WO2012149440A2 - Therapeutic nuclease compositions and methods - Google Patents
Therapeutic nuclease compositions and methods Download PDFInfo
- Publication number
- WO2012149440A2 WO2012149440A2 PCT/US2012/035614 US2012035614W WO2012149440A2 WO 2012149440 A2 WO2012149440 A2 WO 2012149440A2 US 2012035614 W US2012035614 W US 2012035614W WO 2012149440 A2 WO2012149440 A2 WO 2012149440A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- domain
- hybrid nuclease
- molecule
- nuclease molecule
- rnase
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6815—Enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/08—Drugs for genital or sexual disorders; Contraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/10—Drugs for genital or sexual disorders; Contraceptives for impotence
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/12—Drugs for genital or sexual disorders; Contraceptives for climacteric disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/04—Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/14—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/38—Drugs for disorders of the endocrine system of the suprarenal hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/44—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/465—Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/27—Endoribonucleases producing 3'-phosphomonoesters (3.1.27)
- C12Y301/27005—Pancreatic ribonuclease (3.1.27.5)
Definitions
- a hybrid nuclease molecule includes a modified Fc domain which is a mutant, IgGl Fc domain.
- a mutant Fc domain comprises one or more mutations in the hinge, CH2, and/or CH3 domains.
- the Fc domain comprises an amino acid sequence having one or more of the mutations P238S, P331S, SCC, SSS (residues 220, 226, and 229), G236R, L328R, L234A, and L235A.
- a mutant Fc domain includes a P238S mutation.
- a mutant Fc domain includes a P331S mutation.
- a nucleic acid encoding a mutant Fc domain is as shown in SEQ ID NO:59. In some aspects, a mutant Fc domain is as shown in SEQ ID NO:60. In some aspects, a nucleic acid encoding a mutant Fc domain is as shown in SEQ ID NO:71. In some aspects, a mutant Fc domain is as shown in SEQ ID NO:72. In some aspects, a nucleic acid encoding a mutant Fc domain is as shown in SEQ ID NO:73. In some aspects, a mutant Fc domain is as shown in SEQ ID NO:74. In some aspects, a nucleic acid encoding a mutant Fc domain is shown in SEQ ID NO: 75.
- a nucleic acid encoding a hybrid nuclease molecule is as shown in SEQ ID NO: 63, or 79. In some aspects, a hybrid nuclease molecule is as shown in SEQ ID NO: 64, or 79.
- a nucleic acid encoding a hybrid nuclease molecule is as shown in SEQ ID NO: 65, or 81.
- a hybrid nuclease molecule is as shown in SEQ ID NO: 66, or 82.
- a hybrid nuclease molecule comprises an amino acid sequence set forth in SEQ ID NO: 62, 64, 78, 80, 92, or 96, or a hybrid nuclease molecule comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 62, 64, 78, 80, 92, or 96.
- the activity of a hybrid nuclease molecule having a DNase is not less than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or >30-fold less than the activity of a control DNase molecule. In some aspects, the activity of a hybrid nuclease molecule having a DNase is about equal to the activity of a control DNase molecule. In some aspects, the activity of a hybrid nuclease molecule having an RNase is not less than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or >30-fold less than the activity of a control RNase molecule. In some aspects, the activity of a hybrid nuclease molecule having an RNase is about equal to the activity of a control RNase molecule.
- a hybrid nuclease molecule is a polypeptide, wherein the amino acid sequence of the first nuclease domain comprises a human, wild-type RNase amino acid sequence, wherein the first linker domain is (Gly4Ser)n, where n is 0, 1, 2, 3, 4 or 5, wherein the amino acid sequence of the Fc domain comprises a human, mutant IgGl Fc domain amino acid sequence, and wherein the first linker domain is coupled to the C- terminus of the first nuclease domain and the N-terminus of the Fc domain.
- a hybrid nuclease molecule is a polypeptide comprising or consisting of a sequence shown in Table 1.
- a hybrid nuclease molecule includes a leader sequence.
- the leader sequence is human VK3LP peptide from the human kappa light chain family, and the leader sequence is coupled to the N-terminus of the first nuclease domain.
- the VK3LP has the sequence set forth in SEQ ID NO: 100.
- the gly/ser peptide is of the formula (Gly 4 Ser) n , wherein n is a positive integer selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10. In some embodiments, the gly/ser peptide includes (Gly 4 Ser) 3 . In some embodiments, the gly/ser peptide includes (Gly 4 Ser) 4 . In some embodiments, the gly/ser peptide includes (Gly 4 Ser) 5 . In some embodiments, the first linker domain includes at least one restriction site. In some embodiments, the first linker domain includes about 12 or greater nucleotides including at least one restriction site. In some embodiments, the first linker domain includes two or more restriction sites.
- the first nuclease domain is linked to the N-terminus of the Fc domain. In some embodiments, the first nuclease domain is linked to the C-terminus of the Fc domain.
- FIG. 4 shows the concentration of RSLV-124 in mouse serum as extrapolated from the RNase enzymatic activity of the molecule.
- FIG. 5 shows single radial enzyme diffusion (SRED) analysis of serum from two
- FIG. 7 shows survival of TLR7.1 Tg versus TLR7.1xRNaseA DTg mice
- FIG. 10 shows SRED analysis comparing aliquots of protein A purified proteins from RSLV transfected COS supernatants.
- a subject is treated by administering a nuclease activity which is a DNase or an RNase activity, preferably in the form of a hybrid nuclease molecule.
- a nuclease activity which is a DNase or an RNase activity, preferably in the form of a hybrid nuclease molecule.
- the nuclease activity is a first nuclease domain.
- the nuclease domain is coupled to a modified Fc domain such that the molecule has reduced cytotoxicity.
- a hybrid nuclease molecule includes a second nuclease domain.
- a method of treating SLE in which an effective amount of a nuclease-containing composition is administered to a subject.
- treatment results in degradation of immune complexes containing RNA, DNA or both RNA and DNA.
- treatment results in inhibition of Type I interferons, such as interferon-a in a subject.
- a method of treating a subject comprises administering an effective amount of a composition of a hybrid nuclease molecule comprising an amino acid sequence set forth in SEQ ID NO: 62, 64, 66, 68, 70, 78, 80, 82, 84, 86, 92, 94, 96, or 98.
- the composition is a hybrid nuclease molecule comprising an amino acid sequence set forth in SEQ ID NO: 96 or 98.
- Another exemplary gly/ser polypeptide linker comprises the amino acid sequence Ser(Gly 4 Ser)n.
- n l .
- n 2.
- n 3.
- n 4.
- n 5.
- n 6.
- a polypeptide includes a contiguous amino acid sequence at least 80%>, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to a contiguous amino acid sequence set forth in Table 1.
- a polypeptide includes an amino acid sequence having at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, or 500 (or any integer within these numbers) contiguous amino acids of an amino acid sequence set forth in Table 1.
- sequence comparison typically one sequence acts as a reference sequence to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- the nuclease domain is linked to the Fc domain via a linker domain.
- the linker domain is a linker peptide.
- the linker domain is a linker nucleotide.
- the hybrid nuclease molecule includes a leader molecule, e.g., a leader peptide.
- the leader molecule is a leader peptide positioned at the N-terminus of the nuclease domain.
- a hybrid nuclease molecule of the invention comprises a leader peptide at the N-terminus of the molecule, wherein the leader peptide is later cleaved from the hybrid nuclease molecule.
- Methods for generating nucleic acid sequences encoding a leader peptide fused to a recombinant protein are well known in the art.
- any of the hybrid nuclease molecules of the present invention can be expressed either with or without a leader fused to their N-terminus.
- the protein sequence of a hybrid nuclease molecule of the present invention following cleavage of a fused leader peptide can be predicted and/or deduced by one of skill in the art.
- the mutations are P238S, P331 S or N297S, and may include mutations in one or more of the three hinge cysteines.
- the mutations in one or more of three hinge cysteines can be SCC or SSS.
- the molecules contain the SCC hinge, but are otherwise wild type for human IgGl Fc CH2 and CH3 domains, and bind efficiently to Fc receptors, facilitating uptake of the hybrid nuclease molecule into the endocytic compartment of cells to which they are bound.
- the molecule has activity against single and/or double-stranded RNA substrates.
- a hybrid nuclease molecule is as shown in any of SEQ ID NOs 62, 64, 66, 68, 70, 78, 80, 82, 84, 86, 92, 94, 96, or 98.
- a hybrid nuclease molecule comprises a wild-type, human RNasel domain linked to a mutant, human IgGl Fc domain comprising SCC, P238S, and P331S, or a mutant, human IgGl Fc domain comprising SSS, P238S, and P331S.
- a nucleic acid sequence encoding a hybrid nuclease molecule is shown in SEQ ID NO: 65, or 81. In some aspects, a hybrid nuclease molecule is shown in SEQ ID NO: 66, or 82.
- a nucleic acid sequence encoding a hybrid nuclease molecule is shown in SEQ ID NO: 67, or 83. In some aspects, a hybrid nuclease molecule is shown in SEQ ID NO: 68, or 84.
- a hybrid nuclease molecule comprises a wild-type, human RNasel domain linked to a mutant, human IgGl Fc domain comprising SCC, P238S, and P331S linked via a NLG linker domain to a human DNasel G105R Al 14F domain.
- a hybrid nuclease molecule comprises a wild-type, human RNasel domain linked to a mutant, human IgGl Fc domain comprising SSS, P238S, and P331 S linked via a NLG linker domain to a human DNasel G105R Al 14F domain.
- a nucleic acid sequence encoding a hybrid nuclease molecule is shown in SEQ ID NO: 69, 85, or 93.
- a hybrid nuclease molecule is shown in SEQ ID NO: 70, 86, 94, or 98.
- the domain orientation can be altered to construct an Ig-RNase molecule or an Ig-DNase molecule or an RNase-Ig molecule or an RNase-Ig molecule that retains FcR binding and has active nuclease domains.
- linker domains include (gly4ser) 3, 4 or 5 variants that alter the length of the linker by 5 amino acid progressions.
- a linker domain is approximately 18 amino acids in length and includes an N-linked glycosylation site, which can be sensitive to protease cleavage in vivo.
- an N-linked glycosylation site can protect the hybrid nuclease molecules from cleavage in the linker domain.
- an N-linked glycosylation site can assist in separating the folding of independent functional domains separated by the linker domain.
- hybrid nuclease molecules include DNaselL3-Ig- linker-RNase constructs.
- a hybrid nuclease molecule includes a DNase 1-Ig-linker-RNase construct or an RNase-Ig-linker-DNase construct.
- fusion junctions between enzyme domains and the other domains of the hybrid nuclease molecule is optimized.
- a hybrid nuclease molecule includes TREX1.
- a TREX1 hybrid nuclease molecule can digest chromatin.
- further optimization of the fusion junction chosen for truncation of a TREXl enzyme can be used to improve expression of the hybrid nuclease molecules.
- the hybrid nuclease molecule is a TREXl -tandem hybrid nuclease molecule.
- an alternative method for facilitating head-to-tail folding of TREXl is to generate a TREXl -TREXl -I g hybrid hybrid nuclease molecule that incorporates two TREXl domains in tandem, followed by a linker domain and an Ig Fc domain.
- positioning of TREXl cassettes in a head-to-tail manner can be corrected for head-to tail folding on either arm of the immunoenzyme and introduce a single TREXl functional domain into each arm of the molecule.
- each immunoenzyme of a hybrid nuclease molecule has two functional TREXl enzymes attached to a single IgG Fc domain.
- the hybrid nuclease molecule includes 1L3-Ig.
- the 1L3 DNase is constructed from a murine sequence and expressed.
- the enzyme is active.
- a murine 1L3 DNase-Ig-RNase hybrid nuclease is constructed and expressed.
- the molecule includes human 1L3-Ig, human lL3-Ig-RNase, and/or human RNase-Ig-lL3.
- a mutant Fc domain comprises P238S and/or P331S, and/or one or more mutations in the three hinge cysteines. In some aspects, a mutant Fc domain comprises P238S and/or P331 S, and/or mutations in a hinge cysteine to SCC or in the three hinge cysteines to SSS. In some aspects, a mutant Fc domain comprises P238S and P331S and mutations in at least one of the three hinge cysteines. In some aspects, a mutant Fc domain comprises P238S and P331S and SCC. In some aspects, a mutant Fc domain comprises P238S and P331S and SSS.
- the hybrid nuclease molecule of the invention comprises at least one Fc domain which comprises at least one CH4 domain or portion thereof. In another embodiment, the hybrid nuclease molecule of the invention comprises at least one Fc domain which comprises at least one hinge domain or portion thereof and at least one CH2 domain or portion thereof (e.g, in the hinge-CH2 orientation). In another embodiment, the hybrid nuclease molecule of the invention comprises at least one Fc domain which comprises at least one CH2 domain or portion thereof and at least one CH3 domain or portion thereof (e.g, in the CH2-CH3 orientation).
- a hybrid nuclease molecule of the invention comprises at least one Fc domain comprising a complete CH3 domain. In another embodiment, a hybrid nuclease molecule of the invention comprises at least one Fc domain comprising a complete CH2 domain. In another embodiment, a hybrid nuclease molecule of the invention comprises at least one Fc domain comprising at least a CH3 domain, and at least one of a hinge region, and a CH2 domain. In one embodiment, a hybrid nuclease molecule of the invention comprises at least one Fc domain comprising a hinge and a CH3 domain.
- an Fc domain employed in a hybrid nuclease molecule of the invention is altered or modified, e.g., by amino acid mutation (e.g., addition, deletion, or substitution).
- the term "Fc domain variant" refers to an Fc domain having at least one amino acid modification, such as an amino acid substitution, as compared to the wild-type Fc from which the Fc domain is derived.
- a variant comprises at least one amino acid mutation (e.g., substitution) as compared to a wild type amino acid at the corresponding position of the human IgGl Fc region.
- the Fc variant confers an improvement in at least one effector function imparted by an Fc domain comprising said wild-type Fc domain (e.g., an improvement in the ability of the Fc domain to bind to Fc receptors (e.g. FcyRI, FcyRII, or FcyRIII) or complement proteins (e.g. Clq), or to trigger antibody-dependent cytotoxicity (ADCC), phagocytosis, or complement-dependent cytotoxicity (CDCC)).
- Fc receptors e.g. FcyRI, FcyRII, or FcyRIII
- complement proteins e.g. Clq
- an Fc domain includes changes in the region between amino acids 234-238, including the sequence LLGGP at the beginning of the CH2 domain.
- an Fc variant alters Fc mediated effector function, particularly ADCC, and/or decrease binding avidity for Fc receptors.
- sequence changes closer to the CH2-CH3 junction, at positions such as K322 or P331 can eliminate complement mediated cytotoxicity and/or alter avidity for FcR binding.
- an Fc domain incorporates changes at residues P238 and P331, e.g., changing the wild type prolines at these positions to serine.
- alterations in the hinge region at one or more of the three hinge cysteines, to encode CCC, SCC, SSC, SCS, or SSS at these residues can also affect FcR binding and molecular homogeneity, e.g., by elimination of unpaired cysteines that may destabilize the folded protein.
- hybrid nuclease molecules of the invention may employ art-recognized Fc variants which are known to impart an improvement in effector function and/or FcR binding.
- a hybrid nuclease molecule of the invention may include, for example, a change (e.g., a substitution) at one or more of the amino acid positions disclosed in International PCT Publications WO88/07089A1, W096/14339A1, WO98/05787A1, W098/23289A1,
- the specific change (e.g., the specific substitution of one or more amino acids disclosed in the art) may be made at one or more of the disclosed amino acid positions.
- a different change at one or more of the disclosed amino acid positions (e.g., the different substitution of one or more amino acid position disclosed in the art) may be made.
- a hybrid nuclease molecule of the invention comprises an Fc variant comprising an amino acid substitution which alters the antigen-dependent effector functions of the polypeptide, in particular ADCC or complement activation, e.g., as compared to a wild type Fc region.
- said hybrid nuclease molecules exhibit altered binding to an Fc gamma receptor (e.g., CD16).
- Fc gamma receptor e.g., CD16
- the hybrid nuclease molecule exhibits altered binding to an activating FcyR (e.g. Fcyl, Fcylla, or FcyRIIIa). In another embodiment, the hybrid nuclease molecule exhibits altered binding affinity to an inhibitory FcyR (e.g. FcyRIIb). Exemplary amino acid substitutions which altered FcR or complement binding activity are disclosed in International PCT Publication No. WO05/063815 which is incorporated by reference herein.
- At least two of the Fc domains may differ at about 5 amino acid positions (e.g., 1, 2, 3, 4, or 5 amino acid positions), about 10 positions, about 15 positions, about 20 positions, about 30 positions, about 40 positions, or about 50 positions).
- Linker Domains e.g., 1, 2, 3, 4, or 5 amino acid positions
- a polypeptide linker can comprise at least a portion of an immunoglobulin hinge region.
- a polypeptide linker comprises an upper hinge domain (e.g., an IgGl, an IgG2, an IgG3, or IgG4 upper hinge domain).
- a polypeptide linker comprises a middle hinge domain (e.g., an IgGl, an IgG2, an IgG3, or an IgG4 middle hinge domain).
- a polypeptide linker comprises a lower hinge domain (e.g., an IgGl, an IgG2, an IgG3, or an IgG4 lower hinge domain).
- polypeptide linkers can be constructed which combine hinge elements derived from the same or different antibody isotypes.
- the polypeptide linker comprises a chimeric hinge comprising at least a portion of an IgGl hinge region and at least a portion of an IgG2 hinge region.
- the polypeptide linker comprises a chimeric hinge comprising at least a portion of an IgGl hinge region and at least a portion of an IgG3 hinge region.
- a polypeptide linker comprises a chimeric hinge comprising at least a portion of an IgGl hinge region and at least a portion of an IgG4 hinge region.
- variant forms of these exemplary polypeptide linkers can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence encoding a polypeptide linker such that one or more amino acid substitutions, additions or deletions are introduced into the polypeptide linker.
- mutations may be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis.
- the invention also includes a vector capable of expressing the peptides in an appropriate host.
- the vector comprises the DNA molecule that codes for the peptides operatively linked to appropriate expression control sequences. Methods of affecting this operative linking, either before or after the DNA molecule is inserted into the vector, are well known.
- Expression control sequences include promoters, activators, enhancers, operators, ribosomal nuclease domains, start signals, stop signals, cap signals, polyadenylation signals, and other signals involved with the control of transcription or translation.
- a hybrid nuclease molecule is administered alone. In certain embodiments, a hybrid nuclease molecule is administered prior to the administration of at least one other therapeutic agent. In certain embodiments, a hybrid nuclease molecule is administered concurrent with the administration of at least one other therapeutic agent. In certain embodiments, a hybrid nuclease molecule is administered subsequent to the administration of at least one other therapeutic agent. In other embodiments, a hybrid nuclease molecule is administered prior to the administration of at least one other therapeutic agent. As will be appreciated by one of skill in the art, in some embodiments, the hybrid nuclease molecule is combined with the other agent/compound. In some embodiments, the hybrid nuclease molecule and other agent are administered concurrently. In some
- the invention provides for pharmaceutical compositions comprising a hybrid nuclease molecule together with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or
- hydroxypropyl-beta-cyclodextrin fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emulsifying agents; hydrophilic polymers (such as polyvinylpyrrolidone); low molecular weight polypeptides; salt-forming counterions (such as sodium); preservatives (such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide); solvents (such as glycerin, propylene glycol or polyethylene glycol); sugar alcohols (such as mannitol or sorbitol); suspending agents; surfactants or wetting agents (such as pluronics, PEG, sorbitan esters
- a hybrid nuclease molecule and/or a therapeutic molecule is linked to a half-life extending vehicle known in the art.
- vehicles include, but are not limited to, polyethylene glycol, glycogen (e.g., glycosylation of the hybrid nuclease molecule), and dextran.
- glycogen e.g., glycosylation of the hybrid nuclease molecule
- dextran e.g., dextran
- compositions may influence the physical state, stability, rate of in vivo release and rate of in vivo clearance of the antibodies of the invention.
- a pharmaceutical composition can be formulated for inhalation.
- a hybrid nuclease molecule, with or without at least one additional therapeutic agent can be formulated as a dry powder for inhalation.
- an inhalation solution comprising a hybrid nuclease molecule, with or without at least one additional therapeutic agent, can be formulated with a propellant for aerosol delivery.
- solutions can be nebulized. Pulmonary administration is further described in PCT application no. PCT/US94/001875, which describes pulmonary delivery of chemically modified proteins.
- a pharmaceutical composition can involve an effective quantity of a hybrid nuclease molecule, with or without at least one additional therapeutic agents, in a mixture with non-toxic excipients which are suitable for the manufacture of tablets.
- suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
- sustained-release preparations can include semipermeable polymer matrices in the form of shaped articles, e.g.
- sustained release compositions can also include liposomes, which can be prepared by any of several methods known in the art. See, e.g., Eppstein et al, Proc. Natl. Acad. Sci. USA, 82:3688-3692 (1985); EP 036,676; EP 088,046 and EP 143,949.
- the effective amount of a pharmaceutical composition comprising a hybrid nuclease molecule, with or without at least one additional therapeutic agent, to be employed therapeutically will depend, for example, upon the therapeutic context and objectives.
- the appropriate dosage levels for treatment will thus vary depending, in part, upon the molecule delivered, the indication for which a hybrid nuclease molecule, with or without at least one additional therapeutic agent, is being used, the route of administration, and the size (body weight, body surface or organ size) and/or condition (the age and general health) of the patient.
- the clinician can titer the dosage and modify the route of administration to obtain the optimal therapeutic effect.
- a typical dosage can range from about 0.1 ⁇ g/kg to up to about 100 mg/kg or more, depending on the factors mentioned above. In certain embodiments, the dosage can range from 0.1 ⁇ g/kg up to about 100 mg/kg; or 1 ⁇ g/kg up to about 100 mg/kg; or 5 ⁇ g/kg up to about 100 mg/kg.
- the composition can therefore be administered as a single dose, or as two or more doses (which may or may not contain the same amount of the desired molecule) over time, or as a continuous infusion via an implantation device or catheter. Further refinement of the appropriate dosage is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them. In certain embodiments, appropriate dosages can be ascertained through use of appropriate dose-response data.
- the route of administration of the pharmaceutical composition is in accord with known methods, e.g. orally, through injection by intravenous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, subcutaneously, intra-ocular, intraarterial, intraportal, or intralesional routes; by sustained release systems or by implantation devices.
- the compositions can be administered by bolus injection or continuously by infusion, or by implantation device.
- the composition can be administered locally via implantation of a membrane, sponge or another appropriate material onto which the desired molecule has been absorbed or encapsulated.
- the device can be implanted into any suitable tissue or organ, and delivery of the desired molecule can be via diffusion, timed-release bolus, or continuous administration.
- a hybrid nuclease molecule and/or any additional therapeutic agents can be delivered by implanting certain cells that have been genetically engineered, using methods such as those described herein, to express and secrete the polypeptides.
- such cells can be animal or human cells, and can be autologous, heterologous, or xenogeneic.
- the cells can be immortalized.
- the cells in order to decrease the chance of an immunological response, the cells can be encapsulated to avoid infiltration of surrounding tissues.
- the encapsulation materials are typically biocompatible, semi-permeable polymeric enclosures or membranes that allow the release of the protein product(s) but prevent the destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.
- hybrid nuclease molecules of the instant invention are particularly effective in the treatment of autoimmune disorders or abnormal immune responses.
- the hybrid nuclease molecules of the present invention may be used to control, suppress, modulate, treat, or eliminate unwanted immune responses to both external and autoantigens.
- Plasmid DNA was prepared using Qiagen (Valencia, CA) QIAprep miniprep kits according to manufacturer's instructions, and eluted in 50 ul EB buffer. DNA concentrations were measured using a Nanodrop 1000 (Thermo Fisher Scientific,
- pDG a selectable, amplifiable plasmid
- the pDG vector is a modified version of pcDNA3 encoding the DHFR selectable marker with an attenuated promoter to increase selection pressure for the plasmid.
- Plasmid DNA was prepared using Qiagen maxiprep kits, and purified plasmid was linearized at a unique Ascl site prior to phenol extraction and ethanol precipitation. Salmon sperm DNA (Sigma- Aldrich, St.
- Transfected cells were allowed to recover overnight in non-selective media prior to selective plating in 96 well flat bottom plates (Costar) at varying serial dilutions ranging from 125 cells/well to 2000 cells/well.
- Culture media for cell cloning was Excell 302 complete, containing 50 nM methotrexate. Once clonal outgrowth was sufficient, serial dilutions of culture supernatants from master wells were screened for expression of hybrid nuclease molecules by use of an -IgG sandwich ELISA.
- NUNC immulon II plates were coated overnight at 4°C with 7.5 microgram/ml F(ab'2) goat anti-mouse IgG (KPL Labs, Gaithersburg, MD) or 2 ug/ml goat anti-human or anti-mouse IgG (Jackson
- DTg mice had very high levels of RNase in their serum (equivalent to >13 U/ml RNase based on our standard with specific activity of 993 U /mg).
- RNaseA concentration in Tg and DTg mice was also measured by ELISA assay as shown in Fig. 6.
- the RNase A Tg and TLR7.1XRNaseA Dtg mice have RNase A serum
- Coat plate with anti-RnaseA Abeam Ab(ab6610) 2.5-10ug/ml O/N in 4C.
- IRGs including MX1 (Interferon-induced GTP-binding protein Mxl (UniProtKB
- RNA-to-cDNA kit (Applied Biosystems) using random primers.
- Relative quantification was calculated using the 2 "ddCT method with age matched wild type B6 mice as baseline to determine fold changes for each GOI.
- the dissociation curves for the reactions show a single melt peak for each gene.
- the standard curve showed similar amplification efficiencies for each gene and that template concentrations were within the linear dynamic range for each of primer set.
- Example 8 Construction and expression of DNasel-Ig single and dual enzyme hybrid nuclease molecules.
- Naturally occurring enzyme variants may thus be less immunogenic when administered to patients, since these isoforms occur in the human population.
- the combination of the actin resistant properties of alleles similar to Al 14F with the increased enzymatic activity of alleles like G105R would generate novel allelic variants of human DNase 1 that might show improved clinical activity in vitro and in vivo.
- ours is the first report of this new mutant form of DNase 1 generated from a combination of two naturally occurring variants G105R and Al 14F.
- DNA concentration was measured using the Nanodrop and an aliquot equivalent to 2.5 ug plasmid DNA used for each transfection reaction.
- Each DNaselg ) or RNase-Ig-DNase ) expression cassette was inserted into the mammalian expression vector pDG, a derivative of pcDNA3.1.
- Transfected cells were incubated for 72 hours at 37°C, 5% C02 prior to harvest of culture supernatants for further analysis. Culture supernatants were harvested, residual cells centrifuged from the solution, and the liquid transferred to new tubes.
- COS-7 cells were transiently transfected with plasmids containing human DNasel wild type or naturally occurring DNase 1 mutant alleles (G105R and/or Al 14F) ) fused to the wild type human IgGl Fc domain.
- This hinge-CH2-CH3 cassette contains a single C- ⁇ S mutation in the hinge region to eliminate the first cysteine in this domain since it is unpaired due to absence of its pairing partner present in the light chain of the antibody.
- more complex multi-nuclease fusion proteins were also expressed from COS cell transient transfections.
- Example 9 Isolation of human-Ig tails, introduction of mutations into the coding sequence, and construction of mutant nuclease molecules
- the P238S mutation and SSS substitutions for SCC were introduced by PCR mutagenesis using two overlapping 5' oligos in sequential PCR reactions.
- the first PCR reaction included the following 5' primer that incorporates the P238S mutation within its sequence: CS-P238S 5-1 : TCT CCA CCG AGC CCA GCA CCT GAA CTC CTG GGA GGA TCG TCA GTC TTC CTC TTC CCC C (58mer). (SEQ ID NO: 25)
- a 5' subfragment was amplified using the full-length wild type clone as template, and the 5' primer was SSSH-5-2: AGA TCT CGA GCC CAA ATC TTC TGA CAA AAC TCA CAC ATC TCC ACC GAG CCC AGC ACC T (58 mer), while the 3' primer was P331S-AS: TGG AGA TGG TTT TCT CGA TGG GGG CTG GGA GGG CTT TGT TGG AGA CC (47mer). (SEQ ID NO: 27)
- RSLV- 128 is a multinuclease fusion construct that incorporates an amino terminal wild type human RNase domain, fused to a (gly4ser)4 linker domain, followed by an SSS mutant hinge and P238S-P33 IS double mutant Fc domain fused to an NLG linker domain and followed by a C terminal mutant DNase (G105R/A114F) domain (SEQ ID NO:67-68).
- COS supernatants were harvested after 72 hours and 0.5 ml samples were immunoprecipitated overnight at 4°C with 100 ul protein A-agarose beads.
- Protein A beads were centrifuged and washed twice in PBS prior to resuspending in SDS- PAGE loading buffer, for NuPAGE gels— reducing or nonreducing LDS sample buffer (Invitrogen, Carlsbad, CA). Samples were heated according to manufacturer's instructions, protein A beads centrifuged to pellet, and sample buffer loaded onto 5-12% NuPAGE gradient gels. Samples were electrophoresed at 150 volts for 1.5-2 hours, and gels blotted to nitrocellulose membranes at 30 mAmp for 1 hour.
- Figure 11 shows results from a DNase nuclease activity assay performed on protein A purified protein from COS7 supematants transfected with the RSLV fusion plasmids in Example 10.
- Figure 11 shows fivee panels (11a, 1 lb, 11c), with each gel panel showing the digestion pattern with decreasing amounts of the indicated fusion protein and 1 microgram of plasmid DNA.
- Each protein was serially diluted in two-fold increments in nuclease free water from 500ng to 4ng of enzyme. To each sample, was added 1 ug PDG plasmid DNA, incubated for 30 minutes at 37 degrees.
- Figure 11c shows the resits of an in gel DNase enzyme activity assay using commercially available DNase 1 (Biolabs, Inc.).
- the far right lane is a negative control with the DNA alone and no enzyme, the lane to the left of that is another negative control, this is an RNase-Ig molecule which has RNase activity but no DNase activity, as expected the plasmid DNA remains intact and is not digested in both cases.
- the results demonstrate that commercially available DNase 1 enzyme is highly active and digests all the DNA at most of the concentrations tested.
- Figures 11a and 1 lb show the DNase activity of four different nuclease Fc fusion constructs.
- the top panel in Figure 11a shows the ability of a DNase-Ig fusion protein to digest the plasmid DNA, as is apparent from the gel, this enzyme digests all the DNA at all concentrations tested is as active, or more active than commercially available DNase 1.
- the lower panel of Figure 1 la is a bi-specific nuclease Fc fusion protein with the DNase on the amino terminus of the Fc (SED ID 65-66) and it also has robust DNase enzymatic activity, but a little less than the DNase-Ig in the upper panel of Figure 11a.
- This bi-specific nuclease also has good DNase activity but it appears to be somewhat less than the other two bi-specific nuclease Fc fusion proteins shown in this experiment.
- This data suggests that all of the bi-specific nucleases have good DNase activity, which is an unexpected given the past efforts of others in this regard (Dwyer et al. JBC; Vol 271, No. 14; pp 9738-9743).
- the position of the DNase in the construct as well as the linker length and composition connecting the DNase to the Fc are critical in creating a highly active DNase enzyme in the context of a bi-specific nuclease Fc fusion protein.
- Figures 12-13 show results from a kinetic fluorescence enzyme activity assay comparing the RNase enzyme activity of recombinant RNase A (Ambion), RSLV 125, RSLV 126, hRNase WT-SCCH-WThlgGl, and hRNaseG88D-SCCH-(P238S/K322S/P331S)hIgGl .
- RNase A recombinant RNase A
- RSLV 125 RSLV 126
- hRNase WT-SCCH-WThlgGl hRNaseG88D-SCCH-(P238S/K322S/P331S)hIgGl
- hRNaseG88D-SCCH-(P238S/K322S/P331S)hIgGl hRNaseG88D-SCCH-(P238S/K322S/P331S)hIgGl .
- Figure 12 shows the RFU (relative fluorescence units) versus time for each protein at equimolar concentrations, with the test proteins at 4.5 pg/ul or 4.5 ng/ml, and the recombinant RNaseA control at 1.3 pg/ul in the presence of 200 nM RNase Alert substrate.
- Figure 13 shows a Lineweaver Burk plot of the different molecules.
- RNase Alert kinetic fluorescence assays were set up using 105pM enzyme, and the substrate concentration was decreased from 200nM to 50 pM in four fold increments. Thus, the enzyme concentration was fixed and substrate concentration titrated in this series of experiments.
- the data show the Lineweaver Burk plots generated for the different fusion proteins under these conditions. Taken together the data in Figures 12 and 13 demonstrate that the RNase moieties are highly active in the three RNase Fc fusion proteins constructed and tested here.
- Example 14 Assessment of in vitro cytotoxicity against human THP-1 cell line
- Figure 15 presents the results of fluorescence- activated cell sorting (FACS) experiments to examine the cytotoxicity of RNase Fc fusions constructs with a wild type or mutant Fc domain (RNase-wtlgG or RNase-mtlgG
- IC immune complexes
- normal human serum does not stimulate the production of interferon.
- the IC are incubated with normal human peripheral blood mononuclear cells (PBMC's) as reporter cells.
- PBMC's peripheral blood mononuclear cells
- the production of interferon by the reporter cell sis measured using an interferon-a ELISA.
- Reporter cells were obtained from normal volunteers by Ficoll density gradient centrifugation. Lupus patient or healthy normal volunteer serum was obtained under University of Washington Institutional Rreview Board #HSD No. 3971, the serum was diluted 1/1000 and added to 10% (v/v) of necrotic cell extract (NCE) derived from cultured U937 cells as above.
- NCE necrotic cell extract
- Diluted lupus patient or normal volunteer serum was incubated with the NCE for 15 minutes at room temperature, the resulting IC's were incubated with or without various doses of RSLV-132, RSLV-124, or wild type RNase for 15 minutes then incubated with normal PBMC's for 20 hours in the presence of 500 U/mL Universal IFN followed by measurement of the amount of IFN secreted from the PBMC culture.
- Serum was obtained from three (3) different lupus patients with various degrees of disease activity ranging from mild to active.
- the NCE was incubated with either lupus patient serum or healthy normal volunteer serum at room temperature for 15 minutes followed by 20 hour incubation with PBMC's.
- the test article (RSLV-124 or RSLV-132) was added at concentrations of 0.16, 0.5, 1.6 and 5.0 ug/mL or RNAse was added at concentrations of 0.05, 0.16, 0.5 and 1.6 ug/mL (equimolar) to the NCE.
- the ability of the lupus patient serum to stimulate production of IFN from the PBMC's was reduced by approximately 50% with the addition of 5.0 ug/mL RSLV-124. This inhibition mirrored that of an equimolar quantity of RNAse.
- RSLV-132 binds to its molecular target, the RNA associated with the lupus patient IC's and potently degrades it, thereby preventing the stimulation of IFN from the PBMC's ( Figure 16).
- RSLV-132 appears to be more active than RSLV-124 in this assay.
- RSLV-132 is a potent in vivo inhibitor of RNA-induced Interferon activation.
- poly I:C polyinosinic:polycytidilic acid
- Poly(LC) is a mismatched double-stranded RNA with one strand being a polymer of inosinic acid, the other a polymer of cytidylic acid. It is know to interact with toll-like receptor 3 (TLR3) which is expressed in the membrane of B cells, macrophages and dendritic cells.
- TLR3 toll-like receptor 3
- Poly(LC) is available from Invitrogen. The effects of poly I:C can be quantitated by measuring the expression levels of interferon stimulated genes in the spleen of the mouse following administration.
- mice On day zero 10 B6 mice, three months of age, were treated with either RSLV-132 (250ug per mouse) or intravenous immunoglobulin (IVIG) (Privigen, Behring) (250ug per mouse) as a control, both via intraperitoneal injection. Twenty hours after injection of RSLV-132 or IVIG, poly(LC) was injected into the mice at 200ug per mouse intraperitoneally. Two hours later, the animals were sacrificed by C02 exposure, the spleens were collected into RNAlater (Qiagen) and stored at -80C for later study of the expression of Interferon stimulated genes (ISGs).
- ISGs Interferon stimulated genes
- RSLV-132 and RSLV-133 were transiently expressed in CHO cells and purified using protein-A.
- the RNase activity of these RNase Fc fusion proteins was quantitated using the RNaseAlert QC kit from Ambion (Cat # AM 1966).
- Various amounts of the RNase Fc fusion protein were used and the results shown in Figure 18 in relative fluorescence units (RFU's) over time.
- the results demonstrate that RSLV-132 is a highly active RNase enzyme, and has increased RNase activity relative to other RNase Fc fusion constructs such as RSLV-124 and wild type RNase For example using equal amounts (400pM) of RSLV132 and RSLV-124 yields more than twice the RFU's (80,000 vs.
- RSLV-132 vs. RSLV-124.
- two production lots were tested for their stability at 4C.
- RSLV- 132.1 was stored at 4C for 8 weeks prior to this experiment and RSLV-132.2 was stored at - 80C and thawed just prior to testing, demonstrating that the protein is stable at 4C for up to 2 months.
- the stability of the drug and increased catalytic activity may provide increased efficacy in a therapeutic setting.
- Figure 19 shows the RNase enzymatic activity in RFUs over time, comparing the amount of RNase activity of the bi-specific RSLV-133 molecule with the monospecific RSLV-132, and wild type RNase.
- the RSLV-133 molecule has significantly increased RNase activity relative to the monospecific RSLV-124 molecule or, an earlier bispecific nuclease Fc, RSLV-123, or wild type RNase, yielding greater than 2-fold more RFU's with an equal amount of protein.
- Figure 20 show the results of a DNase enzymatic activity assay of the RLSV-133 molecule in comparison to RSLV-123, a previous bi-specific nuclease construct, and wild type DNase.
- Figure 21 demonstrates the ability of the RSLV-133 molecule to digest DNA in an in-gel digestion experiment.
- the results show that RSLV-133 is able to digest DNA in this assay as effectively as wild type DNase (compare lanes 5&7). Given the relative molecular weights of RSLV-133 and wild type DNase it appears that RSLV-133 is more effective in digesting DNA in this assay as well.
- Example 18 RSLV-132 Demonstrates decreased Fc Receptor binding.
- RSLV124 wild type Fc domain
- RSLV-132 mutant Fc domain; P238S/P331S
- FACS fluorescence-activated cell sorting
- Example 19 In vitro assessment of hybrid nuclease molecule biological activity.
- hybrid nuclease molecules are purified, e.g., by affinity or ion exchange chromatography as previously described in the examples above.
- the hybrid nuclease molecule is a polypeptide.
- the hybrid nuclease molecule includes one or more sequences from Table 1.
- the hybrid nuclease molecule includes a nuclease domain linked to a mutant Fc domain.
- the hybrid nuclease molecule includes a mutant Fc domain.
- the mutant Fc domain comprises mutations in the hinge, CH2, and/or CH3 domains.
- the mutant Fc domain comprises P238S and/or P331S, and may include mutations in one or more of the three hinge cysteines. In some instances, the mutant Fc domain comprises P238S and/or P331S, and/or mutations in the three hinge cysteines. In some instances, the mutant Fc domain comprises P238S and/or P331S, and/or mutations in the three hinge cysteines to SSS. In some instances, the mutant Fc domain comprises P238S and P331 S and mutations in the three hinge cysteines. In some instances, the mutant Fc domain comprises P238S and P331S and SSS. In some instances the mutant Fc domain is shown in SEQ ID NOs 59, 60, 61.
- PBMC normal or patient human PBMC (approximately lxl 0e6 cells) are cultured for 24, 48, or 96 hours depending on the assay. PBMC are cultured in the presence of stimuli such as TLR ligands, costimulatory antibodies, immune complexes, and normal or autoimmune sera.
- stimuli such as TLR ligands, costimulatory antibodies, immune complexes, and normal or autoimmune sera.
- the effects of the molecules on cytokine production is measured using commercially available reagents, such as the antibody pair kits from Biolegend (San Diego, CA) for IL-6, IL-8, IL-10, IL-4, IFN-gamma, TNF-alpha.
- Culture supernatants from in vitro cultures are harvested at 24, 48 hours or later time points to determine the effects of the molcules on cytokine production.
- IFN-alpha production is measured using, e.g., anti-human IFN-alpha antibodies and standard curve reagents available from PBL interferon source (Piscataway, NJ). A similar set of assays is performed using human lymphocyte
- subpopulations isolated monocytes, B cells, pDCs, T cells, etc.
- purified using, e.g., commercially available magnetic bead based isolation kits available from Miltenyi Biotech (Auburn, CA).
- lymphocyte activation receptors such as CD5, CD23, CD69, CD80, CD86, and CD25
- PBMC or isolated cell subpopulations are subjected to multi-color flow cytometry to determine how these molecules affect the expression of different receptors associated with immune cell activation.
- Another assay will measure the cytotoxicity of one or more molecules. This assay will measure toxicity using Annexin 5 staining (e.g., Annexin 5-FITC).
- Cells of interest e.g., monocytes or a monocyte cell line
- a hybrid nuclease molecule of interest e.g., a hybrid nuclease molecule having a mutant Fc domain
- cells are separated from culture and stained with Annexin 5.
- the number of apoptotic or dead cells are then counted, e.g., using flow cytometry or a fluorescence microscope.
- Cells contacted with a hybrid nuclease molecule of interest show lower numbers of cells staining positive for Annexin 5 compared to positive controls.
- hybrid nuclease molecule The effectiveness of a hybrid nuclease molecule is demonstrated by comparing the results of an assay from cells treated with a hybrid nuclease molecule disclosed herein to the results of the assay from cells treated with control formulations. After treatment, the levels of the various markers (e.g., cytokines, cell-surface receptors, proliferation) described above are generally improved in an effective molecule-treated group relative to the marker levels existing prior to the treatment, or relative to the levels measured in a control group.
- markers e.g., cytokines, cell-surface receptors, proliferation
- Example 20 Administration of a hybrid nuclease molecule to a mammal in need thereof.
- the mutant Fc domain comprises mutations in the hinge, CH2, and/or CH3 domains. In some instances, the mutant Fc domain comprises P238S and/or P331S, and may include mutations in one or more of the three hinge cysteines. In some instances, the mutant Fc domain comprises P238S and/or P331 S, and/or mutations in the three hinge cysteines. In some instances, the mutant Fc domain comprises P238S and/or P331S, and/or mutations in the three hinge cysteines to SSS. In some instances, the mutant Fc domain comprises P238S and P331S and mutations in the three hinge cysteines. In some instances, the mutant Fc domain comprises P238S and P331 S and SSS.
- the mutant Fc domain is shown in SEQ ID NOs 59, 60, 61.
- the hybrid nuclease molecule is shown in SEQ ID NOs.
- Various linker domains can be used to link the Fc domains to nuclease domains.
- linker domains 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40 or more amino acids in length can be used.
- the hybrid nuclease molecule is formulated a pharmaceutically acceptable carrier.
- the molecule is formulated as described in the pharmaceutical compositions section above.
- the hybrid nuclease molecule targets RNase and/or DNase.
- a suitable first dose of a hybrid nuclease molecule is administered to the subject.
- the hybrid nuclease molecule is formulated as described herein.
- the subject's condition is evaluated, e.g., by measuring IFN-alpha levels, IFN-alpha response gene levels, autoantibody titers, kidney function and pathology, and/or circulating immune complex levels. Other relevant criteria can also be measured.
- the number and strength of doses are adjusted according to the subject's needs.
- the subject's IFN-alpha levels, IFN-alpha response gene levels, autoantibody titers, kidney function and pathology, and/or circulating immune complex levels are lowered and/or improved relative to the levels existing prior to the treatment, or relative to the levels measured in a similarly afflicted but untreated/control subject.
- a rodent subject in need of treatment is selected or identified.
- the identification of the subject can occur in a laboratory setting or elsewhere.
- a suitable first dose of a hybrid nuclease molecule is administered to the subject.
- the hybrid nuclease molecule is formulated as described herein.
- the subject's condition is evaluated, e.g., by measuring IFN-alpha levels, IFN-alpha response gene levels, autoantibody titers, kidney function and pathology, and/or circulating immune complex levels. Other relevant criteria can also be measured.
- the number and strength of doses are adjusted according to the subject's needs.
- the subject's IFN-alpha levels, IFN-alpha response gene levels, autoantibody titers, kidney function and pathology, and/or circulating immune complex levels are lowered and/or improved relative to the levels existing prior to the treatment, or relative to the levels measured in a similarly afflicted but untreated/control subject.
- RSLV125-2 atggaaacccctgcccagctgctgttcctgctgctgctgtggctgcccgacacc huVK3LP- accggtaaggaatcccgggccaagaaattccagcggcagcatatggactcagac wthRNase- agttcccccagcagcagctccacctactgtaaccaaatgatgaggcgccggaat atgacacaggggcggtgcaaaccagtgaacacctttgtgcacgagcccctggta SCC-mthlgGl
- RSLV127-2 metpaqllfllllwlpdttglkiaafniqtfgetkmsnatlvsyivqilsrydi huVK3LP- alvqevrdshltavgklldnlnqdapdtyhy vseplgrnsykerylfvyrpdq hDNasel vsavdsyyddgcepcrndtfnrepfivrffsrftevrefaivplhaapgdava eidalydvyldvqekwgledvmlmgdfnagcsyvrpsqwssirlwtsptfqwli 105/114- pdsadttatpthcaydrivvagmllrga vpdsalpfnfqaayglsdq
- RSLV128-2 metpaqllfllllwlpdttgkesrakkfqrqhmdsdsspssstycnqmmrrrn huVK3LP- mtqgrckpvntfvheplvdvqnvcfqekvtckngqgncyksnssmhitdcrltn hRNase WT- gsrypncayrtspkerhiivacegspyvpvhfdasvedstdlsggggsggggsg gggsggggstglepkssdkthtcppcpapellggssvflfppkpkdtlmisrtp (g4s) 4-SCC- evtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhq m
- RSLV129-2 metpaqllfllllwlpdttgkesrakkfqrqhmdsdsspssstycnqmmrrrn huVK3LP- mtqgrckpvntfvheplvdvqnvcfqekvtckngqgncyksnssmhitdcrltn hRNAseWT- gsrypncayrtspkerhiivacegspyvpvhfdas edstlepkssdkthtcpp scc- cpapellggssvflfppkpkdtlmisrtpevtcv vdvshedpevkfnwyvdgv evhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpasiekti mthlg
- RSLV132 metpaqllfllllwlpdttgkesrakkfqrqhmdsdsspssstycnqmmrrrn huVK3LP- mtqgrckpvntfvheplvdvqnvcfqekvtckngqgncyksnssmhitdcrltn wthRNase- gsrypncayrtspkerhiivacegspyvpvhfdasvedstlepkssdkthtcpp cpapellggssvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgv SCC-mthlgGl
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Diabetes (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Endocrinology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Epidemiology (AREA)
- Hematology (AREA)
- Reproductive Health (AREA)
- Microbiology (AREA)
- Neurology (AREA)
- Physical Education & Sports Medicine (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Rheumatology (AREA)
- Gynecology & Obstetrics (AREA)
- Obesity (AREA)
- Urology & Nephrology (AREA)
Priority Applications (43)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2012249360A AU2012249360B2 (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| EA201391585A EA201391585A1 (ru) | 2011-04-29 | 2012-04-27 | Терапевтические нуклеазные композиции и способы |
| SG2013080148A SG194680A1 (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| PL12777116T PL2704737T3 (pl) | 2011-04-29 | 2012-04-27 | Terapeutyczne kompozycje nukleaz i sposoby |
| NZ616989A NZ616989A (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| JP2014508143A JP6063450B2 (ja) | 2011-04-29 | 2012-04-27 | 治療用ヌクレアーゼ組成物および方法 |
| DK12777116.0T DK2704737T3 (en) | 2011-04-29 | 2012-04-27 | THERAPEUTIC NUCLEASE COMPOSITIONS AND PROCEDURES |
| EP12777116.0A EP2704737B1 (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| HRP20180564TT HRP20180564T1 (hr) | 2011-04-29 | 2012-04-27 | Terapijski pripravci nukleaze i postupci |
| IL300276A IL300276B2 (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| KR1020197021908A KR102161657B1 (ko) | 2011-04-29 | 2012-04-27 | 치료적 뉴클레아제 조성물 및 방법 |
| KR1020257006611A KR20250037576A (ko) | 2011-04-29 | 2012-04-27 | 치료적 뉴클레아제 조성물 및 방법 |
| PH1/2013/502441A PH12013502441B1 (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| ES12777116.0T ES2666303T3 (es) | 2011-04-29 | 2012-04-27 | Composiciones terapéuticas de nucleasa y métodos |
| KR1020137031347A KR102006393B1 (ko) | 2011-04-29 | 2012-04-27 | 치료적 뉴클레아제 조성물 및 방법 |
| CN201711217220.XA CN107964539B (zh) | 2011-04-29 | 2012-04-27 | 治疗性核酸酶组合物和方法 |
| LTEP12777116.0T LT2704737T (lt) | 2011-04-29 | 2012-04-27 | Terapinės nukleazės kompozicijos ir būdai |
| KR1020207027463A KR102428875B1 (ko) | 2011-04-29 | 2012-04-27 | 치료적 뉴클레아제 조성물 및 방법 |
| KR1020237037142A KR102776415B1 (ko) | 2011-04-29 | 2012-04-27 | 치료적 뉴클레아제 조성물 및 방법 |
| US13/822,215 US10202588B2 (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| MX2017014091A MX389061B (es) | 2011-04-29 | 2012-04-27 | Composiciones de nucleasa terapeuticas y metodos. |
| MX2013012612A MX351953B (es) | 2011-04-29 | 2012-04-27 | Composiciones de nucleasa terapeuticas y metodos. |
| SI201231276T SI2704737T1 (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| BR112013027547-2A BR112013027547B1 (pt) | 2011-04-29 | 2012-04-27 | polipeptídeo, dímero, composição, molécula de ácido nucleico, vetor de expressão recombinante, célula hospedeira microbiana, método para preparar o polipeptídeo e composição contendo nucleasse |
| CA2834626A CA2834626A1 (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| IL313299A IL313299A (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| EP18167227.0A EP3449933A1 (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| CN201280032451.2A CN103930127B (zh) | 2011-04-29 | 2012-04-27 | 治疗性核酸酶组合物和方法 |
| KR1020227026432A KR102596953B1 (ko) | 2011-04-29 | 2012-04-27 | 치료적 뉴클레아제 조성물 및 방법 |
| TNP2013000433A TN2013000433A1 (en) | 2012-03-29 | 2013-10-24 | Therapeutic nuclease compositions and methods |
| IL229074A IL229074B (en) | 2011-04-29 | 2013-10-24 | Therapeutic nuclease compositions and methods |
| MA36441A MA35154B1 (fr) | 2011-04-29 | 2013-11-15 | Compositions à base de nucléase thérapeutique et procédés associés |
| US14/174,167 US8937157B2 (en) | 2011-04-29 | 2014-02-06 | Therapeutic nuclease compositions and methods |
| US14/599,567 US10000745B2 (en) | 2009-11-02 | 2015-01-19 | Therapeutic nuclease compositions and methods |
| AU2016201790A AU2016201790B2 (en) | 2011-04-29 | 2016-03-22 | Therapeutic nuclease compositions and methods |
| AU2018201073A AU2018201073C1 (en) | 2011-04-29 | 2018-02-14 | Therapeutic nuclease compositions and methods |
| US16/229,431 US11034944B2 (en) | 2011-04-29 | 2018-12-21 | Therapeutic nuclease compositions and methods |
| IL269020A IL269020B (en) | 2011-04-29 | 2019-08-29 | Therapeutic nuclease compositions and methods |
| AU2020201619A AU2020201619C1 (en) | 2011-04-29 | 2020-03-04 | Therapeutic nuclease compositions and methods |
| US17/324,641 US12338466B2 (en) | 2011-04-29 | 2021-05-19 | Therapeutic nuclease compositions and methods |
| IL285985A IL285985B2 (en) | 2011-04-29 | 2021-08-31 | Therapeutic nuclease preparations and methods |
| AU2022203877A AU2022203877B2 (en) | 2011-04-29 | 2022-06-03 | Therapeutic nuclease compositions and methods |
| US19/217,745 US20260043012A1 (en) | 2011-04-29 | 2025-05-23 | Therapeutic Nuclease Compositions and Methods |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161480961P | 2011-04-29 | 2011-04-29 | |
| US61/480,961 | 2011-04-29 | ||
| US201261617241P | 2012-03-29 | 2012-03-29 | |
| US61/617,241 | 2012-03-29 |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/822,215 A-371-Of-International US10202588B2 (en) | 2011-04-29 | 2012-04-27 | Therapeutic nuclease compositions and methods |
| US14/174,167 Continuation US8937157B2 (en) | 2009-11-02 | 2014-02-06 | Therapeutic nuclease compositions and methods |
| US16/229,431 Continuation US11034944B2 (en) | 2011-04-29 | 2018-12-21 | Therapeutic nuclease compositions and methods |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2012149440A2 true WO2012149440A2 (en) | 2012-11-01 |
| WO2012149440A3 WO2012149440A3 (en) | 2014-05-15 |
Family
ID=47073103
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/035614 Ceased WO2012149440A2 (en) | 2009-11-02 | 2012-04-27 | Therapeutic nuclease compositions and methods |
Country Status (28)
| Country | Link |
|---|---|
| US (6) | US10202588B2 (https=) |
| EP (2) | EP3449933A1 (https=) |
| JP (7) | JP6063450B2 (https=) |
| KR (6) | KR20250037576A (https=) |
| CN (2) | CN107964539B (https=) |
| AU (5) | AU2012249360B2 (https=) |
| BR (1) | BR112013027547B1 (https=) |
| CA (1) | CA2834626A1 (https=) |
| CL (1) | CL2013003123A1 (https=) |
| CO (1) | CO6811815A2 (https=) |
| CR (1) | CR20130598A (https=) |
| DK (1) | DK2704737T3 (https=) |
| DO (1) | DOP2013000250A (https=) |
| EA (1) | EA201391585A1 (https=) |
| EC (1) | ECSP13013060A (https=) |
| ES (1) | ES2666303T3 (https=) |
| HR (1) | HRP20180564T1 (https=) |
| HU (1) | HUE038759T2 (https=) |
| IL (5) | IL300276B2 (https=) |
| LT (1) | LT2704737T (https=) |
| MX (3) | MX351953B (https=) |
| NZ (1) | NZ616989A (https=) |
| PE (1) | PE20141172A1 (https=) |
| PH (1) | PH12013502441B1 (https=) |
| PL (1) | PL2704737T3 (https=) |
| SG (2) | SG10201913930UA (https=) |
| SI (1) | SI2704737T1 (https=) |
| WO (1) | WO2012149440A2 (https=) |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013114371A1 (en) * | 2012-02-01 | 2013-08-08 | Protalix Ltd. | Dry powder formulations of dnase i |
| US8841416B2 (en) | 2009-11-02 | 2014-09-23 | University Of Washington | Therapeutic nuclease compositions and methods |
| US8937157B2 (en) | 2011-04-29 | 2015-01-20 | University Of Washington | Therapeutic nuclease compositions and methods |
| WO2015066550A1 (en) | 2013-10-31 | 2015-05-07 | Resolve Therapeutics, Llc | Therapeutic nuclease-albumin fusions and methods |
| WO2016069889A1 (en) * | 2014-10-31 | 2016-05-06 | Resolve Therapeutics, Llc | Therapeutic nuclease-transferrin fusions and methods |
| WO2018005954A3 (en) * | 2016-07-01 | 2018-03-29 | Resolve Therapeutics, Llc | Optimized binuclease fusions and methods |
| WO2020142740A1 (en) * | 2019-01-04 | 2020-07-09 | Resolve Therapeutics, Llc | Treatment of sjogren's disease with nuclease fusion proteins |
| US20220127334A1 (en) * | 2014-02-24 | 2022-04-28 | Takeda Pharmaceutical Company Limited | Uti fusion proteins |
| WO2022178090A3 (en) * | 2021-02-19 | 2022-09-29 | Theripion, Inc. | Dnase fusion polypeptides and related compositions and methods |
| US11840712B2 (en) * | 2018-10-08 | 2023-12-12 | Neutrolis, Inc. | Engineering of DNASE enzymes for manufacturing and therapy |
| US12129288B2 (en) | 2017-08-22 | 2024-10-29 | Sanabio, Llc | Polynucleotides heterodimers of soluble interferon receptors and uses thereof |
Families Citing this family (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2898184A1 (en) | 2013-01-16 | 2014-07-24 | Emory University | Cas9-nucleic acid complexes and uses related thereto |
| WO2015191546A2 (en) * | 2014-06-10 | 2015-12-17 | The Board Of Regents Of The University Of Texas System | Adp-ribose detection reagents |
| US10117911B2 (en) | 2015-05-29 | 2018-11-06 | Agenovir Corporation | Compositions and methods to treat herpes simplex virus infections |
| KR102440820B1 (ko) | 2015-09-08 | 2022-09-05 | 테리피온, 인크. | ApoA-1 융합 폴리펩티드 및 관련 조성물 및 방법 |
| BR112018074453A2 (pt) | 2016-05-27 | 2019-03-19 | Abbvie Biotherapeutics Inc. | proteínas de ligação biespecíficas ligando uma protéina imunomoduladora e um antígeno tumoral |
| WO2018136163A2 (en) | 2016-12-09 | 2018-07-26 | Theripion, Inc. | Tandem apoa-1 fusion polypeptides |
| IL325846A (en) * | 2018-10-08 | 2026-03-01 | Neutrolis Inc | Engineering deoxyribonuclease enzymes for manufacturing and medicine |
| JP2020136505A (ja) | 2019-02-20 | 2020-08-31 | 株式会社Joled | 半導体装置および表示装置 |
| IL294114A (en) * | 2020-01-11 | 2022-08-01 | Univ Yale | Preparations and methods for the treatment, improvement and/or prevention of diseases or disorders caused by or related to dnase1 and/or dnase1l3 |
| EP4161645A4 (en) * | 2020-06-08 | 2023-11-01 | Yale University | COMPOSITIONS AND METHODS FOR TREATING AND/OR PREVENTING COAGULOPATHY AND/OR SEPSIS IN PATIENTS WITH BACTERIAL AND/OR VIRAL INFECTIONS |
| CN112088903A (zh) * | 2020-09-28 | 2020-12-18 | 武汉愔紫生物科技有限公司 | 一种大分子蛋白在抗菌抗病毒消毒剂中的应用 |
| CN115595315B (zh) * | 2021-06-28 | 2024-08-16 | 四川大学华西医院 | 核糖核酸酶i在抑制疼痛的药物中的新用途 |
| WO2026037276A1 (zh) * | 2024-08-12 | 2026-02-19 | 上海交通大学医学院 | 一种减少线粒体dna泄露的方法 |
Citations (64)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3941763A (en) | 1975-03-28 | 1976-03-02 | American Home Products Corporation | PGlu-D-Met-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 and intermediates |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| WO1988007089A1 (en) | 1987-03-18 | 1988-09-22 | Medical Research Council | Altered antibodies |
| US4800159A (en) | 1986-02-07 | 1989-01-24 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences |
| US4965188A (en) | 1986-08-22 | 1990-10-23 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme |
| WO1996014339A1 (en) | 1994-11-05 | 1996-05-17 | The Wellcome Foundation Limited | Antibodies |
| US5658570A (en) | 1991-07-25 | 1997-08-19 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| WO1998005787A1 (en) | 1996-08-02 | 1998-02-12 | Bristol-Myers Squibb Company | A method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| US5834250A (en) | 1988-10-28 | 1998-11-10 | Genentech, Inc. | Method for identifying active domains and amino acid residues in polypeptides and hormone variants |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| WO1999025044A1 (en) | 1997-11-07 | 1999-05-20 | Nathan Cohen | Microstrip patch antenna with fractal structure |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| WO2000032767A1 (en) | 1998-12-03 | 2000-06-08 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | RECOMBINANT SOLUBLE Fc RECEPTORS |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6096871A (en) | 1995-04-14 | 2000-08-01 | Genentech, Inc. | Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6242195B1 (en) | 1998-04-02 | 2001-06-05 | Genentech, Inc. | Methods for determining binding of an analyte to a receptor |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| WO2002044215A2 (en) | 2000-12-01 | 2002-06-06 | Cockbain, Julian | Hybrid antibodies |
| WO2002060919A2 (en) | 2000-12-12 | 2002-08-08 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| WO2002060955A2 (en) | 2001-01-29 | 2002-08-08 | Idec Pharmaceuticals Corporation | Modified antibodies and methods of use |
| WO2002096948A2 (en) | 2001-01-29 | 2002-12-05 | Idec Pharmaceuticals Corporation | Engineered tetravalent antibodies and methods of use |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| US20030108548A1 (en) | 1993-06-01 | 2003-06-12 | Bluestone Jeffrey A. | Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies |
| WO2003074569A2 (en) | 2002-03-01 | 2003-09-12 | Immunomedics, Inc. | Bispecific antibody point mutations for enhancing rate of clearance |
| US6660843B1 (en) | 1998-10-23 | 2003-12-09 | Amgen Inc. | Modified peptides as therapeutic agents |
| WO2004016750A2 (en) | 2002-08-14 | 2004-02-26 | Macrogenics, Inc. | FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| WO2004035752A2 (en) | 2002-10-15 | 2004-04-29 | Protein Design Labs, Inc. | ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2004044859A1 (en) | 2002-11-14 | 2004-05-27 | Gary Michael Wilson | Warning unit |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| WO2004074455A2 (en) | 2003-02-20 | 2004-09-02 | Applied Molecular Evolution | Fc REGION VARIANTS |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| WO2005018572A2 (en) | 2003-08-22 | 2005-03-03 | Biogen Idec Ma Inc. | Improved antibodies having altered effector function and methods for making the same |
| WO2005040217A2 (en) | 2003-10-17 | 2005-05-06 | Cambridge University Technical Services Limited | Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions |
| WO2005047327A2 (en) | 2003-11-12 | 2005-05-26 | Biogen Idec Ma Inc. | NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO |
| WO2005063815A2 (en) | 2003-11-12 | 2005-07-14 | Biogen Idec Ma Inc. | Fcϝ receptor-binding polypeptide variants and methods related thereto |
| WO2005070963A1 (en) | 2004-01-12 | 2005-08-04 | Applied Molecular Evolution, Inc | Fc region variants |
| WO2005077981A2 (en) | 2003-12-22 | 2005-08-25 | Xencor, Inc. | Fc POLYPEPTIDES WITH NOVEL Fc LIGAND BINDING SITES |
| WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| WO2005123780A2 (en) | 2004-04-09 | 2005-12-29 | Protein Design Labs, Inc. | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2006019447A1 (en) | 2004-07-15 | 2006-02-23 | Xencor, Inc. | Optimized fc variants |
| WO2006047350A2 (en) | 2004-10-21 | 2006-05-04 | Xencor, Inc. | IgG IMMUNOGLOBULIN VARIANTS WITH OPTIMIZED EFFECTOR FUNCTION |
| WO2006085967A2 (en) | 2004-07-09 | 2006-08-17 | Xencor, Inc. | OPTIMIZED ANTI-CD20 MONOCONAL ANTIBODIES HAVING Fc VARIANTS |
| US20060235208A1 (en) | 2002-09-27 | 2006-10-19 | Xencor, Inc. | Fc variants with optimized properties |
| US20070111281A1 (en) | 2005-05-09 | 2007-05-17 | Glycart Biotechnology Ag | Antigen binding molecules having modified Fc regions and altered binding to Fc receptors |
| US20070231329A1 (en) | 2003-03-03 | 2007-10-04 | Xencor, Inc. | Fc Variants Having Increased Affinity for FcyRIIb |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| US20080057056A1 (en) | 2003-03-03 | 2008-03-06 | Xencor, Inc. | Fc Variants with Increased Affinity for FcyRIIC |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
| US9401875B2 (en) | 2012-06-01 | 2016-07-26 | Nippon Telegraph And Telephone Corporation | Packet transfer processing method and packet transfer processing device |
Family Cites Families (74)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5453269A (en) | 1986-04-14 | 1995-09-26 | The General Hospital Corporation | Heterobifunctional antibodies having dual specificity for fibrin and thrombolylic agents and methods of use |
| US5559212A (en) | 1988-04-06 | 1996-09-24 | Alfacell Corporation | Frog embryo and egg-derived tumor cell anti-proliferation protein |
| US5225538A (en) | 1989-02-23 | 1993-07-06 | Genentech, Inc. | Lymphocyte homing receptor/immunoglobulin fusion proteins |
| US5840840A (en) | 1990-04-17 | 1998-11-24 | The United States Of America As Represented By The Department Of Health And Human Services | Selective RNase cytotoxic reagents |
| ES2133285T3 (es) | 1991-04-17 | 1999-09-16 | Medisup Int Nv | Polipeptidos hidrosolubles que tienen una alta afinidad para los interferones alfa y beta. |
| US5637481A (en) | 1993-02-01 | 1997-06-10 | Bristol-Myers Squibb Company | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
| US5470582A (en) | 1992-02-07 | 1995-11-28 | Syntex (U.S.A.) Inc. | Controlled delivery of pharmaceuticals from preformed porous polymeric microparticles |
| GB9300686D0 (en) | 1993-01-15 | 1993-03-03 | Imp Cancer Res Tech | Compounds for targeting |
| US6348343B2 (en) | 1995-02-24 | 2002-02-19 | Genentech, Inc. | Human DNase I variants |
| BR9606706A (pt) | 1995-10-16 | 1999-04-06 | Unilever Nv | Análogo de fragmento de anticorpo biespecífico ou bivalente uso processo para produzir o mesmo |
| US6482626B2 (en) | 1996-02-05 | 2002-11-19 | Genentech, Inc. | Human DNase |
| US6716974B1 (en) | 1996-05-31 | 2004-04-06 | Maine Medical Center Research Institute | Therapeutic and diagnostic methods and compositions based on jagged/notch proteins and nucleic acids |
| US6391607B1 (en) | 1996-06-14 | 2002-05-21 | Genentech, Inc. | Human DNase I hyperactive variants |
| US7247302B1 (en) | 1996-08-02 | 2007-07-24 | Bristol-Myers Squibb Company | Method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis |
| US6653104B2 (en) | 1996-10-17 | 2003-11-25 | Immunomedics, Inc. | Immunotoxins, comprising an internalizing antibody, directed against malignant and normal cells |
| DK0932417T3 (da) | 1996-10-17 | 2003-04-14 | Immunomedics Inc | Non-antigent toxinkonjugat og fusionsprotein af internaliserende receptorsystem |
| US20030068623A1 (en) | 1997-06-16 | 2003-04-10 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| US20020192659A1 (en) | 1997-09-17 | 2002-12-19 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| US6280991B1 (en) | 1997-10-15 | 2001-08-28 | Wisconsin Alumni Research Foundation | Engineered cytotoxic ribonclease |
| US5840296A (en) | 1997-10-15 | 1998-11-24 | Raines; Ronald T. | Engineered cytotoxic ribonuclease A |
| US6239257B1 (en) | 1998-12-30 | 2001-05-29 | Alfacell Corporation | Family of proteins belonging to the pancreatic ribonuclease a superfamily |
| IL147270A0 (en) | 1999-07-02 | 2002-08-14 | Genentech Inc | Fusion peptides comprising a peptide ligand domain and a multimerization domain |
| US6175003B1 (en) | 1999-09-10 | 2001-01-16 | Alfacell Corporation | Nucleic acids encoding ribonucleases and methods of making them |
| WO2001026608A2 (en) | 1999-10-14 | 2001-04-19 | Ledbetter Jeffrey A | Dna vaccines encoding antigen linked to a domain that binds cd40 |
| US20030133939A1 (en) | 2001-01-17 | 2003-07-17 | Genecraft, Inc. | Binding domain-immunoglobulin fusion proteins |
| US7829084B2 (en) * | 2001-01-17 | 2010-11-09 | Trubion Pharmaceuticals, Inc. | Binding constructs and methods for use thereof |
| US7754208B2 (en) | 2001-01-17 | 2010-07-13 | Trubion Pharmaceuticals, Inc. | Binding domain-immunoglobulin fusion proteins |
| RU2003129528A (ru) | 2001-03-07 | 2005-04-10 | Мерк Патент ГмбХ (DE) | Способ экспрессии белков, содержащих в качестве компонента гибридный изотип антитела |
| JP4586310B2 (ja) | 2001-07-04 | 2010-11-24 | 株式会社Ihi | セラミックス複合部材の製造方法 |
| US20060040262A1 (en) * | 2002-12-27 | 2006-02-23 | Morris David W | Novel compositions and methods in cancer |
| US7662925B2 (en) | 2002-03-01 | 2010-02-16 | Xencor, Inc. | Optimized Fc variants and methods for their generation |
| CA2489446A1 (en) | 2002-06-14 | 2003-12-24 | Wisconsin Alumni Research Foundation | Ribonuclease zymogen design |
| EP1578367A4 (en) | 2002-11-01 | 2012-05-02 | Genentech Inc | COMPOSITIONS AND METHODS FOR THE TREATMENT OF IMMUNE DISEASES |
| US7067298B2 (en) | 2003-03-31 | 2006-06-27 | Ambion, Inc. | Compositions and methods of using a synthetic Dnase I |
| US7666417B2 (en) | 2003-04-22 | 2010-02-23 | Fred Hutchinson Cancer Research Center | Methods and compositions for treating autoimmune diseases or conditions |
| US7754209B2 (en) * | 2003-07-26 | 2010-07-13 | Trubion Pharmaceuticals | Binding constructs and methods for use thereof |
| US9296820B2 (en) | 2003-11-05 | 2016-03-29 | Roche Glycart Ag | Polynucleotides encoding anti-CD20 antigen binding molecules with increased Fc receptor binding affinity and effector function |
| RU2370276C2 (ru) | 2003-12-31 | 2009-10-20 | Мерк Патент Гмбх | Fc-ЭРИТРОПОЭТИН СЛИТЫЙ БЕЛОК С УЛУЧШЕННОЙ ФАРМАКОКИНЕТИКОЙ |
| US7544487B2 (en) | 2004-02-13 | 2009-06-09 | Immunomedics, Inc. | Fusion proteins containing recombinant cytotoxic RNAses |
| JP2008505853A (ja) | 2004-04-13 | 2008-02-28 | クインテセンス バイオサイエンシーズ インコーポレーティッド | 細胞傷害性薬剤としての非天然のリボヌクレアーゼ複合体 |
| AU2005334481A1 (en) | 2004-08-11 | 2007-01-25 | Trubion Pharmaceuticals, Inc. | Binding domain fusion proteins |
| DE102005000921A1 (de) | 2005-01-07 | 2006-07-27 | Siemens Ag | Verfahren und Vorrichtung zur Broadband-Datenverteilung zwischen mehreren Benutzerendgeräten |
| DE102005009219A1 (de) | 2005-02-25 | 2006-08-31 | Martin-Luther-Universität Halle-Wittenberg | Ribonuclease-Tandemenzyme und Verfahren zu ihrer Herstellung |
| US20110123440A1 (en) | 2005-03-29 | 2011-05-26 | Genevieve Hansen | Altered Antibody FC Regions and Uses Thereof |
| EP1896579A2 (en) | 2005-06-16 | 2008-03-12 | Wisconsin Alumni Research Foundation | Cytotoxic ribonuclease variants |
| EP1910541B1 (en) | 2005-06-16 | 2010-10-20 | Wisconsin Alumni Research Foundation | Cytotoxic ribonuclease variants |
| US20080279850A1 (en) | 2005-07-25 | 2008-11-13 | Trubion Pharmaceuticals, Inc. | B-Cell Reduction Using CD37-Specific and CD20-Specific Binding Molecules |
| RU2423381C2 (ru) | 2005-07-25 | 2011-07-10 | Трабьон Фармасьютикалз, Инк. | Снижение количества в-клеток с использованием cd37-специфических и cd20-специфических связывающих молекул |
| US7807409B2 (en) | 2005-10-21 | 2010-10-05 | Roche Palo Alto Llc | Method for the recombinant expression of a polypeptide |
| AU2007238034A1 (en) | 2006-04-14 | 2007-10-25 | Trubion Pharmaceuticals Inc. | Binding proteins comprising immunoglobulin hinge and Fc regions having altered Fc effector functions |
| US20100015661A1 (en) * | 2006-04-21 | 2010-01-21 | Mab-Factory Gmbh | Antibody-rnase-conjugate |
| GB0611444D0 (en) | 2006-06-09 | 2006-07-19 | Medical Res Council Technology | Rnase H2 complex and genes therefor |
| NZ573646A (en) | 2006-06-12 | 2012-04-27 | Wyeth Llc | Single-chain multivalent binding proteins with effector function |
| EP1905841A1 (en) | 2006-09-25 | 2008-04-02 | Max Delbrück Centrum für Molekulare Medizin (MDC) Berlin-Buch; | Trex1 as a marker for lupus erythematosus |
| EP2144930A1 (en) * | 2007-04-18 | 2010-01-20 | ZymoGenetics, Inc. | Single chain fc, methods of making and methods of treatment |
| US20090258005A1 (en) | 2007-05-29 | 2009-10-15 | Trubion Pharmaceuticals Inc. | Therapeutic compositions and methods |
| JP2010531137A (ja) | 2007-06-12 | 2010-09-24 | ワイス・エルエルシー | 抗cd20治療用組成物および方法 |
| JP2010532764A (ja) * | 2007-07-06 | 2010-10-14 | トゥルビオン・ファーマシューティカルズ・インコーポレーテッド | C末端に配置された特異的結合性ドメインを有する結合性ペプチド |
| WO2009015345A1 (en) | 2007-07-25 | 2009-01-29 | Amgen Inc. | Pharmaceutical compositions comprising fc fusion proteins |
| BRPI0814465B1 (pt) | 2007-07-26 | 2021-11-23 | Novagen Holding Corporation | Proteína de fusão, dímero, método para produzir uma proteína de fusão, linhagem de célula, usos de uma proteína de fusão e de uma composição farmacêutica e composição farmacêutica |
| CA2705542A1 (en) | 2007-11-13 | 2009-05-22 | Sapphire Energy, Inc. | Production of fc-fusion polypeptides in eukaryotic algae |
| RU2531754C2 (ru) | 2008-04-11 | 2014-10-27 | ЭМЕРДЖЕНТ ПРОДАКТ ДИВЕЛОПМЕНТ СИЭТЛ,ЭлЭлСи,US | Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством |
| CN102224258A (zh) * | 2008-09-26 | 2011-10-19 | 弗·哈夫曼-拉罗切有限公司 | 用于治疗、诊断和监测狼疮的方法 |
| BRPI0920743A2 (pt) | 2008-10-01 | 2016-09-20 | Quintessence Biosciences Inc | ribonucleases terapeuticas |
| MX341084B (es) | 2009-11-02 | 2016-08-05 | Univ Washington | Composiciones de nucleasas terapéuticas y métodos. |
| TWI529163B (zh) | 2011-01-25 | 2016-04-11 | 陶氏農業科學公司 | 用於製備4-胺基-5-氟-3-鹵素-6-(經取代之)吡啶甲酸酯的方法 |
| EA201370187A1 (ru) | 2011-02-23 | 2013-12-30 | Амген Инк. | Клеточная культуральная среда для уфс воздействия и относящиеся к ней способы |
| MX363013B (es) | 2011-02-25 | 2019-03-04 | Recombinetics Inc | Animales genéticamente modificados y métodos para su obtención. |
| RS61447B1 (sr) | 2011-04-21 | 2021-03-31 | Glaxo Group Ltd | Modulacija ekspresije virusa hepatitisa b (hbv) |
| ES2666303T3 (es) | 2011-04-29 | 2018-05-03 | University Of Washington | Composiciones terapéuticas de nucleasa y métodos |
| US20140178479A1 (en) | 2011-08-12 | 2014-06-26 | Perosphere, Inc. | Concentrated Felbamate Formulations for Parenteral Administration |
| HRP20192080T1 (hr) | 2013-10-31 | 2020-02-07 | Resolve Therapeutics, Llc | Terapeutske fuzije nukleaza-albumine i postupci |
| CA3029627A1 (en) | 2016-07-01 | 2018-01-04 | Resolve Therapeutics, Llc | Optimized binuclease fusions and methods |
| JP6866739B2 (ja) * | 2017-04-13 | 2021-04-28 | 住友ゴム工業株式会社 | ゴムクローラ |
-
2012
- 2012-04-27 ES ES12777116.0T patent/ES2666303T3/es active Active
- 2012-04-27 KR KR1020257006611A patent/KR20250037576A/ko active Pending
- 2012-04-27 PL PL12777116T patent/PL2704737T3/pl unknown
- 2012-04-27 PH PH1/2013/502441A patent/PH12013502441B1/en unknown
- 2012-04-27 PE PE2013002425A patent/PE20141172A1/es not_active Application Discontinuation
- 2012-04-27 EP EP18167227.0A patent/EP3449933A1/en active Pending
- 2012-04-27 IL IL300276A patent/IL300276B2/en unknown
- 2012-04-27 EA EA201391585A patent/EA201391585A1/ru unknown
- 2012-04-27 SG SG10201913930UA patent/SG10201913930UA/en unknown
- 2012-04-27 KR KR1020207027463A patent/KR102428875B1/ko active Active
- 2012-04-27 NZ NZ616989A patent/NZ616989A/en unknown
- 2012-04-27 KR KR1020197021908A patent/KR102161657B1/ko active Active
- 2012-04-27 CN CN201711217220.XA patent/CN107964539B/zh active Active
- 2012-04-27 WO PCT/US2012/035614 patent/WO2012149440A2/en not_active Ceased
- 2012-04-27 AU AU2012249360A patent/AU2012249360B2/en active Active
- 2012-04-27 KR KR1020237037142A patent/KR102776415B1/ko active Active
- 2012-04-27 HR HRP20180564TT patent/HRP20180564T1/hr unknown
- 2012-04-27 DK DK12777116.0T patent/DK2704737T3/en active
- 2012-04-27 MX MX2013012612A patent/MX351953B/es active IP Right Grant
- 2012-04-27 MX MX2017014091A patent/MX389061B/es unknown
- 2012-04-27 HU HUE12777116A patent/HUE038759T2/hu unknown
- 2012-04-27 US US13/822,215 patent/US10202588B2/en active Active
- 2012-04-27 KR KR1020227026432A patent/KR102596953B1/ko active Active
- 2012-04-27 SI SI201231276T patent/SI2704737T1/en unknown
- 2012-04-27 CN CN201280032451.2A patent/CN103930127B/zh active Active
- 2012-04-27 EP EP12777116.0A patent/EP2704737B1/en active Active
- 2012-04-27 SG SG2013080148A patent/SG194680A1/en unknown
- 2012-04-27 CA CA2834626A patent/CA2834626A1/en active Pending
- 2012-04-27 IL IL313299A patent/IL313299A/en unknown
- 2012-04-27 LT LTEP12777116.0T patent/LT2704737T/lt unknown
- 2012-04-27 JP JP2014508143A patent/JP6063450B2/ja active Active
- 2012-04-27 KR KR1020137031347A patent/KR102006393B1/ko active Active
- 2012-04-27 BR BR112013027547-2A patent/BR112013027547B1/pt active IP Right Grant
-
2013
- 2013-10-24 IL IL229074A patent/IL229074B/en active IP Right Grant
- 2013-10-25 DO DO2013000250A patent/DOP2013000250A/es unknown
- 2013-10-28 CL CL2013003123A patent/CL2013003123A1/es unknown
- 2013-10-29 MX MX2021015735A patent/MX2021015735A/es unknown
- 2013-11-15 CR CR20130598A patent/CR20130598A/es unknown
- 2013-11-27 CO CO13279038A patent/CO6811815A2/es unknown
- 2013-11-28 EC ECSP13013060 patent/ECSP13013060A/es unknown
-
2014
- 2014-02-06 US US14/174,167 patent/US8937157B2/en active Active
-
2015
- 2015-01-19 US US14/599,567 patent/US10000745B2/en active Active
-
2016
- 2016-03-22 AU AU2016201790A patent/AU2016201790B2/en active Active
- 2016-12-16 JP JP2016243950A patent/JP2017114854A/ja active Pending
-
2018
- 2018-02-14 AU AU2018201073A patent/AU2018201073C1/en active Active
- 2018-09-21 JP JP2018177009A patent/JP6762345B2/ja active Active
- 2018-12-21 US US16/229,431 patent/US11034944B2/en active Active
-
2019
- 2019-08-29 IL IL269020A patent/IL269020B/en unknown
-
2020
- 2020-03-04 AU AU2020201619A patent/AU2020201619C1/en active Active
- 2020-09-08 JP JP2020150220A patent/JP7212016B2/ja active Active
-
2021
- 2021-05-19 US US17/324,641 patent/US12338466B2/en active Active
- 2021-08-31 IL IL285985A patent/IL285985B2/en unknown
-
2022
- 2022-06-03 AU AU2022203877A patent/AU2022203877B2/en active Active
-
2023
- 2023-01-12 JP JP2023003096A patent/JP7551794B2/ja active Active
-
2024
- 2024-05-10 JP JP2024077060A patent/JP2024099851A/ja active Pending
- 2024-09-03 JP JP2024151150A patent/JP2024167368A/ja active Pending
-
2025
- 2025-05-23 US US19/217,745 patent/US20260043012A1/en active Pending
Patent Citations (78)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3941763A (en) | 1975-03-28 | 1976-03-02 | American Home Products Corporation | PGlu-D-Met-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 and intermediates |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4683202B1 (https=) | 1985-03-28 | 1990-11-27 | Cetus Corp | |
| US4683195B1 (https=) | 1986-01-30 | 1990-11-27 | Cetus Corp | |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4800159A (en) | 1986-02-07 | 1989-01-24 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences |
| US4965188A (en) | 1986-08-22 | 1990-10-23 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| WO1988007089A1 (en) | 1987-03-18 | 1988-09-22 | Medical Research Council | Altered antibodies |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5834250A (en) | 1988-10-28 | 1998-11-10 | Genentech, Inc. | Method for identifying active domains and amino acid residues in polypeptides and hormone variants |
| US5658570A (en) | 1991-07-25 | 1997-08-19 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| US20030108548A1 (en) | 1993-06-01 | 2003-06-12 | Bluestone Jeffrey A. | Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies |
| WO1996014339A1 (en) | 1994-11-05 | 1996-05-17 | The Wellcome Foundation Limited | Antibodies |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6096871A (en) | 1995-04-14 | 2000-08-01 | Genentech, Inc. | Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life |
| US6998253B1 (en) | 1995-04-14 | 2006-02-14 | Genentech, Inc. | Altered polypeptides with increased half-life |
| WO1998005787A1 (en) | 1996-08-02 | 1998-02-12 | Bristol-Myers Squibb Company | A method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| US6821505B2 (en) | 1997-03-03 | 2004-11-23 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| WO1999025044A1 (en) | 1997-11-07 | 1999-05-20 | Nathan Cohen | Microstrip patch antenna with fractal structure |
| US6538124B1 (en) | 1998-04-02 | 2003-03-25 | Genentech, Inc. | Polypeptide variants |
| US6242195B1 (en) | 1998-04-02 | 2001-06-05 | Genentech, Inc. | Methods for determining binding of an analyte to a receptor |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| US6660843B1 (en) | 1998-10-23 | 2003-12-09 | Amgen Inc. | Modified peptides as therapeutic agents |
| WO2000032767A1 (en) | 1998-12-03 | 2000-06-08 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | RECOMBINANT SOLUBLE Fc RECEPTORS |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2002044215A2 (en) | 2000-12-01 | 2002-06-06 | Cockbain, Julian | Hybrid antibodies |
| US7083784B2 (en) | 2000-12-12 | 2006-08-01 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| WO2002060919A2 (en) | 2000-12-12 | 2002-08-08 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| WO2002096948A2 (en) | 2001-01-29 | 2002-12-05 | Idec Pharmaceuticals Corporation | Engineered tetravalent antibodies and methods of use |
| WO2002060955A2 (en) | 2001-01-29 | 2002-08-08 | Idec Pharmaceuticals Corporation | Modified antibodies and methods of use |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| WO2003074569A2 (en) | 2002-03-01 | 2003-09-12 | Immunomedics, Inc. | Bispecific antibody point mutations for enhancing rate of clearance |
| WO2004016750A2 (en) | 2002-08-14 | 2004-02-26 | Macrogenics, Inc. | FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| US20060235208A1 (en) | 2002-09-27 | 2006-10-19 | Xencor, Inc. | Fc variants with optimized properties |
| WO2004035752A2 (en) | 2002-10-15 | 2004-04-29 | Protein Design Labs, Inc. | ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS |
| WO2004044859A1 (en) | 2002-11-14 | 2004-05-27 | Gary Michael Wilson | Warning unit |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| WO2004074455A2 (en) | 2003-02-20 | 2004-09-02 | Applied Molecular Evolution | Fc REGION VARIANTS |
| US20070237765A1 (en) | 2003-03-03 | 2007-10-11 | Xencor, Inc. | Fc Variants Having Increased Affinity for FcyRl |
| US20070286859A1 (en) | 2003-03-03 | 2007-12-13 | Xencor, Inc. | Fc Variants Having Decreased Affinity for FcyRl |
| US20070248603A1 (en) | 2003-03-03 | 2007-10-25 | Xencor, Inc. | Fc Variants with Increased Affinity for FcyRlla |
| US20070243188A1 (en) | 2003-03-03 | 2007-10-18 | Xencor, Inc. | Fc Variants Having Decreased Affinity for FcyRlla |
| US20070237767A1 (en) | 2003-03-03 | 2007-10-11 | Xencor, Inc. | Fc Variants Having Decreased Affinity for FcyRllla |
| US20070237766A1 (en) | 2003-03-03 | 2007-10-11 | Xencor, Inc. | Fc Variants Having Increased Affinity for FcyRllla |
| US20080057056A1 (en) | 2003-03-03 | 2008-03-06 | Xencor, Inc. | Fc Variants with Increased Affinity for FcyRIIC |
| US20070231329A1 (en) | 2003-03-03 | 2007-10-04 | Xencor, Inc. | Fc Variants Having Increased Affinity for FcyRIIb |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| WO2005018572A2 (en) | 2003-08-22 | 2005-03-03 | Biogen Idec Ma Inc. | Improved antibodies having altered effector function and methods for making the same |
| WO2005040217A2 (en) | 2003-10-17 | 2005-05-06 | Cambridge University Technical Services Limited | Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions |
| WO2005063815A2 (en) | 2003-11-12 | 2005-07-14 | Biogen Idec Ma Inc. | Fcϝ receptor-binding polypeptide variants and methods related thereto |
| WO2005047327A2 (en) | 2003-11-12 | 2005-05-26 | Biogen Idec Ma Inc. | NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO |
| WO2005077981A2 (en) | 2003-12-22 | 2005-08-25 | Xencor, Inc. | Fc POLYPEPTIDES WITH NOVEL Fc LIGAND BINDING SITES |
| WO2005070963A1 (en) | 2004-01-12 | 2005-08-04 | Applied Molecular Evolution, Inc | Fc region variants |
| WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| WO2005123780A2 (en) | 2004-04-09 | 2005-12-29 | Protein Design Labs, Inc. | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2006085967A2 (en) | 2004-07-09 | 2006-08-17 | Xencor, Inc. | OPTIMIZED ANTI-CD20 MONOCONAL ANTIBODIES HAVING Fc VARIANTS |
| WO2006019447A1 (en) | 2004-07-15 | 2006-02-23 | Xencor, Inc. | Optimized fc variants |
| WO2006047350A2 (en) | 2004-10-21 | 2006-05-04 | Xencor, Inc. | IgG IMMUNOGLOBULIN VARIANTS WITH OPTIMIZED EFFECTOR FUNCTION |
| US20070111281A1 (en) | 2005-05-09 | 2007-05-17 | Glycart Biotechnology Ag | Antigen binding molecules having modified Fc regions and altered binding to Fc receptors |
| US9401875B2 (en) | 2012-06-01 | 2016-07-26 | Nippon Telegraph And Telephone Corporation | Packet transfer processing method and packet transfer processing device |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
Non-Patent Citations (41)
| Title |
|---|
| "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS |
| "Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY |
| "Remington's Pharmaceutical Sciences", 1995, MACK PUBLISHING COMPANY |
| "Sequences of Proteins of Immunological Interest", vol. 1, 1991, NIH, pages: 647 - 723 |
| A.L. LEHNINGER: "Biochemistry", WORTH PUBLISHERS, INC. |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| BATZER ET AL., NUCLEIC ACID RES., vol. 19, 1991, pages 5081 |
| BENHAR; PASTAN, PROTEIN ENGINEERING, vol. 7, 1994, pages 1509 |
| CAREY; SUNDBERG: "Advanced Organic Chemistry", vol. A, B, 1992, PLENUM PRESS |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883 |
| CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| DAVIS ET AL., BIOCHEM. INTL., vol. 10, 1985, pages 394 - 414 |
| DWYER ET AL., JBC, vol. 271, no. 14, pages 9738 - 9743 |
| EPPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688 - 3692 |
| ERICKSON ET AL.: "The Proteins", vol. 2, 1976, pages: 257 - 527 |
| FINN ET AL.: "The Proteins", vol. 2, 1976, pages: 105 - 253 |
| HO ET AL., GENE, vol. 77, 1989, pages 51 |
| HORTON ET AL., METHODS ENZYMOL., vol. 217, 1993, pages 270 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", vol. L, 1991, NIH, article "Introduction", pages: XIII - XCVI |
| LANGER ET AL., J. BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277 |
| LANGER, CHEM. TECH., vol. 12, 1982, pages 98 - 105 |
| LARRICK ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 160, 1989, pages 1250 |
| LYODA ET AL., NEPHROL DIAL TRANSPLAT, vol. 22, 2007, pages 3451 |
| MARTINEZ-VALLE F. ET AL, LUPUS, vol. 18, no. 5, 2009, pages 418 - 423 |
| MERRIFIELD, J. AM. CHEM. SOC., vol. 85, 1963, pages 2149 |
| MERRIFIELD: "Chem. Polypeptides", 1973, pages: 335 - 361 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| OHTSUKA ET AL., J. BIOL. CHEM., vol. 260, 1985, pages 2605 - 2608 |
| PAN, CQ ET AL, J BIOL CHEM, vol. 273, 1998, pages 18374 - 18381 |
| PEARSON; LIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| RODRIGUEZ AM ET AL, GENOMICS, vol. 42, 1997, pages 507 - 513 |
| ROSSOLINI ET AL., MOL. CELL. PROBES, vol. 8, 1994, pages 91 - 98 |
| RUBERTI, F ET AL., J. IMMUNOL. METHODS, vol. 173, 1994, pages 33 |
| S. COLOWICK ET AL: "Methods In Enzymology", ACADEMIC PRESS, INC. |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989 |
| SIDMAN ET AL., BIOPOLYMERS, vol. 22, 1983, pages 547 - 556 |
| SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
| STEWART; YOUNG, SOLID PHASE PEPTIDE SYNTHESIS, 1969 |
| T.E. CREIGHTON: "Proteins: Structures and Molecular Properties", 1993, W.H. FREEMAN AND COMPANY |
| YASUDA T. ET AL, INT J BIOCHEM CELL BIOL, vol. 42, no. 7, 2010, pages 1216 - 1225 |
| ZHEN A. ET AL, BIOCHEM AND BIOPHYS RES COMM, vol. 231, 1997, pages 499 - 504 |
Cited By (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8841416B2 (en) | 2009-11-02 | 2014-09-23 | University Of Washington | Therapeutic nuclease compositions and methods |
| US11306297B2 (en) | 2009-11-02 | 2022-04-19 | University Of Washington | Therapeutic nuclease compositions and methods |
| US12435322B2 (en) | 2009-11-02 | 2025-10-07 | University Of Washington | Therapeutic nuclease compositions and methods |
| US9790479B2 (en) | 2009-11-02 | 2017-10-17 | University Of Washington | Therapeutic nuclease compositions and methods |
| US10000745B2 (en) | 2009-11-02 | 2018-06-19 | University Of Washington | Therapeutic nuclease compositions and methods |
| US8937157B2 (en) | 2011-04-29 | 2015-01-20 | University Of Washington | Therapeutic nuclease compositions and methods |
| US11034944B2 (en) | 2011-04-29 | 2021-06-15 | University Of Washington | Therapeutic nuclease compositions and methods |
| US12338466B2 (en) | 2011-04-29 | 2025-06-24 | University Of Washington | Therapeutic nuclease compositions and methods |
| US10202588B2 (en) | 2011-04-29 | 2019-02-12 | The University Of Washington | Therapeutic nuclease compositions and methods |
| WO2013114371A1 (en) * | 2012-02-01 | 2013-08-08 | Protalix Ltd. | Dry powder formulations of dnase i |
| US9603906B2 (en) | 2012-02-01 | 2017-03-28 | Protalix Ltd. | Inhalable liquid formulations of DNase I |
| US9603907B2 (en) | 2012-02-01 | 2017-03-28 | Protalix Ltd. | Dry powder formulations of dNase I |
| WO2015066557A1 (en) | 2013-10-31 | 2015-05-07 | Resolve Therapeutics, Llc | Therapeutic nuclease molecules with altered glycosylation and methods |
| US12163165B2 (en) | 2013-10-31 | 2024-12-10 | Resolve Therapeutics, Llc | Nucleic acid molecules encoding nuclease-albumin fusion proteins |
| WO2015066550A1 (en) | 2013-10-31 | 2015-05-07 | Resolve Therapeutics, Llc | Therapeutic nuclease-albumin fusions and methods |
| US10988745B2 (en) | 2013-10-31 | 2021-04-27 | Resolve Therapeutics, Llc | Therapeutic nuclease-albumin fusions and methods |
| JP2023123763A (ja) * | 2014-02-24 | 2023-09-05 | タケダ ゲー・エム・ベー・ハー | Uti融合タンパク質 |
| US20220127334A1 (en) * | 2014-02-24 | 2022-04-28 | Takeda Pharmaceutical Company Limited | Uti fusion proteins |
| WO2016069889A1 (en) * | 2014-10-31 | 2016-05-06 | Resolve Therapeutics, Llc | Therapeutic nuclease-transferrin fusions and methods |
| EP4410378A3 (en) * | 2016-07-01 | 2024-10-09 | Resolve Therapeutics, LLC | Optimized binuclease fusions and methods |
| US20190241878A1 (en) * | 2016-07-01 | 2019-08-08 | Resolve Therapeutics, Llc | Optimized binuclease fusions and methods |
| EP3478830B1 (en) * | 2016-07-01 | 2024-04-10 | Resolve Therapeutics, LLC | Optimized binuclease fusions and methods |
| US12077790B2 (en) | 2016-07-01 | 2024-09-03 | Resolve Therapeutics, Llc | Optimized binuclease fusions and methods |
| AU2017290389B2 (en) * | 2016-07-01 | 2024-09-26 | Resolve Therapeutics, Llc | Optimized binuclease fusions and methods |
| CN109790526A (zh) * | 2016-07-01 | 2019-05-21 | 分解治疗有限责任公司 | 优化的二核酸酶融合体和方法 |
| WO2018005954A3 (en) * | 2016-07-01 | 2018-03-29 | Resolve Therapeutics, Llc | Optimized binuclease fusions and methods |
| US12129288B2 (en) | 2017-08-22 | 2024-10-29 | Sanabio, Llc | Polynucleotides heterodimers of soluble interferon receptors and uses thereof |
| US11840712B2 (en) * | 2018-10-08 | 2023-12-12 | Neutrolis, Inc. | Engineering of DNASE enzymes for manufacturing and therapy |
| CN113597319A (zh) * | 2019-01-04 | 2021-11-02 | 分解治疗有限责任公司 | 用核酸酶融合蛋白治疗干燥症 |
| WO2020142740A1 (en) * | 2019-01-04 | 2020-07-09 | Resolve Therapeutics, Llc | Treatment of sjogren's disease with nuclease fusion proteins |
| WO2022178090A3 (en) * | 2021-02-19 | 2022-09-29 | Theripion, Inc. | Dnase fusion polypeptides and related compositions and methods |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20260043012A1 (en) | Therapeutic Nuclease Compositions and Methods | |
| AU2016202135B2 (en) | Therapeutic nuclease compositions and methods | |
| AU2013203097B2 (en) | Therapeutic nuclease compositions and methods | |
| HK40005595A (en) | Therapeutic nuclease compositions and methods | |
| HK1196067A (en) | Therapeutic nuclease compositions and methods | |
| HK1196067B (en) | Therapeutic nuclease compositions and methods | |
| HK1173660A (en) | Therapeutic nuclease compositions and methods | |
| HK1173660B (en) | Therapeutic nuclease compositions and methods | |
| HK40006279B (en) | Therapeutic nuclease compositions and methods | |
| HK40006279A (en) | Therapeutic nuclease compositions and methods |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12777116 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13822215 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2012249360 Country of ref document: AU Date of ref document: 20120427 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 0193113 Country of ref document: KE |
|
| ENP | Entry into the national phase |
Ref document number: 2014508143 Country of ref document: JP Kind code of ref document: A Ref document number: 2834626 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013003123 Country of ref document: CL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 002425-2013 Country of ref document: PE Ref document number: MX/A/2013/012612 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: CR2013-000598 Country of ref document: CR |
|
| ENP | Entry into the national phase |
Ref document number: 13299 Country of ref document: GE Kind code of ref document: P Ref document number: 20137031347 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2013000756 Country of ref document: DZ Ref document number: 13279038 Country of ref document: CO Ref document number: 15234237 Country of ref document: CO Ref document number: 201391585 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: A201312889 Country of ref document: UA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012777116 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112013027547 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112013027547 Country of ref document: BR Kind code of ref document: A2 Effective date: 20131025 |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020257006611 Country of ref document: KR |