the dAb e.g. the VHH, VH or VL
- the VHH, VH or VL) which comprises one or more modifications selected from: P14A, P14K, P14Q, P14T P41A, L108A, T110A and S112A also comprises an amino acid extension at the C terminus of the dAb which is selected from: (a) alanine, or (b) an amino acid sequence comprising or consisting of an extension selected from: AS, AST, ASTK, ASTKG, or ASTKGP.
- the dAb molecules described herein and pharmaceutical compositions comprising these molecules may be useful in the prevention or reduction of side effects.
- the binding of anti-drug antibodies by a dAb may lead to two dAbs being brought together. In some circumstances, this may lead to safety concerns.
- the target of a dAb is a receptor or a polymeric target
- the bringing together of two dAbs may bring two targets together.
- This may lead to unexpected pharmacological impacts, for example agonism rather than antagonism e.g. via dimerisation of the receptor.
- the present invention provides the use of the molecules of the invention in a method of preventing side effects.
- prevention is meant that the use of the molecules of the invention abrogates to a complete or partial level binding of pre-existing anti drug antibodies as compared to the equivalent molecule which has not been modified.
- the reduction in binding of ADAs leads to a reduction in the level of unwanted pharmacological effects.
- the molecules of the invention can have an enhanced safety profile and fewer side effects than the unmodified molecules e.g. unmodified dAbs, which do not comprise a C terminal extension, addition, deletion or tag and/or other framework modification, to reduce pre-existing ADA binding.
- administration of the modified molecules described herein or of pharmaceutical compositions comprising these modified molecules can lead to modified immunogenicity, this is because when the unmodified molecules bind to ADAs they form immune complexes and such immune complexes could then generate an immune response.
- administration of the modified molecules described herein or of pharmaceutical compositions comprising these modified molecules can also result in improved efficacy and an improved safety profile and e.g.
- dAb molecules of the invention are able to be administered to a patient population without the need for pre-screening for ADA titres to remove subjects at risk of an adverse reaction.
- Y is selected from the group consisting of: a tag such as an affinity tag, a myc tag, a FLAG tag or a his- tag, a chemical modification such as a PEG group, or a protein, such as the Fc portion of an antibody.
- the present invention also provides a method of preventing or reducing side effects in treatment regimen by administration of the molecules of the invention, or molecules of the invention in which X has been replaced by Y as defined above. Also provided is a method of modifying a molecule as described herein to reduce its binding to ADAs and to reduce side effects.
- compositions which comprise the modified molecules as described herein e.g. compositions comprising modified VHH, VH or VL.
- Such compositions can comprise the modified molecules present as a fusion or conjugate with other molecules e.g. other proteins, antibody molecules or antibody fragments.
- a dAb can be present as a formatted dAb (e.g.
- the dAb can be present as a dAb-fc fusion or conjugate as described in for example WO 2008/149148) or it can be present as a mAbdAb (as described in WO 2009/068649) or the dAb be present as a fusion or conjugate with half life extending proteins or polypeptides e.g., a further dAb e.g., a dAb which binds to serum albumin (AlbudAbTM) or e.g., with polyethyleneglygol PEG or further therapeutic or active molecules.
- the therapeutic molecule(s) when present as a fusion or conjugate with a dAb (e.g.
- a VHH, VH or VL can be linked to either the C-terminal extension of the dAb or the N-terminus of the dAb.
- one or more therapeutic molecules are present as a fusion (or conjugate) at the N terminus of the dAb.
- the dAbs of the invention (and also molecules comprising dAbs such as mAbdAbs which are also part of the invention) which have reduced ability to bind ADAs bind to a target ligand with high affinity, for example they can have a KD as measured by surface plasmon resonance using BiacoreTM in the region of 5 micromolar to about 1 pM , e.g. about 500 nM to about 10 pM e.g. about 200nM to about ⁇ , e.g. 50nM to about ⁇ e.g. about lOnm to about ⁇ .
- the molecule can have a KD of about ⁇ to about 10-30pM e.g. it can be a TNFR1 dAb with reduced binding to ADAs and which has a KD of about 10-30pM e.g. about 20pM.
- the dAbs of the invention (and also molecules comprising dAbs such as mAbdAbs which are also part of the invention) which have reduced ability to bind ADAs can have expression levels which are at least 3%, e.g. 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100% of those shown by a dAb of the same or similar amino acid sequence which is not modified as described herein to reduce binding to ADAs.
- the molecules of the invention e.g. dAbs and molecules comprising dAbs such as mAbdAbs
- which have reduced ability to bind ADAs can have expression levels of at least O.lg/Litre.
- the dAbs of the invention (and also molecules comprising dAbs such as mAbdAbs which are also part of the invention) which have reduced ability to bind ADAs have a KD of binding . .
- the dAbs of the invention (and also molecules comprising dAbs such as mAbdAbs which are also part of the invention) which have reduced ability to bind ADAs have a KD to their target antigen which is essentially the same (e.g. around 2 fold higher to 2 fold lower) or more than 2 fold lower than the KD of a dAb of the same or similar amino acid sequence which is not modified as described herein to reduce binding to ADAs.
- the invention further relates to uses, formulations, compositions comprising such C terminally extended and/or modified molecules and also to methods of production and expression of these molecules.
- the invention provides a dAb (VH, VL, or VHH) which has any of the C terminal modifications as described above and which binds to a target selected from: TNFa, TNFR1, VEGF, IL-1R, IL-6R, IL-4, IL-5, IL-13, DC-SIGN, ASGPR, albumin, and TGF ⁇ R2.
- a target selected from: TNFa, TNFR1, VEGF, IL-1R, IL-6R, IL-4, IL-5, IL-13, DC-SIGN, ASGPR, albumin, and TGF ⁇ R2.
- the invention provides a dAb which is described or disclosed in any one of: WO 2007/049017 (e.g. the anti-TNFRl dAb designated 2H-131-511 or a dAb which is at least 80% identical to this (e.g. 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100% identical), WO 2008/149144 (e.g. an anti-TNFRl dAb selected from: lh-131-201, lh-131-202, lh-131-203, lh-131- 204, lh-131-205 or a dAb which is at least 80% identical to this (e.g.
- WO 2008/149148 (the contents of which are explicitly incorporated herein by reference) e.g. any one of the anti-TNFRl dAbs therein; and which dAb further comprises at least one of the modifications described herein to reduce binding affinity and/or avidity to ADAs e.g. any one of the C terminal modifications as described above and/or any one of the amino acid substitutions and/or deletions as described above.
- the invention provides an unmodified dAb which is described or disclosed in any one of WO 2007/049017, WO 2008/149144, and WO 2008/149148 (e.g. any one of the dAb sequences described above), and which dAb is then modified to comprises one or more framework modifications e.g. selected from: P14A, P14K, P14Q, P14T P41A, L108A, T110A and S112A framework mutations and which can also further optionally comprise any of the C terminal modifications described herein.
- the unmodified dAb can be any one of the anti- TNFRldAb sequences described or disclosed in any one of WO 2007/049017, WO 2008/149144, and WO 2008/149148.
- the unmodified anti-TNFRl dAb sequence can be one which is at least 80% (e.g. 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100%) identical to the dAb sequence identified as either DOMlh-131-206 (disclosed in WO 2008/149148) , DOM lh-131-511 (disclosed in WO 2007/049017 and 2008/149144) and DOM lh-131-202 (disclosed in WO 2008/149144) .
- the invention provides a VEGF dAb which is described or disclosed in WO 2008/149147 e.g. the dAb designated 15-26-593 (amino acid sequence shown in Figure 5 of # which dAb further comprises any one of the modifications described herein to reduce binding affinity and/or avidity to ADAs e.g. any one of the C terminal modifications as described above and/or any one of the amino acid substitutions and/or deletions as described above.
- EVQLVESGGGLVQPGGSLRLS (I7 ⁇ SGFTFSDYWMYV RQAPGKGLEWVSEINTNGUTKYPDSVKGR mSRDNAKNTLYLQMNSLRPEDTAVYYCARSPSGFNRGQGTLVTVSSGGGGSGGGSEVQLVESGGGL VQPGNSLRLSCLAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGRFnSRDNAKTTL YLQMNSLRPEDTAVYYCT1GGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCA ASGFTFSDYWMYV RQAPGKGLEWVSEINTNGLITKYPDSVKGRFTISRDNAKNTLYLQMNSLRPED TAVYYCARSPSGFNRGQGTLVTVSS
- the invention provides a modified DOMlh-131-206 dAb which binds to TNFR1 and which is selected from the following amino acid sequences:
- the invention also provides nucleic acids encoding the molecules described herein for example nucleic acids encoding the anti-TNFRl dAbs described above.
- host cells e.g. non-embryonic host cells e.g. prokaryotic or eukaryotic hosts cells such as E. coli or or yeast host cells or mammalian cells that comprise these nucleic acids.
- the invention additionally provides a dAb which has reduced binding to ADA in human sera (e.g. does not bind to pre-existing ADA in human sera) and wherein the epitope on the dAb to which the ADA binds is masked (i.e. the epitope is no longer available to bind to ADA as e.g. it has been covered or masked by another molecule so preventing binding or its steric conformation has been changed so preventing binding) .
- the epitope on the dAb can be masked by any of the modifications described herein to reduce ADA binding, for example adding a chemical entity to the C terminus of the dAb or by framework substitutions, or deletions as described herein.
- the chemical entity added to the C terminus of the dAb can be an extension (e.g. an amino acid extension) or a tag or it can be a chemical modification such as pegylation or amidation.
- the modification to the C terminus can be one which either directly or indirectly changes the conformation of the epitope on the dAb which binds to ADAs thereby reducing the ability of the dAb to bind to ADAs.
- a molecule as described herein e.g. a dAb, in particular depending on the cell line used and particular amino acid sequence of the molecule e.g. dAb, post-translational modifications may occur. For example, this may include the cleavage of certain leader sequences, the addition of various sugar moieties in various glycosylation and phosphorylation patterns, deamidation, oxidation, disulfide bond scrambling, isomerisation, C- terminal lysine clipping, and N-terminal glutamine cyclisation.
- the present invention encompasses the use of such molecules , e.g. dAbs, which have been subjected to, or have undergone, one or more post-translational modifications.
- an dAb of the invention includes an a dAb which has undergone a post-translational modification such as described as follows: Glycosylation of antibodies at conserved positions in their constant regions is known to have a profound effect on antibody function, particularly effector functioning, see for example, Boyd et al. (1996) Mol. Immunol. 32: 1311-1318. Glycosylation variants of the antigen binding proteins of the invention wherein one or more carbohydrate moiety is added, substituted, deleted or modified are contemplated. Introduction of an asparagine-X-serine or asparagine-X-threonine motif creates a potential site for enzymatic attachment of carbohydrate moieties and may therefore be used to manipulate the glycosylation of an antibody.
- the antibodies for example of the IgG isotype, e.g. IgGl
- the antibodies may comprise a defined number (e.g.
- Deamidation is an enzymatic reaction primarily converting asparagine (N) to iso-aspartic acid and aspartic acid (D) at approximately 3:1 ratio. To a much lesser degree, deamidation can occur with glutamine residues in a similar manner. Deamidation in a CDR results in a change in charge of the molecule, but typically does not result in a change in antigen binding, nor does it impact on PK/PD; Oxidation can occur during production and storage (i.e.
- -SH free (unpaired) sulfhydryls
- Isomerization typically occurs during production, purification, and storage (at acidic pH) and usually occurs when aspartic acid is converted to isoaspartic acid through a chemical process
- N-terminal glutamine in the heavy chain and/or light chain is likely to form pyroglutamate (pGlu).
- pGlu pyroglutamate
- pGlu formation is considered as one of the principal degradation pathways for recombinant mAbs;
- C-terminal lysine clipping is an enzymatic reaction catalyzed by carboxypeptidases, and is commonly observed in recombinant mAbs. Variants of this process include removal of lysine from one or both heavy chains. Lysine clipping does not appear to impact bioactivity and has no effect on mAb effector function.
- the invention further provides a method for producing a molecule of the present invention comprising an amino acid extension present as a direct fusion which method comprises maintaining a host cell such as those described above that comprises a recombinant nucleic acid and/or construct that encodes a fusion of the invention under conditions suitable for expression of said recombinant nucleic acid, whereby a fusion is produced.
- the invention also provides pharmaceutical compositions comprising the modified molecules of the invention.
- the invention further provides a pharmaceutical composition of the invention for use in medicine, e.g. for use in the treatment or prevention of e.g. disease or condition or disorder and which comprises administering to said individual a therapeutically effective amount of a pharmaceutical composition of the invention.
- the molecules of the invention will be utilised in purified form together with pharmacologically or physiologically appropriate carriers.
- these carriers can include aqueous or alcoholic/aqueous solutions, emulsions or .
- Suitable physiologically-acceptable adjuvants if necessary to keep a polypeptide complex in suspension, may be chosen from thickeners such as carboxymethylcellulose, polyvinylpyrrolidone, gelatin and alginates.
- Intravenous vehicles include fluid and nutrient replenishers and electrolyte replenishers, such as those based on Ringer's dextrose.
- Preservatives and other additives such as antimicrobials, antioxidants, chelating agents and inert gases, may also be present (Mack (1982) Remington's Pharmaceutical Sciences, 16th Edition).
- a variety of suitable formulations can be used, including extended release formulations.
- the invention also provides a method for treating (therapeutically or prophylactically) a patient or subject having a disease or disorder, such as those described herein, and which comprises administering to said individual a therapeutically effective amount of a pharmaceutical composition of the invention.
- compositions, of the invention may be administered alone or in combination with other molecules or moieties e.g. polypeptides, therapeutic proteins and/or molecules (e.g., other proteins (including antibodies), peptides, or small molecule drugs.
- molecules or moieties e.g. polypeptides, therapeutic proteins and/or molecules (e.g., other proteins (including antibodies), peptides, or small molecule drugs.
- compositions of the invention comprising anti- TNFRl VH or VL dAbs modified as described herein, for example those anti-TNFRl VH or VL dAbs described herein, or anti-TNFRl VHH domains modified as described herein, for use in the treatment of inflammatory diseases or disorders, e.g.
- respiratory or pulmonary diseases or disorders e.g selected from: chronic obstructive pulmonary disease, chronic bronchitis, chronic obstructive bronchitis and emphysema, lung inflammation, chronic obstructive pulmonary disease, asthma, pneumonia, hypersensitivity pneumonitis, pulmonary infiltrate with eosinophil, environmental lung disease, pneumonia, bronchiectasis, cystic fibrosis, interstitial lung disease, primary pulmonary hypertension, pulmonary thromboembolism, disorders of the pleura, disorders of the mediastinum, disorders of the diaphragm, hypoventilation, hyperventilation, sleep apnea, acute respiratory distress syndrome, mesothelioma, sarcoma, graft rejection, graft versus host disease, lung cancer, allergic rhin
- pneumococcal disease influenza, nontuberculous mycobacteria, pleural effusion, pneumoconiosis, pneumocytosis, pneumonia, pulmonary actinomycosis, pulmonary alveolar proteinosis, pulmonary anthrax, pulmonary edema, pulmonary embolus, pulmonary inflammation, pulmonary histiocytosis X, pulmonary hypertension, pulmonary nocardiosis, pulmonary tuberculosis, pulmonary veno- occlusive disease, rheumatoid lung disease, sarcoidosis, and Wegener's granulomatosis and Acute lung injury (AU) and also Acute Respiratory Distress syndrome (ARDS) and complications thereof such as Acute Kidney Injury.
- AU Acute Respiratory Distress syndrome
- ARDS Acute Respiratory Distress syndrome
- the invention also provides for use of a pharmaceutical composition of the invention . , ,
- the invention also relates to use of any of the compositions described herein for use in therapy, diagnosis or prophylaxis of any of the inflammatory diseases or disorders or respiratory or pulmonary diseases or disorders as described above.
- the invention also relates to prophylactic use of any of the compositions described herein to prevent or alleviate any of the inflammatory diseases or disorders or respiratory or pulmonary diseases or disorders described above.
- compositions containing the anti-TNFRl dAbs as described herein, e.g. DOM 1H-131- 206 with a C-terminal alanine extension can be administered for prophylactic and/or therapeutic treatments and are administered as a "therapeutically-effective dose". Amounts needed to achieve this dosage will depend upon the severity of the disease and the general state of the patient's own immune system, but generally range from 0.005 to 5.0 mg of dAb e kilogram of body weight, with doses of 0.05 to 2.0 mg/kg/dose being more commonly used.
- similar or slightly lower dosages, to prevent, inhibit or delay onset of disease e.g., to sustain remission or quiescence, or to prevent acute phase
- an anti- TNFR1 dAb as described herein when administered to treat, suppress or prevent a chronic inflammatory disease, it can be administered up to four times per day, twice weekly, once weekly, once every two weeks, once a month, or once every two months, at a dose off, for example, about 10 ng/kg to about 80 mg/kg, about 100 ng/kg to about 80 mg/kg, about 1 mg/kg to about 80 mg/kg, about 1 mg/kg to about 70 mg/kg, about 1 mg/kg to about 60 mg/kg, about 1 mg/kg to about 50 mg/kg, about 1 mg/kg to about 40 mg/kg, about 1 mg/kg to about 30 mg/kg, about 1 mg/kg to about 20 mg/kg , about 1 mg/kg to about 10 mg/kg, about 10 ⁇ g/k.g to about 10 mg/kg, about 10 ng/kg to about 5 mg/kg, about 10 ng/kg to about
- the anti-TNFRl dAb can be administered to treat, suppress or prevent a chronic inflammatory disease once every two weeks or once a month at a dose of about 10 ng/kg to about 10 mg/kg (e.g., about 10 ng/kg, about 100 ng/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg or about 10 mg/kg.)
- Treatment or therapy performed using the compositions described herein is considered “effective” if one or more symptoms or signs are reduced or alleviated (e.g., by at least 10% or at least one point on a clinical assessment scale), relative to such symptoms present before treatment, or relative to such symptoms in an individual (human or model animal) not treated with such composition or other suitable control.
- Symptoms will obviously vary depending upon the precise nature of the disease or disorder targeted, but can be measured by an ordinarily skilled clinician or
- prophylaxis performed using a composition as described herein is "effective” if the onset or severity of one or more symptoms or signs is delayed, reduced or abolished relative to such symptoms in a similar individual (human or animal model) not treated with the composition.
- the molecules of the invention can be further formatted to have a larger hydrodynamic size to further extend the half life, for example, by attachment of a PEG group, serum albumin, transferrin, transferrin receptor or at least the transferrin-binding portion thereof, an antibody Fc region, or by conjugation to an antibody domain.
- the dAb that binds serum albumin can be formatted as a larger antigen-binding fragment of an antibody (e.g., formatted as a Fab, Fab', F(ab) 2 , F(ab 2 , IgG, scFv).
- the invention provides a composition according to the invention that comprises a dual-specific ligand or multi-specific ligand that comprises a first dAb which is modified according to the invention e.g. by a C terminal extension and/or by a P14A framework mutation and a second dAb that has the same or a different binding specificity from the first dAb and optionally in the case of multi-specific ligands further dAbs.
- the second dAb (or further dAbs) may optionally bind a different target and may optionally also comprise a C terminal extension and/or a P14A framework mutation according to the invention.
- the invention provides the molecules and compositions of the invention for delivery by parenteral administration e.g. by subcutaneous, intramuscular or intravenous injection, inhalation, nasal delivery, transmucossal delivery, oral delivery, delivery to the GI tract of a patient, rectal delivery or ocular delivery.
- parenteral administration e.g. by subcutaneous, intramuscular or intravenous injection, inhalation, nasal delivery, transmucossal delivery, oral delivery, delivery to the GI tract of a patient, rectal delivery or ocular delivery.
- the invention provides the use of the molecules and compositions of the invention in the manufacture of a medicament for delivery by subcutaneous injection, inhalation, intravenous delivery, nasal delivery, transmucossal delivery, oral delivery, delivery to the GI tract of a patient, rectal delivery, transdermal or ocular delivery.
- the invention provides a method for delivery to a patient by subcutaneous injection, pulmonary delivery, intravenous delivery, nasal delivery, transmucossal delivery, oral delivery, delivery to the GI tract of a patient, rectal or ocular delivery, wherein the method comprises administering to the patient a pharmaceutically effective amount of a molecule of the invention.
- the invention provides an oral, injectable, inhalable, nebulisable formulation comprising a molecule of the invention.
- the formulation can be in the form of a tablet, pill, capsule, liquid or syrup.
- subject or “individual” is defined herein to include animals such as mammals, including, but not limited to, primates ⁇ e.g., humans), cows, sheep, goats, horses, dogs, cats, rabbits, guinea pigs, rats, mice or other bovine, ovine, equine, canine, feline, rodent or murine species.
- mammals including, but not limited to, primates ⁇ e.g., humans
- the invention also provides a kit for use in administering molecules and compositions according to the invention to a subject ⁇ e.g., human patient), comprising a molecule or composition . . . . , , .
- the drug delivery device is selected from the group consisting of a syringe, an inhaler, an intranasal or ocular administration device (e.g., a mister, eye or nose dropper), and a needleless injection device.
- the molecules and compositions of this invention can be lyophilized for storage and reconstituted in a suitable carrier prior to use. Any suitable lyophilization method (e.g., spray drying, cake drying) and/or reconstitution techniques can be employed. It will be appreciated by those skilled in the art that lyophilisation and reconstitution can lead to varying degrees of antibody activity loss and that use levels may have to be adjusted to compensate.
- the invention provides a composition comprising a lyophilized (freeze dried) composition as described herein.
- the lyophilized (freeze dried) composition loses no more than about 20%, or no more than about 25%, or no more than about 30%, or no more than about 35%, or no more than about 40%, or no more than about 45%, or no more than about 50% of its activity (e.g., binding activity for serum albumin) when rehydrated.
- Activity is the amount of composition required to produce the effect of the composition before it was lyophilized.
- the activity of the composition can be determined using any suitable method before lyophilization, and the activity can be determined using the same method after rehydration to determine amount of lost activity.
- the invention also provides sustained or slow release formulations comprising the molecules of the invention, such sustained release formulations can comprise the molecules of the invention in combination with, e.g. hyaluronic acid, microspheres or liposomes and other pharmaceutically or pharmacalogically acceptable carriers, excipients and/or diluents.
- sustained release formulations can comprise the molecules of the invention in combination with, e.g. hyaluronic acid, microspheres or liposomes and other pharmaceutically or pharmacalogically acceptable carriers, excipients and/or diluents.
- the invention provides a pharmaceutical composition
- a pharmaceutical composition comprising a molecule of the invention, and a pharmaceutically or physiologically acceptable carrier, excipient or diluent.
- the invention provides the modified TNFR1 dAbs of the present invention which have reduced binding to ADAs e.g. such as a modified DOMlh-131-206 dAb with a modification as described herein to reduce binding to ADAs.
- ADAs e.g. such as a modified DOMlh-131-206 dAb with a modification as described herein to reduce binding to ADAs.
- the invention provides the DOMlh-131-206 dAb with an extension of a single alanine at the C-terminus (SEQ ID NO 16) e.g. as a pharmaceutical composition e.g. for use to treat a disease or disorder, for example to treat a respiratory disease or disorder such as COPD, ALI or ARDS.
- the DOMlh-131-206 dAb with an extension of a single alanine at the C terminus (or pharmaceutical composition comprising the DOMlh-131-206 dAb with an extension of a single alanine at the C terminus) when used to treat a respiratory disease or disorder such as COPD, ALI or ARDS can be administered to a subject, e.g. to a human subject, by injection (e.g. by subcutaneous, intravenous or intramuscular injection) or it alternatively it can be given to the subject, e.g. to a human subject, by pulmonary administration e.g. by nebulisation using a standard nebuliser or by inhalation for example by using a standard inhaler device.
- injection e.g. by subcutaneous, intravenous or intramuscular injection
- pulmonary administration e.g. by nebulisation using a standard nebuliser or by inhalation for example by using a standard inhaler device.
- the invention further provides sustained release and/or freeze dried . _ binding, such as the DOMlh-131-206 dAb with an extension of a single alanine at the C-terminus (SEQ ID NO 16).
- a delivery device e.g. an inhaler or a nebuliser device which comprises the modified TNFR1 dAbs of the present invention, such as DOMlh-131-206 dAb with an extension of a single alanine at the C-terminus nucleic acid (SEQ ID NO 22).
- the invention provides the unmodified DOMlh-131-206 dAb (SEQ ID NO 1) or the DOMlh-131-206 dAb modified in any of the ways described herein to reduce ADA binding e.g. the DOMlh-131-206 dAb with an extension of a single alanine at the C-terminus (SEQ ID NO 16), to treat an inflammatory skin disorder e.g. psoriasis and also provided is any one of the dosage regimens as described below for use of a domain antibody in the treatment of psoriasis.
- the domain antibody useful for the treatment of psoriasis selectively targets the same domain of human TNFR1 as the natural, human TNF-alpha ligand for this receptor and is a specific, competitive antagonist of TNFR1, but not of TNFR2, and prevents the binding of TNF-alpha to TNFRl and the signaling of this ligand through TNFR1.
- Such a domain antibody may comprise any anti-TNFRl dAb which has been modified to reduce binding to ADAs as disclosed herein.
- the domain antibody may be a human domain antibody such as DOMlh-131-206 having the amino acid sequence shown in SEQ ID NO: 1, the DOMlh-131-206 with an C terminal alanine having the amino acid sequences shown in SEQ ID NO: 16, or a DOMlh-131-206 dAb (SEQ ID NO 1) which has then been modified to reduce ADA binding as described herein (i.e. any modification to reduce binding to ADAs) as disclosed herein.
- the domain antibody may be provided in a vial containing e.g. 100 mg or e.g. 40mg of a lyophilizate of the domain antibody.
- the lyophilizate may comprise sucrose, glycine, sodium dihydrogen phosphate and polysorbate 80. This domain antibody lyophilizate can initially be reconstituted in 5 mL of sterile water and then diluted with sterile water, or another
- compositions comprising 20mg/mL, 5mg/ml_, and lmg/mL of the domain antibody.
- the domain antibody may be used to treat human patients identified as having psoriasis.
- the domain antibody may be used to treat human patients identified as having chronic mild, moderate, or severe, stable plaque type psoriasis with one or two plaque areas.
- mild plaque type psoriasis affects less than 3% of a human patient's body surface area
- moderate plaque type psoriasis affects between 3% and 10% of a human patient's body surface area
- severe psoriasis affects more than 10 percent of a human patient's body surface area.
- the human patients may be male or female subjects having chronic plaque type psoriasis with stable plaque(s) on the upper extremities, thighs or trunk. These human patients may be from about 18 to about 70 years old. Human patients may also be from 14 to 26 years old as well as 14 or more years old.
- the domain antibody can be administered to these human patients by injection into a psoriatic plaque.
- ⁇ of a pharmaceutical composition comprising 20mg/ml_, 5mg/mL, or lmg/mL of the domain antibody can be administered by injection into a psoriatic plaque at a depth which targets the epidermis and superficial dermis in the plaque.
- the domain antibody can be administered to a human patient with a psoriatic plaque according to a treatment protocol in which ⁇ of a pharmaceutical composition comprising 5mg/ml_ of the domain antibody is injected into a psoriatic plaque once a week during a 28 day treatment period.
- a treatment protocol in which ⁇ of a pharmaceutical composition comprising 5mg/ml_ of the domain antibody is injected into a psoriatic plaque once a week during a 28 day treatment period.
- the patient will be administered the pharmaceutical composition four times and will receive 0.5 mg of the domain antibody during each administration such that a total dose of 2 mg of the domain antibody is received during the 28 day treatment period.
- Domain antibody doses e.g., ⁇ injection containing
- the domain antibody can also be administered to a human patient with a psoriatic plaque according to a treatment protocol in which ⁇ of a pharmaceutical composition comprising 20 mg/mL of the domain antibody is injected into a psoriatic plaque once a week during a 28 day treatment period.
- a treatment protocol in which ⁇ of a pharmaceutical composition comprising 20 mg/mL of the domain antibody is injected into a psoriatic plaque once a week during a 28 day treatment period.
- the patient will be administered the pharmaceutical composition four times and will receive 2 mg of the domain antibody during each administration such that a total dose of 8 mg of the domain antibody is received during the 28 day treatment period.
- Domain antibody doses e.g., ⁇ injection containing 2 mg of the domain
- the domain antibody can also be administered to a human patient with a psoriatic plaque according to a treatment protocol in which ⁇ of a pharmaceutical composition comprising 5 mg/mL of the domain antibody is injected into a psoriatic plaque twice a week during a 28 day treatment period.
- a treatment protocol in which ⁇ of a pharmaceutical composition comprising 5 mg/mL of the domain antibody is injected into a psoriatic plaque twice a week during a 28 day treatment period.
- the patient will be administered the pharmaceutical composition eight times and will receive 0.5 mg of the domain antibody during each administration such that a total dose of 4 mg of the domain antibody is received during the 28 day .
- ⁇ of a pharmaceutical composition comprising 5 mg/mL of the domain antibody is injected into a psoriatic plaque twice a week during a 28 day treatment period.
- the patient will be administered the pharmaceutical composition eight times and will receive 0.5 mg of the domain antibody during each administration such that a total dose of 4 mg of the domain antibody is received during the 28
- Domain antibody doses e.g., ⁇ injection containing 0.5 mg of the domain antibody in this treatment protocol are administered on a mg per patient basis.
- the domain antibody can also be administered to a human patient with a psoriatic plaque according to a treatment protocol in which ⁇ of a pharmaceutical composition comprising 1 mg/mL of the domain antibody is injected into a psoriatic plaque once a week during a 28 day treatment period.
- a treatment protocol in which ⁇ of a pharmaceutical composition comprising 1 mg/mL of the domain antibody is injected into a psoriatic plaque once a week during a 28 day treatment period.
- the patient will be administered the pharmaceutical composition four times and will receive 0.1 mg of the domain antibody during each administration such that a total dose of 0.4 mg of the domain antibody is received during the 28 day treatment period.
- T is means, for example, that in a treatment protocol spanning 28 days the patient would receive the first ⁇ . injection containing 0.1 mg of the domain antibody on day one, the second such injection on day eight, the third such injection on day fifteen, and the fourth such injection on day twenty-two.
- Domain antibody doses (e.g., ⁇ . injection containing 0.1 mg of the domain antibody) in this treatment protocol are administered on a mg per patient basis.
- WO 2008/149148 describes methods of testing, isolating and producing the unmodified DOMlh-131- 206 dAb and such methods are applicable to the modified T FR1 dAbs of the present invention with reduced binding to ADAs e.g. to the DOMlh-131-206 dAb with an extension of a single alanine at the C-terminus (SEQ ID NO 16), and this disclosure (including methods of testing, isolating and producing) is incorporated herein.
- SEQ ID NO 16 an extension of a single alanine at the C-terminus
- a single immunoglobulin variable domain (e.g. VH, VL or a VHH), e.g. which binds to a target, which comprises one or more modifications selected from:
- a C-terminal addition, extension or tag (b) one or more amino acid framework substitutions wherein at least one substitution is a substitution selected from: a P14A substitution, a P41A substitution and a L108A substitution; and which has reduced binding to pre-existing ADAs compared to the unmodified single immunoglobulin variable domain (dAb).
- dAb single immunoglobulin variable domain
- unog o u n var a e oma n accor ng o . a o s selected from a human VH, or VL dAb or a Camelid VHH.
- a single immunoglobulin variable domain (dAb) according to 1 or 2 , which comprises a C- terminal extension of at least one amino acid.
- a single immunoglobulin variable domain (dAb)according to 3 or 4 wherein said C-terminal extension comprises an amino acid which is alanine.
- a single immunoglobulin variable domain (dAb)according to 5 wherein said C-terminal extension consists of a single amino acid which is alanine.
- a single immunoglobulin variable domain (dAb)according to claim 5 wherein said C terminal extension comprises an amino acid extension selected from: : (a) AS, (b) AST (c) ASTK,(d) ASTKG, or (e) ASTKGP.
- a single immunoglobulin variable domain (dAb) according to any of 1-2, wherein the C terminal has a tag selected from: affinity tag, a myc tag, FLAG tag , his-tags, chemical modification such as PEG, or protein domains such as the antibody Fc domain.
- a single immunoglobulin variable domain (dAb) according to any of the preceding claims which binds to a target wherein said is selected from: TNFa, TNFR1, VEGF, IL-1R, IL-6R, IL- 4, IL-5, IL-13, DC-SIGN, ASGPR, albumin, TGF3R2.
- a single immunoglobulin variable domain according to 11, which is selected from the following an amino acid sequence identified as: (a) DOMlh-131-206 dAb with an extension of a single alanine (SEQ ID NO 16) (b) DOMlh-131-206 dAb with an extension of a single alanine and a P14A framework mutation (SEQ ID NO 17) (c) DOMlh-131-206 dAb with a P14A framework mutation (SEQ ID NO 18) (d) DOMlh- 131-206 dAb with an ASTKG C terminus extension (SEQ ID NO 19) (e) DOMlh-131- ID NO 20).
- a single immunoglobulin variable domain according to 11 or 12, wherein the target is TNFRl and the unmodified dAb is selected from an amino acid sequence that is 100%, 95%, 90%, 85% or 80% identical to the amino acid identified as: DOMlh-131-206 (SEQ ID NO 1), DOM lh-131-511 (SEQ ID NO 2), DOM lh-131-202 (SEQ ID NO 3).
- a single immunoglobulin variable domain (dAb) according to any preceding claim, wherein the dAb is present as a fusion or conjugate with additional molecules.
- a single immunoglobulin variable domain (dAb) according to 15, wherein the dAb is present as a mAbdAb molecule.
- a pharmaceutical composition comprising a single immunoglobulin variable domain (dAb) according to any of the preceding in combination with a pharmaceutically or physiologically acceptable carrier, excipient or diluent.
- the pharmaceutical composition according to 17, which comprises further therapeutic or active agents.
- a pharmaceutical composition according to 17 or 18 which comprises an anti- TNFRl dAb.
- a pharmaceutical composition according to 19, which comprises an anti-TNFRl dAb according to any one of 12-13.
- a single immunoglobulin variable domain (dAb) according to any of claims 1-16 or a composition according to any of 17-20, for use in medicine.
- a method of treating or preventing at least one disease or disorder or condition selected from an inflammatory disease or disorder or a respiratory or pulmonary disease or disorder by administering to a subject a therapeutically or prophylactically effective amount of a composition according to any one 19-20 or a dAb according to 11-13. . ,
- respiratory or pulmonary diseases or disorders e.g selected from: chronic obstructive pulmonary disease, chronic bronchitis, chronic obstructive bronchitis and emphysema, lung inflammation, chronic obstructive pulmonary disease, asthma, pneumonia, hypersensitivity pneumonitis, pulmonary infiltrate with eosinophilia, environmental lung disease, pneumonia, bronchiectasis, cystic fibrosis, interstitial lung disease, primary pulmonary hypertension, pulmonary thromboembolism, disorders of the pleura, disorders of the mediastinum, disorders of the diaphragm, hypoventilation, hyperventilation, sleep apnea, acute respiratory distress syndrome, mesothelioma, sarcoma, graft rejection, graft versus host disease, lung cancer,
- chronic obstructive pulmonary disease chronic bronchitis, chronic obstructive bronchitis and emphysema
- lung inflammation
- composition or dAb is delivered to a subject by subcutaneous, intravenous or intramuscular injection.
- composition or dAb is delivered to a subject via parenteral, oral, rectal, transmucosal, ocular, pulmonary or GI tract delivery.
- An injectable, oral, inhalable or nebulisable formulation which comprises a composition or a dAb according to any one of 1-20.
- a sustained release formulation which comprises a composition according to any one of claims 1-20.
- a freeze dried formulation which comprises a composition according to any one of 1-20.
- a delivery device comprising a composition according to any one of 1-20. . evce compr s ng a compos on accor ng o any one o
- a device is a nebulizer or an inhaler.
- a vector comprising a nucleic acid of 32 or 33.
- a host cell comprising the nucleic acid of claim 32 or 33 or the vector of 34.
- a dAb according to 1-16 wherein the dAb binds to ADA with a KD which is 150% or more of the KD of the unmodified dAb (e.g. 200%, 250%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650% or more).
- the invention also provides the following embodiments listed as lb- 25b:
- a single immunoglobulin variable domain (dAb) which does not bind (or has reduced binding) to pre-existing human ADA in human sera, wherein the epitope on the dAb to which ADA binds is masked.
- a dAb according to lb above which has a KD of binding to ADA which is 150% or more (e.g. 200%, 250%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650% or more) of the KD of an equivalent sequence in which the epitope is not masked.
- a dAb according to 3b wherein the chemical entity comprises, one or more amino acid(s), a C-terminal tag, or a chemical modification such as pegylation or amidation.
- a humanised single immunoglobulin variable domain which has a non-human sequence at one or more of the following residues: Kabat residues 14, 41, 108, 110 and/or 112.
- a dAb according to 10b wherein said extension is between 1 and 8 amino acids.
- a dAb according to any of of of lb-15b, wherein the target to which the dAb binds is TNFa, TNFR1, VEGF, IL-1R, IL-6R, IL-4, IL-5, IL-13, DC-SIGN, ASGPR, albumin, and TGF R2.
- a single immunoglobulin variable domain (dAb) according to 16b which is selected from the following amino acid sequences identified as: (a) DOMlh-131-206 dAb with an extension of a single alanine (SEQ ID NO 16); (b) DOMlh-131-206 dAb with an extension of a single alanine and a P14A framework mutation (SEQ ID NO 17) (c) DOMlh-131-206 dAb with a P14A framework mutation (SEQ ID NO 18); (d) DOMlh-131-206 dAb with an ASTKG C terminus extension (SEQ ID NO 19); and (e) DOMlh-131-206 dAb with an ASTKG C terminus extension and a P14A framework mutation (SEQ ID NO 20).
- a single immunoglobulin variable domain (dAb) according to 16b or 17b, wherein the target is TNFR1 and the unmodified dAb is selected from a sequence that is 100%, 95%, 90%, 85% or 80% identical to the amino acid identified as: DOMlh-131-206 (SEQ ID NO 1), DOM lh-131-511 (SEQ ID NO 2), DOM lh-131-202 (SEQ ID NO 3).
- dAb immunoglobulin variable domain
- dAb single immunoglobulin variable domain
- the dAb comprising the masked epitope has a KD which is 150% or more of the KD of a dAb in which the epitope is not masked.
- a method according to 22b, wherein the chemical entity comprises, one or more amino acid(s), a C-terminal tag, or a chemical modification such as pegylation or amidation.
- n Comprises framework 4, and the loops between the beta-strands of frameworks 1 and 2.
- VHH single immunoglobulin variable domain which retains one or more camel germline residue(s) at Kabat residues 14 and/or 108.
- a single immunoglobulin variable domain according to lc above which has a KD of binding to human ADA in human serum which is 150% or more (e.g. 200%, 250%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650% or more) of the KD of an equivalent sequence in which residues 14 and/or 108 have been humanised.
- a single immunoglobulin variable domain according to 5c wherein said addition, extension or tag is selected from the group consisting of: one or more amino acid(s) extension, a C- terminal tag, or a chemical modification such as pegylation or amidation.
- n a r . comprises an alanine residue.
- a single immunoglobulin variable domain according to any of the preceding embodiments lc-lOc which additionally comprises non-human residues at one or more of the following residues: Kabat residues 41, 110 and/or 112.
- the target to which the dAb binds is TNFa, TNFR1, VEGF, IL-1R, IL-6R, IL-4, IL-5, IL-13, DC-SIGN, ASGPR, albumin, and TGF R2.
- a method of humanisation of a Camelid VHH single immunoglobulin variable domain comprising retaining one or more camel germline residue(s) at Kabat residues: 14 and/or
- dAb Camelid VHH single immunoglobulin variable domain
- dAb as used herein is a registered trademark.
- Example 1 Frequency of healthy subjects with pre-existing ADA to the dAb designated DOMlH- 131-206
- DOMlH-131-206 (SEQ ID NO 1) is biotinylated at a biotin molar challenge ratio of 8:1. After labelling, biotinylated DOMlH-131-206 (SEQ ID NO 1) is buffer-exchanged and stored in a formulation buffer containing 14mM Sodium Phosphate, 8.4% sucrose, 0.35% glycine, 0.014% polysorbate 80 at pH 7.4.
- DOMlH-131-206 is ruthenium labelled at a Sulfo-Tag molar challenge ratio of 5:1. After labelling, Sulfo-TAG labelled DOMlH-131-206 is buffer-exchanged and stored in a formulation buffer , . , . , .
- the anti-drug antibody (ADA) assay is a bridging assay performed on the MSD TM ECL (electrochemiluminescence) technology platform.
- MSDTM technology available from Meso scale Discovery, Matyland, USA
- the bound Sulfo-TagTM used in the assay produces a chemiluminescence signal that is triggered when voltage is applied by the instrument (Meso Scale Discovery SectorTM Imager 6000).
- the resulting luminescence signal is measured in ECLTM units.
- the intensity of the signal is directly proportional to the quantity of detected antibodies in the sample.
- Negative (normal human serum; NHS) and positive (PC; mouse anti- DOM1H-131-206 idiotypic antibody spiked in normal human serum) control samples (QCs) are run on each assay plate.
- a MSDTM streptavidin plate is blocked with 150 L/well blocking Casein in PBS (1%) at room temperature (RT) for 1-2 hours. The blocker is removed without washing.
- the MSD plate is then washed 3 times with PBST.
- Free unlabelled DOM1H-131-206 competes for ADA binding in this assay resulting in reduced signal intensity (high % signal inhibition)
- This 'Confirmation Assay' was used to determine whether modified versions of DOM1H-131-206 and other antibody based molecules could compete with DOM1H-131-206 for ADA binding.
- Free, unlabelled DOM1H-131-206 competes for ADA binding and results in reduced signal intensity in the DOM1H-131-206 ADA assay as described above.
- This 'Confirmation Assay' was therefore used to determine whether test materials e.g. DOM1H-131-206, modified versions of .- ' o er an o y ase mo ecu es es ma er a , u . to DOM1H-131-206.
- DQM1H-131-206 Confirmation Assay procedure (which can be used to screen VH dAbs for ADA binding): lOpg/mL DOM1H-131-206 or other test material such as modified dAbs, is pre-incubated for 1 hour ⁇ 5 minutes at RT with 4% ADA positive human serum in assay diluent (1% casein in PBS).
- a MSDTM streptavidin plate is blocked with 150pLJwell blocking casein in PBS (1%) at room temperature (RT) for 1-2 hours. The blocker is removed without washing.
- the sample containing ADA positive human serum sample and lOpg/mL test material such as modified dAbs is added to a homogeneous mixture of biotinylated DOM1H-131-206 (SEQ ID NO 1) (drug) and ruthenylated (“Sulfo-Tag”TM)
- DOM1H-131-206 SEQ ID NO 1
- drug in assay diluent (1% casein in PBS) such that the final concentrations are 2% ADA positive human serum, O.lpg/mL biotinylated DOM1H-131-
- the assay samples are transferred to the blocked MSD plate, and the plate is incubated for 1 hour ⁇ 5 minutes in the dark at RT.
- 150pL/well read buffer is added and the plate is read.
- Example 5c (results shown in Table 1): P14A, P41A, L108Q.
- % inhibition ADA binding (% inhibition of signal when the given protein is competed in the ADA bridging assay (confirmation assay)).
- Table 2 Assessment of ADA binding of VHH molecules and VH domain antibodies with c-terminal extensions
- % inhibition ADA binding (% inhibition of signal when the given protein is competed in the ADA bridging assay).
- the sequence of the FLAG tag can be found in Nature Biotechnology 1988, Vol 16, ppl204-1210.
- Example 4 Combination of Amino acid substitutions and C-terminal extension to the VH framework of DOM1H-131-206 To determine whether a combination of amino acid substitutions and modification of the C-terminus of the VH framework could reduce ADA binding, a number of C-terminal modifications and/or amino acid substitutions were made to frameworks by standard site-directed mutagenesis techniques. Molecules with substitutions were assayed using the 'confirmation assay' described previously in Example 2). Results are shown below in Table 3:
- Example 5a Assessment of TNFRl binding of DOM1H-131-206 mutants bv ELISA
- modified variants of DOM 1H-131-206 (test dAbs) to bind to human TNFRl was determined by ELISA. It was observed that framework mutation and C-terminal modifications which were shown to reduce pre-existing ADA binding generally had comparable binding to TNFRl compared with the parental DOM1H-131-206 dAb. The exception was DOM1H-131-206 with a C- terminal extension of ASTKGP, which had approximately 5-fold lower EC50 for TNFRl binding compared with the parental dAb DOM1H-131-206. _
- Recombinant human TNFRl-Fc (R&D Systems) is added to 96-well ELISA plates at a final concentration of O.l g/mL in carbonate-bicarbonate buffer pH9.4 (Pierce).
- TNFRl:Fc is removed by washing three times with wash buffer (Wash Buffer - 0.1% Tween-20/PBS) and three times with PBS.
- Plates are blocked with 1% BSA in PBS for 1 hour at room temperature. Block is removed by washing as above and then test dAb samples diluted in assay diluent (0.1% BSA + 0.05% Tween-20/PBS) are added to the plate and incubated for 1 hour at room temperature.
- mice anti-Rabbit HRP conjugate antibody is added at a dilution of 1:10,000 in assay diluent and incubated for 1 hour at room temperature.
- the enzymatic reaction is stopped with ⁇ of 1M HCI and the plate is read plate at 450nm.
- Affinity of a modified DOMlH-131-206 dAb with a C terminal was determined by surface Plasmon resonance using a BiacoreTM T100. Anti-human IgG antibody was immobilised relative units. Test materials diluted in buffer to final concentrations of 25nM to 0.024nM (in a 4 fold dilution range) were injected over the TNFRl:Fc. Binding curves generated were double referenced using a OnM test material curve, and data fitted to a 1:1 binding model to generate kinetic data. Binding of test material to cynomolgus monkey TNFR1 was determined in the same way. Binding kinetic data are shown below in Table 4d below.
- test material up to 48 hours post dosing and the levels of the two test materials determined by immunoassay. Briefly, biotinylated antibody specific to the test material was added to a streptavidin-coated 96-well microtitre plate, following which the monkey plasma samples were added. Digoxiginin-labelled human TNFRl:Fc was added, after which a horseradish peroxidase conjugated anti-digoxiginin antibody was added. Finally TMB substrate (available from R+D systems) was added and the amount of test material determined by back calculation of colourimetric signal from a test material standard curve.
- biotinylated antibody specific to the test material was added to a streptavidin-coated 96-well microtitre plate, following which the monkey plasma samples were added. Digoxiginin-labelled human TNFRl:Fc was added, after which a horseradish peroxidase conjugated anti-digoxiginin antibody was added. Finally TMB substrate (available from R+D systems) was added and
- Example 7a Expression of DOM1H-131-206 variants
- the yield of a panel of modified variants of anti-TNFRl DOM1H 131-206 dAbs was compared with the parental clone after growth in 1 litre fermentation vessels.
- the test dAbs incorporated a C-terminal extension (+A or +ASTKG), with or without a framework substitution (P14A).
- the test dAbs were expressed in the same E Co// strain, using the same microbial expression vector (paveOll (Avecia)) as the unmodified DOM1H 131-206 (SEQ ID NO 1).
- a 'seed expansion' stage was completed by inoculating a 100ml shake flask with a vial of E Coli cells expressing the dAb construct in a microbial expression vector.
- the seed flask is used to inoculate a 1L fermenter.
- the production process is made up of three stages, batch, fed-batch and induction.
- the initial batch phase lasts for approximately 13 hours during which time the culture is growing exponentially at 37°C (stepped-down to 30°C for the last 4 hours) until the primary carbon source, glycerol, is depleted.
- DO dissolved oxygen
- the nutrient feed commences (fed-batch stage).
- IPTG induction stage
- the batch is stopped approximately 48 hours after induction and the amount of dAb in the supernatant was quantified by HPLC.
- the stability of the C-terminal alanine extension of DOM 1H-131-206 +A was determined in human serum, lung homogenate or liver homogenate measured using a validated immunoassay for DOM 1H-131-206 (described below) which detects DOM 1H-131-206 but is very weakly cross- reactive to DOM 1H-131-206+A. This is due to the fact that the detection antibody M2.3G10.1G06 binds strongly to DOM 1H-131-206 but poorly to DOM 1H-131-206 +A.
- the assay format uses human TNFRl:Fc as a capture reagent and therefore is considered to be specific for intact, functional dAb.
- human whole blood, human lung homogenate (lOmg protein/ml), or human liver homogenate (lOmg protein/ml) were spiked with ⁇ g/ml of either DOM 1H-131-206, DOM 1H-131-206 +A or buffer (no drug added).
- plasma/supernatant was collected by centrifugation and samples frozen prior to assay for DOM 1H- 131-206 using the validated immunoassay (working range of 0.1 to lOng/ml).
- Biotinylated anti-VH mAb (M2.3G10.1G06) is diluted in assay buffer (10 mM Tris, 150 mM NaCI, 0.1% BSA, 0.1% Tween20, pH 7.5) and 100 ⁇ _ added at a final concentration of lOng/ml to each well of a Neutravidin-coated plate (Pierce). The plate is sealed and incubated for 1 hour at 37°C.
- microtiter plate is washed 5 times with 300 ⁇ _ of wash buffer (10 mM Tris, 150 mM NaCI, 0.1% Tween 20, pH 7.5) using a plate washer.
- the microtiter plate is washed 5 times with 300 ⁇ _ of wash buffer.
- the microtiter plate is washed 5 times with 300 ⁇ _ of wash buffer.
- TMB substrate 100 ⁇ _ per well of TMB substrate (Thermo) is added and the plate is incubated with constant shaking for approximately 5 minutes at room temperature.
- TMB substrate stop solution 100 ⁇ _ per well of TMB substrate stop solution (Sigma) is added, and the absorbance at 450 nm for each well is read using a plate reader.
- the standard curve is fitted fit to a 1/x weighted four parameter logistic algorithm using SMS2000 and the unknown samples are interpolated from the curve.
- Example 7c Ability of DOMlH-131-206 with a C-terminal alanine extension (+A) to inhibit TNFR1 signal transduction:
- TNFa signals through the NFKB pathway and results in the secretion of various cytokines including IL-8.
- IL-8 mRNA is rapidly degraded.
- activation of the NFKB pathway leads to the stabilisation of IL-8 mRNA.
- This stabilisation results in an increase in mRNA and contributes to induction of IL-8 secretion.
- induction of secreted IL-8 is to determine whether the addition of a C-terminal extension affects the ability of DOMlH-131-206 or DOM1H-131-206+A (i.e. a C terminal alanine extension) to inhibit TNFR1 signal transduction.
- DOMlH-131-206 or DOM1H-131-206+A The ability of DOMlH-131-206 or DOM1H-131-206+A to prevent human TNFa binding to human TNFR1 and to inhibit IL-8 secretion was determined using human lung fibroblast MRC-5 cells (ATCC). MRC-5 cells were incubated with the test samples for one hour after which TNFa (220pg/ml) was added. Following incubation at 37°C and 5% C0 2 for 24 hours the supernatants were harvested and stored at -20°C until the MSDTM assay for IL-8 was performed according to the manufacturer's protocol for tissue culture samples. The supernatants were diluted 1 in 12 in the supplied Calibrator Diluent prior to assay. Curve fitting was conducted in GraphPad Prism in order to determine the IC 50 .
- CYNOM-K1 cells were incubated for one hour in the presence of DOM1H-131-206 or DOM1H-131-206+A at various concentrations starting at ⁇ . This was followed by stimulation with TNFa at a final concentration of lng/ml. Following incubation at 37°C and 5% C0 2 for 24 hours the supernatants were harvested and stored at -20°C until the MSDTM assay for IL-8 was performed according to the manufacturer's protocol for tissue culture samples. The supernatants were diluted 1 in 12 in the supplied Calibrator Diluent prior to assay. Curve fitting was conducted in GraphPad Prism order to determine the IC 50 .
- Assay medium was prepared by adding 1% BSA to RPMI-1640 media (without phenol red).
- DOM1H-131-206 or DOM1H-131-206+A and V H dummy dAb were diluted in 96-well plates in assay medium such that the final concentration after addition of blood would be 800nM, and serially diluted 1 in 2 down to O.OlnM.
- 130 ⁇ of blood was added per well and the plates were incubated for one hour (37°C, 5% C0 2 ) to allow binding to TNFR1.
- Blood samples were then stimulated with 10 ⁇ of TNFa diluted in assay medium such that the final concentration was lOng/ml. Each condition was tested in duplicate.
- the plasma was transferred to a new plate and stored at -80°C until the IL-8 was measured using the MSDTM assay for human IL-8 performed according to the manufacturer's protocol for serum and plasma samples.
- the plasma was undiluted in the assay. Curve fits and ⁇ 0 ⁇ values were calculated using XLFit.
- Table 6b Summary of the potency of DOM1H-131-206 compared with DOM1H-131-206 +A in human and monkey cell-based assays:
- DOMlh-131-206 domain antibody having the amino acid sequence shown in SEQ ID NO: 1 was utilized as well as rodent orthologs of this domain antibody. Data obtained with these molecules was used to select the doses and treatment protocols described herein to be used for treatment of psoriasis, and psoriatic plaques, in human patients to be administered either DOMlh-131-206 (having the amino acid sequence shown in SEQ ID NO: 1), or shown in SEQ ID NO: 16), or a DOMlhl31206 ADA fixed molecule comprising any ADA fix (i.e. any modification to decrease binding of a dAb to ADAs) as is disclosed herein.
- DOMlh-131-206 domain antibody (with the amino acid sequence shown in SEQ ID NO: 1) to have a plasma clearance of 2.4 mL/min/kg, which approximates to the glomerular filtration rate (GFR) in monkeys and gives an elimination half-life of approximately 3 hours.
- the volume of distribution for this domain antibody was 0.26 L/kg which equates approximately to the extravascular volume and suggested distribution outside of the central/plasma compartment.
- the DOMlh-131-206 domain antibody distributes to vascularized tissues in the skin e.g., the dermis) where it is rapidly extracted into plasma and is eliminated via renal filtration.
- the initial distribution and absorption phase through the tissues of the skin is reflected in the absorption lag time before plasma exposures become measurable.
- the absorption rate in humans was expected to be longer, which in turn would lead to lower/unmeasurable plasma exposure of the DOMlh-131-206 domain antibody. This means that human plasma exposure predictions are based on observations from rodent studies and therefore serve as a conservative estimate of plasma exposure in humans.
- the DOMlh-131-206 domain antibody (having the amino acid sequence shown in SEQ ID NO: 1) was also dosed to healthy volunteers via intravenous infusion (up to 3 hours duration) up to
- IC 50 ranges (8-40 ng/mL) in these in vitro systems (varying complexity and cell type) have been used as target trough levels within the dermal compartment and facilitated selection of the domain antibody doses and treatment protocols for the treatment of psoriasis, and psoriatic plaques, in human patients described here.
- the starting dose of 0.5 mg was chosen to achieve a plasma exposure, assuming a worst case systemic exposure, lower than those achieved in the FTIH intravenous study were agonism was observed in ADA positive subjects.
- TNFR1 mediated signaling is inhibited within a discreet zone around the injection site ( ⁇ 2 cm 2 surface area) to a level of > 90 % immediately after dosing.
- TNFR1 inhibition over time is dependent on the amount of drug delivered, retained and then eliminated from the dermal compartment. Assuming a minimum (10 % dermal retention and Ke 0.1-0.14 h "1 as in rat) it was expected that levels will be maintained > IC 50 (within an injection/test zone) for a minimum of 3 days following an intradermal injection of 0.5 mg of the DOMlh-131-206 domain antibody.
- Sonographic, high frequency ultrasound based measurements can be performed using a 20 MHz high frequency sonograph (DUB USB, Taberna pro Medicum, Lueneburg).
- Serial A-scans can be composed and presented on a monitor as a section of the skin. A lateral resolution of approximately 200 pm and an axial resolution of 80 pm are possible and preferred.
- Dependent on the echo patterns, components of the epidermis, dermis and subcutis are presented and exact measurement of skin thickness is possible.
- the inflammatory psoriatic infiltrate at the psoriatic plaque site is seen as a clearly definable echo lucent band below the entrance echo.
- the thickness of the echo lucent psoriatic band can be determined and documented prior to administration of a domain antibody and after administration of a domain antibody. This thickness can be measured in pm. A decrease in thickness of the echolucent psoriatic band after administration of a domain ,
- Clinical assessment can be performed using a 5-point score determined by comparison in the clinic of a treated psoriatic plaque into which a domain antibody has been injected with at least one untreated plaque near the treated psoriatic plaque. According to this comparison the following clinical assessment scores are assigned (clinical assessment scores are 0 by definition prior to the first administration of a domain antibody):
- an increased clinical assessment score after the administration of a domain antibody according to a treatment protocol as disclosed herein indicates efficacy in the treatment of psoriasis, and a psoriatic plaque, in a human patient.
- Example 8 Single alanine extensions to VHH clones.
- Clone VHH2(d) is a bispecific format, having an IL6R binding module linked by GGGGSGGGS to a human serum albumin binding module as described in WO2010100135. (The amino acid sequence is shown in Figure 2 d: SEQ ID NO 4)
- Clone VHH2(e) is a bispecific format, having TIMF binding module linked to a serum albumin binding module in turn linked to a TNF binding module, using GGGGSGGGS as linker as described in WO2010077422. (The amino acid sequence is shown in Figure 2 e: SEQ ID NO 5)
- Clone VHH2(f) is a bivalent mono-specific format comprising two identical modules linked by an Ala-Ala-Ala linker, each module is a dAb which can bind the Al domain of the Von-Willebrand factor, as shown in WO2009115614A2.
- the amino acid sequence is shown in Figure 2 f: SEQ ID NO 6)
- Example 9 Frequency of healthy subjects with pre-existing ADA to a range of VH and V L dAb-based molecules
- test molecules (DOM 1H-131-206 (SEQ ID NO 1), DOM 1H-131-206 + C terminal alanine extension (SEQ ID NO 16), mAb- VH (SEQ ID NO), a Peptide-VL sequence, VH-VL (SEQ ID NO 11), the 735 molecule (SEQ ID NO 30 and 31), were biotinylated, buffer-exchanged and stored in formulation buffer.
- test molecules were also ruthenium labelled and then buffer-exchanged and stored in formulation buffer.
- the anti-drug antibody (ADA) for each molecule is a bridging assay performed on the MSD TM ECL (electrochemiluminescence) technology platform as described earlier.
- MSD TM ECL electrophotometric fluorescence
- a MSDTM streptavidin plate is blocked with 150ML/well blocking Casein in PBS (1%) at room temperature (RT) for 1-2 hours. The blocker is removed without washing.
- VK VL
- V L molecule (designated '735 - this molecule is "mAbdAb” - it is a IL-13mAb:linker:IL-4 (v Kappa) dAb), a panel of test mAb: linker: V L molecules were generated by standard site-directed mutagenesis, and which contained the same VL dAb sequence, but have various C-terminal modifications to the VL dAb.
- test materials designated '15014', '15019', '15020' and ⁇ 502 were engineered to have a C-terminal extension (+AAA, +T or +TV), or to have a C-terminal deletion (-R) (shown below in Table 8).
- Test materials were assayed using a 'confirmation assay' as described below, similar to that described previously for V H dAbs. Compound testing was performed by evaluating the ability of individual compounds to compete with labelled assay-specific compounds for binding to pre-existing antibodies. Any potential reductions in assay signal were reported as %inhibition. Percent inhibition levels greater than the previously determined confirmatory cutpoint for that particular assay suggests that the test compound competes with the assay specific compound for binding to anti- ⁇ antibodies, and thus may share epitope(s) with the assay specific compound.
- 2% ADA positive serum sample in assay diluent 1% casein in PBS
- a final concentration of lOpg/mL '735 or other test material such as modified dAbs.
- the MSD plate is then washed 3 times with PBST, the assay samples are transferred to the MSD plate, and the plate is incubated for 1 hour ⁇ 5 minutes in the dark at RT. _
- HEK-STAT6 cells Invivogen (which express secreted embryonic alkaline phosphatase (SEAP) under the control of a STAT6-dependent promoter) were plated into 96 well plates.
- Human IL-13 at 3ng/mL concentration and a dilution series of DOM1-H-53-567 molecules were pre-equilibrated for 1 hour at room temperature and then added to the cells for 24 hours at 37°C.
- Example 12a Cloning of anti-VEGF VH/Vk dAb-Fc-dAb molecules with modified C-termini
- the Vh-Vk dAb-Fc-dAbs with modifications made to the C-terminus of the Vk dAb portion: DMS30047-30054 were engineered by generating the variant Vk dAb sequences by PCR and then by re-cloning into DMS30045 (SEQ ID NO 40) and DMS30046 (SEQ ID NO 41), respectively to generate the modified mammalian expression vectors.
- DMS30045 From DMS30045: (i) the C-terminal arginine residue was removed to generate DMS30047 (DMS30037 -R), (ii) a C-terminal alanine was added to generate DMS30048 (which is DMS30037 + A) (SEQ ID NO 43), (iii) three C-terminal alanines were added to generate DMS30049 (DMS30037 + AAA) (SEQ ID NO 44), and a C-terminal threonine was added to generate DMS30050 (DMS30037 + T) (SEQ ID NO 45).
- DMS30046 From DMS30046 (SEQ ID NO 41): (i) the C-terminal arginine residue was removed to generate DMS30051 (DMS30038 -R) (SEQ ID NO 46), (ii) a C-terminal alanine was added to generate DMS30052 ((DMS30038 + A) (SEQ ID NO 47) , (iii) three C-terminal alanines were added to generate DMS30053 (DMS30038 + AAA) (SEQ ID NO 48), and a C-terminal threonine was added to generate DMS30054 (DMS30038 + T) (SEQ ID NO 43).
- DMS1576 with C-terminal K-044-085 dAb minus C-term R ((TGLDSP)x4)
- DMS30052 (contains modified C terminus): DMS1576 with C-terminal K-044-085 dAb +A ((TGLDSP)x4)
- DMS30053 (contains modified C terminus): DMS1576 with C-terminal K-044-085 dAb +AAA ((TGLDSP)x4)
- DMS30054 (contains modified C terminus): DMS1576 with C-terminal K-044-085 dAb +T
- Example 12B Modifications to the C-terminal region of the VEGF dAb dumbbell molecules DMS30037 and DMS30038 have reduced binding to pre-existing antibodies
- ADA positive serum sample in assay diluent 1% casein in PBS
- a final concentration of lOpg/mL of the test material such as modified dAbs.
- the ADA positive serum/test material is added to an assay plate with a homogeneous mixture containing Biotinylated V kappa dAb (unmodified) and ruthenylated ("Sulfo-Tag”TM) 'V kappa dAb (unmodified) for a final concentration of about 0.025pg/ml_ Biotinylated dAb, about 0.0125pg/ml_ ruthenylated (“Sulfo-Tag”TM) dAb, and 5% ADA positive serum in assay diluent (1% casein in PBS).
- the plate is incubated for 1 hour ⁇ 5 minutes at RT.
- a MSDTM streptavidin plate is blocked with 150pL-/well blocking casein in PBS (1%) at room temperature (RT) for 1-2 hours. The blocker is removed without washing.
- streptavidin assay plate and incubated for 1 hour ⁇ 5 minutes at RT.
- the MSD plate is then washed 3 times with PBST, the assay samples are transferred to the MSD plate, and the plate is incubated for 1 hour ⁇ 5 minutes in the dark at RT.
- the 1H-131-206 (and modified versions) may have slightly different concentrations and times of incubations as compared to a DOM10H-53-567.
- Expression plasmids encoding the relevant anti-VEGF dAb-Fc-dAb molecules described above in Example 12a were transiently transfected into HEK293 6E cells and expressed at 500ml scale to produce the antibody fragment molecules using the method described below in this example.
- the dAb sequences were cloned onto the N- or C-terminus of a generic Fc of the human IgGl isotype in a mammalian expression vector.
- the dAbs were linked to the Fc using a linker sequence: the N-terminal linker was either AAAS, or TVAAPS and the C-terminal linker was either ((GS(TVAAPSGS)x3), or Albumin Domain 3.
- Example 14 Purification of anti-VEGF VH/Vk dAb-Fc-dAb molecules with modified C-termini
- the dAb-Fc-dAb molecules were affinity purified from the supernatants, as described for the Example above.
- VEGFi 65 The binding affinity of certain anti-VEGF dAb-Fc-dAb molecules, (with small C-terminal modifications), for VEGFi 65 was determined by Surface Plasmon resonance (SPR) using a Biacore T100. Protein A was immobilised on a CI chip by primary amine coupling and this surface was then used to capture the anti-VEGF constructs. Human recombinant VEGFi 6 s (sourced 'in house' from transient transfection of HEK293 cells) was used as the analyte at 32nM to 0.03125nM in a 4 fold dilution series. All binding curves were double referenced with a buffer injection (i.e. OnM) and the data was fitted to 1:1 model inherent to the T100.
- SPR Surface Plasmon resonance
- DMS30038 were compared with variants modified at the C-terminus: DMS30037-R, (labelled as +R (DMS30047), DMS30037+T (DMS30050) and DMS30038-R, (labelled as +R (DMS30051) and Bevacizumab (Avastin) in the Biacore.
- DMS30037-R labelled as +R (DMS30047), DMS30037+T (DMS30050) and DMS30038-R, (labelled as +R (DMS30051) and Bevacizumab (Avastin) in the Biacore.
- Table 10B Binding of the anti-VEGF dAb-Fc-dAb molecules: DMS30037 and DMS30038 with C-terminal modifications to VEGFi 65 and comparison to parental dAb-Fc-dAb and Bevacizumab( Avastin).
- Table IOC Binding of the anti-VEGF dAb-Fc-dAb molecules: DMS30037 and DMS30038 with C-terminal modifications to VEGFi 65 and comparison to parental dAb-Fc-dAb and Bevacizumab( Avastin).
- Example 17 VEGF R2 Receptor Binding Assay of anti-VEGF Vh/Vk dAb-Fc-dAb molecules with modified C-termini
- DMS30038 but with C-terminal modifications, were compared both to the wild type molecule and Bevacizumab (Avastin), in the VEGF receptor 2, (R2), binding assay using the modified method, i.e. with no pre-incubation, as described below in this example.
- the data is shown in Table 11 A, all the tested dAb-Fc-dAb molecules: DMS30037, DMS30037+T (DMS30050), DMS30037-R (DMS30047), DMS30038, DMS30038-R (DMS30051), appeared to be of comparable potency and considerably more potent than Bevacizumab (Avastin), Table 11A. There was little variation in the maximal percentage inhibition achived by the molecules in the assay with all molecules achieving >93-98% maximal inhibition, (data not shown).
- VEGF R2 Receptor Binding Assay The potencies were analysed in the VEGF receptor binding assay in comparison to that of Bevacizumab (Avastin). This assay measures the binding of VEGF165 to either VEGF Rl or VEGF R2 and the ability of the test molecules to block this interaction.
- a MSD standard bind 96 well plate (L11XA-3) was coated with 0.25pg/ml VEGF Rl (R&D Systems 321-FL) or VEGF R2 (R&D 357-KD) in bicarbonate buffer (50pl/well), covered with a plate sealer and incubated overnight at 4°C.
- MSD plate was washed 3x 300 l/well with Tris wash buffer and blotted over a pad of tissue to remove excess wash buffer from the wells.
- the MSD plate was then blocked with 3% BSA in PBS (250pl/well) and incubated shaking (750 RPM) at room temperature for 1 hour.
- the MSD plate was washed again before the addition of a 2x concentration of anti-VEGF molecule (25 l/well) and incubated with shaking (750 RPM) at room temperature for 10 minutes before the addition of a 2x concentration of rhVEGF, 25pl/well, R&D Systems (293-VE/CF, made in insect cells using Baculovirus) or a GSK ⁇ house' source of VEGF (made from HEK293 mammalian cells, latter data not shown except Table 3A).
- the anti-VEGF molecules and the VEGF were prepared using 0.1% BSA in PBS.
- the initial assay was performed with a step in which the anti-VEGF molecule was pre-incubated with VEGF.
- the pre-incubations were prepared by adding an equal volume of a 2x concentration of anti-VEGF molecule to an equal volume of a 2x concentration of VEGF (R&D, 293-VE/CF) for 30 minutes at room temperature.
- the final VEGF concentration used was lOng/ml. No VEGF and VEGF alone controls were also included.
- the MSD plate was incubated with shaking (750 RPM) at room temperature for 2 hours after which it was was washed again before the addition of the detection reagent (50 LJwell, goat anti-human VEGF biotinylated antibody - R&D Systems BAF293) at 0.25 g/ml in 1% BSA in PBS and incubated with shaking (750 RPM) at room temperature for 1 hour.
- the MSD plate was washed again before the addition of the streptavidin sulfo-TAG (50u1/well, MSD R32AD-1) at 2 g/ml in 1% BSA in PBS and incubated with shaking (750 RPM) at room temperature for 30 minutes. Prior to measurement of the electrochemiluminescence in a MSD Sector Imager 6000, the MSD plate was washed and 150 ⁇ ⁇ of 2x Read Buffer T (MSD R92TC-1) was added. Curve fitting and EC50 calculations were performed using GraphPad Prism. The ability of the test anti-VEGF molecules and Bevacizumab (Avastin) to inhibit VEGF binding to VEGFR1 and VEGFR2 was determined as described.
- a second assay was performed whereby the anti-VEGF agent and the VEGF were not pre-incubated prior to the addition to the VEGF Receptor coated MSD plate. This assay was carried out and only used VEGF sourced from R&D Systems, (293-VE/CF). The ability of the anti- VEGF molecules and Bevacizumab (Avastin) to inhibit VEGF binding to VEGFR1 and VEGFR2 was determined as described above but without the pre-incubation step
- Table 11A EC 50 values of anti-VEGF dAb-Fc-dAbs with C-terminal modifications compared to Bevacizumab (Avastin) in VEGFR2 Receptor Binding Assay: Curve fitting and EC 50 calculations were performed using GraphPad Prism.
- Table 11B EC 50 values of anti-VEGF dAb-Fc-dAbs with C-terminal modifications compared to Bevacizumab (Avastin) in VEGFR2 Receptor Binding Assay:
- Example 18 Human Umbilical Vein Endothelial Cell fHUVEO Proliferation assay: Inhibition with anti-VEGF Vh/Vk dAb-Fc-dAb molecules containing C-terminal modifications:
- DMS30050 4; DMS30038-R (DMS30051): 4 & DMS30038+T (DMS30054): 4, (data not shown).
- the focus was upon analysing both the degree of maximum inhibition and the relative EC50 values in the assay generated by certain molecules compared to that of Bevacizumab (Avastin).
- Anti-VEGF molecules were assayed for their ability to suppress proliferation of human umbilical vein endothelial cells compared to that of Bevacizumab (Avastin). This assay measures the extent of endothelial cell proliferation induced by a defined concentration of VEGFi 6 s and the ability of VEGF antagonists to block this effect.
- HUVECs were seeded at 5000 cells per well in 96- well gelatine-coated plates, leaving outer wells free of cells, and incubated for several hours to permit adherence. Test molecules were assayed at equimolar concentrations (max 3.33xlO "08 M) with a 2-fold serial dilution, each in triplicate.
- the EGFi 6 5 was prepared in basal medium to achieve 75ng/ml final concentration. Medium was removed manually from the cell monolayers and 50 ⁇ basal media was added to prevent the cells from drying out. 25 ⁇ VEGFi 6 5-containing medium and 25 ⁇ basal medium or test antibody-containing medium was added as appropriate. Cells were incubated for 72hrs, after which time the total number of cells was determined using Cell Titre Glo. Treatment of HUVECs with VEGFi 65 resulted in the expected increase in the total number of cells after 72hrs, when compared with VEGF 165 -untreated cells (data not shown). This VEGF-mediated increase is interpreted as representing the cumulative effects of VEGF on both HUVEC proliferation and prevention of HUVEC cell death. The test compounds were independently assessed on individual plates against the comparator molecule, Bevacizumab (Avastin).
- Table 12A Predicted geometric means of maximum percentage inhibition of C-terminally modified anti-VEGF dAb-Fc-dAbs with 95% confidence intervals (CI) compared to parental and Bevacizumab (Avastin) in the HUVEC Assay:
- Table 12B Geometric means of IC50 for C-terminally modified anti-VEGF dAb-Fc-dAbs with 95% confidence intervals (CI) compared to parental and Bevacizumab (Avastin) in the HUVEC Assay:
- DMS30038 have very similar IC50 values and levels of maximal inhibition in the HUVEC assay to parental molecules and appear more potent, than Bevacizumab (Avastin), both in terms of maximal percentage inhibition and lower IC50 , ( see Tables 12A and 12B).
- Example 19 The use of an anti-VH mAb to define the epitope for binding of pre-existing anti-VH ADA:
- a monoclonal antibody (anti-VH mAb M2.3G10.1G06) binds to the VH framework of DOM1H- 131-206 and it was determined that this mAb has much reduced binding to DOMlH-131-206 +A; therefore this antibody appears to bind a similar epitope to the pre-existing human anti-VH ADA.
- CDR sequences of anti-VH mAb M2.3G10.1G06 The CDR sequences of the anti-VH mAb M2.3G10.1G06 were amplified and sequenced from the hybridoma cell line. The heavy and light chain sequences for mAb M2.3G10.1G06 are shown in [the amino acid sequences are shown in Figure 6a and 6b]. Sequences were cloned into a human IgGl mAb expression vector and transfected into mammalian cells to express the identified mAb. The resulting antibody was purified from the cell supernatant and tested for its ability to bind the VH dAb framework.
- Specificity of anti-VH mAb M2.3G10.1G06 The specificity of mAb M2.3G10.1G06 for binding to the VH dAb framework (with or without a modification which abrogates pre-existing ADA binding) was determined by measuring binding of mAb M2.3G10.1G06 in a TNFRl:dAb binding assay performed on the MSDTM platform (see Example 1 for details of MSDTM platform). The TNFRl:dAb binding assay is detailed below. It was demonstrated that ruthenylated anti-VH mAb M2.3G10.1G06 has a reduced binding to the VH framework by up to 85% when the C-terminus is modified by extension with alanine (1 to 15% residual binding) (results shown in Table 13).
- Modifications to VH dAbs which disrupt the epitope for pre-existing ADA binding may be predicted based on the binding of anti-VH mAb M2.3G10.1G06.
- the binding of anti-VH mAb M2.3G10.1G06 can therefore be used to assay for modifications which lead to reduced pre-existing ADA binding.
- TNFRl :Fc is captured onto a hi-bind MSD plate overnight at 4°C. The MSD plate is then washed 3 times with MSD/TRIS wash buffer.
- the plate is blocked with 3% BSA in PBS for 1.5 hours at room temperature.
- the MSD plate is then washed 3 times with MSD/TRIS wash buffer.
- biotinylated test molecule which was DOM 1H-131-206 (SEQ ID NO 1) and 20% serum sample in assay diluent (1% Casein in PBS) are incubated in a round-bottom assay plate for 1 hour ⁇ 5 minutes at RT. . . .
- MSD plate is then washed 3 times with PBST.
- This mAb binds the framework of VH dAbs e.g. DOM 1H-131-206 (SEQ ID NO 1), but binding is highly reduced in dAbs with a +A C-terminal modification e.g. DOM 1H-131-206 with a C terminal alanine extension (SEQ ID NO 16).
- H & L chain sequences have been determined from the hybridoma deposited in Biocat. There was only one LC sequence but two HC sequences: one functional (see below) and one non-functional sequence including stop codons and frameshifts.
- Fc is human IgGl.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Pulmonology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Heart & Thoracic Surgery (AREA)
- Cardiology (AREA)
- Virology (AREA)
- Dermatology (AREA)
- Rheumatology (AREA)
- Physical Education & Sports Medicine (AREA)
- Vascular Medicine (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Tropical Medicine & Parasitology (AREA)
- Pain & Pain Management (AREA)
- Transplantation (AREA)
- Otolaryngology (AREA)
- Urology & Nephrology (AREA)
Priority Applications (24)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2014525418A JP6297976B2 (ja) | 2011-08-17 | 2012-08-13 | 改変タンパク質およびペプチド |
| NZ621203A NZ621203B2 (en) | 2011-08-17 | 2012-08-13 | Modified proteins and peptides |
| CA2845029A CA2845029A1 (en) | 2011-08-17 | 2012-08-13 | Modified proteins and peptides |
| AU2012296961A AU2012296961B2 (en) | 2011-08-17 | 2012-08-13 | Modified proteins and peptides |
| PH1/2014/500380A PH12014500380A1 (en) | 2011-08-17 | 2012-08-13 | Modified proteins and peptides |
| KR1020197027997A KR102143506B1 (ko) | 2011-08-17 | 2012-08-13 | 변형된 단백질 및 펩티드 |
| BR112014003679-9A BR112014003679B1 (pt) | 2011-08-17 | 2012-08-13 | Domínio variável de imunoglobulina único, composição farmacêutica, formulação, ácido nucleico isolado ou recombinante, vetor, microorganismo transgênico, e, uso de uma composição farmacêutica |
| CN201280051150.4A CN103917557B (zh) | 2011-08-17 | 2012-08-13 | 具有降低的与抗药物抗体结合的经修饰的单可变结构域抗体 |
| SG2014010482A SG2014010482A (en) | 2011-08-17 | 2012-08-13 | Modified proteins and peptides |
| UAA201401344A UA118833C2 (uk) | 2011-08-17 | 2012-08-13 | Одиничний варіабельний домен імуноглобуліну, який зв'язується з tnfr1 |
| EP12746095.4A EP2744822B1 (en) | 2011-08-17 | 2012-08-13 | Modified proteins and peptides |
| ES12746095T ES2813432T3 (es) | 2011-08-17 | 2012-08-13 | Proteínas y péptidos modificados |
| MX2014001883A MX2014001883A (es) | 2011-08-17 | 2012-08-13 | Proteinas y peptidos modificados. |
| CN201810128962.3A CN108178800B (zh) | 2011-08-17 | 2012-08-13 | 具有降低的与抗药物抗体结合的经修饰的单可变结构域抗体 |
| US14/239,196 US10808040B2 (en) | 2011-08-17 | 2012-08-13 | Modified proteins and peptides |
| KR1020147006909A KR102162413B1 (ko) | 2011-08-17 | 2012-08-13 | 변형된 단백질 및 펩티드 |
| EA201490262A EA027160B1 (ru) | 2011-08-17 | 2012-08-13 | Модифицированные белки и пептиды |
| EP17191815.4A EP3339322A3 (en) | 2011-08-17 | 2012-08-13 | Immunoglobulin single variable domain antibodies with a c-terminal extension for reduced immunogenicity |
| IL230918A IL230918A0 (en) | 2011-08-17 | 2014-02-11 | Modified proteins and peptides |
| MA36807A MA35428B1 (fr) | 2011-08-17 | 2014-03-06 | Proteines et peptides podifies |
| AU2016277685A AU2016277685B2 (en) | 2011-08-17 | 2016-12-22 | Modified proteins and peptides |
| AU2019201505A AU2019201505A1 (en) | 2011-08-17 | 2019-03-05 | Modified proteins and peptides |
| US17/014,441 US20210017293A1 (en) | 2011-08-17 | 2020-09-08 | Modified proteins and peptides |
| US18/893,457 US20250136721A1 (en) | 2011-08-17 | 2024-09-23 | Modified proteins and peptides |
Applications Claiming Priority (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161524488P | 2011-08-17 | 2011-08-17 | |
| US61/524,488 | 2011-08-17 | ||
| GBGB1121233.9A GB201121233D0 (en) | 2011-12-12 | 2011-12-12 | Modified proteins and peptides |
| GB1121233.9 | 2011-12-12 | ||
| GBGB1121236.2A GB201121236D0 (en) | 2011-12-12 | 2011-12-12 | Proteins and peptides |
| GB1121236.2 | 2011-12-12 | ||
| GBGB1121226.3A GB201121226D0 (en) | 2011-12-12 | 2011-12-12 | Modified proteins and peptides |
| GB1121226.3 | 2011-12-12 | ||
| PCT/EP2012/064632 WO2013014208A2 (en) | 2011-07-27 | 2012-07-25 | Antigen binding constructs |
| EPPCT/EP2012/064632 | 2012-07-25 |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/239,196 A-371-Of-International US10808040B2 (en) | 2011-08-17 | 2012-08-13 | Modified proteins and peptides |
| EP15180982.9A Previously-Filed-Application EP2987806A3 (en) | 2011-08-17 | 2012-08-13 | Modified single variable domain antibodies with reduced binding to anti-drug-antibodies |
| US17/014,441 Division US20210017293A1 (en) | 2011-08-17 | 2020-09-08 | Modified proteins and peptides |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| WO2013024059A2 true WO2013024059A2 (en) | 2013-02-21 |
| WO2013024059A9 WO2013024059A9 (en) | 2014-04-03 |
| WO2013024059A3 WO2013024059A3 (en) | 2014-05-30 |
Family
ID=47715521
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2012/065782 Ceased WO2013024059A2 (en) | 2011-08-17 | 2012-08-13 | Modified proteins and peptides |
Country Status (25)
| Country | Link |
|---|---|
| US (3) | US10808040B2 (OSRAM) |
| EP (3) | EP2987806A3 (OSRAM) |
| JP (3) | JP6297976B2 (OSRAM) |
| KR (2) | KR102143506B1 (OSRAM) |
| CN (2) | CN103917557B (OSRAM) |
| AR (1) | AR087521A1 (OSRAM) |
| AU (3) | AU2012296961B2 (OSRAM) |
| BR (1) | BR112014003679B1 (OSRAM) |
| CA (1) | CA2845029A1 (OSRAM) |
| CO (1) | CO7020851A2 (OSRAM) |
| DO (1) | DOP2014000029A (OSRAM) |
| EA (1) | EA027160B1 (OSRAM) |
| ES (1) | ES2813432T3 (OSRAM) |
| HK (1) | HK1214281A1 (OSRAM) |
| IL (1) | IL230918A0 (OSRAM) |
| MA (1) | MA35428B1 (OSRAM) |
| MX (1) | MX2014001883A (OSRAM) |
| MY (1) | MY167125A (OSRAM) |
| PE (1) | PE20141522A1 (OSRAM) |
| PH (1) | PH12014500380A1 (OSRAM) |
| SG (2) | SG2014010482A (OSRAM) |
| TW (1) | TW201321405A (OSRAM) |
| UA (1) | UA118833C2 (OSRAM) |
| UY (1) | UY34254A (OSRAM) |
| WO (1) | WO2013024059A2 (OSRAM) |
Cited By (81)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013024059A3 (en) * | 2011-08-17 | 2014-05-30 | Glaxo Group Limited | Modified single variable domain antibodies with reduced binding to anti-drug-antibodies |
| WO2014043509A3 (en) * | 2012-09-13 | 2014-05-30 | Novartis Ag | Single domain antibody with c-terminal modification |
| WO2014111550A1 (en) * | 2013-01-17 | 2014-07-24 | Glaxosmithkline Intellectual Property Development Limited | Modified anti-serum albumin binding proteins |
| WO2015104322A1 (en) * | 2014-01-09 | 2015-07-16 | Glaxosmithkline Intellectual Property Development Limited | Treatment of inflammatory diseases with non-competitive tnfr1 antagonists |
| US9139825B2 (en) | 2009-10-30 | 2015-09-22 | Novartis Ag | Universal fibronectin type III bottom-side binding domain libraries |
| EP2944653A1 (en) * | 2011-06-23 | 2015-11-18 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| WO2015173342A1 (en) | 2014-05-16 | 2015-11-19 | Ablynx Nv | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| WO2015173325A3 (en) * | 2014-05-16 | 2016-02-18 | Ablynx Nv | Improved immunoglobulin variable domains |
| US9328174B2 (en) | 2012-05-09 | 2016-05-03 | Novartis Ag | Chemokine receptor binding polypeptides |
| US9346884B2 (en) | 2011-09-30 | 2016-05-24 | Ablynx N.V. | Biological materials related to c-Met |
| WO2016118733A1 (en) | 2015-01-21 | 2016-07-28 | Inhibrx Biopharma LLC | Non-immunogenic single domain antibodies |
| WO2016150845A1 (en) * | 2015-03-20 | 2016-09-29 | Ablynx Nv | Glycosylated immunoglobulin single variable domains |
| EP2723769B1 (en) * | 2011-06-23 | 2017-01-11 | Ablynx NV | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US9573992B2 (en) | 2011-06-23 | 2017-02-21 | Ablynx N.V. | Serum albumin binding proteins |
| WO2017059397A1 (en) | 2015-10-01 | 2017-04-06 | Whitehead Institute For Biomedical Research | Labeling of antibodies |
| WO2017081265A1 (en) * | 2015-11-12 | 2017-05-18 | Ablynx Nv | Improved p2x7 receptor binders and polypeptides comprising the same |
| WO2017080850A1 (en) | 2015-11-13 | 2017-05-18 | Ablynx Nv | Improved serum albumin-binding immunoglobulin variable domains |
| WO2017081320A1 (en) * | 2015-11-12 | 2017-05-18 | Ablynx Nv | Improved tnf binders |
| WO2017087589A2 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Pd1 and/or lag3 binders |
| WO2017087588A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Ctla4 binders |
| WO2017087587A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | PD1/CTLA4 Binders |
| WO2017085172A2 (en) | 2015-11-18 | 2017-05-26 | Ablynx Nv | Improved serum albumin binders |
| US9683045B2 (en) | 2010-09-30 | 2017-06-20 | Ablynx N.V. | Biological materials related to c-Met |
| WO2018104444A1 (en) | 2016-12-07 | 2018-06-14 | Ablynx Nv | Improved serum albumin binding immunoglobulin single variable domains |
| WO2018134235A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| WO2018134234A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| WO2018178307A1 (en) | 2017-03-31 | 2018-10-04 | Ablynx N.V. | Improved immunogenicity assays |
| US20180305462A1 (en) * | 2015-10-30 | 2018-10-25 | Genentech, Inc. | Hinge modified antibody fragments and methods of making |
| WO2018220080A1 (en) | 2017-05-31 | 2018-12-06 | Boehringer Ingelheim International Gmbh | Polypeptides antagonizing wnt signaling in tumor cells |
| WO2019051102A2 (en) | 2017-09-08 | 2019-03-14 | Maverick Therapeutics, Inc. | Constrained conditionally activated binding proteins |
| WO2019154867A1 (en) * | 2018-02-06 | 2019-08-15 | Ablynx Nv | Methods of treating initial episode of ttp with immunoglobulin single variable domains |
| GB201914468D0 (en) | 2019-10-07 | 2019-11-20 | Crescendo Biologics Ltd | Binding Molecules |
| EP3569618A1 (en) | 2018-05-19 | 2019-11-20 | Boehringer Ingelheim International GmbH | Antagonizing cd73 antibody |
| WO2019234220A1 (en) | 2018-06-09 | 2019-12-12 | Boehringer Ingelheim International Gmbh | Dll3-cd3 bispecific antibodies |
| US10633438B2 (en) | 2015-03-31 | 2020-04-28 | Vhsquared Limited | Polypeptides |
| WO2020089811A1 (en) | 2018-10-31 | 2020-05-07 | Novartis Ag | Dc-sign antibody drug conjugates |
| FR3088640A1 (fr) | 2018-10-14 | 2020-05-22 | Smart Diagnostix Pharma | Nouveau polypeptide se liant specifiquement a la proteine p16 |
| WO2020181140A1 (en) | 2019-03-05 | 2020-09-10 | Maverick Therapeutics, Inc. | Constrained conditionally activated binding proteins |
| EP3797790A1 (en) | 2015-12-04 | 2021-03-31 | Boehringer Ingelheim International GmbH | Biparatopic polypeptides antagonizing wnt signaling in tumor cells |
| WO2021064137A2 (en) | 2019-10-02 | 2021-04-08 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| WO2021119531A1 (en) * | 2019-12-11 | 2021-06-17 | Cullinan Management, Inc. | Anti-serum albumin antibodies |
| WO2021119551A1 (en) * | 2019-12-11 | 2021-06-17 | Cullinan Oncology, Inc. | Anti-cd19 antibodies and multi-specific binding proteins |
| WO2021198335A1 (en) * | 2020-04-01 | 2021-10-07 | F. Hoffmann-La Roche Ag | Bispecific antibodies comprising a modified c-terminal crossfab fragment |
| US11248055B2 (en) | 2015-11-27 | 2022-02-15 | Ablynx N.V. | Polypeptides inhibiting CD40L |
| WO2022040128A2 (en) | 2020-08-17 | 2022-02-24 | Maverick Therapeutics, Inc. | Constrained conditionally activated binding proteins |
| WO2022051647A2 (en) | 2020-09-04 | 2022-03-10 | Maverick Therapeutics, Inc. | Constrained conditionally activated binding protein constructs with human serum albumin domains |
| US20220112276A1 (en) * | 2020-10-12 | 2022-04-14 | Janssen Biotech, Inc. | Biosynthetic materials and methods for multidirectional biotransportation |
| RU2774823C2 (ru) * | 2015-11-12 | 2022-06-23 | Аблинкс Нв | Усовершенствованные агенты, связывающие tnf |
| WO2022214978A1 (en) | 2021-04-06 | 2022-10-13 | Takeda Pharmaceutical Company Limited | Therapeutic methods using constrained conditionally activated binding proteins |
| US11623952B2 (en) | 2019-06-21 | 2023-04-11 | Sorriso Pharmaceuticals, Inc. | IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides |
| US11644471B2 (en) | 2010-09-30 | 2023-05-09 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| WO2023093899A1 (zh) | 2021-11-29 | 2023-06-01 | 江苏恒瑞医药股份有限公司 | 经修饰的蛋白或多肽 |
| US11667719B2 (en) | 2019-06-21 | 2023-06-06 | Sorriso Pharmaceuticals, Inc. | VHH immunoglobulin chain variable domain that binds to IL-7R and methods of use thereof for treating autoimmune and/or inflammatory diseases |
| WO2023110190A1 (en) | 2021-12-13 | 2023-06-22 | Heraeus Medical Gmbh | Tests and methods for detecting bacterial infection |
| US11684677B2 (en) | 2016-09-30 | 2023-06-27 | Sorriso Pharmaceuticals, Inc. | Compositions |
| WO2024023271A1 (en) | 2022-07-27 | 2024-02-01 | Ablynx Nv | Polypeptides binding to a specific epitope of the neonatal fc receptor |
| EP4357778A1 (en) | 2022-10-20 | 2024-04-24 | Heraeus Medical GmbH | Treatment of microbial infections diagnosed using the biomarker d-lactate |
| EP4151649A4 (en) * | 2020-08-20 | 2024-06-26 | Regenecore Biotech Co., Ltd | Il-5 binding molecule, preparation method therefor, and use thereof |
| WO2024151515A2 (en) | 2023-01-09 | 2024-07-18 | Odyssey Therapeutics, Inc. | Anti-tnfr2 antigen-binding proteins and uses thereof |
| EP4350345A3 (en) * | 2011-06-23 | 2024-07-24 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| WO2024170756A1 (en) | 2023-02-17 | 2024-08-22 | Ablynx N.V. | Polypeptides binding to the neonatal fc receptor |
| WO2024192065A1 (en) | 2023-03-14 | 2024-09-19 | Odyssey Therapeutics, Inc. | Anti-cd25 antigen-binding proteins and uses thereof |
| WO2024238790A1 (en) * | 2023-05-17 | 2024-11-21 | Odyssey Therapeutics, Inc. | Modified single-domain antibodies |
| US12173054B2 (en) | 2015-03-31 | 2024-12-24 | Sorriso Pharmaceuticals, Inc. | Polypeptides |
| WO2025006846A2 (en) | 2023-06-29 | 2025-01-02 | Odyssey Therapeutics, Inc. | Anti-trailr2 antigen-binding proteins and uses thereof |
| WO2025008537A1 (en) | 2023-07-05 | 2025-01-09 | Ablynx Nv | Improved fcrn antagonists for treatment of igg-related diseases and disorders |
| US12234279B2 (en) | 2015-03-31 | 2025-02-25 | Sorriso Pharmaceuticals, Inc. | Peptide construct having a protease-cleavable linker |
| WO2025049750A1 (en) | 2023-08-30 | 2025-03-06 | Xilio Development, Inc. | Vhh masked cytokines and methods of use thereof |
| WO2025049948A1 (en) | 2023-08-30 | 2025-03-06 | Xilio Development, Inc. | Masked il-2 cytokines and methods of use thereof |
| WO2025061919A1 (en) | 2023-09-22 | 2025-03-27 | Ablynx Nv | Bi- and multivalent albumin binders |
| US12269893B2 (en) | 2014-06-16 | 2025-04-08 | Ablynx N.V. | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
| WO2025080751A2 (en) | 2023-10-13 | 2025-04-17 | Odyssey Therapeutics, Inc. | Anti-cdh17 antigen-binding proteins and uses thereof |
| WO2025151752A1 (en) | 2024-01-10 | 2025-07-17 | Xilio Development, Inc. | Masked il-2 cytokines and methods of use thereof |
| WO2025217240A1 (en) | 2024-04-10 | 2025-10-16 | Odyssey Therapeutics, Inc. | Anti-tnfr2 antigen-binding proteins and uses thereof |
| USRE50682E1 (en) | 2014-05-16 | 2025-12-02 | Ablynx Nv | Immunoglobulin variable domains |
| WO2025255558A2 (en) | 2024-06-07 | 2025-12-11 | Odyssey Therapeutics, Inc. | Anti-thymic stromal lymphopoietin (tslp) antigen-binding proteins and uses thereof |
| WO2025255435A2 (en) | 2024-06-07 | 2025-12-11 | Odyssey Therapeutics, Inc. | Antigen-binding proteins against serum albumin and uses thereof |
| WO2026006708A2 (en) | 2024-06-27 | 2026-01-02 | Odyssey Therapeutics, Inc. | Anti-cd25 antigen-binding proteins and uses thereof |
| WO2026006809A1 (en) | 2024-06-27 | 2026-01-02 | Odyssey Therapeutics, Inc. | Multispecific molecules binding tnfr2 and cd25 and uses thereof |
| US12523659B2 (en) | 2018-07-10 | 2026-01-13 | Regeneron Pharmaceuticals, Inc. | Modifying binding molecules to minimize pre-existing interactions |
| US12570736B2 (en) | 2019-06-21 | 2026-03-10 | Sorriso Pharmaceuticals, Inc. | Compositions |
Families Citing this family (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MX375669B (es) * | 2014-09-26 | 2025-03-06 | Macrogenics Inc | Diacuerpos monovalentes biespecificos que son capaces de unir cd19 y cd3, y usos de los mismos. |
| CA2991634C (en) * | 2015-07-16 | 2026-03-17 | Inhibrx Biosciences, Inc. | Multivalent and multispecific dr5-binding fusion proteins |
| CN108350069B (zh) | 2015-10-30 | 2021-11-12 | 埃博灵克斯股份有限公司 | 针对il-23的多肽 |
| GB201522539D0 (en) | 2015-12-21 | 2016-02-03 | Hexcel Composites Ltd | Improvements in or relating to electrically conducting materials |
| AU2017281421B2 (en) * | 2016-06-23 | 2024-07-25 | Ablynx N.V. | Improved pharmacokinetic assays for immunoglobulin single variable domains |
| US11919949B2 (en) | 2017-09-27 | 2024-03-05 | Elasmogen Ltd | Specific binding molecules |
| CN109096394B (zh) * | 2018-09-21 | 2021-11-05 | 成都阿帕克生物科技有限公司 | 一种抗葡萄球菌蛋白a的b亚单位的纳米抗体及核酸分子和应用 |
| GB201818460D0 (en) * | 2018-11-13 | 2018-12-26 | Crescendo Biologics Ltd | Single domain antibodies that bind human serum albumin |
| CA3193273A1 (en) * | 2020-08-27 | 2022-03-03 | Enosi Therapeutics Corporation | Methods and compositions to treat autoimmune diseases and cancer |
| CN113307870B (zh) * | 2020-10-30 | 2022-12-23 | 上海洛启生物医药技术有限公司 | 抗il5纳米抗体及其应用 |
| CN116964090A (zh) | 2020-12-14 | 2023-10-27 | 武田药品工业有限公司 | 条件性双特异性结合蛋白 |
| CN112341543B (zh) * | 2021-01-11 | 2021-04-23 | 广东赛尔生物科技有限公司 | 包含间充质干细胞外泌体的药物组合物在治疗疾病中的应用 |
| AU2023212292A1 (en) * | 2022-01-27 | 2024-09-12 | Janssen Biotech, Inc. | Enhanced protein compositions |
| AR128593A1 (es) | 2022-02-23 | 2024-05-22 | Takeda Pharmaceuticals Co | Proteínas de unión condicionalmente biespecíficas |
| CN115819599B (zh) * | 2022-11-29 | 2024-01-16 | 江苏耀海生物制药有限公司 | 一种利用重组大肠杆菌分泌表达纳米抗体Cablivi的方法 |
| CN121666535A (zh) * | 2023-04-20 | 2026-03-13 | 赞特里亚公司 | 用于检测针对抗TNFα抗体的抗药物抗体(ADA)的方法 |
| CN119173537A (zh) * | 2024-01-03 | 2024-12-20 | 苏州智核生物医药科技有限公司 | 经修饰的免疫球蛋白单一可变结构域 |
| WO2025167664A1 (zh) * | 2024-02-07 | 2025-08-14 | 原启生物科技(上海)有限责任公司 | Ror1抗原结合蛋白及其用途 |
| CN120025456B (zh) * | 2024-03-13 | 2025-11-07 | 寻济生物科技(北京)有限公司 | 一种抗vegfa融合构建体及其制备方法和应用 |
Citations (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| WO1995004079A1 (fr) | 1993-08-02 | 1995-02-09 | Raymond Hamers | Vecteur recombinant contenant une sequence d'un gene de lipoproteine pour l'expression de sequences de nucleotides |
| WO2000029004A1 (en) | 1998-11-18 | 2000-05-25 | Peptor Ltd. | Small functional units of antibody heavy chain variable regions |
| WO2007049017A2 (en) | 2005-10-24 | 2007-05-03 | Domantis Limited | Agents that bind a target in pulmonary tissue for treating respiratory diseases |
| WO2008149147A2 (en) | 2007-06-06 | 2008-12-11 | Domantis Limited | Polypeptides, antibody variable domains and antagonists |
| WO2008149144A2 (en) | 2007-06-06 | 2008-12-11 | Domantis Limited | Polypeptides, antibody variable domains and antagonists |
| WO2008149148A2 (en) | 2007-06-06 | 2008-12-11 | Domantis Limited | Polypeptides, antibody variable domains and antagonists |
| WO2009068649A2 (en) | 2007-11-30 | 2009-06-04 | Glaxo Group Limited | Antigen-binding constructs |
| WO2009115614A2 (en) | 2008-03-21 | 2009-09-24 | Ablynx Nv | Von willebrand factor specific binders and methods of use therefor |
| WO2010077422A2 (en) | 2008-10-29 | 2010-07-08 | Wyeth Llc | Formulations of single domain antigen binding molecules |
| WO2010100135A1 (en) | 2009-03-05 | 2010-09-10 | Ablynx N.V. | Novel antigen binding dimer-complexes, methods of making/avoiding and uses thereof |
Family Cites Families (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050271663A1 (en) | 2001-06-28 | 2005-12-08 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
| US20060073141A1 (en) * | 2001-06-28 | 2006-04-06 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
| AU2003210060B2 (en) | 2002-03-22 | 2010-02-25 | Aprogen, Inc. | Humanized antibody and process for preparing same |
| AU2003244817B2 (en) | 2002-06-28 | 2010-08-26 | Domantis Limited | Antigen-binding immunoglobulin single variable domains and dual-specific constructs |
| US7563443B2 (en) * | 2004-09-17 | 2009-07-21 | Domantis Limited | Monovalent anti-CD40L antibody polypeptides and compositions thereof |
| ES2694247T3 (es) * | 2005-05-20 | 2018-12-19 | Ablynx N.V. | NanobodiesTM mejorados para el tratamiento de trastornos mediados por agregación |
| DE102005023617A1 (de) * | 2005-05-21 | 2006-11-23 | Aspre Ag | Verfahren zum Mischen von Farben in einem Display |
| JP2007008925A (ja) | 2005-05-31 | 2007-01-18 | Canon Inc | 標的物質捕捉分子 |
| WO2006129843A2 (en) * | 2005-05-31 | 2006-12-07 | Canon Kabushiki Kaisha | Bispecific capturing molecule |
| US20100323905A1 (en) * | 2005-09-23 | 2010-12-23 | Academisch Ziekenhuis Leiden | Vhh for the Diagnosis, Prevention and Treatment of Diseases Associated with Protein Aggregates |
| EA200801166A1 (ru) * | 2005-12-01 | 2008-12-30 | Домантис Лимитед | Форматы конкурентного доменного антитела, которые связываются с рецептором интерлейкина 1 первого типа |
| JP2009519011A (ja) * | 2005-12-01 | 2009-05-14 | ドマンティス リミテッド | インターロイキン1受容体1型に結合する非競合ドメイン抗体フォーマット |
| US20100047171A1 (en) | 2006-01-24 | 2010-02-25 | Roland Beckmann | Fusion Proteins That Contain Natural Junctions |
| WO2008020079A1 (en) | 2006-08-18 | 2008-02-21 | Ablynx N.V. | Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling |
| EP2121018A2 (en) * | 2006-12-13 | 2009-11-25 | Schering Corporation | Treating cancer with anti-igf1r antibody 19d12=sch 717454 |
| EP2158318A2 (en) | 2007-05-14 | 2010-03-03 | Biogen Idec MA, Inc. | Single-chain fc (scfc) regions, binding polypeptides comprising same, and methods related thereto |
| EP2650311A3 (en) * | 2007-11-27 | 2014-06-04 | Ablynx N.V. | Amino acid sequences directed against heterodimeric cytokines and/or their receptors and polypeptides comprising the same |
| EP2220115A2 (en) | 2007-12-13 | 2010-08-25 | Glaxo Group Limited | Polypeptides, antibody variable domains & antagonists |
| US8020937B2 (en) * | 2008-07-31 | 2011-09-20 | Lear Corporation | Layered technology for energy management of vehicle seating |
| JP2011530297A (ja) | 2008-08-14 | 2011-12-22 | セファロン・オーストラリア・ピーティーワイ・リミテッド | バリアントドメイン抗体 |
| NZ595461A (en) * | 2009-04-10 | 2013-01-25 | Ablynx Nv | Improved amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of il-6r related diseases and disorders |
| WO2011003622A1 (en) * | 2009-07-10 | 2011-01-13 | Ablynx N.V. | Method for the production of variable domains |
| GB201005063D0 (en) | 2010-03-25 | 2010-05-12 | Ucb Pharma Sa | Biological products |
| CA2784498A1 (en) * | 2009-12-18 | 2011-06-23 | Sanofi | Novel antagonist antibodies and their fab fragments against gpvi and uses thereof |
| EP2621953B1 (en) * | 2010-09-30 | 2017-04-05 | Ablynx N.V. | Biological materials related to c-met |
| RS55775B2 (sr) * | 2011-06-23 | 2022-10-31 | Ablynx Nv | Tehnike za predviđanje, otkrivanje i smanjenje nespecifične proteinske interferencije u testovima koji uključuju pojedinačne varijabilne domene imunoglobulina |
| SG10201805064SA (en) * | 2011-06-23 | 2018-07-30 | Ablynx Nv | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| PE20141522A1 (es) * | 2011-08-17 | 2014-11-17 | Glaxo Group Ltd | Proteinas y peptidos modificados |
| WO2014111550A1 (en) | 2013-01-17 | 2014-07-24 | Glaxosmithkline Intellectual Property Development Limited | Modified anti-serum albumin binding proteins |
-
2012
- 2012-08-13 PE PE2014000214A patent/PE20141522A1/es active IP Right Grant
- 2012-08-13 ES ES12746095T patent/ES2813432T3/es active Active
- 2012-08-13 WO PCT/EP2012/065782 patent/WO2013024059A2/en not_active Ceased
- 2012-08-13 SG SG2014010482A patent/SG2014010482A/en unknown
- 2012-08-13 KR KR1020197027997A patent/KR102143506B1/ko active Active
- 2012-08-13 CA CA2845029A patent/CA2845029A1/en active Pending
- 2012-08-13 CN CN201280051150.4A patent/CN103917557B/zh active Active
- 2012-08-13 SG SG10201605891TA patent/SG10201605891TA/en unknown
- 2012-08-13 KR KR1020147006909A patent/KR102162413B1/ko active Active
- 2012-08-13 EP EP15180982.9A patent/EP2987806A3/en active Pending
- 2012-08-13 MX MX2014001883A patent/MX2014001883A/es unknown
- 2012-08-13 UY UY0001034254A patent/UY34254A/es not_active Application Discontinuation
- 2012-08-13 US US14/239,196 patent/US10808040B2/en active Active
- 2012-08-13 EA EA201490262A patent/EA027160B1/ru not_active IP Right Cessation
- 2012-08-13 TW TW101129262A patent/TW201321405A/zh unknown
- 2012-08-13 UA UAA201401344A patent/UA118833C2/uk unknown
- 2012-08-13 BR BR112014003679-9A patent/BR112014003679B1/pt active IP Right Grant
- 2012-08-13 EP EP12746095.4A patent/EP2744822B1/en active Active
- 2012-08-13 PH PH1/2014/500380A patent/PH12014500380A1/en unknown
- 2012-08-13 JP JP2014525418A patent/JP6297976B2/ja active Active
- 2012-08-13 EP EP17191815.4A patent/EP3339322A3/en active Pending
- 2012-08-13 AU AU2012296961A patent/AU2012296961B2/en not_active Ceased
- 2012-08-13 MY MYPI2014700336A patent/MY167125A/en unknown
- 2012-08-13 CN CN201810128962.3A patent/CN108178800B/zh active Active
- 2012-08-13 AR ARP120102955A patent/AR087521A1/es unknown
-
2014
- 2014-02-11 IL IL230918A patent/IL230918A0/en unknown
- 2014-02-12 CO CO14029997A patent/CO7020851A2/es unknown
- 2014-02-17 DO DO2014000029A patent/DOP2014000029A/es unknown
- 2014-03-06 MA MA36807A patent/MA35428B1/fr unknown
- 2014-06-26 HK HK16102229.1A patent/HK1214281A1/en unknown
-
2016
- 2016-12-22 AU AU2016277685A patent/AU2016277685B2/en not_active Ceased
-
2018
- 2018-02-22 JP JP2018029267A patent/JP2018117623A/ja not_active Withdrawn
-
2019
- 2019-03-05 AU AU2019201505A patent/AU2019201505A1/en not_active Abandoned
- 2019-12-09 JP JP2019222041A patent/JP6979446B2/ja active Active
-
2020
- 2020-09-08 US US17/014,441 patent/US20210017293A1/en not_active Abandoned
-
2024
- 2024-09-23 US US18/893,457 patent/US20250136721A1/en active Pending
Patent Citations (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| WO1995004079A1 (fr) | 1993-08-02 | 1995-02-09 | Raymond Hamers | Vecteur recombinant contenant une sequence d'un gene de lipoproteine pour l'expression de sequences de nucleotides |
| WO2000029004A1 (en) | 1998-11-18 | 2000-05-25 | Peptor Ltd. | Small functional units of antibody heavy chain variable regions |
| WO2007049017A2 (en) | 2005-10-24 | 2007-05-03 | Domantis Limited | Agents that bind a target in pulmonary tissue for treating respiratory diseases |
| WO2008149147A2 (en) | 2007-06-06 | 2008-12-11 | Domantis Limited | Polypeptides, antibody variable domains and antagonists |
| WO2008149144A2 (en) | 2007-06-06 | 2008-12-11 | Domantis Limited | Polypeptides, antibody variable domains and antagonists |
| WO2008149148A2 (en) | 2007-06-06 | 2008-12-11 | Domantis Limited | Polypeptides, antibody variable domains and antagonists |
| WO2009068649A2 (en) | 2007-11-30 | 2009-06-04 | Glaxo Group Limited | Antigen-binding constructs |
| WO2009115614A2 (en) | 2008-03-21 | 2009-09-24 | Ablynx Nv | Von willebrand factor specific binders and methods of use therefor |
| WO2010077422A2 (en) | 2008-10-29 | 2010-07-08 | Wyeth Llc | Formulations of single domain antigen binding molecules |
| WO2010100135A1 (en) | 2009-03-05 | 2010-09-10 | Ablynx N.V. | Novel antigen binding dimer-complexes, methods of making/avoiding and uses thereof |
Non-Patent Citations (14)
| Title |
|---|
| AUSUBEL ET AL.: "Short Protocols in Molecular Biology", 1999, JOHN WILEY & SONS, INC |
| BANGHA, SKIN PHARMACOL., vol. 9, 1996, pages 298 |
| BOYD ET AL., MOL. IMMUNOL., vol. 32, 1996, pages 1311 - 1318 |
| DAVIS ET AL., CHEM. REV., vol. 102, 2002, pages 579 |
| HANG ET AL., ACC. CHEM. RES, vol. 34, 2001, pages 727 |
| KRAJACIC, BIOTECHNOLOGY HEALTHCARE, vol. 6, no. 5, December 2009 (2009-12-01) |
| MACK: "Remington's Pharmaceutical Sciences", 1982 |
| NATURE BIOTECHNOLOGY, vol. 16, 1988, pages 1204 - 1210 |
| RAJU ET AL., BIOCHEMISTRY, vol. 40, 2001, pages 8868 - 8876 |
| SAMBROOK: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SEARS ET AL., SCIENCE, vol. 291, 2001, pages 2344 |
| TATUSOVA, T. A. ET AL., FEMSMICROBIOLLETT, 1999, pages 174187 - 188 |
| WACKER ET AL., SCIENCE, vol. 298, 2002, pages 1790 |
| ZHANG ET AL., SCIENCE, vol. 303, 2004, pages 371 |
Cited By (193)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9139825B2 (en) | 2009-10-30 | 2015-09-22 | Novartis Ag | Universal fibronectin type III bottom-side binding domain libraries |
| US10253313B2 (en) | 2009-10-30 | 2019-04-09 | Novartis Ag | Universal fibronectin type III bottom-side binding domain libraries |
| US11644471B2 (en) | 2010-09-30 | 2023-05-09 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US9683045B2 (en) | 2010-09-30 | 2017-06-20 | Ablynx N.V. | Biological materials related to c-Met |
| EP2974737A1 (en) * | 2011-06-23 | 2016-01-20 | Ablynx N.V. | Techniques for predicting, detecting and reducing a specific protein interference in assays involving immunoglobulin single variable domains |
| KR20190107200A (ko) * | 2011-06-23 | 2019-09-18 | 아블린쓰 엔.브이. | 면역글로불린 단일 가변 도메인을 수반하는 어세이에서 비특이적 단백질 간섭을 예측하고 검출하고 감소시키는 기법 |
| EP2944653A1 (en) * | 2011-06-23 | 2015-11-18 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| EP2944654A1 (en) * | 2011-06-23 | 2015-11-18 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| KR20210047369A (ko) * | 2011-06-23 | 2021-04-29 | 아블린쓰 엔.브이. | 면역글로불린 단일 가변 도메인을 수반하는 어세이에서 비특이적 단백질 간섭을 예측하고 검출하고 감소시키는 기법 |
| EP4350345A3 (en) * | 2011-06-23 | 2024-07-24 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| US11192937B2 (en) | 2011-06-23 | 2021-12-07 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US12006352B2 (en) | 2011-06-23 | 2024-06-11 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| EP3020728A1 (en) * | 2011-06-23 | 2016-05-18 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| EP3363812A1 (en) * | 2011-06-23 | 2018-08-22 | Ablynx NV | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| EP3363813A1 (en) * | 2011-06-23 | 2018-08-22 | Ablynx NV | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| US11192938B2 (en) | 2011-06-23 | 2021-12-07 | Ablynx N.V. | Serum albumin binding proteins containing immunoglobulin single variable domains |
| US10858418B2 (en) | 2011-06-23 | 2020-12-08 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| EP2723769B1 (en) * | 2011-06-23 | 2017-01-11 | Ablynx NV | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US9573992B2 (en) | 2011-06-23 | 2017-02-21 | Ablynx N.V. | Serum albumin binding proteins |
| EP2974737B1 (en) * | 2011-06-23 | 2025-10-22 | Ablynx N.V. | Techniques for predicting, detecting and reducing a specific protein interference in assays involving immunoglobulin single variable domains |
| EP2723769B2 (en) † | 2011-06-23 | 2022-06-15 | Ablynx NV | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| KR102246924B1 (ko) | 2011-06-23 | 2021-04-30 | 아블린쓰 엔.브이. | 면역글로불린 단일 가변 도메인을 수반하는 어세이에서 비특이적 단백질 간섭을 예측하고 검출하고 감소시키는 기법 |
| KR102430693B1 (ko) | 2011-06-23 | 2022-08-08 | 아블린쓰 엔.브이. | 면역글로불린 단일 가변 도메인을 수반하는 어세이에서 비특이적 단백질 간섭을 예측하고 검출하고 감소시키는 기법 |
| US12516105B2 (en) | 2011-06-23 | 2026-01-06 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US10808040B2 (en) | 2011-08-17 | 2020-10-20 | Glaxo Group Limited | Modified proteins and peptides |
| EA027160B1 (ru) * | 2011-08-17 | 2017-06-30 | Глаксо Груп Лимитед | Модифицированные белки и пептиды |
| WO2013024059A3 (en) * | 2011-08-17 | 2014-05-30 | Glaxo Group Limited | Modified single variable domain antibodies with reduced binding to anti-drug-antibodies |
| EP2987806A3 (en) * | 2011-08-17 | 2016-07-13 | Glaxo Group Limited | Modified single variable domain antibodies with reduced binding to anti-drug-antibodies |
| US9346884B2 (en) | 2011-09-30 | 2016-05-24 | Ablynx N.V. | Biological materials related to c-Met |
| US11466089B2 (en) | 2012-05-09 | 2022-10-11 | Ablynx N.V. | Chemokine receptor binding polypeptides |
| US9688763B2 (en) | 2012-05-09 | 2017-06-27 | Novartis Ag | Chemokine receptor binding polypeptides |
| US9328174B2 (en) | 2012-05-09 | 2016-05-03 | Novartis Ag | Chemokine receptor binding polypeptides |
| US20140161796A1 (en) * | 2012-09-13 | 2014-06-12 | Andreas Loew | Single chain proteins with c-terminal modifications |
| WO2014043509A3 (en) * | 2012-09-13 | 2014-05-30 | Novartis Ag | Single domain antibody with c-terminal modification |
| WO2014111550A1 (en) * | 2013-01-17 | 2014-07-24 | Glaxosmithkline Intellectual Property Development Limited | Modified anti-serum albumin binding proteins |
| WO2015104322A1 (en) * | 2014-01-09 | 2015-07-16 | Glaxosmithkline Intellectual Property Development Limited | Treatment of inflammatory diseases with non-competitive tnfr1 antagonists |
| EP4707303A2 (en) | 2014-05-16 | 2026-03-11 | Ablynx NV | Improved immunoglobulin variable domains |
| US11485778B2 (en) | 2014-05-16 | 2022-11-01 | Ablynx N.V. | Immunoglobulin variable domains |
| IL295534B1 (en) * | 2014-05-16 | 2024-11-01 | Ablynx Nv | Improved immunoglobulin variable domains |
| EP3248986A2 (en) | 2014-05-16 | 2017-11-29 | Ablynx NV | Immunoglobulin variable domains |
| WO2015173342A1 (en) | 2014-05-16 | 2015-11-19 | Ablynx Nv | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| RU2809788C2 (ru) * | 2014-05-16 | 2023-12-18 | Аблинкс Нв | Улучшенные вариабельные домены иммуноглобулина |
| JP7325928B2 (ja) | 2014-05-16 | 2023-08-15 | アブリンクス エン.ヴェー. | 改善された免疫グロブリン可変ドメイン |
| RU2746738C2 (ru) * | 2014-05-16 | 2021-04-20 | Аблинкс Нв | Улучшенные вариабельные домены иммуноглобулина |
| US11009511B2 (en) | 2014-05-16 | 2021-05-18 | Ablynx N.V. | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| CN113717280A (zh) * | 2014-05-16 | 2021-11-30 | 埃博灵克斯股份有限公司 | 改进的免疫球蛋白可变结构域 |
| US12180268B2 (en) | 2014-05-16 | 2024-12-31 | Ablynx N.V. | Immunoglobulin variable domains |
| JP2017518072A (ja) * | 2014-05-16 | 2017-07-06 | アブリンクス エン.ヴェー. | 改善された免疫グロブリン可変ドメイン |
| US11708404B2 (en) | 2014-05-16 | 2023-07-25 | Ablynx N.V. | Immunoglobulin variable domains |
| JP2018162297A (ja) * | 2014-05-16 | 2018-10-18 | アブリンクス エン.ヴェー. | 改善された免疫グロブリン可変ドメイン |
| WO2015173325A3 (en) * | 2014-05-16 | 2016-02-18 | Ablynx Nv | Improved immunoglobulin variable domains |
| US11220539B2 (en) | 2014-05-16 | 2022-01-11 | Ablynx N.V. | Immunoglobulin variable domains |
| IL248636B2 (en) * | 2014-05-16 | 2023-04-01 | Ablynx Nv | Enhanced immunoglobulin variable sites |
| AU2020202570B2 (en) * | 2014-05-16 | 2022-12-08 | Ablynx Nv | Improved immunoglobulin variable domains |
| IL295534B2 (en) * | 2014-05-16 | 2025-03-01 | Ablynx Nv | Improved immunoglobulin variable sites |
| AU2020202855B2 (en) * | 2014-05-16 | 2022-12-08 | Ablynx Nv | Improved immunoglobulin variable domains |
| IL248636B (en) * | 2014-05-16 | 2022-12-01 | Ablynx Nv | Enhanced immunoglobulin variable sites |
| EP3248986B1 (en) | 2014-05-16 | 2022-01-26 | Ablynx NV | Immunoglobulin variable domains |
| US11485777B2 (en) | 2014-05-16 | 2022-11-01 | Ablynx N.V. | Immunoglobulin variable domains |
| EP3248986A3 (en) * | 2014-05-16 | 2017-12-20 | Ablynx NV | Immunoglobulin variable domains |
| EP3982124A1 (en) | 2014-05-16 | 2022-04-13 | Ablynx NV | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| USRE50682E1 (en) | 2014-05-16 | 2025-12-02 | Ablynx Nv | Immunoglobulin variable domains |
| US12553901B2 (en) | 2014-05-16 | 2026-02-17 | Ablynx N.V. | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| JP7098439B2 (ja) | 2014-05-16 | 2022-07-11 | アブリンクス エン.ヴェー. | 改善された免疫グロブリン可変ドメイン |
| CN106661100A (zh) * | 2014-05-16 | 2017-05-10 | 埃博灵克斯股份有限公司 | 改进的免疫球蛋白可变结构域 |
| US11319364B2 (en) | 2014-05-16 | 2022-05-03 | Ablynx N.V. | Immunoglobulin variable domains |
| EP3702369A1 (en) | 2014-05-16 | 2020-09-02 | Ablynx NV | Immunoglobulin variable domains |
| US11312764B2 (en) | 2014-05-16 | 2022-04-26 | Ablynx N.V. | Immunoglobulin variable domains |
| US11312765B2 (en) | 2014-05-16 | 2022-04-26 | Ablynx N.V. | Immunoglobulin variable domains |
| EP3693386A1 (en) | 2014-05-16 | 2020-08-12 | Ablynx NV | Immunoglobulin variable domains |
| EP3143042B1 (en) | 2014-05-16 | 2020-06-10 | Ablynx N.V. | Immunoglobulin variable domains |
| US12269893B2 (en) | 2014-06-16 | 2025-04-08 | Ablynx N.V. | Methods of treating TTP with immunoglobulin single variable domains and uses thereof |
| WO2016118733A1 (en) | 2015-01-21 | 2016-07-28 | Inhibrx Biopharma LLC | Non-immunogenic single domain antibodies |
| EP3247407A1 (en) | 2015-01-21 | 2017-11-29 | Inhibrx LP | Non-immunogenic single domain antibodies |
| EP3247407A4 (en) * | 2015-01-21 | 2018-08-22 | Inhibrx LP | Non-immunogenic single domain antibodies |
| US20220324951A1 (en) * | 2015-03-20 | 2022-10-13 | Ablynx N.V. | Glycosylated immunoglobulin single variable domains |
| WO2016150845A1 (en) * | 2015-03-20 | 2016-09-29 | Ablynx Nv | Glycosylated immunoglobulin single variable domains |
| US12173054B2 (en) | 2015-03-31 | 2024-12-24 | Sorriso Pharmaceuticals, Inc. | Polypeptides |
| US12234279B2 (en) | 2015-03-31 | 2025-02-25 | Sorriso Pharmaceuticals, Inc. | Peptide construct having a protease-cleavable linker |
| US10633438B2 (en) | 2015-03-31 | 2020-04-28 | Vhsquared Limited | Polypeptides |
| WO2017059397A1 (en) | 2015-10-01 | 2017-04-06 | Whitehead Institute For Biomedical Research | Labeling of antibodies |
| EP4218833A1 (en) | 2015-10-01 | 2023-08-02 | Whitehead Institute for Biomedical Research | Labeling of antibodies |
| US20180305462A1 (en) * | 2015-10-30 | 2018-10-25 | Genentech, Inc. | Hinge modified antibody fragments and methods of making |
| US10662254B2 (en) * | 2015-10-30 | 2020-05-26 | Genentech, Inc. | Hinge modified antibody fragments and methods of making |
| CN108473563A (zh) * | 2015-11-12 | 2018-08-31 | 埃博灵克斯股份有限公司 | 改进的tnf结合剂 |
| US10875918B2 (en) | 2015-11-12 | 2020-12-29 | Ablynx N.V. | P2X7 receptor binders and polypeptides comprising the same |
| WO2017081265A1 (en) * | 2015-11-12 | 2017-05-18 | Ablynx Nv | Improved p2x7 receptor binders and polypeptides comprising the same |
| AU2016352695B2 (en) * | 2015-11-12 | 2023-07-27 | Ablynx Nv | Improved P2X7 receptor binders and polypeptides comprising the same |
| WO2017081320A1 (en) * | 2015-11-12 | 2017-05-18 | Ablynx Nv | Improved tnf binders |
| EP3266798A3 (en) * | 2015-11-12 | 2018-03-28 | Ablynx NV | Improved tnf binders |
| RU2774823C2 (ru) * | 2015-11-12 | 2022-06-23 | Аблинкс Нв | Усовершенствованные агенты, связывающие tnf |
| US10544211B2 (en) | 2015-11-12 | 2020-01-28 | Ablynx N.V. | TNF binders |
| CN108473563B (zh) * | 2015-11-12 | 2022-06-14 | 埃博灵克斯股份有限公司 | 改进的tnf结合剂 |
| EP3266798A2 (en) | 2015-11-12 | 2018-01-10 | Ablynx NV | Improved tnf binders |
| US9745372B2 (en) | 2015-11-12 | 2017-08-29 | Ablynx N.V. | TNF binders |
| WO2017080850A1 (en) | 2015-11-13 | 2017-05-18 | Ablynx Nv | Improved serum albumin-binding immunoglobulin variable domains |
| EP3974449A1 (en) | 2015-11-13 | 2022-03-30 | Ablynx NV | Improved serum albumin-binding immunoglobulin variable domains |
| US11168136B2 (en) | 2015-11-18 | 2021-11-09 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| US11168135B2 (en) | 2015-11-18 | 2021-11-09 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| KR102194188B1 (ko) * | 2015-11-18 | 2020-12-24 | 머크 샤프 앤드 돔 코포레이션 | Pd1 및/또는 lag3 결합제 |
| KR20200143748A (ko) * | 2015-11-18 | 2020-12-24 | 머크 샤프 앤드 돔 코포레이션 | Pd1 및/또는 lag3 결합제 |
| JP2019502370A (ja) * | 2015-11-18 | 2019-01-31 | メルク・シャープ・アンド・ドーム・コーポレーションMerck Sharp & Dohme Corp. | Pd1/ctla4結合性物質 |
| WO2017087588A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Ctla4 binders |
| US12351630B2 (en) | 2015-11-18 | 2025-07-08 | Merck Sharp & Dohme Llc | PD1 and/or LAG3 binders |
| IL259224B1 (en) * | 2015-11-18 | 2023-03-01 | Merck Sharp & Dohme | Substances that bind to pd1 and/or lag3 |
| WO2017087587A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | PD1/CTLA4 Binders |
| WO2017085172A2 (en) | 2015-11-18 | 2017-05-26 | Ablynx Nv | Improved serum albumin binders |
| WO2017085172A3 (en) * | 2015-11-18 | 2017-06-29 | Ablynx Nv | Improved serum albumin binders |
| WO2017087589A3 (en) * | 2015-11-18 | 2017-07-13 | Merck Sharp & Dohme Corp. | Pd1 and/or lag3 binders |
| US11649290B2 (en) | 2015-11-18 | 2023-05-16 | Merck Sharp & Dohme Llc | CTLA4 binders |
| US10544222B2 (en) | 2015-11-18 | 2020-01-28 | Merck Sharp & Dohme Corp. | PD1/CTLA4 binders |
| US11332519B2 (en) | 2015-11-18 | 2022-05-17 | Ablynx N.V. | Serum albumin binders |
| KR102220275B1 (ko) | 2015-11-18 | 2021-02-26 | 머크 샤프 앤드 돔 코포레이션 | Pd1 및/또는 lag3 결합제 |
| US11155619B2 (en) | 2015-11-18 | 2021-10-26 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| KR102317574B1 (ko) | 2015-11-18 | 2021-10-26 | 머크 샤프 앤드 돔 코포레이션 | Pd1 및/또는 lag3 결합제 |
| WO2017087589A2 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Pd1 and/or lag3 binders |
| RU2755724C2 (ru) * | 2015-11-18 | 2021-09-20 | Мерк Шарп И Доум Корп. | Pd1/ctla4-связывающие вещества |
| US10501542B2 (en) | 2015-11-18 | 2019-12-10 | Merck Sharp & Dohme Corp. | CTLA4 binders |
| US10323090B2 (en) | 2015-11-18 | 2019-06-18 | Merck Sharp & Dohme Corp. | PD1 and/or LAG3 binders |
| IL259224B2 (en) * | 2015-11-18 | 2023-07-01 | Merck Sharp & Dohme | Substances that bind to pd1 and/or lag3 |
| KR20180081592A (ko) * | 2015-11-18 | 2018-07-16 | 머크 샤프 앤드 돔 코포레이션 | Pd1 및/또는 lag3 결합제 |
| EA038179B1 (ru) * | 2015-11-18 | 2021-07-20 | Мерк Шарп И Доум Корп. | Ctla4-связывающие вещества |
| KR20190116546A (ko) * | 2015-11-18 | 2019-10-14 | 머크 샤프 앤드 돔 코포레이션 | Pd1 및/또는 lag3 결합제 |
| US11248055B2 (en) | 2015-11-27 | 2022-02-15 | Ablynx N.V. | Polypeptides inhibiting CD40L |
| US11952418B2 (en) | 2015-12-04 | 2024-04-09 | Boehringer Ingelheim International Gmbh | Biparatopic polypeptides antagonizing Wnt signaling in tumor cells |
| EP3797790A1 (en) | 2015-12-04 | 2021-03-31 | Boehringer Ingelheim International GmbH | Biparatopic polypeptides antagonizing wnt signaling in tumor cells |
| US11684677B2 (en) | 2016-09-30 | 2023-06-27 | Sorriso Pharmaceuticals, Inc. | Compositions |
| WO2018104444A1 (en) | 2016-12-07 | 2018-06-14 | Ablynx Nv | Improved serum albumin binding immunoglobulin single variable domains |
| WO2018134235A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| WO2018134234A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| EP4442708A2 (en) | 2017-01-17 | 2024-10-09 | Ablynx NV | Improved serum albumin binders |
| EP4442707A2 (en) | 2017-01-17 | 2024-10-09 | Ablynx NV | Improved serum albumin binders |
| EP4471058A2 (en) | 2017-01-17 | 2024-12-04 | Ablynx NV | Improved serum albumin binders |
| EP4442709A2 (en) | 2017-01-17 | 2024-10-09 | Ablynx NV | Improved serum albumin binders |
| WO2018178307A1 (en) | 2017-03-31 | 2018-10-04 | Ablynx N.V. | Improved immunogenicity assays |
| WO2018220080A1 (en) | 2017-05-31 | 2018-12-06 | Boehringer Ingelheim International Gmbh | Polypeptides antagonizing wnt signaling in tumor cells |
| EP4628164A2 (en) | 2017-09-08 | 2025-10-08 | Takeda Pharmaceutical Company Limited | Constrained conditionally activated binding proteins |
| WO2019051102A2 (en) | 2017-09-08 | 2019-03-14 | Maverick Therapeutics, Inc. | Constrained conditionally activated binding proteins |
| US20210221912A1 (en) * | 2018-02-06 | 2021-07-22 | Ablynx N.V. | Methods of treating initial episode of ttp with immunoglobulin single variable domains |
| WO2019154867A1 (en) * | 2018-02-06 | 2019-08-15 | Ablynx Nv | Methods of treating initial episode of ttp with immunoglobulin single variable domains |
| US11999797B2 (en) | 2018-02-06 | 2024-06-04 | Ablynx N.V. | Methods of treating initial episode of TTP with immunoglobulin single variable domains |
| US11312785B2 (en) | 2018-05-19 | 2022-04-26 | Boehringer Ingelheim International Gmbh | Antagonizing CD73 antibody |
| WO2019224025A2 (en) | 2018-05-19 | 2019-11-28 | Boehringer Ingelheim International Gmbh | Antagonizing cd73 antibody |
| EP3569618A1 (en) | 2018-05-19 | 2019-11-20 | Boehringer Ingelheim International GmbH | Antagonizing cd73 antibody |
| EP4566621A2 (en) | 2018-06-09 | 2025-06-11 | Boehringer Ingelheim International GmbH | Dll3/cd3 binding proteins for the treatment of cancer |
| US12173083B2 (en) | 2018-06-09 | 2024-12-24 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| US11332541B2 (en) | 2018-06-09 | 2022-05-17 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| WO2019234220A1 (en) | 2018-06-09 | 2019-12-12 | Boehringer Ingelheim International Gmbh | Dll3-cd3 bispecific antibodies |
| US12528879B2 (en) | 2018-06-09 | 2026-01-20 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| US12523659B2 (en) | 2018-07-10 | 2026-01-13 | Regeneron Pharmaceuticals, Inc. | Modifying binding molecules to minimize pre-existing interactions |
| FR3088640A1 (fr) | 2018-10-14 | 2020-05-22 | Smart Diagnostix Pharma | Nouveau polypeptide se liant specifiquement a la proteine p16 |
| WO2020089811A1 (en) | 2018-10-31 | 2020-05-07 | Novartis Ag | Dc-sign antibody drug conjugates |
| EP4592313A2 (en) | 2019-03-05 | 2025-07-30 | Takeda Pharmaceutical Company Limited | Constrained conditionally activated binding proteins |
| WO2020181140A1 (en) | 2019-03-05 | 2020-09-10 | Maverick Therapeutics, Inc. | Constrained conditionally activated binding proteins |
| US12247079B2 (en) | 2019-06-21 | 2025-03-11 | Sorriso Pharmaceuticals, Inc. | Polynucleotides encoding, and method of making, a polypeptide comprising a VHH which binds interleukin-receptor (IL-7R) |
| US12570736B2 (en) | 2019-06-21 | 2026-03-10 | Sorriso Pharmaceuticals, Inc. | Compositions |
| US12559552B2 (en) | 2019-06-21 | 2026-02-24 | Sorriso Pharmaceuticals, Inc. | IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides |
| US11623952B2 (en) | 2019-06-21 | 2023-04-11 | Sorriso Pharmaceuticals, Inc. | IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides |
| US11667719B2 (en) | 2019-06-21 | 2023-06-06 | Sorriso Pharmaceuticals, Inc. | VHH immunoglobulin chain variable domain that binds to IL-7R and methods of use thereof for treating autoimmune and/or inflammatory diseases |
| US11732045B2 (en) | 2019-10-02 | 2023-08-22 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| WO2021064137A2 (en) | 2019-10-02 | 2021-04-08 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| GB201914468D0 (en) | 2019-10-07 | 2019-11-20 | Crescendo Biologics Ltd | Binding Molecules |
| WO2021119551A1 (en) * | 2019-12-11 | 2021-06-17 | Cullinan Oncology, Inc. | Anti-cd19 antibodies and multi-specific binding proteins |
| US12428480B2 (en) | 2019-12-11 | 2025-09-30 | Cullinan Therapeutics, Inc. | Anti-CD19 antibodies and multi-specific binding proteins |
| WO2021119531A1 (en) * | 2019-12-11 | 2021-06-17 | Cullinan Management, Inc. | Anti-serum albumin antibodies |
| WO2021198335A1 (en) * | 2020-04-01 | 2021-10-07 | F. Hoffmann-La Roche Ag | Bispecific antibodies comprising a modified c-terminal crossfab fragment |
| WO2022040128A2 (en) | 2020-08-17 | 2022-02-24 | Maverick Therapeutics, Inc. | Constrained conditionally activated binding proteins |
| EP4151649A4 (en) * | 2020-08-20 | 2024-06-26 | Regenecore Biotech Co., Ltd | Il-5 binding molecule, preparation method therefor, and use thereof |
| WO2022051647A2 (en) | 2020-09-04 | 2022-03-10 | Maverick Therapeutics, Inc. | Constrained conditionally activated binding protein constructs with human serum albumin domains |
| US20220112276A1 (en) * | 2020-10-12 | 2022-04-14 | Janssen Biotech, Inc. | Biosynthetic materials and methods for multidirectional biotransportation |
| WO2022214978A1 (en) | 2021-04-06 | 2022-10-13 | Takeda Pharmaceutical Company Limited | Therapeutic methods using constrained conditionally activated binding proteins |
| EP4435002A4 (en) * | 2021-11-29 | 2025-03-26 | Jiangsu Hengrui Pharmaceuticals Co., Ltd. | MODIFIED PROTEIN OR POLYPEPTIDE |
| WO2023093899A1 (zh) | 2021-11-29 | 2023-06-01 | 江苏恒瑞医药股份有限公司 | 经修饰的蛋白或多肽 |
| WO2023110190A1 (en) | 2021-12-13 | 2023-06-22 | Heraeus Medical Gmbh | Tests and methods for detecting bacterial infection |
| WO2024023271A1 (en) | 2022-07-27 | 2024-02-01 | Ablynx Nv | Polypeptides binding to a specific epitope of the neonatal fc receptor |
| EP4357778A1 (en) | 2022-10-20 | 2024-04-24 | Heraeus Medical GmbH | Treatment of microbial infections diagnosed using the biomarker d-lactate |
| WO2024083429A1 (en) | 2022-10-20 | 2024-04-25 | Heraeus Medical Gmbh | Treatment of microbial infections diagnosed using the biomarker d-lactate |
| WO2024151515A2 (en) | 2023-01-09 | 2024-07-18 | Odyssey Therapeutics, Inc. | Anti-tnfr2 antigen-binding proteins and uses thereof |
| WO2024170756A1 (en) | 2023-02-17 | 2024-08-22 | Ablynx N.V. | Polypeptides binding to the neonatal fc receptor |
| WO2024192065A1 (en) | 2023-03-14 | 2024-09-19 | Odyssey Therapeutics, Inc. | Anti-cd25 antigen-binding proteins and uses thereof |
| WO2024238790A1 (en) * | 2023-05-17 | 2024-11-21 | Odyssey Therapeutics, Inc. | Modified single-domain antibodies |
| WO2025006846A2 (en) | 2023-06-29 | 2025-01-02 | Odyssey Therapeutics, Inc. | Anti-trailr2 antigen-binding proteins and uses thereof |
| WO2025008537A1 (en) | 2023-07-05 | 2025-01-09 | Ablynx Nv | Improved fcrn antagonists for treatment of igg-related diseases and disorders |
| WO2025049948A1 (en) | 2023-08-30 | 2025-03-06 | Xilio Development, Inc. | Masked il-2 cytokines and methods of use thereof |
| WO2025049750A1 (en) | 2023-08-30 | 2025-03-06 | Xilio Development, Inc. | Vhh masked cytokines and methods of use thereof |
| WO2025061919A1 (en) | 2023-09-22 | 2025-03-27 | Ablynx Nv | Bi- and multivalent albumin binders |
| WO2025080751A2 (en) | 2023-10-13 | 2025-04-17 | Odyssey Therapeutics, Inc. | Anti-cdh17 antigen-binding proteins and uses thereof |
| WO2025151752A1 (en) | 2024-01-10 | 2025-07-17 | Xilio Development, Inc. | Masked il-2 cytokines and methods of use thereof |
| WO2025217240A1 (en) | 2024-04-10 | 2025-10-16 | Odyssey Therapeutics, Inc. | Anti-tnfr2 antigen-binding proteins and uses thereof |
| WO2025255435A2 (en) | 2024-06-07 | 2025-12-11 | Odyssey Therapeutics, Inc. | Antigen-binding proteins against serum albumin and uses thereof |
| WO2025255558A2 (en) | 2024-06-07 | 2025-12-11 | Odyssey Therapeutics, Inc. | Anti-thymic stromal lymphopoietin (tslp) antigen-binding proteins and uses thereof |
| WO2026006708A2 (en) | 2024-06-27 | 2026-01-02 | Odyssey Therapeutics, Inc. | Anti-cd25 antigen-binding proteins and uses thereof |
| WO2026006809A1 (en) | 2024-06-27 | 2026-01-02 | Odyssey Therapeutics, Inc. | Multispecific molecules binding tnfr2 and cd25 and uses thereof |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250136721A1 (en) | Modified proteins and peptides | |
| KR102662499B1 (ko) | 개선된 혈청 알부민 결합제 | |
| JP2022180448A (ja) | イヌ化抗体 | |
| US11066473B2 (en) | Galectin-10 antibodies | |
| WO2014111550A1 (en) | Modified anti-serum albumin binding proteins | |
| CA2800581A1 (en) | Antibodies to human gdf8 | |
| KR20110119806A (ko) | 개선된 항tnfr1 폴리펩티드,항체 가변 도메인 및 길항제 | |
| KR20200010294A (ko) | 치료용 항-cd40 리간드 항체 | |
| KR20120101417A (ko) | 안정한 항?tnfr1 폴리펩티드,항체 가변 도메인 및 길항제 | |
| AU2016232897B2 (en) | Anti-sclerostin antibody, antigen binding fragment and medical use thereof | |
| US11976115B2 (en) | Antibody binding to human IL-1β, preparation method therefor and use thereof | |
| NZ621203B2 (en) | Modified proteins and peptides | |
| RU2789495C2 (ru) | Усовершенствованные связывающиеся с сывороточным альбумином вещества | |
| WO2023288078A1 (en) | Coronavirus antibodies and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12746095 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 230918 Country of ref document: IL Ref document number: 201490262 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 2845029 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14029997 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 2014525418 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014000381 Country of ref document: CL Ref document number: 000214-2014 Country of ref document: PE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2014000100 Country of ref document: DZ Ref document number: MX/A/2014/001883 Country of ref document: MX Ref document number: CR2014-000077 Country of ref document: CR |
|
| ENP | Entry into the national phase |
Ref document number: 2012296961 Country of ref document: AU Date of ref document: 20120813 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20147006909 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14239196 Country of ref document: US |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112014003679 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112014003679 Country of ref document: BR Kind code of ref document: A2 Effective date: 20140217 |