WO2012123586A1 - Antibodies to cd70 - Google Patents
Antibodies to cd70 Download PDFInfo
- Publication number
- WO2012123586A1 WO2012123586A1 PCT/EP2012/054733 EP2012054733W WO2012123586A1 WO 2012123586 A1 WO2012123586 A1 WO 2012123586A1 EP 2012054733 W EP2012054733 W EP 2012054733W WO 2012123586 A1 WO2012123586 A1 WO 2012123586A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- antibody
- acid sequence
- human
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2875—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present invention relates to antibodies and antigen binding fragments thereof which bind to the human CD70 protein with high affinity and display potent inhibition of tumour cell growth.
- the cytokine receptor CD27 is a member of the tumour necrosis factor receptor (TFNR) superfamily, which play a role in cell growth and differentiation, as well as apoptosis.
- the ligand for CD27 is CD70, which belongs to the tumour necrosis factor family of ligands.
- CD70 is a 193 amino acid polypeptide having a 20 amino acid hydrophilic N-terminal domain and a C-terminal domain containing 2 potential N-linked glycosylation sites (Goodwin, R.G. et al. (1993) Cell 73:447-56; Bowman et al. (1994) Immunol 152: 1756-61). Based on these features, CD70 was determined to be a type II transmembrane protein having an extracellular C-terminal portion.
- CD70 is transiently found on activated T and B lymphocytes and dendritic cells (Hintzen et al. (1994) J. Immunol. 152: 1762- 1773; Oshima et al. (1998) Int. Immunol. 10:517-26; Tesselaar et al. (2003) J. Immunol. 170:33-40).
- CD70 expression has been reported in different types of cancers including renal cell carcinomas, metastatic breast cancers, brain tumours, leukemias, lymphomas and nasopharyngeal carcinomas (Junker et al. (2005) Urol. 173:2150-3; Sloan et al. (2004) Am J Pathol.
- CD70 represents a target for the treatment of cancer, autoimmune disorders and a variety of other diseases characterized by CD70 expression.
- WO 2006/0044643 describes CD70 antibodies containing an antibody effector domain which can mediate one or more of ADCC, ADCP, CDC or ADC and either exert a cytostatic or cytotoxic effect on a CD70-expressing cancer or exert an
- the antibodies exemplified therein are based on the antigen-binding regions of two monoclonal antibodies, denoted 1F6 and 2F2.
- WO 2007/038637 describes fully human monoclonal antibodies that bind to CD70. These antibodies are characterised by binding to human CD70 with a K D of 1x10 " M or less. The antibodies also bind to, and are internalised by, renal cell carcinoma tumor cell lines which express CD70, such as 786-0.
- CD70 antibodies which bind to the human CD70 protein and exhibit properties which are different, and generally superior, to CD70 antibodies described in the prior art.
- the superior properties of these antibodies are advantageous with regard to use in human therapy, particularly treatment of CD70-expressing cancers and also immunological disorders.
- the CD70 antibodies described herein are characterised by extremely high binding affinity for human CD70. All preferred embodiments described herein exhibit a binding affinity for recombinant human CD70 (measured by BiacoreTM surface plasmon resonance as described herein) which is significantly higher than the most potent prior art CD70 antibodies proposed for human therapy, including prior art CD70 antibodies of "fully human” origin. In addition, all preferred embodiments of the CD70 antibodies described herein exhibit superior (i.e. higher affinity) binding to CD70 expressed on the surface of human cell lines, specifically human cancer cell lines, when compared to prior art CD70 antibodies proposed for human therapy. This superior binding to cell-surface CD70 is particularly marked in regard to human cancer cell lines which express CD70 at "low copy number" and is of direct relevance to use of the antibodies in human therapy. Still further, preferred embodiments of the CD70 antibodies described herein exhibit substantially improved binding to cancer cells isolated from human patients, particularly cancer cells isolated from patients with chronic lymphocytic leukaemia (CLL), when compared to prior art CD70 antibodies proposed for human therapeutic use.
- an antibody, or an antigen binding fragment thereof which binds to human CD70, said antibody or antigen binding fragment comprising at least one heavy chain variable domain (VH) and at least one light chain variable domain (VL), wherein said VH and VL domain exhibit an off- rate (k 0ff measured by BiacoreTM) for human CD70 of less than 7 x 10 ⁇ 4 s "1 , when tested as a Fab fragment using the standard BiacoreTM protocol described herein.
- the antibody or antigen binding fragment comprises at least one heavy chain variable domain (VH) and at least one light chain variable domain (VL), wherein said VH and VL domain exhibit an off-rate for human CD70 of 5 x 10 ⁇ 4 s "1 or less, or 2 x 10 ' V 1 or less, or 1 x 10 ' V 1 or less.
- the CD70 antibody will exhibit an off-rate for CD70 in the range of from 0.4 x 10 "4 s "1 to 4.8 x 10 "4 s "1 , when tested as a Fab fragment.
- an antibody which binds to human CD70 comprising two Fab regions, wherein each of the Fab regions binds to human CD70 and exhibits an off -rate for human CD70 of 5 x 10 "4 s "1 or less, or 2 x 10 ' V 1 or less, or 1 x 10 " V 1 or less and preferably in the range of from 0.4 x 10 "4 s "1 to 4.8 x 10 "4 s "1 , when tested as a Fab fragment.
- the two Fab regions may be identical or they may differ in terms of binding properties, e.g. affinity for human CD70.
- the two Fab regions may bind to the same epitope or overlapping epitopes on human CD70 or they may bind to distinct, non- overlapping epitopes on human CD70.
- the two Fab regions may differ from one another in terms of amino acid sequence within one or both of the VH and VL domains.
- CD70 antibodies provided herein may, in addition to the extremely high binding affinity for CD70, exhibit potent blocking or inhibition of the interaction between CD70 and its ligand CD27.
- the preferred CD70 antibodies which exhibit both high affinity binding to CD70 and potent blocking of the CD70/CD27 interaction are particularly advantageous as therapeutic agents for treatment of disease indications where blocking of CD70/CD27 signalling enhances therapeutic efficacy (e.g. in addition to cell-killing mediated by the effector functions of the CD70 antibody), for example autoimmune diseases and cancers which co-express CD70 and CD27.
- CD70 antibodies described herein exhibit potent blocking of the CD70/CD27 interaction in addition to the high affinity binding to CD70. Also described herein are a number of CD70 antibodies which exhibit very high affinity binding to CD70 but do not show significant blocking of the CD70/CD27 interaction. The properties of these antibodies are described elsewhere herein. The availability of high affinity non- blocking CD70 antibodies may enhance/extend the range of therapeutic possibilities. Preferred embodiments of the CD70 antibodies described herein, exhibiting very high binding affinity for human CD70, are also characterised by a combination of binding properties which is not exhibited by prior art CD70 antibodies proposed for human therapeutic use. Accordingly, the preferred CD70 antibodies described herein are characterised by:
- CD70 antibodies The combination of binding properties exhibited by the preferred CD70 antibodies is advantageous in the context of human drug development.
- cross -reactivity with simian CD70 homologs enables toxicology studies on CD70 antibodies proposed for human therapeutic use to be carried out in primate models.
- the preferred CD70 antibodies described herein still further exhibit favourable properties which are relevant to commercial manufacture as a therapeutic antibody product.
- the preferred CD70 antibodies provided herein exhibit extremely high level expression in the recombinant expression systems utilised for commercial manufacture of clinical grade therapeutic antibody products.
- the expression levels achievable with the preferred CD70 antibodies far exceed the levels typically achieved even for "fully human” therapeutic antibody products.
- the preferred CD70 antibody products (produced by recombinant expression in a format suitable for human therapeutic use) exhibit outstanding thermal stability, which is superior to typical therapeutic antibody products.
- the CD70 antibodies provided herein with superior binding affinity for human CD70 and the other advantageous properties listed above are camelid-derived (for example llama-derived).
- the camelid-derived CD70 antibodies may be isolated or recombinantly expressed monoclonal antibodies.
- Preferred embodiments may be a humanised (or germlined) monoclonal antibody (e.g. a humanised variant of a camelid- derived antibody), a chimeric antibody (e.g. a camelid-human chimeric antibody) or a humanised chimeric antibody (e.g. a chimeric antibody comprising humanised variants of camelid VH and VL domains and constant domains of a human antibody).
- Camelid-derived CD70 antibodies may comprise at least one hypervariable loop or complementarity determining region obtained from a VH domain or a VL domain of a species in the family Camelidae.
- the CD70 antibody, or antigen binding fragment thereof may comprise a heavy chain variable domain (VH) and light chain variable domain (VL), wherein the VH and VL domains, or one or more CDRs thereof, are camelid-derived.
- the antibody or antigen binding fragment thereof may comprise llama VH and VL domains, or human germlined variants of llama VH and VL domains. This antibody, or antigen binding fragment, may exhibit "high human homology", as defined herein.
- the camelid-derived CD70 antibodies described herein typically exhibit VH and/or VL region amino acid sequences having at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) sequence identity the closest matching human antibody germline sequence.
- inventions include humanised (or human germlined) variants of the camelid-derived CD70 antibodies.
- invention provides humanised or human germlined variants of the llama-derived CD70 antibodies described herein.
- a chimeric camelid-human antibody which binds human CD70, wherein the antigen-binding portions of the antibody (e.g. VH and/or VL domains or CDRs thereof) are camelid-derived and the constant regions of the antibody are derived from a human antibody.
- the invention provides a chimeric llama-human antibody which binds human CD70.
- a humanised variant of a chimeric camelid-human antibody which binds human CD70 wherein the antigen- binding portions of the antibody (e.g. VH and/or VL domains or CDRs thereof) are humanised variants of camelid-derived sequences and the constant regions of the antibody are derived from a human antibody.
- the invention provides a humanised variant of a chimeric llama-human antibody which binds human CD70.
- Preferred (but non-limiting) embodiments of the CD70 antibodies, or antigen binding fragments thereof, are defined below by reference to specific structural characteristics, i.e.
- All of these antibodies bind to human CD70 with high affinity, exhibiting an off -rate for human CD70 of 5 x 10 "4 s “1 or less, and typically in the range of from 0.4 x 10 " 4 s “1 to 4.8 x 10 "4 s "1 , when tested as a Fab fragment.
- the invention also provides humanised/germlined variants of these antibodies, plus affinity variants and variants containing conservative amino acid substitutions, as defined herein.
- chimeric antibodies containing VH and VL domains which are camelid-derived, or human germlined variants thereof, fused to constant domains of human antibodies, in particular human IgGl, IgG2, IgG3 or IgG4.
- the heavy chain variable domains defined above can be utilised as single domain antibodies, or may be included within a conventional four-chain antibody or other antigen binding proteins, such as for example Fab, Fab', F(ab')2, bi-specific Fab's, and Fv fragments, diabodies, linear antibodies, single-chain antibody molecules, a single chain variable fragment (scFv) and multispecific antibodies.
- CD70 antibodies are antibodies, or antigen binding fragments thereof, comprising a heavy chain variable domain comprising a variable heavy chain CDR3, a variable heavy chain CDR2 and a variable heavy chain CDR1, wherein said variable heavy chain CDR3 comprises an amino acid sequence selected from the group consisting of:
- variable heavy chain CDR2 optionally comprises an amino acid sequence selected from the group consisting of: amino acid sequences of SEQ ID NO: 306
- Xi is any amino acid, preferably D, T, S or E,
- X 2 is any amino acid, preferably I,
- X 3 is any amino acid, preferably N, S, T or Y,
- X 4 is any amino acid, preferably N, M, S or T,
- X5 is any amino acid, preferably E, D, Y or H,
- X 6 is any amino acid, preferably G, D, S or N,
- X 7 is any amino acid, preferably G, Y, S, D or M,
- X 8 is any amino acid, preferably T, E, S, N, Y or R,
- X9 is any amino acid, preferably T, A or R, and
- Xio is any amino acid, preferably G or S,
- sequence variants of any one of the recited sequences wherein the sequence variant comprises one, two or three amino acid substitutions in the recited sequence;
- variable heavy chain CDR1 optionally comprises an amino acid sequence selected from the group consisting of: amino acid sequences of SEQ ID NO: 307
- Xi is any amino acid, preferably V, G or A,
- Xi is any amino acid, preferably D, T, S, N or G and
- X 2 is any amino acid, preferably Y, S or P,
- sequence variants of any one of the recited sequences wherein the sequence variant comprises one, two or three amino acid substitutions in the recited sequence.
- the heavy chain variable domain may comprise any one of the listed variable heavy chain CDR3 sequences (HCDR3) in combination with any one of the variable heavy chain CDR2 sequences (HCDR2) and any one of the variable heavy chain CDR1 sequences (HCDR1).
- HCDR3 and HCDR2 and HCDR1 are particularly preferred, these being the "native" combinations which derive from a single common VH domain. These preferred combinations are listed in Table 6 and Table 14A.
- the antibody or antigen binding fragment thereof may additionally comprise a light chain variable domain (VL), which is paired with the VH domain to form an antigen binding domain.
- VL light chain variable domain
- Preferred light chain variable domains are those comprising a variable light chain CDR3, a variable light chain CDR2 and a variable light chain CDRl, wherein said variable light chain CDR3 comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 148, SEQ ID NO: 149, SEQ ID NO: 150, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, SEQ ID NO: 154, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158, SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, SEQ ID NO: 162, SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, SEQ ID NO: 166,
- variable light chain CDR2 optionally comprises an amino acid sequence selected from the group consisting of:
- Xi is any amino acid, preferably N or S,
- X 2 is any amino acid, preferably N, S or A, and
- X 3 is any amino acid, preferably S, N or T,
- Xi is any amino acid, preferably Y, V or L,
- X 2 is any amino acid, preferably K or S,
- X 3 is any amino acid, preferably H or N, and
- X 4 is any amino acid, preferably G or S,
- Xi is any amino acid, preferably V, I or Y, and
- X 2 is any amino acid, preferably N or T,
- Xi is any amino acid, preferably Y, and
- X 2 is any amino acid, preferably R or M,
- Xi is any amino acid, preferably D or G, and X 2 is any amino acid, preferably S or I,
- sequence variants of any one of the recited sequences wherein the sequence variant comprises one, two or three amino acid substitutions in the recited sequence;
- variable light chain CDR1 optionally comprises an amino acid sequence selected from the group consisting of:
- Xi is any amino acid, preferably S or T,
- X 2 is any amino acid, preferably V or A,
- X 3 is any amino acid, preferably S or T,
- X 4 is any amino acid, preferably S, T or G,
- X5 is any amino acid, preferably N or H,
- X 6 is any amino acid, preferably G, D or E,
- Xi is any amino acid, preferably S, N or I,
- X 2 is any amino acid, preferably G or A,
- X 3 is any amino acid, preferably N or D,
- X 4 is any amino acid, preferably N or S,
- X5 is any amino acid, preferably V or I,
- X 6 is any amino acid, preferably N or S,
- Xi is any amino acid, preferably G or W,
- Xi is any amino acid, preferably S or T,
- X 2 is any amino acid, preferably E or R,
- X 3 is any amino acid, preferably R or N,
- X 4 is any amino acid, preferably G or H,
- X5 is any amino acid, preferably T or A,
- Xi is any amino acid, preferably V or L,
- X 2 is any amino acid, preferably K or T,
- X 3 is any amino acid, preferably T or D, and the amino acid sequences of SEQ ID NO:82, SEQ ID NO:87, SEQ ID NO:88, SEQ ID NO:250, SEQ ID NO:251, SEQ ID NO: 252, SEQ ID NO:253, SEQ ID NO:267 and SEQ ID NO:268 and sequence variants of any one of the recited sequences, wherein the sequence variant comprises one, two or three amino acid substitutions in the recited sequence.
- the light chain variable domain may comprise any one of the listed variable light chain CDR3 sequences (LCDR3) in combination with any one of the variable light chain CDR2 sequences (LCDR2) and any one of the variable light chain CDRl sequences (LCDRl).
- LCDR3 variable light chain CDR3 sequences
- LCDR2 variable light chain CDR2 sequences
- LCDRl variable light chain CDRl sequences
- CD70 antibody or antigen binding fragment thereof comprising a VH domain paired with a VL domain to form a binding site for CD70 antigen will comprise a combination of 6 CDRs: variable heavy chain CDR3 (HCDR3), variable heavy chain CDR2 (HCDR2), variable heavy chain CDRl (HCDR1), variable light chain CDR3
- LCDR3 variable light chain CDR2
- LCDRl variable light chain CDRl
- Preferred combinations of 6 CDRs include, but are not limited to, the
- variable heavy chain CDR3 variable heavy chain CDR2 (HCDR2), variable heavy chain CDRl (HCDR1), variable light chain CDR3 (LCDR3), variable light chain CDR2 (LCDR2) and variable light chain CDRl (LCDRl) selected from the group consisting of:
- HCDR3 comprising SEQ ID NO:50, HCDR2 comprising SEQ ID NO:27, HCDR1 comprising SEQ ID NO: 11, LCDR3 comprising SEQ ID NO: 160, LCDR2 comprising SEQ ID NO: 119, and LCDRl comprising SEQ ID NO:250;
- HCDR3 comprising SEQ ID NO:49, HCDR2 comprising SEQ ID NO:26, HCDR1 comprising SEQ ID NO: 10, LCDR3 comprising SEQ ID NO: 148, LCDR2 comprising
- HCDR3 comprising SEQ ID NO:50, HCDR2 comprising SEQ ID NO:27, HCDRl comprising SEQ ID NO: 11, LCDR3 comprising SEQ ID NO: 149, LCDR2 comprising SEQ ID NO: 110, and LCDR1 comprising SEQ ID NO:78;
- HCDR3 comprising SEQ ID NO:50, HCDR2 comprising SEQ ID NO:28, HCDRl comprising SEQ ID NO: 11, LCDR3 comprising SEQ ID NO: 150, LCDR2 comprising
- SEQ ID NO: 111 and LCDR1 comprising SEQ ID NO:79 ;
- HCDR3 comprising SEQ ID NO:50, HCDR2 comprising SEQ ID NO:28, HCDRl comprising SEQ ID NO: l l, LCDR3 comprising SEQ ID NO: 151, LCDR2 comprising SEQ ID NO: 110, and LCDR1 comprising SEQ ID NO:80;
- HCDR3 comprising SEQ ID NO:51, HCDR2 comprising SEQ ID NO:29, HCDRl comprising SEQ ID NO: 12, LCDR3 comprising SEQ ID NO: 152, LCDR2 comprising SEQ ID NO: 110, and LCDR1 comprising SEQ ID NO:80;
- HCDR3 comprising SEQ ID NO:52, HCDR2 comprising SEQ ID NO:30, HCDRl comprising SEQ ID NO: 13, LCDR3 comprising SEQ ID NO: 153, LCDR2 comprising SEQ ID NO: 112, and LCDR1 comprising SEQ ID NO:81;
- HCDR3 comprising SEQ ID NO:53, HCDR2 comprising SEQ ID NO:31, HCDRl comprising SEQ ID NO: 14, LCDR3 comprising SEQ ID NO: 154, LCDR2 comprising SEQ ID NO: 113, and LCDR1 comprising SEQ ID NO:82;
- HCDR3 comprising SEQ ID NO:54, HCDR2 comprising SEQ ID NO:32, HCDRl comprising SEQ ID NO: 15, LCDR3 comprising SEQ ID NO: 155, LCDR2 comprising
- HCDR3 comprising SEQ ID NO:55, HCDR2 comprising SEQ ID NO:33, HCDRl comprising SEQ ID NO: 16, LCDR3 comprising SEQ ID NO: 156, LCDR2 comprising SEQ ID NO: 115, and LCDR1 comprising SEQ ID NO:84;
- HCDR3 comprising SEQ ID NO:56, HCDR2 comprising SEQ ID NO:34, HCDRl comprising SEQ ID NO: 17, LCDR3 comprising SEQ ID NO: 157, LCDR2 comprising SEQ ID NO: 116, and LCDR1 comprising SEQ ID NO:85;
- HCDR3 comprising SEQ ID NO:57, HCDR2 comprising SEQ ID NO:35, HCDRl comprising SEQ ID NO: 18, LCDR3 comprising SEQ ID NO:158 , LCDR2 comprising SEQ ID NO: 117, and LCDR1 comprising SEQ ID NO: 84;
- HCDR3 comprising SEQ ID NO: 58, HCDR2 comprising SEQ ID NO: 36, HCDRl comprising SEQ ID NO: 19, LCDR3 comprising SEQ ID NO: 159, LCDR2 comprising SEQ ID NO: 118, and LCDR1 comprising SEQ ID NO: 86;
- HCDR3 comprising SEQ ID NO: 50, HCDR2 comprising SEQ ID NO: 27, HCDRl comprising SEQ ID NO: 11, LCDR3 comprising SEQ ID NO: 161, LCDR2 comprising SEQ ID NO: 120 , and LCDR1 comprising SEQ ID NO:88;
- HCDR3 comprising SEQ ID NO: 50, HCDR2 comprising SEQ ID NO: 27, HCDRl comprising SEQ ID NO: 11, LCDR3 comprising SEQ ID NO: 162, LCDR2 comprising
- HCDR3 comprising SEQ ID NO: 50, HCDR2 comprising SEQ ID NO: 27, HCDRl comprising SEQ ID NO: 11, LCDR3 comprising SEQ ID NO: 163, LCDR2 comprising SEQ ID NO: 122, and LCDR1 comprising SEQ ID NO: 90;
- HCDRl comprising SEQ ID NO: 12
- LCDR3 comprising SEQ ID NO: 164
- LCDR2 comprising SEQ ID NO: 123
- LCDR1 comprising SEQ ID NO:91;
- HCDR3 comprising SEQ ID NO: 51, HCDR2 comprising SEQ ID NO: 29, HCDRl comprising SEQ ID NO: 12, LCDR3 comprising SEQ ID NO: 164, LCDR2 comprising SEQ ID NO: 124, and LCDR1 comprising SEQ ID NO: 91;
- HCDR3 comprising SEQ ID NO: 59, HCDR2 comprising SEQ ID NO: 37, HCDRl comprising SEQ ID NO: 12, LCDR3 comprising SEQ ID NO: 165, LCDR2 comprising SEQ ID NO: 125, and LCDR1 comprising SEQ ID NO: 92;
- HCDR3 comprising SEQ ID NO: 59, HCDR2 comprising SEQ ID NO: 37, HCDRl comprising SEQ ID NO: 20, LCDR3 comprising SEQ ID NO: 165, LCDR2 comprising
- SEQ ID NO: 126 and LCDR1 comprising SEQ ID NO: 93;
- HCDR3 comprising SEQ ID NO: 59, HCDR2 comprising SEQ ID NO: 37, HCDRl comprising SEQ ID NO: 20, LCDR3 comprising SEQ ID NO: 166, LCDR2 comprising SEQ ID NO: 127, and LCDR1 comprising SEQ ID NO: 92;
- HCDR3 comprising SEQ ID NO:59
- HCDR2 comprising SEQ ID NO: 37
- HCDRl comprising SEQ ID NO: 20
- LCDR3 comprising SEQ ID NO: 167
- LCDR2 comprising SEQ ID NO: 128, and LCDR1 comprising SEQ ID NO: 94;
- HCDR3 comprising SEQ ID NO: 59, HCDR2 comprising SEQ ID NO: 37, HCDRl comprising SEQ ID NO: 20, LCDR3 comprising SEQ ID NO: 168, LCDR2 comprising SEQ ID NO: 110, and LCDR1 comprising SEQ ID NO: 95;
- HCDR3 comprising SEQ ID NO: 262, HCDR2 comprising SEQ ID NO: 258, HCDRl comprising SEQ ID NO: 256, LCDR3 comprising SEQ ID NO: 271, LCDR2 comprising SEQ ID NO: 110, and LCDR1 comprising SEQ ID NO: 267;
- HCDR3 comprising SEQ ID NO: 263, HCDR2 comprising SEQ ID NO: 259, HCDR1 comprising SEQ ID NO: 257, LCDR3 comprising SEQ ID NO: 273, LCDR2 comprising SEQ ID NO: 270, and LCDR1 comprising SEQ ID NO: 268.
- CD70 antibodies exhibiting high affinity binding to human CD70, include isolated antibodies or antigen binding fragments thereof, comprising a heavy chain variable domain having an amino acid sequence selected from the group consisting of: the amino acid sequences of SEQ ID NO: 177, SEQ ID NO: 178, SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, SEQ ID NO: 182, SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, SEQ ID NO: 186, SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO:212, SEQ ID NO:213, SEQ ID NO:214, SEQ ID NO:215, SEQ ID NO:216, SEQ ID NO:217, SEQ ID NO:218, SEQ ID NO:219, SEQ ID NO:220, SEQ ID NO:221, SEQ ID NO:222, SEQ ID NO:223, SEQ ID NO:224, SEQ ID NO:225, SEQ ID NO:22
- VH domains and VL domains selected from the VH and VL domain sequence groups listed above are permissible, and within the scope of the invention, certain combinations VH and VL are particularly preferred; these being the "native" combinations within a single Fab exhibiting high affinity binding to human CD70.
- preferred CD70 antibodies, or antigen binding fragments thereof, exhibiting high affinity CD70 binding are those comprising a combination of a heavy chain variable domain (VH) and a light chain variable domain (VL), wherein the combination is selected from the group consisting of:
- VH/VL combinations listed above, it is also permissible, and within the scope of the invention, to combine a VH domain having an amino acid sequence at least 90%, 92%, 95%, 97% or 99% identical to the recited VH domain sequence with a VL domain having an amino acid sequence at least 90%, 92%, 95%, 97% or 99% identical to the recited VL domain sequence.
- antibodies/antigen binding fragments is defined on the basis of % sequence identity with a recited reference sequence (with a given SEQ ID NO).
- % sequence identity between two amino acid sequences may be determined by comparing these two sequences aligned in an optimum manner and in which the amino acid sequence to be compared can comprise additions or deletions with respect to the reference sequence for an optimum alignment between these two sequences.
- the percentage of identity is calculated by determining the number of identical positions for which the amino acid residue is identical between the two sequences, by dividing this number of identical positions by the total number of positions in the comparison window and by multiplying the result obtained by 100 in order to obtain the percentage of identity between these two sequences.
- the comparison window with correspond to the full length of the sequence being compared.
- BLAST 2 sequences (Tatusova et al, "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS Microbiol Lett. 174:247-250) available on the site http://www.ncbi.nlm.nih.gov/ gorf/bl2.html, the parameters used being those given by default (in particular for the parameters "open gap penalty”: 5, and “extension gap penalty”: 2; the matrix chosen being, for example, the matrix "BLOSUM 62" proposed by the program), the percentage of identity between the two sequences to be compared being calculated directly by the program.
- CD70 antibodies provided herein which exhibit a particularly advantageous combination of properties, including extremely high affinity binding to human CD70, are those based on the antigen-binding portion of the llama-derived Fab denoted 27B3 in the accompanying examples, plus human germlined variants of 27B3, including the germlined variants identified in the accompanying examples.
- CD70-associated diseases specifically CD70-expressing cancers and immunological disorders.
- preferred embodiments of the CD70 antibody, or antigen binding fragments thereof are those comprising a heavy chain variable domain wherein the variable heavy chain CDR3 comprises or consists of the amino acid sequence of SEQ ID NO:50 or a sequence variant thereof, wherein the sequence variant comprises one, two or three amino acid substitutions in the recited sequence.
- antibodies or antigen binding fragments thereof which include the same combination of heavy chain CDRs as 27B3, or human germlined variants of 27B3. Accordingly, the antibody or antigen binding fragment thereof, may comprise a heavy chain variable domain wherein
- variable heavy chain CDR3 comprises or consists of the amino acid sequence of SEQ ID NO:50 or a sequence variant thereof;
- variable heavy chain CDR2 comprises or consists of an amino acid sequence selected from the group consisting of: SEQ ID NO:27, SEQ ID NO:249 and sequence variants thereof;
- variable heavy chain CDR1 comprises or consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 11, SEQ ID NO:248 and sequence variants thereof, wherein the sequence variants comprise one, two or three amino acid substitutions (e.g., conservative substitutions, humanising substitutions or affinity variants) in the recited sequence.
- the antigen or antigen binding fragment thereof may comprise a heavy chain variable domain wherein the combination of HCDR3, HCDR2 and HCDR1 is selected from the following:
- variable heavy chain CDR3 comprises or consists of SEQ ID NO:50
- variable heavy chain CDR2 comprises or consists of SEQ ID NO:27
- variable heavy chain CDR1 comprises or consists of SEQ ID NO: 11
- sequence variants comprises one, two or three amino acid
- substitutions e.g., conservative substitutions, humanising substitutions or affinity variants
- variable heavy chain CDR3 comprises or consists of SEQ ID NO:50
- variable heavy chain CDR2 comprises or consists of SEQ ID NO:249
- variable heavy chain CDR1 comprises or consists of SEQ ID NO: 11
- sequence variants comprises one, two or three amino acid
- substitutions e.g., conservative substitutions, humanising substitutions or affinity variants
- variable heavy chain CDR3 comprises or consists of SEQ ID NO:50
- variable heavy chain CDR2 comprises or consists of SEQ ID NO:27
- variable heavy chain CDR1 comprises or consists of SEQ ID NO:248
- sequence variants comprises one, two or three amino acid
- substitutions e.g., conservative substitutions, humanising substitutions or affinity variants
- the antibody or antigen binding fragment thereof also includes a light chain variable domain (VL), paired with the heavy chain variable domain,
- VL light chain variable domain
- the variable light chain CDR3 comprises or consists of SEQ ID NO: 160 or a sequence variant thereof;
- variable light chain CDR2 comprises or consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 119, SEQ ID NO: 110 and sequence variants of the recited sequences; and
- variable light chain CDR1 comprises or consists of an amino acid sequence selected from the group consisting of: SEQ ID NO:87, SEQ ID NO:250, SEQ ID
- sequence variants comprise one, two or three amino acid substitutions (e.g., conservative substitutions, humanising substitutions or affinity variants) in the recited sequences.
- the antigen or antigen binding fragment thereof may comprise a light chain variable domain wherein the combination of LCDR3, LCDR2 and LCDRl is selected from the following:
- variable light chain CDR3 comprises or consists of SEQ ID NO: 160
- AFISNPSVE or a sequence variant thereof
- variable light chain CDR2 comprises or consists of SEQ ID NO: 119
- NNTRHS N-(NTNTRHS) or a sequence variant thereof
- variable light chain CDR1 comprises or consists of SEQ ID NO:250
- sequence variants comprises one, two or three amino acid
- substitutions e.g., conservative substitutions, humanising substitutions or affinity variants
- variable light chain CDR3 comprises or consists of SEQ ID NO: 160
- AFISNPSVE or a sequence variant thereof
- variable light chain CDR2 comprises or consists of SEQ ID NO: 119
- NNTRHS N-(NTNTRHS) or a sequence variant thereof
- variable light chain CDR1 comprises or consists of SEQ ID NO:87
- sequence variants comprises one, two or three amino acid
- substitutions e.g., conservative substitutions, humanising substitutions or affinity variants
- the most preferred embodiment of the CD70 antibody or antigen binding fragment thereof comprises a heavy chain variable domain (VH) and a light chain variable domain (VL) wherein the combination of 6 CDRs which forms the binding site for human CD70 is as follows:
- variable heavy chain CDR3 comprises or consists of SEQ ID NO:50
- variable heavy chain CDR2 comprises or consists of SEQ ID NO:27
- variable heavy chain CDR1 comprises or consists of SEQ ID NO: 11
- variable light chain CDR3 comprises or consists of SEQ ID NO: 160
- AFISNPSVE or a sequence variant thereof
- variable light chain CDR2 comprises or consists of SEQ ID NO: 119
- NNTRHS N-(NTNTRHS) or a sequence variant thereof
- variable light chain CDR1 comprises or consists of SEQ ID NO:250
- sequence variants comprises one, two or three amino acid
- substitutions e.g., conservative substitutions, humanising substitutions or affinity variants
- the antibody preferably includes the CHI domain, hinge region, CH2 domain and CH3 domain of a human antibody, in particular human IgGl, IgG2, IgG3 or IgG4.
- human IgGl in particular human IgGl, IgG2, IgG3 or IgG4.
- the most preferred embodiment is a human IgGl.
- the human IgGl it is still further preferred for the human IgGl to be engineering to maximise effector function in one or more of antibody-dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC) or antibody- dependent cellular phagocytosis (ADCP).
- ADCC antibody-dependent cellular cytotoxicity
- CDC complement-dependent cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- a non-fucosylated human IgGl e.g. a non-fucosylated IgGl produced using the PotelligentTM technology of BioWa Inc.
- CD70 antibodies exhibiting high affinity binding to human CD70, based on the Fab denoted 27B3 and human germlined variants of 27B3, include isolated antibodies or antigen binding fragments thereof, comprising a heavy chain variable domain having an amino acid sequence selected from the group consisting of: the amino acid sequences of SEQ ID NO: 178, SEQ ID NO:212, SEQ ID NO:213, SEQ ID NO:214, SEQ ID NO:215, SEQ ID NO:216, SEQ ID NO:217, SEQ ID NO:218, SEQ ID NO:219, SEQ ID NO:220, SEQ ID NO:221, SEQ ID NO:222, SEQ ID NO:223, SEQ ID NO:224, SEQ ID NO:225, SEQ ID NO:226, SEQ ID NO:227, SEQ ID NO:228, SEQ ID NO:229, SEQ ID NO:274 and SEQ ID NO:275 and amino acid sequences exhibiting at least 90%, 95%, 97%, 98% or 99% sequence identity
- VH and VL domain sequence groups listed above are permissible, and within the scope of the invention, certain combinations VH and VL are particularly preferred; these being the "native" combinations within a single Fab exhibiting high affinity binding to human CD70.
- preferred CD70 antibodies, or antigen binding fragments thereof, exhibiting high affinity CD70 binding are those comprising a combination of a heavy chain variable domain and a light chain variable domain, wherein the combination is selected from the group consisting of:
- a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:214 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO:232;
- a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:215 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO:235;
- VH/VL combinations listed above, it is also permissible, and within the scope of the invention, to combine a VH domain having an amino acid sequence at least 90%, 92%, 95%, 97% or 99% identical to the recited VH domain sequence with a VL domain having an amino acid sequence at least 90%, 92%, 95%, 97% or 99% identical to the recited VL domain sequence.
- the most preferred embodiment is a CD70 antibody or antigen binding fragment thereof based on the native VH/VL combination of the human germlined variant denoted 4 ID 12. Accordingly, there is also provided herein an antibody or antigen binding fragment thereof comprising a heavy chain variable domain (VH) comprising or consisting of an amino acid sequence selected from the group consisting of: the amino acid sequence shown as SEQ ID NO:223, germlined variants and affinity variants thereof and amino acid sequences at least 90%, 95%, 97%, 98% or 99% identical thereto, and a light chain variable domain (VL) comprising or consisting of an amino acid sequence selected from the group consisting of: the amino acid sequence shown as SEQ ID
- VH heavy chain variable domain
- VL light chain variable domain
- amino acid sequence of the VH domain exhibits less than 100% sequence identity with the sequence shown as SEQ ID NO: 223 may nevertheless comprise heavy chain CDRs which are identical to HCDR1, HCDR2 and HCDR3 of SEQ ID NO:223 (SEQ ID NOs: l l, 27 and 50, respectively) whilst exhibiting amino acid sequence variation within the framework regions.
- amino acid sequence of the VL domain exhibits less than 100% sequence identity with the sequence shown as SEQ ID NO: 241 may nevertheless comprise heavy chain CDRs which are identical to LCDR1, LCDR2 and LCDR3 of SEQ ID NO:241 (SEQ ID NOs:250, 116 and 160, respectively) whilst exhibiting amino acid sequence variation within the framework regions.
- the antibody preferably includes the CHI domain, hinge region, CH2 domain and CH3 domain of a human antibody, in particular human IgGl, IgG2, IgG3 or IgG4.
- human IgGl in particular human IgGl, IgG2, IgG3 or IgG4.
- the most preferred embodiment is a human IgGl. It is still further preferred for the human IgGl to be engineering to maximise effector function in one or more of ADCC, CDC or ADCP.
- Particularly preferred is a de-fucosylated human IgGl, preferably prepared using the PotelligentTM expression system.
- Another advantageous embodiment is an antibody or antigen binding fragment thereof comprising a heavy chain variable domain (VH) comprising or consisting of an amino acid sequence selected from the group consisting of: the amino acid sequence shown as SEQ ID NO:225, germlined variants and affinity variants thereof and amino acid sequences at least 90%, 95%, 97%, 98% or 99% identical thereto, and a light chain variable domain (VL) comprising or consisting of an amino acid sequence selected from the group consisting of: the amino acid sequence shown as SEQ ID NO:243, germlined variants and affinity variants thereof and amino acid sequences at least 90%, 95%, 97%, 98% or 99% identical thereto; or
- Another advantageous embodiment is an antibody or antigen binding fragment thereof comprising a heavy chain variable domain (VH) comprising or consisting of an amino acid sequence selected from the group consisting of: the amino acid sequence shown as SEQ ID NO:226, germlined variants and affinity variants thereof and amino acid sequences at least 90%, 95%, 97%, 98% or 99% identical thereto, and a light chain variable domain (VL) comprising or consisting of an amino acid sequence selected from the group consisting of: the amino acid sequence shown as SEQ ID NO:244, germlined variants and affinity variants thereof and amino acid sequences at least 90%, 95%, 97%, 98% or 99% identical thereto.
- VH heavy chain variable domain
- VL light chain variable domain
- the CD70 antibodies, or antigen binding fragments thereof may each exhibit one or more, or any combination, of the following properties or features:
- the antibody or antigen binding fragment may bind to human CD70 with high affinity, exhibiting an off-rate for human CD70 of 7 x 10 "4 s “1 or less, preferably 5 x 10 "4 s “1 or less, and typically in the range of from 0.4 x 10 "4 s “1 to 4.8 x 10 "4 s "1 , when tested as a Fab fragment.
- the antibody or antigen binding fragment may bind to human CD70 with high affinity and inhibit the interaction between CD70 and CD27.
- the antibody or antigen binding fragment may bind to human CD70 but not inhibit the interaction between CD70 and CD27.
- the antibody or antigen binding fragment may bind with high affinity to human CD70 on the surface of CD70-expressing cells.
- the antibody or antigen binding fragment may bind to human CD70 on the surface of CD70-expressing cells and be slowly or only partially internalised.
- a key aspect of the invention is the observation that the CD70 antibodies are in fact very poorly internalised on a large number of CD70-expressing cell-lines, including many CD70- expressing cancer cell lines. This observation is in direct contrast to previous published reports that CD70 antibodies are rapidly internalised following binding to renal cell carcinoma cell lines (see Adam et ah , British Journal of Cancer (2006) 95: 298-306; and WO 2007/038637) and has direct implications for therapeutic use of the antibodies.
- CD70 antibodies are very poorly internalised following binding to cancer cells strongly supports the conclusion that therapeutic strategies for treatment of many CD70-expressing cancers, and indeed CD70-associated immunological diseases, should be based on extreme high affinity binding to CD70, coupled with antibody effector function, in particular any one or more of ADCC, CDC or ADCP, and not on the use of immunoconjugates in which the CD70 antibody is linked to a therapeutic agent, e.g. a cytotoxic or cytostatic drug moiety.
- the antibody or antigen binding fragment may bind within the amino acid sequence HIQVTLAICSS (SEQ ID NO:342) in human CD70;
- the antibody or antigen binding fragment may exhibit cross-reactivity with CD70 of simian origin, specifically the CD70 homologs of rhesus macaque (Macaco, mulatto) and cynomolgus monkey (Macaco cynomolgus).
- the antibody or antigen binding fragment may bind to both native human CD70 (e.g. CD70 expressed on the surface of a cell, such as a cell line or a CD70-expressing cell isolated from a human patient) and heat denatured recombinant human CD70.
- native human CD70 e.g. CD70 expressed on the surface of a cell, such as a cell line or a CD70-expressing cell isolated from a human patient
- heat denatured recombinant human CD70 bind to both native human CD70 (e.g. CD70 expressed on the surface of a cell, such as a cell line or a CD70-expressing cell isolated from a human patient) and heat denatured recombinant human CD70.
- the antibody or antigen binding fragment may provide very high production yields (>4g/L) in recombinant antibody expression systems, such as for example the CHK1SV cell line (proprietary to BioWa/Lonza), as compared to a l-2g/L historical average for therapeutic antibody products, resulting in a substantial reduction in production costs.
- CHK1SV cell line proprietary to BioWa/Lonza
- the antibody or antigen binding fragment may be highly stable under 37°C storage conditions and in freeze-thaw cycles, which is also a major cost reduction factor.
- the antibody may exhibit one or more effector functions selected from antibody-dependent cell-mediated cytotoxicity (ADCC), complement dependent cytotoxicity (CDC) and antibody-dependent cell-mediated phagocytosis (ADCP) against cells expressing human CD70 protein on the cell surface.
- ADCC antibody-dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- ADCP antibody-dependent cell-mediated phagocytosis
- the antibody may exhibit ADCC against CD70-expressing cells, e.g. cancer cells or other malignant cells, or immune cells.
- the antibody may exhibit enhanced ADCC function in comparison to a reference antibody which is an equivalent antibody comprising a native human Fc domain.
- the ADCC function may be at least lOx enhanced in comparison to the reference antibody comprising a native human Fc domain.
- “equivalent” may be taken to mean that the antibody with enhanced ADCC function displays substantially identical antigen-binding specificity and/or shares identical amino acid sequence with the reference antibody, except for any modifications made (relative to native human Fc) for the purposes of enhancing ADCC .
- the antibody or antigen binding fragment may inhibit tumour growth in an in vivo tumour xenograft model, in the absence of conjugation to a cytotoxic or cytostatic agent.
- the inhibition of tumour growth function may be at least 10 fold enhanced in comparison to the reference antibody SGN70 .
- the antibody or antigen binding fragment may induce apoptosis of CD70- expressing cells.
- the antibody may contain the hinge region, CH2 domain and CH3 domain of a human IgG, most preferably human IgGl, IgG2, IgG3 or IgG4.
- the antibody may include modifications in the Fc region, such as modifications which enhance antibody effector function as explained elsewhere herein.
- the antibody may be a non-fucosylated IgG.
- the invention also provides polynucleotide molecules which encode the above-listed CD70 antibodies and antigen binding fragments thereof, in addition to expression vectors comprising the polynucleotides, host cells containing the vectors and methods of recombinant expression/production of the CD70 antibodies.
- the invention provides a pharmaceutical composition comprising any one of the CD70 antibodies described above and a pharmaceutically acceptable carrier or excipient.
- a still further aspect of the invention concerns methods of medical treatment using the above-listed CD70 antibodies, particularly in the treatment of cancer.
- Figure 1 Shows the immune response tested in ELISA on recombinant CD70 for llamas immunised with 786-0 cells (top) and with Raji cells (bottom).
- Figure 2 illustrates inhibition of binding of CD27 to CD70 by llama-derived CD70 Fabs and reference CD70 Fabs, measured by ELISA.
- Figure 3 is a graphical representation of the signal for llama-derived Fabs tested in a binding Elisa (black) or in an inhibition Elisa (white).
- Figure 4 illustrates inhibition of binding of CD27 to human CD70 (A&B) or rhesus CD70 (C) by chimeric llama-human CD70 mAbs and reference CD70 mAbs measured by ELISA.
- Figure 5 shows binding of chimeric llama-human CD70 mAbs to 786-0 cells (A) or MHH-PREB-1 cells (B) as demonstrated by FACS analysis.
- Figure 6 shows inhibition by CD70 specific chimeric llama-human mAbs in a Raji cell based co-culture potency assay.
- Figure 7 shows the results of standard Cr 51 release ADCC assay on 786-0 cells.
- Figure 8 shows the results of CDC assay on U266 cells in the presence of 9% human serum.
- Figure 9 demonstrates the efficacy of chimeric llama-human CD70 mAbs in a ADCP assay on 786-0 cells
- Figure 10 illustrates antibody internalisation, assessed as MFI OUT for different chimeric llama-human CD70 mAbs as a function of time on 786-0 cells in two independent experiments.
- Figure 11 demonstrates survival of mice in a Raji Xenograft model after treatment with chimeric llama-human CD70 mAb 4 ID 12, isotype control and Fc-dead control.
- Figure 12 depicts alignments of the VH and VL amino acid sequences of clone 27B3 with the amino acid sequences of human germline gene segments VH3-38 and VL8-61, respectively.
- Figure 13 shows gelfiltration analysis of samples of germlined 27B3 mAb variants taken after 5 weeks incubation at 37 °C.
- Figure 14 shows the potency in CD70 binding, as measured using Biacore, of samples of germlined CD70 mAbs taken at various time points after incubation at various temperatures.
- Figure 15 shows the binding affinity of CD70 mAbs for CD70-expressing cancer cell lines.
- Figure 16 shows the affinity of CD70 mAbs for CLL patient cells expressing CD70.
- Figure 17 shows lysis of SU-DHL-6 cells bound by CD70 mAbs.
- Figure 18 shows inhibition of binding of CD27 to CD70 by CD70 mAbs, measured by ELISA.
- Figure 19 shows an alignment of CD70 sequences from different species.
- Figure 20 shows the binding affinity of CD70 mAbs for human U266 cells, rhesus monkey LCL8864 cells and cynomologus monkey HSC-F cells.
- Figure 21 shows inhibition of binding of CD27 to CD70 of human, rhesus monkey and cynomologus monkey by CD70 mAbs as determined by ELISA.
- Figure 22 shows binding of CD70 mAbs to denatured recombinant CD70, assessed by ELISA.
- Figure 23 shows CD70 chimeric sequences used for epitope mapping.
- Figure 24 illustrates antibody internalisation for CD70 mAbs as a function of time on 786-0 cells.
- Antibody or “Immunoglobulin”— As used herein, the term “immunoglobulin” includes a polypeptide having a combination of two heavy and two light chains whether or not it possesses any relevant specific immunoreactivity. “Antibodies” refers to such assemblies which have significant known specific immunoreactive activity to an antigen of interest (e.g. human CD70). The term “CD70 antibodies” is used herein to refer to antibodies which exhibit immunological specificity for human CD70 protein. As explained elsewhere herein, “specificity” for human CD70 does not exclude cross- reaction with species homologues of CD70. Antibodies and immunoglobulins comprise light and heavy chains, with or without an interchain covalent linkage between them. Basic immunoglobulin structures in vertebrate systems are relatively well understood.
- immunoglobulin comprises five distinct classes of antibody that can be distinguished biochemically. All five classes of antibodies are within the scope of the present invention, the following discussion will generally be directed to the IgG class of immunoglobulin molecules.
- immunoglobulins comprise two identical light polypeptide chains of molecular weight approximately 23,000 Daltons, and two identical heavy chains of molecular weight 53,000-70,000. The four chains are joined by disulfide bonds in a "Y" configuration wherein the light chains bracket the heavy chains starting at the mouth of the "Y” and continuing through the variable region.
- the light chains of an antibody are classified as either kappa or lambda ( ⁇ , ⁇ ) .
- Each heavy chain class may be bound with either a kappa or lambda light chain.
- the light and heavy chains are covalently bonded to each other, and the "tail" portions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are generated either by hybridomas, B cells or genetically engineered host cells.
- the amino acid sequences run from an N-terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain.
- heavy chains are classified as gamma, mu, alpha, delta, or epsilon, ( ⁇ , ⁇ , , ⁇ , ⁇ ) with some subclasses among them (e.g., ⁇ - ⁇ 4). It is the nature of this chain that determines the "class" of the antibody as IgG, IgM, IgA, IgD or IgE, respectively.
- the immunoglobulin subclasses e.g., IgGl, IgG2, IgG3, IgG4, IgAl, etc. are well characterized and are known to confer functional specialization. Modified versions of each of these classes and isotypes are readily discernable to the skilled artisan in view of the instant disclosure and, accordingly, are within the scope of the instant invention.
- variable region of an antibody allows the antibody to selectively recognize and specifically bind epitopes on antigens. That is, the VL domain and VH domain of an antibody combine to form the variable region that defines a three dimensional antigen binding site.
- This quaternary antibody structure forms the antigen binding site present at the end of each arm of the Y. More specifically, the antigen binding site is defined by three complementary determining regions (CDRs) on each of the VH and VL chains.
- CDRs complementary determining regions
- CD70 protein or “CD70 antigen”— As used herein, the terms “CD70 protein” or “CD70 antigen” or “CD70” are used interchangeably and refer to a member of the TNF ligand family which is a ligand for TNFRS F27/CD27.
- the terms “human CD70 protein” or “human CD70 antigen” or “human CD70” are used interchangeably to refer specifically to the human homolog, including the native human CD70 protein naturally expressed in the human body and/or on the surface of cultured human cell lines, as well as recombinant forms and fragments thereof. Specific examples of human CD70 include the polypeptide having the amino acid sequence shown under NCBI Reference Sequence Accession No. NP_001243, or the extracellular domain thereof.
- Binding Site comprises a region of a polypeptide which is responsible for selectively binding to a target antigen of interest (e.g. human CD70). Binding domains comprise at least one binding site. Exemplary binding domains include an antibody variable domain.
- the antibody molecules of the invention may comprise a single binding site or multiple (e.g., two, three or four) binding sites.
- the term "derived from” a designated protein refers to the origin of the polypeptide.
- the polypeptide or amino acid sequence which is derived from a particular starting polypeptide is a CDR sequence or sequence related thereto.
- the amino acid sequence which is derived from a particular starting polypeptide is not contiguous. For example, in one embodiment, one, two, three, four, five, or six CDRs are derived from a starting antibody.
- the polypeptide or amino acid sequence which is derived from a particular starting polypeptide or amino acid sequence has an amino acid sequence that is essentially identical to that of the starting sequence, or a portion thereof wherein the portion consists of at least of at least 3-5 amino acids, 5-10 amino acids, at least 10-20 amino acids, at least 20-30 amino acids, or at least 30-50 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the starting sequence.
- the one or more CDR sequences derived from the starting antibody are altered to produce variant CDR sequences, e.g. affinity variants, wherein the variant CDR sequences maintain CD70 binding activity.
- the CD70 antibody molecules of the invention comprise framework amino acid sequences and/or CDR amino acid sequences derived from a camelid conventional antibody raised by active immunisation of a camelid with CD70 antigen.
- CD70 antibodies comprising camelid-derived amino acid sequences may be engineered to comprise framework and/or constant region sequences derived from a human amino acid sequence (i.e. a human antibody) or other non-camelid mammalian species.
- a human or non-human primate framework region, heavy chain portion, and/or hinge portion may be included in the subject CD70 antibodies.
- one or more non-camelid amino acids may be present in the framework region of a "camelid-derived" CD70 antibody, e.g., a camelid framework amino acid sequence may comprise one or more amino acid mutations in which the corresponding human or non-human primate amino acid residue is present.
- camelid-derived VH and VL domains, or humanised variants thereof may be linked to the constant domains of human antibodies to produce a chimeric molecule, as extensively described elsewhere herein.
- Constant amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta- branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g.,
- a nonessential amino acid residue in an immunoglobulin polypeptide may be replaced with another amino acid residue from the same side chain family.
- a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
- "Heavy chain portion" As used herein, the term “heavy chain portion” includes amino acid sequences derived from the constant domains of an immunoglobulin heavy chain.
- a polypeptide comprising a heavy chain portion comprises at least one of: a CHI domain, a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant or fragment thereof.
- an antibody or antigen binding fragment of the invention may comprise the Fc portion of an immunoglobulin heavy chain.
- an antibody or antigen binding fragment of the invention may lack at least a portion of a constant domain (e.g., all or part of a CH2 domain).
- at least one, and preferably all, of the constant domains are derived from a human immunoglobulin heavy chain.
- the heavy chain portion comprises a fully human hinge domain.
- the heavy chain portion comprising a fully human Fc portion (e.g., hinge, CH2 and CH3 domain sequences from a human immunoglobulin).
- the constituent constant domains of the heavy chain portion are from different immunoglobulin molecules.
- a heavy chain portion of a polypeptide may comprise a CH2 domain derived from an IgGl molecule and a hinge region derived from an IgG3 or IgG4 molecule.
- the constant domains are chimeric domains comprising portions of different immunoglobulin molecules.
- a hinge may comprise a first portion from an IgGl molecule and a second portion from an IgG3 or IgG4 molecule.
- the constant domains of the heavy chain portion may be modified such that they vary in amino acid sequence from the naturally occurring (wild-type) immunoglobulin molecule. That is, the polypeptides of the invention disclosed herein may comprise alterations or modifications to one or more of the heavy chain constant domains (CHI, hinge, CH2 or CH3) and/or to the light chain constant region domain (CL). Exemplary modifications include additions, deletions or substitutions of one or more amino acids in one or more domains.
- chimeric protein comprises a first amino acid sequence linked to a second amino acid sequence with which it is not naturally linked in nature.
- the amino acid sequences may normally exist in separate proteins that are brought together in the fusion polypeptide or they may normally exist in the same protein but are placed in a new arrangement in the fusion polypeptide.
- a chimeric protein may be created, for example, by chemical synthesis, or by creating and translating a polynucleotide in which the peptide regions are encoded in the desired relationship.
- Exemplary chimeric CD70 antibodies include fusion proteins comprising camelid-derived VH and VL domains, or humanised variants thereof, fused to the constant domains of a human antibody, e.g. human IgGl, IgG2, IgG3 or IgG4.
- variable region or “variable domain” — The terms “variable region” and “variable domain” are used herein interchangeable and are intended to have equivalent meaning.
- variable refers to the fact that certain portions of the variable domains VH and VL differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its target antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called “hypervariable loops" in each of the VL domain and the VH domain which form part of the antigen binding site.
- the first, second and third hypervariable loops of the VLambda light chain domain are referred to herein as hl ), L2 ) and L3 ) and may be defined as comprising residues 24-33 Ll(k), consisting of 9, 10 or 11 amino acid residues), 49-53 L2 ), consisting of 3 residues) and 90-96 (L3( ), consisting of 5 residues) in the VL domain (Morea et al., Methods 20:267-279 (2000)).
- the first, second and third hypervariable loops of the VKappa light chain domain are referred to herein as L1(K), L2(K) and L3(K) and may be defined as comprising residues 25-33 (L1(K), consisting of 6, 7, 8, 11, 12 or 13 residues), 49-53 (L2(K), consisting of 3 residues) and 90-97 (L3(K), consisting of 6 residues) in the VL domain (Morea et al., Methods 20:267-279 (2000)).
- the first, second and third hypervariable loops of the VH domain are referred to herein as HI, H2 and H3 and may be defined as comprising residues 25-33 (HI, consisting of 7, 8 or 9 residues), 52-56 (H2, consisting of 3 or 4 residues) and 91-105 (H3, highly variable in length) in the VH domain (Morea et al., Methods 20:267-279 (2000)).
- LI, L2 and L3 respectively refer to the first, second and third hypervariable loops of a VL domain, and encompass hypervariable loops obtained from both Vkappa and Vlambda isotypes.
- HI, H2 and H3 respectively refer to the first, second and third hypervariable loops of the VH domain, and encompass hypervariable loops obtained from any of the known heavy chain isotypes, including ⁇ , ⁇ , ⁇ , a or ⁇ .
- the hypervariable loops LI, L2, L3, HI, H2 and H3 may each comprise part of a "complementarity determining region" or "CDR", as defined below.
- CDR complementarity determining region
- hypervariable loop and CDRs are not strictly synonymous, since the hypervariable loops (HVs) are defined on the basis of structure, whereas complementarity determining regions (CDRs) are defined based on sequence variability (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD., 1983) and the limits of the HVs and the CDRs may be different in some VH and VL domains.
- the CDRs of the VL and VH domains can typically be defined as comprising the following amino acids: residues 24-34 (CDRL1), 50-56 (CDRL2) and 89-97 (CDRL3) in the light chain variable domain, and residues 31-35 or 31-35b (CDRHl), 50-65 (CDRH2) and 95-102 (CDRH3) in the heavy chain variable domain; (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).
- the HVs may be comprised within the following amino acids: residues 24-34 (CDRL1), 50-56 (CDRL2) and 89-97 (CDRL3) in the light chain variable domain, and residues 31-35 or 31-35b (CDRHl), 50-65 (CDRH2) and 95-102 (CDRH3) in the heavy chain variable domain; (Kabat et al., Sequences of Proteins of Immunological Interest
- variable domains The more highly conserved portions of variable domains are called the framework region (FR), as defined below.
- the variable domains of native heavy and light chains each comprise four FRs (FR1, FR2, FR3 and FR4, respectively), largely adopting a ⁇ - sheet configuration, connected by the three hypervariable loops.
- the hypervariable loops in each chain are held together in close proximity by the FRs and, with the hypervariable loops from the other chain, contribute to the formation of the antigen-binding site of antibodies.
- Structural analysis of antibodies revealed the relationship between the sequence and the shape of the binding site formed by the complementarity determining regions (Chothia et al., J. Mol. Biol.
- CDR complementarity determining region
- CDR complementary antigen combining sites found within the variable region of both heavy and light chain polypeptides. These particular regions have been described by Kabat et al., J. Biol. Chem. 252, 6609-6616 (1977) and Kabat et al., Sequences of protein of immunological interest. (1991), and by Chothia et al., J. Mol. Biol. 196:901-917 (1987) and by MacCallum et al., J. Mol. Biol. 262:732-745 (1996) where the definitions include overlapping or subsets of amino acid residues when compared against each other. The amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth for comparison.
- the term "CDR” is a CDR as defined by Kabat based on sequence comparisons.
- Residue numbering follows the nomenclature of Kabat et al., supra
- Residue numbering follows the nomenclature of MacCallum et al., supra
- Framework region includes the amino acid residues that are part of the variable region, but are not part of the CDRs (e.g., using the Kabat definition of CDRs). Therefore, a variable region framework is between about 100-120 amino acids in length but includes only those amino acids outside of the CDRs.
- the framework regions for the light chain are similarly separated by each of the light claim variable region CDRs.
- the framework region boundaries are separated by the respective CDR termini as described above.
- the CDRs are as defined by Kabat.
- the six CDRs present on each monomeric antibody are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen binding site as the antibody assumes its three dimensional configuration in an aqueous environment.
- the remainder of the heavy and light variable domains show less inter- molecular variability in amino acid sequence and are termed the framework regions.
- the framework regions largely adopt a ⁇ -sheet conformation and the CDRs form loops which connect, and in some cases form part of, the ⁇ -sheet structure. Thus, these framework regions act to form a scaffold that provides for positioning the six CDRs in correct orientation by inter-chain, non-covalent interactions.
- the antigen binding site formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non- covalent binding of the antibody to the immunoreactive antigen epitope.
- the position of CDRs can be readily identified by one of ordinary skill in the art.
- "Hinge region” As used herein, the term “hinge region” includes the portion of a heavy chain molecule that joins the CHI domain to the CH2 domain. This hinge region comprises approximately 25 residues and is flexible, thus allowing the two N-terminal antigen binding regions to move independently. Hinge regions can be subdivided into three distinct domains: upper, middle, and lower hinge domains (Roux et al. J. Immunol. 1998 161:4083).
- CD70 antibodies comprising a "fully human” hinge region may contain one of the hinge region sequences shown in Table 2 below. Table 2: human hinge sequences
- CH2 domain includes the portion of a heavy chain molecule that extends, e.g., from about residue 244 to residue 360 of an antibody using conventional numbering schemes (residues 244 to 360, Kabat numbering system; and residues 231-340, EU numbering system, Kabat EA et al. Sequences of Proteins of Immunological Interest. Bethesda, US Department of Health and Human Services, NIH. 1991).
- the CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. It is also well documented that the CH3 domain extends from the CH2 domain to the C-terminal of the IgG molecule and comprises approximately 108 residues.
- fragment refers to a part or portion of an antibody or antibody chain comprising fewer amino acid residues than an intact or complete antibody or antibody chain.
- antigen-binding fragment refers to a polypeptide fragment of an immunoglobulin or antibody that binds antigen or competes with intact antibody (i.e., with the intact antibody from which they were derived) for antigen binding (i.e., specific binding to human CD70).
- fragment of an antibody molecule includes antigen-binding fragments of antibodies, for example, an antibody light chain variable domain (VL), an antibody heavy chain variable domain (VH), a single chain antibody (scFv), a F(ab')2 fragment, a Fab fragment, an Fd fragment, an Fv fragment, and a single domain antibody fragment (DAb). Fragments can be obtained, e.g., via chemical or enzymatic treatment of an intact or complete antibody or antibody chain or by recombinant means.
- valency refers to the number of potential target binding sites in a polypeptide.
- Each target binding site specifically binds one target molecule or specific site on a target molecule.
- each target binding site may specifically bind the same or different molecules (e.g., may bind to different ligands or different antigens, or different epitopes on the same antigen).
- the subject binding molecules have at least one binding site specific for a human CD70 molecule.
- Specificity refers to the ability to bind (e.g., immunoreact with) a given target, e.g., CD70.
- a polypeptide may be monospecific and contain one or more binding sites which specifically bind a target or a polypeptide may be multispecific and contain two or more binding sites which specifically bind the same or different targets.
- an antibody of the invention is specific for more than one target.
- a multispecific binding molecule of the invention binds to CD70 and a second molecule expressed on a tumor cell.
- Exemplary antibodies which comprise antigen binding sites that bind to antigens expressed on tumor cells are known in the art and one or more CDRs from such antibodies can be included in an antibody of the invention.
- Synthetic As used herein the term “synthetic” with respect to polypeptides includes polypeptides which comprise an amino acid sequence that is not naturally occurring. For example, non-naturally occurring polypeptides which are modified forms of naturally occurring polypeptides (e.g., comprising a mutation such as an addition, substitution or deletion) or which comprise a first amino acid sequence (which may or may not be naturally occurring) that is linked in a linear sequence of amino acids to a second amino acid sequence (which may or may not be naturally occurring) to which it is not naturally linked in nature.
- Engineerered As used herein the term “engineered” includes manipulation of nucleic acid or polypeptide molecules by synthetic means (e.g.
- the antibodies of the invention are engineered, including for example, humanized and/or chimeric antibodies, and antibodies which have been engineered to improve one or more properties, such as antigen binding, stability/half-life or effector function.
- Modified antibody includes synthetic forms of antibodies which are altered such that they are not naturally occurring, e.g., antibodies that comprise at least two heavy chain portions but not two complete heavy chains (such as, domain deleted antibodies or minibodies); multispecific forms of antibodies (e.g., bispecific, trispecific, etc.) altered to bind to two or more different antigens or to different epitopes on a single antigen); heavy chain molecules joined to scFv molecules and the like. ScFv molecules are known in the art and are described, e.g., in US patent 5,892,019.
- modified antibody includes multivalent forms of antibodies (e.g., trivalent, tetravalent, etc., antibodies that bind to three or more copies of the same antigen).
- a modified antibody of the invention is a fusion protein comprising at least one heavy chain portion lacking a CH2 domain and comprising a binding domain of a polypeptide comprising the binding portion of one member of a receptor ligand pair.
- modified antibody may also be used herein to refer to amino acid sequence variants of a CD70 antibody. It will be understood by one of ordinary skill in the art that a CD70 antibody may be modified to produce a variant CD70 antibody which varies in amino acid sequence in comparison to the CD70 antibody from which it was derived. For example, nucleotide or amino acid substitutions leading to conservative substitutions or changes at "non-essential" amino acid residues may be made (e.g., in CDR and/or framework residues). Amino acid substitutions can include replacement of one or more amino acids with a naturally occurring or non-natural amino acid.
- “Humanising substitutions” refers to amino acid substitutions in which the amino acid residue present at a particular position in the VH or VL domain of a CD70 antibody (for example a camelid-derived CD70 antibody) is replaced with an amino acid residue which occurs at an equivalent position in a reference human VH or VL domain.
- the reference human VH or VL domain may be a VH or VL domain encoded by the human germline. Humanising substitutions may be made in the framework regions and/or the CDRs of a CD70 antibody, defined herein.
- Humanised variants refers to a variant antibody which contains one or more "humanising substitutions” compared to a reference CD70 antibody, wherein a portion of the reference antibody (e.g. the VH domain and/or the VL domain or parts thereof containing at least one CDR) has an amino derived from a non-human species, and the "humanising substitutions" occur within the amino acid sequence derived from a non-human species.
- a portion of the reference antibody e.g. the VH domain and/or the VL domain or parts thereof containing at least one CDR
- Germlined variants The term “germlined variant” is used herein to refer specifically to “humanised variants” in which the "humanising substitutions” result in replacement of one or more amino acid residues present at a particular position (s) in the VH or VL domain of a CD70 antibody (for example a camelid-derived CD70 antibody) with an amino acid residue which occurs at an equivalent position in a reference human VH or VL domain encoded by the human germline. It is typical that for any given “germlined variant", the replacement amino acid residues substituted into the germlined variant are taken exclusively, or predominantly, from a single human germline-encoded VH or VL domain.
- humanised variant and “germlined variant” are often used interchangeably herein.
- Introduction of one or more "humanising substitutions" into a camelid-derived (e.g. llama derived) VH or VL domain results in production of a "humanised variant” of the camelid (llama)-derived VH or VL domain.
- the amino acid residues substituted in are derived predominantly or exclusively from a single human germline-encoded VH or VL domain sequence, then the result may be a "human germlined variant" of the camelid (llama)-derived VH or VL domain.
- affinity variants refers to a variant antibody which exhibits one or more changes in amino acid sequence compared to a reference CD70 antibody, wherein the affinity variant exhibits an altered affinity for the human CD70 protein in comparison to the reference antibody.
- affinity variants will exhibit a changed affinity for human CD70, as compared to the reference CD70 antibody.
- affinity variant will exhibit improved affinity for human CD70, as compared to the reference CD70 antibody. The improvement may be apparent as a lower K D , for human CD70, or a slower off-rate for human CD70 or an alteration in the pattern of cross -reactivity with non-human CD70 homologues.
- Affinity variants typically exhibit one or more changes in amino acid sequence in the CDRs, as compared to the reference CD70 antibody. Such substitutions may result in replacement of the original amino acid present at a given position in the CDRs with a different amino acid residue, which may be a naturally occurring amino acid residue or a non-naturally occurring amino acid residue.
- the amino acid substitutions may be conservative or non- conservative.
- High human homology An antibody comprising a heavy chain variable domain (VH) and a light chain variable domain (VL) will be considered as having high human homology if the VH domains and the VL domains, taken together, exhibit at least 90% amino acid sequence identity to the closest matching human germline VH and VL sequences.
- Antibodies having high human homology may include antibodies comprising VH and VL domains of native non-human antibodies which exhibit sufficiently high % sequence identity to human germline sequences, including for example antibodies comprising VH and VL domains of camelid conventional antibodies, as well as engineered, especially humanised or germlined, variants of such antibodies and also "fully human" antibodies.
- the VH domain of the antibody with high human homology may exhibit an amino acid sequence identity or sequence homology of 80% or greater with one or more human VH domains across the framework regions FRl, FR2, FR3 and FR4.
- the amino acid sequence identity or sequence homology between the VH domain of the polypeptide of the invention and the closest matching human germline VH domain sequence may be 85% or greater, 90% or greater, 95% or greater, 97% or greater, or up to 99% or even 100%.
- the VH domain of the antibody with high human homology may contain one or more (e.g. 1 to 10) amino acid sequence mis-matches across the framework regions FRl, FR2, FR3 and FR4, in comparison to the closest matched human VH sequence.
- the VL domain of the antibody with high human homology may exhibit a sequence identity or sequence homology of 80% or greater with one or more human VL domains across the framework regions FRl, FR2, FR3 and FR4.
- the amino acid sequence identity or sequence homology between the VL domain of the polypeptide of the invention and the closest matching human germline VL domain sequence may be 85% or greater 90% or greater, 95% or greater, 97% or greater, or up to 99% or even 100%.
- the VL domain of the antibody with high human homology may contain one or more (e.g. 1 to 10) amino acid sequence mis-matches across the framework regions FRl, FR2, FR3 and FR4, in comparison to the closest matched human VL sequence.
- the canonical folds may be determined, which allows the identification of the family of human germline segments with the identical combination of canonical folds for HI and H2 or LI and L2 (and L3). Subsequently the human germline family member that has the highest degree of sequence homology with the variable region of the antibody of interest is chosen for scoring the sequence homology.
- the determination of Chothia canonical classes of hypervariable loops LI, L2, L3, HI and H2 can be performed with the bioinformatics tools publicly available on webpage www.bioinf.org.uk/abs/chothia.html.page.
- the output of the program shows the key residue requirements in a datafile.
- the key residue positions are shown with the allowed amino acids at each position.
- the sequence of the variable region of the antibody of interest is given as input and is first aligned with a consensus antibody sequence to assign the Kabat numbering scheme.
- the analysis of the canonical folds uses a set of key residue templates derived by an automated method developed by Martin and Thornton (Martin et al., J. Mol. Biol. 263:800-815 (1996)).
- residues of FR1, FR2 and FR3 are evaluated using the closest match sequence from the human germline family with the identical combination of canonical folds. Only residues different from the closest match or other members of the same family with the same combination of canonical folds are scored (NB - excluding any primer-encoded differences). However, for the purposes of humanization, residues in framework regions identical to members of other human germline families, which do not have the same combination of canonical folds, can be considered "human", despite the fact that these are scored "negative” according to the stringent conditions described above.
- Antibodies with high human homology may comprise hypervariable loops or CDRs having human or human-like canonical folds, as discussed in detail below.
- At least one hypervariable loop or CDR in either the VH domain or the VL domain of the antibody with high human homology may be obtained or derived from a VH or VL domain of a non-human antibody, for example a conventional antibody from a species of Camelidae, yet exhibit a predicted or actual canonical fold structure which is substantially identical to a canonical fold structure which occurs in human antibodies.
- canonical structures of the hypervariable loops in intact VH or VL domains can be determined by structural analysis (e.g. X-ray crystallography), but it is also possible to predict canonical structure on the basis of key amino acid residues which are characteristic of a particular structure (discussed further below). In essence, the specific pattern of residues that determines each canonical structure forms a "signature" which enables the canonical structure to be recognised in hypervariable loops of a VH or VL domain of unknown structure; canonical structures can therefore be predicted on the basis of primary amino acid sequence alone.
- HI and H2 loops may be scored as having a canonical fold structure "substantially identical" to a canonical fold structure known to occur in human antibodies if at least the first, and preferable both, of the following criteria are fulfilled:
- the foregoing analysis relies on prediction of the canonical structure of the HI and H2 loops of the antibody of interest. If the actual structures of the HI and H2 loops in the antibody of interest are known, for example based on X-ray crystallography, then the HI and H2 loops in the antibody of interest may also be scored as having a canonical fold structure "substantially identical" to a canonical fold structure known to occur in human antibodies if the length of the loop differs from that of the closest matching human canonical structural class (typically by +1 or +2 amino acids) but the actual structure of the HI and H2 loops in the antibody of interest matches the structure of a human canonical fold.
- both HI and H2 in the VH domain of the antibody with high human homology exhibit a predicted or actual canonical fold structure which is substantially identical to a canonical fold structure which occurs in human antibodies.
- Antibodies with high human homology may comprise a VH domain in which the hypervariable loops HI and H2 form a combination of canonical fold structures which is identical to a combination of canonical structures known to occur in at least one human germline VH domain. It has been observed that only certain combinations of canonical fold structures at HI and H2 actually occur in VH domains encoded by the human germline.
- HI and H2 in the VH domain of the antibody with high human homology may be obtained from a VH domain of a non-human species, e.g.
- a Camelidae species yet form a combination of predicted or actual canonical fold structures which is identical to a combination of canonical fold structures known to occur in a human germline or somatically mutated VH domain.
- HI and H2 in the VH domain of the antibody with high human homology may be obtained from a VH domain of a non-human species, e.g. a Camelidae species, and form one of the following canonical fold combinations: 1-1, 1-2, 1-3, 1-6, 1-4, 2-1, 3-1 and 3- 5.
- An antibody with high human homology may contain a VH domain which exhibits both high sequence identity/sequence homology with human VH, and which contains hypervariable loops exhibiting structural homology with human VH.
- the canonical folds present at HI and H2 in the VH domain of the antibody with high human homology, and the combination thereof, may be "correct" for the human VH germline sequence which represents the closest match with the VH domain of the antibody with high human homology in terms of overall primary amino acid sequence identity.
- the closest sequence match is with a human germline VH3 domain
- the VH domain of the CD70 antibody with high human homology may exhibit a sequence identity or sequence homology of 80% or greater, 85% or greater, 90% or greater, 95% or greater, 97% or greater, or up to 99% or even 100% with a human VH domain across the framework regions FR1, FR2 , FR3 and FR4, and in addition HI and H2 in the same antibody are obtained from a non-human VH domain (e.g. derived from a Camelidae species), but form a combination of predicted or actual canonical fold structures which is the same as a canonical fold combination known to occur naturally in the same human VH domain.
- a non-human VH domain e.g. derived from a Camelidae species
- LI and L2 in the VL domain of the antibody with high human homology are each obtained from a VL domain of a non-human species (e.g. a camelid-derived VL domain), and each exhibits a predicted or actual canonical fold structure which is substantially identical to a canonical fold structure which occurs in human antibodies.
- a non-human species e.g. a camelid-derived VL domain
- VLambda and VKappa types can adopt a limited number of conformations or canonical structures, determined in part by length and also by the presence of key amino acid residues at certain canonical positions.
- LI, L2 and L3 loops obtained from a VL domain of a non-human species may be scored as having a canonical fold structure "substantially identical" to a canonical fold structure known to occur in human antibodies if at least the first, and preferable both, of the following criteria are fulfilled:
- LI, L2 and L3 loops in the VL domain of the antibody of interest. If the actual structure of the LI, L2 and L3 loops is known, for example based on X-ray crystallography, then LI, L2 or L3 loops derived from the antibody of interest may also be scored as having a canonical fold structure "substantially identical" to a canonical fold structure known to occur in human antibodies if the length of the loop differs from that of the closest matching human canonical structural class (typically by +1 or +2 amino acids) but the actual structure of the Camelidae loops matches a human canonical fold.
- LI and L2 in the VL domain of an antibody with high human homology may form a combination of predicted or actual canonical fold structures which is identical to a combination of canonical fold structures known to occur in a human germline VL domain.
- LI and L2 in the VLambda domain of an antibody with high human homology may form one of the following canonical fold combinations: 11-7, 13-7(A,B,C), 14-7(A,B), 12-11, 14-11 and 12-12 (as defined in Williams et al. J. Mol. Biol. 264:220 -32 (1996) and as shown on
- LI and L2 in the Vkappa domain may form one of the following canonical fold combinations: 2-1, 3-1, 4-1 and 6-1 (as defined in Tomlinson et al. EMBO J. 14:4628-38 (1995) and as shown on
- all three of LI, L2 and L3 in the VL domain of an antibody with high human homology may exhibit a substantially human structure. It is preferred that the VL domain of the antibody with high human homology exhibits both high sequence identity/sequence homology with human VL, and also that the
- hypervariable loops in the VL domain exhibit structural homology with human VL.
- the VL domain of a CD70 antibody with high human homology may exhibit a sequence identity of 80% or greater, 85% or greater, 90% or greater, 95% or greater, 97% or greater, or up to 99% or even 100% with a human VL domain across the framework regions FR1, FR2 , FR3 and FR4, and in addition hypervariable loop LI and hypervariable loop L2 may form a combination of predicted or actual canonical fold structures which is the same as a canonical fold combination known to occur naturally in the same human VL domain.
- the invention relates, at least in part, to antibodies, and antigen binding fragments thereof, that bind to human CD70 with high affinity.
- the properties and characteristics of the CD70 antibodies, and antibody fragments, according to the invention will now be described in further detail.
- the antibodies, and antigen binding fragments thereof, provided herein bind to human CD70 with high affinity.
- Antibodies, or antigen binding fragments thereof, which bind to human CD70 with high affinity may exhibit a binding affinity (K D ) for human CD70, and more particularly the extracellular domain of human CD70, of about ⁇ or less, or InM or less, or O.lnM or less, or ⁇ or less.
- the CD70 antibody may comprise VH and VL domains which, when the VH and VL domains are expressed in the form of a Fab, exhibit a dissociation off -rate for human CD70 binding of less than 7 x 10 ' V 1 , preferably less than 5 x 10 ' V 1 , or less than 2 x 10 ' V 1 , less than 1 x 10 ' V 1 .
- the off rate will fall in the range of from 0.4 x 10 ' V 1 to 4.8 x 10 ' V 1 .
- Binding affinity (K D ) and dissociation rate (K 0ff ) can be measured using standard techniques well known to persons skilled in the art, such as for example surface plasmon resonance (BIAcore), as described in the accompanying examples.
- BIOAcore surface plasmon resonance
- Biacore analysis is performed at room temperature using a highly CD70 coated CM5 chip (4000 RU) using the manufacturer's supplied protocol.
- VH and VL combinations in the form of Fabs, this does not mean that the VH and VL domains contribute equally to CD70 binding.
- VH/VL combinations it is the VH domain which mainly contributes to CD70 binding, with the VL domain contributing to solubility and/or stability of the VH/VL pairing.
- Binding of the CD70 antibodies described herein, or Fab fragments thereof, to recombinant human CD70 may also be assessed by ELISA.
- CD70 antibodies described herein may further exhibit binding to CD70 expressed on the surface of intact cells, e.g. 786-0 renal carcinoma cells and other cancer cell lines. Binding of CD70 antibodies to CD70-expressing cells may be assessed by flow cytometry.
- the results presented in the accompanying examples demonstrate that preferred CD70 antibodies, including variant 4 ID 12 (when expressed as non-fucosylated IgGl ARGX-110), exhibit very strong binding to cell-surface CD70. Indeed, for many cell lines ARGX-110 exhibits stronger binding than comparator prior art antibody SGN70.
- ARGX-110 exhibits strong binding to cell lines which express CD70 at low copy number, including inter alia the cell lines Raji, SU- DHL-6, MHHPREB 1, Mino, Mecl, JVM-2, HH and EBC-1, and also to cancer cells isolated from patients (e.g. CLL patients), in both cases the binding of ARGX-110 is markedly stronger than SGN70.
- the "improved" binding to low copy number cell lines and CLL patient materials may in large part reflect the extremely high affinity of ARGX- 110 for recombinant CD70.
- binding characteristics are supportive of a particular utility of ARGX-110 (based on 4 ID 12) and other CD70 antibodies described herein with similar properties in cancer treatment, particularly when utilised as an IgG exhibiting potent effector function (e.g. non-fucosylated IgGl) rather than as an immunoconjugate linked to a cytotoxic or cytostatic moiety.
- the significance of high affinity binding (i.e. higher affinity than can be achieved with prior art CD70 antibodies) to recombinant CD70 and cell surface CD70 with regard to clinical utility of the antibodies is
- CD70 antibodies described herein exhibit high affinity binding to human CD70, and more specifically the extracellular domain of human CD70, but cross- reactivity with non-human homologues of CD70 is not excluded. Indeed, it is an advantageous feature of many of the CD70 antibodies described herein, including 27B3 and its germlined variants, particularly 4 ID 12, that in addition to high affinity binding to human CD70 they also cross-react with simian CD70 homologs, specifically the CD70 homlogs of rhesus macaque and cynomolgus monkey.
- a CD70 antibody can be considered to exhibit cross-reactivity with a simian CD70 homolog, for example the CD70 homlogs of rhesus macaque and cynomolgus monkey, if the difference in IC50 for human versus simian (rhesus or cynomolgus monkey) CD70 in a CD70-CD27 inhibition ELISA, such as that described in the accompanying example 20.2, is less than 5-fold, preferably less than 3-fold or less than 2-fold.
- the binding affinity, and therefore blocking potency, for human and simian CD70 should be broadly comparable.
- the CD70 antibodies, or antigen binding fragments thereof, provided herein may bind to human CD70 with high affinity and block the interaction between CD70 and CD27.
- CD70 antibodies, or antigen binding fragments thereof, to block binding of CD70 to CD27 may be assessed by Elisa using either captured recombinant CD70 (Flag-TNC-CD70) or directed coated CD70 and recombinant CD27-Fc.
- the CD70 antibodies described herein may inhibit the interaction between CD70 and CD27 with an IC50 of 300 ng/ml or less, or 200 ng/ml or less, or 110 ng/ml or less, or 70 ng/ml or less, or 50 ng/ml or less.
- CD70 antibodies, or antigen binding fragments thereof, to block binding of CD70 to CD27 may also be assessed in an assay based on co-culture of Raji cells (human B cell lymphoma) and HT1080-CD27 cells (human epithelial cell line transfected with CD27), as described in the accompanying examples.
- the CD70 antibodies described which inhibit the interaction between CD70 and CD27 may exhibit an IC50 in this co-culture assay of 500 ng/ml or less, or 300 ng/ml or less, or 100 ng/ml or less, or 50 ng/ml or less, or 30 ng/ml or less.
- CD70/CD27 interactions than comparator antibodies SGN70 and MDX1411.
- the interaction between CD70 and CD27 may contribute to tumour cell survival, proliferation and/or immune suppression within the tumour microenvironment. Accordingly, potent inhibition of the CD70/CD27 interaction, in addition to high affinity binding to CD70, may contribute to improved clinical outcome in the treatment of certain CD70-expressing cancers or immunological disorders, for example autoimmune diseases and cancers which co-express CD70 and CD27.
- the CD70 antibodies, or antigen binding fragments thereof may bind to human CD70 but not inhibit the interaction between CD70 and CD27.
- CD70 antibodies which bind CD70 but do not inhibit the interaction between CD70 and CD27 can be assessed based on Elisa using either captured recombinant CD70 (Flag-TNC- CD70) or directed coated CD70 and recombinant CD27-Fc. As demonstrated in the accompanying examples, a number of Fabs have been identified which bind CD70 but do not inhibit the CD70/CD27 interaction to a significant extent.
- the Fab clone identified herein as 59D10 exhibits strong binding to recombinant CD70 as measured by Biacore but does not block the CD70/CD27 interaction to a significant extent, when assessed by ELISA.
- CD70 antibodies described herein which bind CD70 but do not inhibit the interaction between CD70 and CD27 may still possess intact antibody effector functions, i.e. one or more of ADCC, CDC, ADCP or ADC and inhibit tumour cell growth in vivo.
- CD70 antibodies which bind CD70 with high affinity but are non- blocking may be advantageously utilised as "one-armed" antibodies, or PEGylated Fab products or in any other antibody format which provides a strict monovalent interaction with a target cell expressing CD70.
- CD70 antibodies described herein bind to epitopes within the extracellular domain of human CD70.
- epitopes refers to the portion(s) of an antigen (e.g. human CD70) that contact an antibody. Epitopes can be linear, i.e., involving binding to a single sequence of amino acids, or conformational, i.e., involving binding to two or more sequences of amino acids in various regions of the antigen that may not necessarily be contiguous.
- the CD70 antibodies provided herein may bind to different (overlapping or non- overlapping) epitopes within the extracellular domain of the human CD70 protein.
- the Fabs denoted 1C2 and 9E1 in the accompanying examples clearly bind to different, non-overlapping epitopes on human CD70.
- the preferred CD70 antibody 4 ID 12 (ARGX-110) exhibits a particularly useful combination of binding characteristics which is not exhibited by any known prior art CD70 antibody, namely:
- the ability to bind human CD70 within the amino acid sequence HIQVTLAICSS can be readily determined by a person of ordinary skill in the art, for example using the mouse-human chimeric CD70 binding analysis described in the accompanying example 20.4.
- Cross -reactivity with simian CD70 homologs can also be readily determined by a person of ordinary skill in the art, for example by FACs analysis, surface plasmon resonance (BiacoreTM) or using a CD70-CD27 inhibition ELISA.
- a CD70 antibody can be considered to exhibit cross -reactivity with a simian CD70 homolog, for example the CD70 homlogs of rhesus macaque and cynomolgus monkey, if the difference in IC50 for human versus simian (rhesus or cynomolgus monkey) CD70 in a CD70-CD27 inhibition ELISA, such as that described in the accompanying example 20.2, is less than 5-fold, preferably less than 3-fold or less than 2-fold.
- the CD70 antibodies described herein may also demonstrate the ability to bind both native human CD70 and heat denatured recombinant human CD70.
- binding to "native" human CD70 is indicated by binding to CD70 expressed on the surface of a CD70-expressing cell, such as any of the CD70+ cell lines described in the accompanying examples, or even natural CD70-expressing cells isolated from patient material (e.g. cells isolated from CLL patients as in the accompanying examples), activated T cells, etc. Binding to "native" human CD70 can thus be easily tested by a person of ordinary skill in the art.
- Binding to heat denatured recombinant human CD70 can be tested as described in the accompanying example 20.3. It is preferred that the CD70 antibody should exhibit an OD at 620 nm of 0.6 or greater in this assay, in order to demonstrate significant binding to heat denatured recombinant human CD70. Partial or slow intemalisation
- the CD70 antibodies described herein exhibit partial intemalisation in renal carcinoma cell lines, meaning that when antibody intemalisation is tested in 786-0 renal carcinoma cells a substantial proportion of the bound antibody, i.e. at least 30-40%, remains external after 6 hours, and even after 24 hours, incubation at 37°C.
- the CD70 antibodies may also exhibit a slow rate of intemalisation.
- a CD70 antibody is considered to exhibit slow intemalisation if it is internalised at a slower rate than a reference CD70 antibody 9D1 (VH SEQ ID NO: 178; VL SEQ ID NO: 190).
- the antibodies or antigen binding fragments thereof described herein may comprise at least one hypervariable loop or complementarity determining region obtained from a VH domain or a VL domain of a species in the family Camelidae.
- the antibody or antigen binding fragment may comprise VH and/or VL domains, or CDRs thereof, obtained by active immunisation of outbred camelids, e.g. llamas, with a human CD70 antigen.
- hypervariable loop or complementarity determining region obtained from a VH domain or a VL domain of a species in the family Camelidae is meant that that hypervariable loop (HV) or CDR has an amino acid sequence which is identical, or substantially identical, to the amino acid sequence of a hypervariable loop or CDR which is encoded by a Camelidae immunoglobulin gene.
- hypervariable loop (HV) or CDR has an amino acid sequence which is identical, or substantially identical, to the amino acid sequence of a hypervariable loop or CDR which is encoded by a Camelidae immunoglobulin gene.
- immunoglobulin gene includes germline genes, immunoglobulin genes which have undergone
- the amino acid sequence of the HV or CDR obtained from a VH or VL domain of a Camelidae species may be identical to the amino acid sequence of a HV or CDR present in a mature Camelidae conventional antibody.
- the term "obtained from” in this context implies a structural relationship, in the sense that the HVs or CDRs of the CD70 antibody embody an amino acid sequence (or minor variants thereof) which was originally encoded by a Camelidae
- Camelid-derived CD70 antibodies may be derived from any camelid species, including inter alia, llama, dromedary, alpaca, vicuna, guanaco or camel.
- CD70 antibodies comprising camelid-derived VH and VL domains, or CDRs thereof, are typically recombinantly expressed polypeptides, and may be chimeric polypeptides.
- chimeric polypeptide refers to an artificial (non-naturally occurring) polypeptide which is created by juxtaposition of two or more peptide fragments which do not otherwise occur contiguously. Included within this definition are "species" chimeric polypeptides created by juxtaposition of peptide fragments encoded by two or more species, e.g. camelid and human.
- Camelid-derived CDRs may comprise one of the CDR sequences shown as SEQ ID Nos: 49-59, 262 or 263 (heavy chain CDR3), or SEQ ID Nos: 26-37, 249, 258 or 259 (heavy chain CDR2) or SEQ ID Nos: 10-20, 248, 256 or 257 (heavy chain CDR1) or one of the CDR sequences shown as SEQ ID NOs: 148-168, 271 or 273 (light chain CDR3), or SEQ ID Nos: 109-128 or 270 (light chain CDR2) or SEQ ID Nos:77-95, or 250-253, 267 and 268 (light chain CDR1).
- the entire VH domain and/or the entire VL domain may be obtained from a species in the family Camelidae.
- the camelid- derived VH domain may comprise the amino acid sequence shown as SEQ ID NOs: 177- 188, 212-223, 274 or 275
- the camelid-derived VL domain may comprise the amino acid sequence show as SEQ ID Nos: 189-211, 230-245, 276 or 277 (VL).
- the camelid-derived VH domain and/or the camelid-derived VL domain may then be subject to protein engineering, in which one or more amino acid substitutions, insertions or deletions are introduced into the camelid amino acid sequence.
- These engineered changes preferably include amino acid substitutions relative to the camelid sequence.
- Such changes include "humanisation” or "germlining" wherein one or more amino acid residues in a camelid-encoded VH or VL domain are replaced with equivalent residues from a homologous human-encoded VH or VL domain.
- Isolated camelid VH and VL domains obtained by active immunisation of a camelid (e.g. llama) with a human CD70 antigen can be used as a basis for engineering antigen binding polypeptides according to the invention.
- a camelid e.g. llama
- a human CD70 antigen can be used as a basis for engineering antigen binding polypeptides according to the invention.
- Starting from intact camelid VH and VL domains it is possible to engineer one or more amino acid substitutions, insertions or deletions which depart from the starting camelid sequence.
- substitutions, insertions or deletions may be present in the framework regions of the VH domain and/or the VL domain.
- the purpose of such changes in primary amino acid sequence may be to reduce presumably unfavourable properties (e.g.
- changes in primary amino acid sequence can be engineered in one or more of the hypervariable loops (or CDRs) of a Camelidae VH and/or VL domain obtained by active immunisation. Such changes may be introduced in order to enhance antigen binding affinity and/or specificity, or to reduce presumably unfavourable properties, e.g.
- humanization immunogenicity in a human host (so-called humanization), sites of potential product heterogeneity and or instability, glycosylation, deamidation, isomerisation, etc., or to enhance some other favourable property of the molecule, e.g. solubility, stability, bioavailability, etc.
- the invention provides a variant CD70 antibody which contains at least one amino acid substitution in at least one framework or CDR region of either the VH domain or the VL domain in comparison to a camelid-derived VH or VL domain, examples of which include but are not limited to the camelid VH domains comprising the amino acid sequences shown as SEQ ID NO: 177-188, 212-223, 274 or 275, and the camelid VL domains comprising the amino acid sequences show as SEQ ID NO: 189-211, 230-245, 276 or 277.
- chimeric antibody molecules comprising camelid-derived VH and VL domains (or engineered variants thereof) and one or more constant domains from a non-camelid antibody, for example human-encoded constant domains (or engineered variants thereof).
- both the VH domain and the VL domain are obtained from the same species of camelid, for example both VH and VL may be from Lama glama or both VH and VL may be from Lama pacos (prior to introduction of engineered amino acid sequence variation).
- both the VH and the VL domain may be derived from a single animal, particularly a single animal which has been actively immunised with a human CD70 antigen.
- individual camelid-derived hypervariable loops or CDRs can be isolated from camelid VH/VL domains and transferred to an alternative (i.e. non-Camelidae) framework, e.g. a human VH/VL framework, by CDR grafting.
- an alternative framework e.g. a human VH/VL framework
- the camelid- derived CDRs may be selected from CDRs having the amino acid sequences shown as SEQ ID NOs: 49-59 (heavy chain CDR3), or SEQ ID Nos: 26-37 (heavy chain CDR2) or SEQ ID Nos: 10-20 (heavy chain CDR1) or one of the CDR sequences shown as SEQ ID NOs: 148-168 (light chain CDR3), or SEQ ID Nos: 109-128 (light chain CDR2) or SEQ ID Nos:77-95 (light chain CDR1).
- CD70 antibodies comprising camelid-derived VH and VL domains, or CDRs thereof, can take various different embodiments in which both a VH domain and a VL domain are present.
- antibody herein is used in the broadest sense and encompasses, but is not limited to, monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), so long as they exhibit the appropriate immunological specificity for a human CD70 protein.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts.
- Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to conventional (polyclonal) antibody preparations which typically include different antibodies directed against different determinants (epitopes) on the antigen, each monoclonal antibody is directed against a single determinant or epitope on the antigen.
- Antibody fragments comprise a portion of a full length antibody, generally the antigen binding or variable domain thereof. Examples of antibody fragments include Fab, Fab', F(ab')2, bi-specific Fab's, and Fv fragments, diabodies, linear antibodies, single- chain antibody molecules, a single chain variable fragment (scFv) and multispecific antibodies formed from antibody fragments (see Holliger and Hudson, Nature Biotechnol. 23: 1126-36 (2005), the contents of which are incorporated herein by reference).
- CD70 antibodies comprising camelid-derived VH and VL domains, or CDRs thereof, may comprise CHI domains and/or CL domains, the amino acid sequence of which is fully or substantially human.
- the antigen binding polypeptide of the invention is an antibody intended for human therapeutic use, it is typical for the entire constant region of the antibody, or at least a part thereof, to have fully or substantially human amino acid sequence. Therefore, one or more or any combination of the CHI domain, hinge region, CH2 domain, CH3 domain and CL domain (and CH4 domain if present) may be fully or substantially human with respect to it's amino acid sequence.
- the CHI domain, hinge region, CH2 domain, CH3 domain and CL domain may all have fully or substantially human amino acid sequence.
- substantially human refers to an amino acid sequence identity of at least 90%, or at least 92%, or at least 95%, or at least 97%, or at least 99% with a human constant region.
- human amino acid sequence in this context refers to an amino acid sequence which is encoded by a human immunoglobulin gene, which includes germline, rearranged and somatically mutated genes.
- the invention also contemplates polypeptides comprising constant domains of "human" sequence which have been altered, by one or more amino acid additions, deletions or substitutions with respect to the human sequence, excepting those embodiments where the presence of a "fully human” hinge region is expressly required.
- the presence of a "fully human" hinge region in the CD70 antibodies of the invention may be beneficial both to minimise immunogenicity and to optimise stability of the antibody.
- one or more amino acid substitutions, insertions or deletions may be made within the constant region of the heavy and/or the light chain, particularly within the Fc region.
- Amino acid substitutions may result in replacement of the substituted amino acid with a different naturally occurring amino acid, or with a non-natural or modified amino acid.
- Other structural modifications are also permitted, such as for example changes in glycosylation pattern (e.g. by addition or deletion of N- or O-linked glycosylation sites).
- cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region.
- the homodimeric antibody thus generated may have improved internalization capability and/or increased complement- mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- a CD70 antibody can be engineered which has dual Fc regions and may thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al., Anti-Cancer Drug Design 3:219-230 (1989).
- the invention also contemplates immunoconjugates comprising an antibody as described herein conjugated to a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
- a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
- Fc regions may also be engineered for half-life extension, as described by Chan and Carter, Nature Reviews: Immunology, Vol.10, pp301-316, 2010, incorporated herein by reference.
- the Fc region is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity of the antibody for an Fey receptor by modifying one or more amino acids.
- ADCC antibody dependent cellular cytotoxicity
- the glycosylation of an antibody is modified.
- an aglycoslated antibody can be made (i.e., the antibody lacks glycosylation).
- Glycosylation can be altered to, for example, increase the affinity of the antibody for the CD70 target antigen.
- carbohydrate modifications can be accomplished by; for example, altering one or more sites of glycosylation within the antibody sequence.
- one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
- Such aglycosylation may increase the affinity of the antibody for antigen.
- variant CD70 antibodies having an altered type of
- glycosylation such as a hypofucosylated antibody having reduced amounts of fucosyl residues or a non-fucosylated antibody (as described by Natsume et al., Drug Design Development and Therapy, Vol.3, pp7-16, 2009) or an antibody having increased bisecting GlcNac structures.
- Such altered glycosylation patterns have been demonstrated to increase the ADCC activity of antibodies, producing typically 10-fold enhancement of ADCC relative to an equivalent antibody comprising a "native" human Fc domain.
- Such carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation enzymatic machinery (as described by Yamane- Ohnuki and Satoh, mAbs 1:3, 230-236, 2009).
- Examples of non-fucosylated antibodies with enhanced ADCC function are those produced using the PotelligentTM technology of BioWa Inc.
- the invention can, in certain embodiments, encompass chimeric
- Camelidae/human antibodies and in particular chimeric antibodies in which the VH and VL domains are of fully camelid sequence (e.g. Llama or alpaca) and the remainder of the antibody is of fully human sequence.
- CD70 antibodies can include antibodies comprising "humanised” or “germlined” variants of camelid-derived VH and VL domains, or CDRs thereof, and camelid/human chimeric antibodies, in which the VH and VL domains contain one or more amino acid substitutions in the framework regions in comparison to camelid VH and VL domains obtained by active immunisation of a camelid with a human CD70 antigen.
- Such "humanisation” increases the % sequence identity with human germline VH or VL domains by replacing mis-matched amino acid residues in a starting Camelidae VH or VL domain with the equivalent residue found in a human germline- encoded VH or VL domain.
- CD70 antibodies may also be CDR-grafted antibodies in which CDRs (or hypervariable loops) derived from a camelid antibody, for example an camelid CD70 antibody raised by active immunisation with human CD70 protein, or otherwise encoded by a camelid gene, are grafted onto a human VH and VL framework, with the remainder of the antibody also being of fully human origin.
- CDRs or hypervariable loops
- Such CDR-grafted CD70 antibodies may contain CDRs having the amino acid sequences shown as SEQ ID Nos: 49-59, 262 or 263 (heavy chain CDR3), or SEQ ID Nos: 26-37, 249, 258 or 259 (heavy chain CDR2) or SEQ ID Nos: 10-20, 248, 256 or 257 (heavy chain CDR1) or one of the CDR sequences shown as SEQ ID NOs: 148-168, 271 or 273 (light chain CDR3), or SEQ ID Nos: 109-128 or 270 (light chain CDR2) or SEQ ID Nos:77-95, or 250-253, 267 and 268 (light chain CDR1).
- Humanised, chimeric and CDR-grafted CD70 antibodies as described above, particularly antibodies comprising hypervariable loops or CDRs derived from active immunisation of camelids with a human CD70 antigen can be readily produced using conventional recombinant DNA manipulation and expression techniques, making use of prokaryotic and eukaryotic host cells engineered to produce the polypeptide of interest and including but not limited to bacterial cells, yeast cells, mammalian cells, insect cells, plant cells , some of them as described herein and illustrated in the accompanying examples.
- Camelid-derived CD70 antibodies include variants wherein the hypervariable loop(s) or CDR(s) of the VH domain and/or the VL domain are obtained from a conventional camelid antibody raised against human CD70, but wherein at least one of said (camelid-derived) hypervariable loops or CDRs has been engineered to include one or more amino acid substitutions, additions or deletions relative to the camelid-encoded sequence.
- Such changes include "humanisation" of the hypervariable loops/CDRs.
- Camelid-derived HVs/CDRs which have been engineered in this manner may still exhibit an amino acid sequence which is "substantially identical" to the amino acid sequence of a camelid-encoded HV/CDR.
- substantially identical may permit no more than one, or no more than two amino acid sequence mis-matches with the camelid- encoded HV/CDR.
- CD70 antibody may contain humanised variants of the CDR sequences shown as SEQ ID Nos: 49-59, 262 or 263 (heavy chain CDR3), or SEQ ID Nos: 26-37, 249, 258 or 259 (heavy chain CDR2) or SEQ ID Nos: 10-20, 248, 256 or 257 (heavy chain CDR1) or one of the CDR sequences shown as SEQ ID NOs: 148-168, 271 or 273 (light chain CDR3), or SEQ ID Nos: 109- 128 or 270 (light chain CDR2) or SEQ ID Nos:77-95, or 250-253, 267 and 268 (light chain CDR1).
- the camelid-derived CD70 antibodies provided herein may be of any isotype.
- Antibodies intended for human therapeutic use will typically be of the IgA, IgD, IgE IgG, IgM type, often of the IgG type, in which case they can belong to any of the four sub-classes IgGl, IgG2a and b, IgG3 or IgG4. Within each of these sub-classes it is permitted to make one or more amino acid substitutions, insertions or deletions within the Fc portion, or to make other structural modifications, for example to enhance or reduce Fc-dependent functionalities.
- Camelid conventional antibodies provide an advantageous starting point for the preparation of antibodies with utility as human therapeutic agents due to the following factors, discussed in US 12/497,239 which is incorporated herein by reference:
- the camelid (e.g. llama) platform also provides a significant advantage in terms of the functional diversity of the CD70 antibodies which can be obtained.
- CD70 antibodies comprising camelid VH and/or camelid VL domains for human therapy can be improved still further by "humanisation" of natural camelid VH and VL domains, for example to render them less immunogenic in a human host.
- the overall aim of humanisation is to produce a molecule in which the VH and VL domains exhibit minimal immunogenicity when introduced into a human subject, whilst retaining the specificity and affinity of the antigen binding site formed by the parental VH and VL domains.
- This approach can be used to prepare humanised variants of camelid-derived CDRs having the amino acid sequences shown as SEQ ID Nos: 49-59, 262 or 263 (heavy chain CDR3), or SEQ ID Nos: 26-37, 249, 258 or 259 (heavy chain CDR2) or SEQ ID Nos: 10-20, 248, 256 or 257 (heavy chain CDR1) or one of the CDR sequences shown as SEQ ID NOs: 148-168, 271 or 273 (light chain CDR3), or SEQ ID Nos: 109-128 or 270 (light chain CDR2) or SEQ ID Nos:77-95, or 250-253, 267 or 268 (light chain CDR1), and also for humanisation of camelid-derived VH domains having the sequences shown as SEQ ID NOs: 177-188, 212-223, 274 or 275 and of camelid-derived VL domains having the sequences shown as SEQ ID Nos: 189-211, 230-245, 276 or
- Step 1 Select human (germline) family and member of this family that shows highest homology/identity to the mature camelid sequence to be humanised.
- a general procedure for identifying the closest matching human germline for any given camelid VH (or VL) domain is outlined below.
- Step 2 Select specific human germline family member used to germline against.
- this is the germline with the highest homology or another germline family member from the same family.
- Step 3 Identify the preferred positions considered for germlining on the basis of the table of amino acid utilisation for the camelid germline that is closest to the selected human germline.
- Step 4. Try to change amino acids in the camelid germline that deviate from the closest human germline; germlining of FR residues is preferred over CDR residues.
- a. Preferred are positions that are deviating from the selected human germline used to germline against, for which the amino acid found in the camelid sequence does not match with the selected germline and is not found in other germlines of the same subclass (both for V as well as for J encoded FR amino acids).
- b. Positions that are deviating from the selected human germline family member but which are used in other germlines of the same family may also be addressed in the germlining process.
- c. Additional mismatches (e.g. due to additional somatic mutations) towards the selected human germline may also be addressed.
- the canonical folds may first be determined, which allows the identification of the family of human germline segments with the identical combination of canonical folds for HI and H2 or LI and L2 (and L3). Subsequently the human germline family member that has the highest degree of sequence homology with the Camelidae variable region of interest may be chosen for scoring sequence homology.
- the output of the program shows the key residue requirements in a datafile. In these datafiles, the key residue positions are shown with the allowed amino acids at each position.
- the sequence of the variable region of the antibody is given as input and is first aligned with a consensus antibody sequence to assign the Kabat numbering scheme.
- the analysis of the canonical folds uses a set of key residue templates derived by an automated method developed by Martin and Thornton (Martin et al., J. Mol. Biol. 263:800-815 (1996)).
- the boundaries of the individual framework regions may be assigned using the IMGT numbering scheme, which is an adaptation of the numbering scheme of Chothia (Lefranc et al., NAR 27: 209-212 (1999); http://imgt.cines.fr).
- IMGT numbering scheme is an adaptation of the numbering scheme of Chothia (Lefranc et al., NAR 27: 209-212 (1999); http://imgt.cines.fr).
- the best matching family member in terms of sequence homology can be determined.
- the percentage sequence identity between Camelidae VH and VL domain framework amino acid sequences and corresponding sequences encoded by the human germline can be determined using bioinformatic tools, but manual alignment of the sequences could also be used.
- Human immunoglobulin sequences can be identified from several protein data bases, such as VBase (http://vbase.mrc-cpe.cam.ac.uk/) or the Pluckthun/Honegger database (http://www.bioc.unizh.ch/antibody/Sequences/Germlines.
- VBase http://vbase.mrc-cpe.cam.ac.uk/
- Pluckthun/Honegger database http://www.bioc.unizh.ch/antibody/Sequences/Germlines.
- sequence alignment algorithm such as available via websites like www.expasy.ch/tools/#align can be used, but also manual alignment can also be performed with a limited set of sequences.
- Human germline light and heavy chain sequences of the families with the same combinations of canonical folds and with the highest degree of homology with the framework regions 1, 2, and 3 of each chain may be selected and compared with the Camelidae variable region of interest; also the FR4 is checked against the human germline JH and JK or JL regions.
- residues of FR1, FR2 and FR3 are evaluated using the closest match sequence from the human germline family with the identical combination of canonical folds. Only residues different from the closest match or other members of the same family with the same combination of canonical folds are scored (NB - excluding any primer-encoded differences). However, for the purposes of humanization, residues in framework regions identical to members of other human germline families, which do not have the same combination of canonical folds, can be considered for humanization, despite the fact that these are scored "negative" according to the stringent conditions described above.
- Monoclonal antibodies or antigen-binding fragments thereof that "cross-compete” with the molecules disclosed herein are those that bind human CD70 at site(s) that are identical to, or overlapping with, the site(s) at which the present CD70 antibodies bind. Competing monoclonal antibodies or antigen-binding fragments thereof can be identified, for example, via an antibody competition assay. For example, a sample of purified or partially purified human CD70 can be bound to a solid support. Then, an antibody compound or antigen binding fragment thereof of the present invention and a monoclonal antibody or antigen-binding fragment thereof suspected of being able to compete with such invention antibody compound are added. One of the two molecules is labelled.
- the labelled compound and the unlabeled compound bind to separate and discrete sites on CD70, the labelled compound will bind to the same level whether or not the suspected competing compound is present. However, if the sites of interaction are identical or overlapping, the unlabeled compound will compete, and the amount of labelled compound bound to the antigen will be lowered. If the unlabeled compound is present in excess, very little, if any, labelled compound will bind.
- competing monoclonal antibodies or antigen-binding fragments thereof are those that decrease the binding of the present antibody compounds to CD70 by about 50%, about 60%, about 70%, about 80%, about 85%, about 90%, about 95%, or about 99%. Details of procedures for carrying out such competition assays are well known in the art and can be found, for example, in Harlow and Lane (1988) Antibodies, A
- Such assays can be made quantitative by using purified antibodies.
- a standard curve is established by titrating one antibody against itself, i.e., the same antibody is used for both the label and the competitor.
- the capacity of an unlabeled competing monoclonal antibody or antigen-binding fragment thereof to inhibit the binding of the labelled molecule to the plate is titrated. The results are plotted, and the concentrations necessary to achieve the desired degree of binding inhibition are compared.
- the invention also provides polynucleotide molecules encoding the CD70 antibodies of the invention, also expression vectors containing a nucleotide sequences which encode the CD70 antibodies of the invention operably linked to regulatory sequences which permit expression of the antigen binding polypeptide in a host cell or cell-free expression system, and a host cell or cell-free expression system containing this expression vector.
- Polynucleotide molecules encoding the CD70 antibodies of the invention include, for example, recombinant DNA molecules.
- nucleic acid molecules a sequence or structure of a particular nucleic acid molecule may be described herein according to the normal convention of providing the sequence in the 5' to 3' direction. In some
- nucleic acids or polynucleotides are "isolated.”
- This term when applied to a nucleic acid molecule, refers to a nucleic acid molecule that is separated from sequences with which it is immediately contiguous in the naturally occurring genome of the organism in which it originated.
- an "isolated nucleic acid” may comprise a DNA molecule inserted into a vector, such as a plasmid or virus vector, or integrated into the genomic DNA of a prokaryotic or eukaryotic cell or non-human host organism.
- RNA the term “isolated polynucleotide” refers primarily to an RNA molecule encoded by an isolated DNA molecule as defined above. Alternatively, the term may refer to an RNA molecule that has been
- an isolated polynucleotide may further represent a molecule produced directly by biological or synthetic means and separated from other components present during its production.
- the invention provides nucleotide sequences which encode the VH domain and VL domain of the germlined llama-derived Fab denoted herein 4 ID 12, wherein the VH domain has the amino acid sequence shown as SEQ ID NO:223 and the VH domain has the amino acid sequence shown as SEQ ID NO:241.
- nucleotide sequence encoding the VH domain having the amino acid sequence shown as SEQ ID NO:223 comprises the nucleotide sequence shown as SEQ ID NO: 344
- nucleotide sequence encoding the VL domain having the amino acid sequence shown as SEQ ID NO:241 comprises the nucleotide sequence shown as SEQ ID NO:345.
- the invention provides nucleotide sequences which encode the VH domain and VL domain of the germlined llama-derived Fab denoted herein 57B6, wherein the VH domain has the amino acid sequence shown as SEQ ID NO:274 and the VH domain has the amino acid sequence shown as SEQ ID NO:276.
- the nucleotide sequence encoding the VH domain having the amino acid sequence shown as SEQ ID NO:274 comprises the nucleotide sequence shown as SEQ ID NO:346, and the nucleotide sequence encoding the VL domain having the amino acid sequence shown as SEQ ID NO:276 comprises the nucleotide sequence shown as SEQ ID NO:347.
- the invention provides nucleotide sequences which encode the VH domain and VL domain of the germlined llama-derived Fab denoted herein
- nucleotide sequence encoding the VH domain having the amino acid sequence shown as SEQ ID NO:275 comprises the nucleotide sequence shown as SEQ ID NO: 348
- nucleotide sequence encoding the VL domain having the amino acid sequence shown as SEQ ID NO:277 comprises the nucleotide sequence shown as SEQ ID NO:349.
- a recombinant polynucleotide encoding it may be prepared (using standard molecular biology techniques) and inserted into a replicable vector for expression in a chosen host cell, or a cell-free expression system.
- Suitable host cells may be prokaryote, yeast, or higher eukaryote cells, specifically mammalian cells.
- useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen. Virol.
- monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad. Sci.
- host cell generally refers to a cultured cell line.
- the invention also provides a method of producing a CD70 antibody of the invention which comprises culturing a host cell (or cell free expression system) containing polynucleotide (e.g. an expression vector) encoding the CD70 antibody under conditions which permit expression of the CD70 antibody, and recovering the expressed CD70 antibody.
- a host cell or cell free expression system
- polynucleotide e.g. an expression vector
- This recombinant expression process can be used for large scale production of CD70 antibodies according to the invention, including monoclonal antibodies intended for human therapeutic use.
- Suitable vectors, cell lines and production processes for large scale manufacture of recombinant antibodies suitable for in vivo therapeutic use are generally available in the art and will be well known to the skilled person.
- CD70 antibodies provided herein including in particular antibodies based on the Fab 27B3 and its germlined variants such as 4 ID 12 (ARGX-110) display characteristics which are particularly beneficial for large-scale commercial manufacture. Specifically, the extremely high production yield (>4g/L) achievable in a commercial scale recombinant expression system will dramatically reduce production costs.
- Preferred embodiments also exhibit thermal stability when tested at 37°C and also over several freeze-thaw cycles, which is again extremely beneficial for commercial manufacture and storage of a clinical product.
- several of the human germlined variants of Fab 27B3, including 4 ID 12 and 40F1 exhibit improved thermal stability compared to 27B3 itself.
- the invention provides an isolated antibody or antigen binding fragment thereof which binds to human CD70, said antibody or fragment comprising a heavy chain variable domain corresponding to the amino acid sequence set forth in SEQ ID NO: 178, provided that at least one amino acid at a Kabat position selected from the group consisting of H6, H18, H24, H31, H56, H74, H74, H77, H79, H83, H84, H89, H93, H94, H108, HI 10, and HI 12 is substituted with another amino acid.
- This antibody, or antigen binding fragment thereof may exhibit greater thermal stability than an antibody, or antigen binding fragment thereof, comprising a heavy chain variable domain with the amino acid sequence set forth in SEQ ID NO: 178.
- a CD70 antibody or antigen binding fragment which comprises a light chain variable domain corresponding to the amino acid sequence set forth in SEQ ID NO:201, provided that at least one amino acid at a Kabat position selected from the group consisting of L2, Ll l, L12, L25, L26, L30, L46, L53, L60, L61, L67, L68, L76, L80, L81, L85, and L87 is substituted with another amino acid.
- This antibody, or antigen binding fragment thereof may exhibit greater thermal stability than an antibody, or antigen binding fragment thereof, comprising a heavy chain variable domain with the amino acid sequence set forth in SEQ ID NO:201.
- the CD70 antibody, or antigen binding fragment thereof may comprise:
- a heavy chain variable domain with the amino acid sequence set forth in SEQ ID NO: 178 comprising one or more amino acid substitutions at Kabat positions selected from the group consisting of H6, H18, H24, H31, H56, H74, H74, H77, H79, H83, H84, H89, H93, H94, H108, HI 10, and HI 12; and b) a light chain variable domain with the amino acid sequence set forth in SEQ ID NO:201 comprising one or more amino acid substitutions at Kabat positions selected from the group consisting of L2, Ll l, L12, L25, L26, L30, L46, L53, L60, L61, L67, L68, L76, L80, L81, L85, and L87.
- This antibody, or antigen binding fragment thereof, of claim 24, may exhibit greater thermal stability than an antibody, or antigen binding fragment thereof, comprising a heavy chain variable domain with the amino acid sequence set forth in SEQ ID NO: 178 and a light chain variable domain with the amino acid sequence set forth in SEQ ID NO:201.
- CD70 antibodies, or antigen binding fragments thereof, provided herein can be used to inhibit the growth of cancerous tumour cells in vivo and are therefore useful in the treatment of CD70-expressing cancers.
- aspects of the invention relate to methods of inhibiting tumour cell growth in a human patient, and also methods of treating or preventing cancer, which comprise administering to a patient in need thereof a therapeutically effective amount of a CD70 antibody or antigen binding fragment as described herein.
- Another aspect of the invention provides a CD70 antibody or antigen binding fragment as described herein for use inhibiting the growth of CD70-expressing tumour cells in a human patient.
- a still further aspect of the invention provides a CD70 antibody or antigen binding fragment as described herein for use treating or preventing cancer in a human patient.
- Preferred cancers whose growth may be inhibited using the CD70 antibodies described herein include renal cancer (e.g., renal cell carcinoma), breast cancer, brain tumors, chronic or acute leukemias including acute myeloid leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, lymphomas (e.g., Hodgkin's and non-Hodgkin's lymphoma, lymphocytic lymphoma, primary CNS lymphoma, T-cell lymphoma), nasopharyngeal carcinomas, melanoma ⁇ e.g., metastatic malignant melanoma), prostate cancer, colon cancer, lung cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, uterine cancer, carcinoma of the fallopian tubes
- CD70 antibodies described herein can also be used to treat a subject with a tumorigenic disorder characterized by the presence of tumor cells expressing CD70 including, for example, renal cell carcinomas (RCC), such as clear cell RCC,
- RCC renal cell carcinomas
- glioblastoma breast cancer, brain tumors, nasopharangeal carcinomas, non- Hodgkin's lymphoma (NHL), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), Burkitt's lymphoma, anaplastic large-cell lymphomas (ALCL), multiple myeloma, cutaneous T-cell lymphomas, nodular small cleaved-cell lymphomas, lymphocytic lymphomas, peripheral T-cell lymphomas, Lennert's lymphomas, immunoblastic lymphomas, T-cell leukemia/lymphomas (ATLL), adult T-cell leukemia (T-ALL), entroblastic/centrocytic (cb/cc) follicular lymphomas cancers, diffuse large cell lymphomas of B lineage, angioimmunoblastic lymphadenopathy (AILD)-like T cell lymphoma, HIV associated body cavity based lymphomas
- any one of the above-listed cancers may be treated using an antibody comprising the Fab regions of 4 ID 12 (germlined variant of 27B3) fused to the constant regions of human IgGl.
- the human IgGl constant region may be further engineered in order to maximise antibody effector functions (e.g. by addition of point mutations), or the 4 ID 12- IgGl antibody may be non-fucosylated, again to enhance antibody effector function.
- the CD70 antibodies described herein, particularly 27B3 and its germlined variants exhibit particularly strong binding to human cancer cell lines which express cell-surface CD70 at low copy number, such as for example the large B cell lymphoma cell line SU-DHL-6, the chronic lymphocytic leukemia cell line JVM-2, the cutaneous T cell lymphoma cell line HH, the gastric carcinoma cell line MKN-45, the lung carcinoma cell lines A549 and EBC-1, the melanoma cell lines WM852 and
- the affinity of 4 ID 12 (ARGX-110) for these low copy- number cancer cell lines is significantly higher than comparator prior art antibodies, such as SGN70 and MDX1411.
- the "improved" affinity for low copy-number cancer cell lines is of direct relevance for clinical treatment of the corresponding cancers, as demonstrated by the cell spiking experiments in the accompanying examples.
- a low copy-number cell line e.g. the diffuse large B cell lymphoma cell line SU-DHL-6
- cells of the cancer cell line are spiked into freshly isolated PBMCs from healthy donors.
- a further aspect of the invention relates to a method of treating or preventing cancer, which comprises administering to a patient in need thereof a therapeutically effective amount of a CD70 antibody or antigen binding fragment as described herein, wherein the cancer is a cancer which exhibits low copy-number expression of CD70.
- the invention also provides a CD70 antibody or antigen binding fragment as described herein for use treating or preventing cancer in a human patient, wherein the cancer is a cancer which exhibits low copy-number expression of CD70.
- the low copy-number cancer is preferably selected from the group consisting of: large B cell lymphoma, chronic lymphocytic leukaemia, cutaneous T cell lymphoma, gastric cancer, lung cancer, melanoma, glioblastoma and ovarian cancer.
- Specific embodiments relate to treatment of low copy-number cancers with an antibody comprising the llama-derived Fab 27B3, or one of its germlined variants, including in particular 4 ID 12 (ARGX-110).
- any one of the above-listed low copy-number cancers may be treated using an antibody comprising the Fab regions of 41D12 (germlined variant of 27B3) fused to the constant regions of human IgGl.
- the CD70 antibodies described herein are also useful for the treatment of immunological disorders characterised by expression of CD70.
- immunological disorders include the following: rheumatoid arthritis, autoimmune demyelinative diseases (e.g., multiple sclerosis, allergic encephalomyelitis), endocrine ophthalmopathy, uveoretinitis, systemic lupus erythematosus, myasthenia gravis, Grave's disease, glomerulonephritis, autoimmune hepatological disorder, inflammatory bowel disease (e.g., Crohn's disease, ulcerative colitis, Celiac disease), anaphylaxis, allergic reaction, Sjogren's syndrome, type I diabetes mellitus, primary biliary cirrhosis,
- autoimmune demyelinative diseases e.g., multiple sclerosis, allergic encephalomyelitis
- endocrine ophthalmopathy e.g., uveoretinitis
- systemic lupus erythematosus e.g., myasthenia gravis
- Thl - lymphocytes e.g., rheumatoid arthritis, multiple sclerosis, psoriasis, Sjorgren's syndrome, Hashimoto's thyroiditis, Grave's disease, primary biliary cirrhosis, Wegener's
- Th2- lymphocytes e.g., atopic dermatitis, systemic lupus erythematosus, atopic asthma, rhinoconjunctivitis, allergic rhinitis, Omenn's syndrome, systemic sclerosis, or chronic graft versus host disease
- Churg Strauss syndrome microscopic polyangiitis and Takayasu's arteritis.
- any one of the above-listed cancers may be treated using an antibody comprising the Fab regions of 4 ID 12 (germlined variant of 27B3) fused to the constant regions of human IgGl.
- the human IgGl constant region may be further engineered in order to maximise antibody effector functions (e.g. by addition of point mutations), or the 41D12-IgGl antibody may be non-fucosylated, again to enhance antibody effector function.
- treating means slowing, interrupting, arresting, controlling, ameliorating, stopping, reducing severity of a symptom, disorder, condition or disease, but does not necessarily involve a total elimination of all disease-related symptoms, conditions or disorders.
- the CD70 antibodies described herein may be administered to a human subject in need of treatment in an "effective amount".
- the term "effective amount” refers to the amount or dose of a CD70 antibody which, upon single or multiple dose administration to a human patient, provides therapeutic efficacy in the treatment of disease.
- Therapeutically effective amounts of the CD70 antibody can comprise an amount in the range of from about 0.1 mg/kg to about 20 mg/kg per single dose.
- a therapeutic effective amount for any individual patient can be determined by the healthcare professional by monitoring the effect of the CD70 antibody on a biomarker, such as cell surface CD70 in tumour tissues, or a symptom such as tumour regression, etc.
- the amount of antibody administered at any given time point may be varied so that optimal amounts of CD70 antibody, whether employed alone or in combination with any other therapeutic agent, are administered during the course of treatment. It is also contemplated to administer the CD70 antibodies described herein, or pharmaceutical compositions comprising such antibodies, in combination with any other cancer treatment, as a combination therapy. Use of antibodies which are poorly internalised to deplete CD70-expressing cells
- CD70 antibodies bound to CD70 expressed on the surface of cancer cell lines are poorly internalised. This is a surprising result, since the prior art has previously described CD70 as an "internalising target". Although there is variation between different cancer cell types in the precise degree of internalisation of bound CD70 antibodies, no cancer cell type is observed to "fully internalise" the bound CD70 antibody. For example, renal cancer cell lines previously described as rapidly internalising in fact are shown to internalise a maximum of about 70% of bound antibody ARGX-110. Many other cancer cell lines internalise less than 30%, less than 20% or even less than 10% of bound ARGX-110.
- CD70 antibodies with strong effector function in order to deplete (e.g. kill or inhibit the growth of) cancer cells in vivo. Since bound CD70 antibodies are relatively poorly internalised on many cancer cells, the antibody will remain bound to the cell surface and can thereby trigger effector functions (ADCC, CDC, ADCP) by interactions with the immune system of a human patient.
- ADCC effector functions
- a further important aspect of the invention relates to a method of depleting CD70-expressing cells in a human patient, comprising administering to said patient an effective amount of an antibody which binds to human CD70, wherein said CD70-expressing cells exhibit 30% or less, 25% or less, 20% or less, 15% or less, 10% or less or 5% or less internalisation of said antibody after a period of 6 hours, and wherein said antibody exhibits at least one effector function selected from the group consisting of ADCC, CDC and ADCP.
- the CD70 antibody (with active effector functions) is used to deplete CD70 expressing cells.
- This depletion of CD70-expressing cells may form the basis of therapeutic or prophylactic treatment, e.g. for treatment of prevention of CD70- expressing cancers, or for treatment of prevention of CD70-associated immunological disorders.
- the precise mechanism by which CD70-expressing antibodies are depleted may depend on the type of effector functions exhibited by the CD70 antibody, but will be dependent on strong (high affinity) binding of the CD70 antibody to cell-surface CD70, coupled with poor internalisation of the bound antibody.
- the CD70-expressing cells are CD70-expressing cancer cells.
- the CD70-expressing cancer cells may be of a cancer type selected from the group consisting of: Burkitt lymphoma, large B cell lymphoma, Hodgkin lymphoma, non-Hodgkin lymphoma, mantle cell lymphoma, chronic lymphocytic leukemia, pancreatic carcinoma, gastric carcinoma, glioblastoma and lung carcinoma. Cell lines derived from each of these cancers have been demonstrated to internalise 30% or less of bound CD70 antibody over a period of 6 hours.
- CD70- expressing cancer cells may be of a cancer type selected from the group consisting of: Burkitt lymphoma, large B cell lymphoma, Hodgkin lymphoma, non-Hodgkin
- CD70-expressing cancer cells may be of a cancer type selected from the group consisting of: Burkitt lymphoma, large B cell lymphoma, mantle cell lymphoma, chronic lymphocytic leukemia, gastric carcinoma and lung carcinoma. Cell lines derived from each of these cancers have been demonstrated to internalise 10% or less of bound CD70 antibody over a period of 6 hours.
- the CD70-expressing cells may be CD70-expressing activated T cells, which do not exhibit any detectable internalisation of bound CD70 antibodies (specifically no internalisation of ARGX-110 is observed over a period of 6 hours.
- CD70 antibodies with strong effector function ADCC, CDC or ADCP
- ARGX-110 an effector function
- CD70+ activated T cells include autoimmune disorders such as for example rheumatoid arthritis, psoriasis, SLE, etc.
- the antibody can be any CD70 antibody which has been shown experimentally to exhibit 30% or less, 25% or less, 20% or less, 15% or less, 10% or less or 5% or less internalisation after a period of 6 hours in a CD70-expressing cancer cell line selected from the group consisting of Raji, SU-DHL-6, MHHPREB 1, Mino, Mecl, JVM-2, MKN-45, A549, U87MG, PANC-1, PANC-89, L428, Granta 519, Rec-1 and EBC-1.
- a CD70-expressing cancer cell line selected from the group consisting of Raji, SU-DHL-6, MHHPREB 1, Mino, Mecl, JVM-2, MKN-45, A549, U87MG, PANC-1, PANC-89, L428, Granta 519, Rec-1 and EBC-1.
- the cell line internalisation assay described in the accompanying examples can be used as a screen both to determine whether particular disease indications should be targeted with CD70 antibodies having strong effector function, or with CD antibody-drug conjugates (discussed below), and also to identify suitable CD70 antibodies for use in treating particular disease indications.
- the invention also provides a method of depleting CD70-expressing cancer cells in a human patient, comprising administering to said patient an effective amount of an antibody which binds to human CD70, wherein said antibody exhibits 30% or less internalisation after a period of 6 hours in a CD70-expressing cancer cell line selected from the group consisting of Raji, SU-DHL-6, MHHPREB 1, Mino, Mecl, JVM- 2, MKN-45, A549, U87MG, PANC-1, PANC-89, L428, Granta 519, Rec-1 and EBC-1, and wherein said antibody exhibits at least one effector function selected from the group consisting of ADCC, CDC and ADCP.
- a CD70-expressing cancer cell line selected from the group consisting of Raji, SU-DHL-6, MHHPREB 1, Mino, Mecl, JVM- 2, MKN-45, A549, U87MG, PANC-1, PANC-89, L428, Granta 519, Rec-1 and EBC-1
- the antibody to be used to deplete CD70-expressing cancer cells in a human patient may be an antibody which exhibits 10% or less internalisation over a period of 6 hours in a CD70-expressing cancer cell line selected from the group consisting of Raji, SU-DHL-6, Granta 519, Rec-1, Mecl, JVM-2, MKN-45, A549 and EBC-1, and also exhibits at least one effector function selected from the group consisting of ADCC, CDC and ADCP.
- Preferred embodiments may utilise an antibody comprising the llama-derived Fab 27B3, or one of its germlined variants, including in particular 4 ID 12 (ARGX-110). Particularly preferred embodiments utilise an antibody comprising the Fab regions of 4 ID 12
- human IgGl constant region may be further engineered in order to maximise antibody effector functions (e.g. by addition of point mutations), or the 4 ID 12- IgGl antibody may be non-fucosylated, again to enhance antibody effector function.
- the antibodies used in this aspect of the invention are not immunoconjugates in which the CD70 antibody is linked to a pharmaceutical agent, cytotoxic agent, cytostatic agent, drug moiety, etc.
- a particular advantage of this aspect of the invention is avoidance of the need to use antibody-drug conjugates, which is desirable both from a patient-safety perspective (avoids administration of potentially toxic agents) and an economic perspective (avoids costly synthesis of antibody-drug conjugates).
- a further important aspect of the invention relates to a method of depleting CD70-expressing cells in a human patient, comprising administering to said patient an effective amount of an antibody-drug conjugate comprising an antibody which binds to human CD70 and a cytotoxic or cytostatic drug moiety, wherein said CD70- expressing cells exhibit 30% or more, 40% or more, 50% or more, or 60% or more internalisation of said antibody which binds to human CD70 after a period of 6 hours.
- the CD70- expressing cells may internalise between 40% and 70%, preferably between 50% and 70% of the CD70 antibody which forms the basis of the antibody-drug conjugate within a period of 6 hours.
- the CD70 antibody-drug conjugate is used to deplete CD70 expressing cells.
- This depletion of CD70-expressing cells may form the basis of therapeutic or prophylactic treatment, e.g. for treatment of prevention of CD70- expressing cancers, or for treatment of prevention of CD70-associated immunological disorders.
- the precise mechanism by which CD70-expressing antibodies are depleted may depend on the nature of the antibody-drug conjugate, i.e. whether the "drug" moiety is cytotoxic or cytostatic, but will be dependent on strong (high affinity) binding of the CD70 antibody to cell- surface CD70, coupled with significant internalisation of the bound antibody.
- the CD70-expressing cells are CD70-expressing cancer cells.
- the CD70-expressing cancer cells may be of a cancer type selected from the group consisting of: cutaneous T cell lymphoma, multiple myeloma, renal cell carcinoma, astrocytoma, melanoma and ovarian carcinoma. Cell lines derived from each of these cancers have been demonstrated to internalise more than 30% of bound CD70 antibody over a period of 6 hours.
- the CD70-expressing cancer cells may be of a cancer type selected from the group consisting of: renal cell carcinoma, astrocytoma, melanoma and ovarian carcinoma. Cell lines derived from each of these cancers have been demonstrated to internalise more than 50% of bound CD70 antibody over a period of 6 hours.
- the antibody-drug conjugate may be based on any of the CD70 antibodies described herein, which bind human CD70 with extremely high affinity.
- the antibody-drug conjugate may be based on an antibody comprising the llama-derived Fab 27B3, or one of its germlined variants, including in particular 4 ID 12.
- the features of antibody-drug conjugates intended for human therapeutic use are generally known in the art, particularly with regard to the nature of the "drug" moiety, e.g. a cytotoxic or cytostatic agent, and means of conjugation of the drug moiety to the CD70 antibody moiety. Examples of CD70 antibody-drug conjugates are given, for example, in WO 2004/073656.
- compositions containing one or a combination of CD70 antibodies of the invention, or antigen- binding fragments thereof, formulated with one or more a pharmaceutically acceptable carriers or excipients.
- Such compositions may include one or a combination of (e.g., two or more different) CD70 antibodies.
- RNA yields of 450 ⁇ g were achieved, of which an 80 ⁇ g aliquot was used for random cDNA synthesis and subsequent amplification of VHCH1, V C and VKCK gene segments.
- V C and VKCK libraries were constructed using a two step PCR, in which 25 cycles with non tagged primers was done followed by 10 cycles using tagged version of these primers (De Haard H, et ah, Biol. Chem. 274, 1999).
- the VHCH1 libraries were built in parallel using the same approach. The sizes of the individual
- the final phage display libraries were between 5x10 and 2x10 cfu. Quality control of the libraries by analysis of percentage of full length Fab containing clones was routinely performed using PCR.
- Two-to-three rounds of phage selections were done on either captured recombinant CD70 (Flag-TNC-CD70) or on directly coated CD70 using standard protocols. Elution of bound phage was done with trypsin.
- Flag-TNC-CD70 is captured by an anti-Flag mAb and binding of CD27-Fc is detected via a biotinylated anti-CD27 mAb and strep-HRP in the absence or presence of CD70 Fabs (figure 2 and 3) or CD70 mAbs (figure 4).
- Figure 2B it can be seen that 27B3, which has an identical VH as 9D1, but contains a somewhat different light chain, seems to block binding of CD27 to CD70 more efficiently, which was in line with the better off rate of this Fab as measured on Biacore (data not shown).
- Table 3 indicates the blocking potency (expressed as IC50) for the various llama-human chimeric mAbs tested in the CD70 inhibition ELISA.
- Fab 27B3 has an IC50 of around 0.4 nM, which even seems to improve upon formatting into a chimeric llama - human IgGl yielding an IC 50 of 0.25nM, whereas mAb 9D1 with the other light chain is 3-fold less potent (0.73 nM).
- Figure 3 is a composite of an experiment testing llama CD70 Fabs for blocking activity (in the inhibition ELISA, see white bars) and for CD70 binding (binding ELISA, black bars).
- Flag-TNC-CD70 is captured by an anti-Flag mAb and binding of the Fabs is detected using an anti-myc-HRP mAb, which recognizes the MYC tag fused to the C-terminus of the Fd fragment.
- known monoclonal antibodies to CD70 SGN70 described in US 2010/0129362 Al, clone 1F6; and MDX69A7 described in WO2008/074004 figure 5A and 5B were tested in parallel.
- Table 3 Blocking potency expressed as IC50 (ng/ml) for individual SIMPLE antibodies (mAbs) and benchmarks SGN70 and MDX69A7 as measured in the CD70 inhibition ELISA using recombinant human CD70.
- 59D10 107 mAbs 27B3 and 57B6 was also tested for their ability to inhibit the interaction between rhesus recombinant CD70 (FLAG-TNC -rhesus CD70) and CD27.
- the IC50 value determined by the inhibition ELISA described above was 150 and 135 ng/ml,
- Off -rates of the purified llama-derived anti-CD70 blocking Fabs were determined using the Biacore.
- Recombinant human CD70 was immobilized on a CM5 Biacore chip. The immobilization was performed in accordance with a method provided by Biacore and by using the NHS/EDC kit (Biacore AB): after activation of the chip, a solution of 50 ⁇ g/ml of recombinant CD70 in lOmM acetate buffer with pH of 5 was prepared and ⁇ of this solution (50ng) was injected resulting in a surface density of approximately 1000 RU.
- Fabs for the CD70 mAbs ARGX-110, MDX2H5 and SGN70 were prepared by trypsin digestion (SGN70 and MDX69A7 are described elsewhere herein, MDX2H5, also referred to as MDX1411, is described in WO2008/074004 figure 1A and IB).
- Fabs, at a concentration of approximately 100-400 ⁇ g/ml were diluted 6-fold in hepes-buffered saline (0.1M Hepes, 1.5M NaCl, 30mM EDTA, 0.5% v/v surfactant P20). They were injected (30 ⁇ 1) and passed through the flow cells at a flow rate of 30 ⁇ 1/ ⁇ .
- the off -rate was monitored for a period of 10 minutes. After the dissociation, the flow cell surfaces were regenerated by injecting 5 ⁇ 1 of lOmM NaOH. Sometimes multiple injections of NaOH were needed to regenerate the surfaces depending on the affinity of the Fabs. Off-rate analysis was done by applying the
- the off-rates of the llama-derived Fabs for human CD70 are much better than for the reference mAb derived Fabs (7-30 x 10 "4 s "1 ).
- the llama-derived Fabs with the best off-rates were shown to have comparable off-rates to that of CD27 for its interaction with CD70 (0.8 x 10 "4 s "1 ).
- the lower limit for measurement of off-rates using Biacore is around 0.4 x 10 "4 s "1 .
- the llama-derived Fabs with off-rates falling close to this limit as assessed by Biacore may in fact exhibit even a higher affinity for CD70.
- Example 5 Binding of chimeric llama-human CD70 mAbs to CD70 positive cells
- VH and VL of interesting llama-derived Fab clones were fused to constant regions of human IgGl and to human C (all variable light chain regions are of lambda origin) and produced as bivalent chimeric monoclonal antibodies in the system described in patent application WO 2009/145606.
- the chimeric llama-human mAbs were purified on Protein A followed by gel filtration.
- 786-0 cells were incubated with a 1/5 dilution series of chimeric llama-human CD70 inhibiting mAbs (20 ⁇ g/ml - 0.25 ng/ml) and binding of the mAbs to the cells was detected using an anti-human Fc-FITC antibody (1/500 diluted conjugate AF006 from supplier Binding Site). Fluorescence of 10,000 cells/condition was measured using a flow cytometer and the median fluorescence was plotted. The results are shown in figure 5.
- SIMPLE antibody 1C2 which as Fab showed to have the best off rate and blocking potency, was not able to recognize cell surface expressed CD70 (data not shown) and therefore was not studied furthermore.
- SIMPLE antibody 27B3 has the best affinity for cell bound receptor with an EC50 of 0.24 nM.
- NHL-derived MHH-PREB-1 cells (10 5 cells) were incubated with a concentration gradient of chimeric llama-human CD70 inhibiting mAbs (20 ⁇ g/ml- 0.25 ng/ml) and binding of the mAbs to the cells was detected using anti- human IgG-FITC antibody.
- the results are shown in Figure 5B.
- the EC50 values for 57B6 and 59D10 were 83 and 74 ng/ml, respectively.
- Example 6 Inhibition in co-culture experiments by chimeric llama-human CD70 mAbs
- Fibrosarcoma cell line HT1080 transfected with human CD27 secretes IL-8 upon ligation with trimeric recombinant CD70 and blocking of this interaction with a neutralizing mAb can be measured by reduced cytokine levels.
- a modified version of the assay was applied in which the B cell lymphoma Raji cell line served as source of CD70, although the molecule is expressed on the cell surface and therefore is more relevant than soluble CD70.
- Raji cells were cultured and checked for CD70 expression by FACS analysis. Cells were then mixed in a 96-well tissue culture plate (50,000 cells/well) with the anti- CD70 mAbs and incubated at RT for 1 hour. HT1080-CD27 cells were added (10,000 cells/well) and thoroughly mixed. Co-cultures were transferred to the incubator and grown overnight at 37°C. Supematants were collected and analyzed for their IL-8 content by ELISA. The results for the SIMPLE antibodies are shown in figure 6 and are compared to reference CD70 mAbs.
- IC50 values for the chimeric llama-human CD70 mAbs are between 3 and 517 ng/ml as compared to 42 ng/ml for SGN70 and 143 ng/ml for MDX69A7 (see table 5).
- SIMPLE antibodies 27B3 (IC50 of 33 pM) and 9G2 (IC50 of 20 pM) are 10 to 20 fold more potent than benchmark SGN70 (IC50 of 370 pM) that again is 3 fold more potent than benchmark MDX69A7 (1 nM). It can therefore be concluded that the chimeric llama-human mAbs are extremely potent in blocking the interaction between CD27 and CD70 and outperform the benchmark antibodies in this highly relevant bioassay.
- ADCC Antibody Dependent Cellular Cytoxicity
- the target cells were 786-0 cells (RCC) and were labeled with Cr 51 .
- Target to effector cell ratio was 1:20 and the incubation was performed for 2 hours with the antibody present at different concentrations in the culture medium.
- Chimeric llama-human mAbs as well as the benchmark antibodies were tested for ADCC activity on 786-0 cells at different concentrations.
- % Lysis (sample CPM-spontaneous release CPM)/(maximum release CPM- spontaneous release CPM)xl00.
- SIMPLE mAb 27B3 has a potency of around 1 g/ml and therefore is 10 fold more potent than the affinity variant 9D1 that has a comparable IC50 as benchmark SGN70, which again is 2.5 fold more potent in ADCC than benchmark MDX69A7.
- SIMPLE antibody 27B3 combines best in class receptor - ligand blocking potency with superior ADCC potency and therefore has a favourable therapeutic profile.
- CDC Complement Dependent Cytotoxicity
- U266 cells were mixed with chimeric llama-human mAbs (figure 8, upper panel) or the reference CD70 mAbs (fig 8, lower panel) at 0.001-20 ⁇ g/ml in the absence or presence of 9% human serum and incubated for 2h at 37°C. Cells were spun down and Propidium Iodide was added to determine the number of dead cells. Cell lysis was measured in FACS. CDC activity was demonstrated for all chimeric llama- human mAbs on U266 cells in the presence of 9% human serum. SIMPLE antibody 27B3 has a similar IC50 as benchmark SGN70, while again MDX69A7 is 10 fold less potent.
- ADCP Antibody Dependent Cellular Phagocytosis
- PBMC peripheral blood mononuclear cells
- 8.0 x 10 4 target cells (786-0 cells) loaded with the red dye PKH26 were incubated with mAb for 30 minutes on ice in a V-bottom 96 well plate.
- 2.0 xlO 4 MDM cells were added (target to effector (786-0 to MDM) ratio of 4: 1) and after 1 hour of incubation at 37°C, the cells were centrifuged, resuspended in ⁇ PBS 1% BSA and transferred to a V-bottom 96 well plate.
- Anti-CD 1 lb monoclonal antibody (FITC conjugated) for staining of macrophages was added for 30 min while keeping the plates on ice, cells were then washed two times with PBS and fixed with 1% paraformaldehyde (in PBS). Samples were analysed by FACS, where phagocytosis was scored on double stained cells. The results are shown in Figure 9 and these demonstrate that all chimeric llama-human mAbs tested are potent in inducing ADCP.
- SIMPLE antibody 27B3 induces phagocytosis of up to 50% of the labelled tumour cells by macrophages at concentrations of 1 g/ml with an IC50 of around 100 ng/ml (0.4 nM).
- ADC Antibody Drug Conjugates
- Example 11 In vivo efficacy of chimeric llama-human mAbs in a tumour xenograft model
- C.B.-17 severe combined immunodeficient mice (SCID) mice (Harlan, Indianapolis, IN). After injection, all of the mice were pooled and then placed randomly into the various treatment groups, with 9 mice per group. Antibodies were administered in 0.5 ml at day 1, 4, 8, 11, 15 after the cell implantation by intraperitoneal injection. Mice were monitored at least twice per week and were sacrificed when they exhibited signs of disease, including weight loss of 15% to 20%, hunched posture, lethargy, cranial swelling, or dehydration. Mice received treatment with 4 ID 12 mAb in a dose response.
- Fc-dead version of 4 ID 12 was tested at 10 mg/kg. This Fc-dead version has been described before in the literature and has no ADCC and CDC activity and much lower ADCP activity (McEarchern et al, Clin Cancer Res (2008) 14(23):7763-72).
- Results are shown as survival curves in figure 11. These data show that the median survival time for the control mice is 27 days. Median survival time was prolonged to at least 67 days when doses equal to or higher than 0.1 mg/kg of 4 ID 12 were administered. The dose of 0.01 mg/kg is still efficacious.
- the Fc-dead version of 41D12 has no potency in vivo, illustrating the important of ADCC, CDC and ADCP in this model.
- Example 12 Expression of non-fucosylated mAbs
- Table 7 sequence of CD70 specific llama-derived VL (Q in bold encoded by amber
- Human germline genes segments with the same canonical fold structure and the highest amino acid sequence identity to the VH and VL regions of mAb 27B3 were identified by comparison with known human germline gene sequences.
- the closest human VH and VL regions to mAb 27B3 was human VH3-48 (89.7% FR identity) and human VL8-61 (86.1% FR identity), respectively.
- the closest human germline JH and JL human germline gene segment sequences were JH5 and JL7, respectively. Sequence alignment of the VH and VL regions of mAb 27B3 with the closest human germline VH and VL sequences are set forth in Figure 12.
- Table 10 Targeted mutations in the 27B3 VH amino acid sequence. 3 ⁇ 4 denotes the library size needed to cover all potential mutants.
- Table 11 Targeted mutations in the 27B3 VL amino acid sequence. 3 ⁇ 4 denotes the library size needed to cover all potential mutants. * denotes mutations in the CDR1 or CDR2 regions.
- VH_27B3 and VL_27B3 encompassing all combinations of humanizing mutations were created by PCR based assembly (see e.g., Stemmer et al., Gene (1995) 164: 49 - 53). Overlapping oligonucleotides with specific mutations on certain positions were assembled by PCR.
- the library contained both human and llama amino acids at each mutated position to prevent complete loss of binding in the event that the wild type llama residue was critical for high affinity binding (see e.g., Baca et al., J. Biol. Chem. (1997) 272: 10678 - 10684; Tsurushita et al., J. Immunol.
- the VH library contained about 1 x 10 10 clones and the VL library about 8 x 10 9 clones.
- the VH and VL libraries were combined and reformatted into a single Fab library with a size of 1 x 10 10 clones (91% with full length Fab insert) suitable for phage display screening. To required diversity to cover all possible mutations as mentioned in tables 10 and 11 was exceeded in the primary heavy chain and light chain libraries, but also the combined Fab library was large enough to cover all possible permutations (1.89 x 10 7 ).
- Example 14 Selection of germlined 27B3 Fabs with high human FR identity
- Phage display was used to select for germlined 27B3 Fabs with both a high affinity for CD70 and high human FR identity. Specifically, Flag-TNC-CD70 was biotinylated and was incubated at various concentrations with different amounts of Fab expressing phage. Complexes of phage and Flag-TNC-CD70 were then captured on a streptavidin-coated microtiter plate and washed with non-biotinylated Flag-TNC-CD70 at
- Phage eluted from rounds 3, 4 and 5 of selection were transfected into TGI and plated clonally; individual clones were picked randomly for further analysis.
- Periplasmic fractions containing Fabs were prepared from IPTG induced small scale cultures the off rate of each Fab was determined using a CD70 coated CM5 chip in a Biacore binding assay.
- Clones with Fab having off rates similar to that of 27B3 were sequenced. Off rates for clones with a total human FR sequence identity above 94% are set forth in Table 13, along with the percentage human FR identity of the individual clone (VH, VL and total).
- Table 13 Off rate of germlined 27B3 Fab clones with more than 94% total human FR identity.
- Table 14A VH amino acid sequences of germlined 27B3 clones with more than 94% total human identity, with sequence identifiers broken down by FR and CDR.
- Table 14B VH amino acid sequences of germlined 27B3 clones with more than 94% total human identity, with sequence identifiers for the full VH amino acid sequence. 213 53F1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSVYYMNWVRQAPGKGLEWVSDINNEGGTTYYADSVKG RFTISRDNAKNTLTLQMNSLKPEDTA3 ⁇ 4YYCVRDAGYSNHVPIFDSWGQGTQV3 ⁇ 4VAS
- Table 15B VL amino acid sequences of germlined 27B3 clones with more than 94%
- Example 15 Temperature stability of germlined 27B3 mAbs
- the temperature stability of germlined 27B3 mAbs: 41D12, 35G2 and 40F1 was further studied using a variety of techniques. Aliquots (1 ml) of the test mAbs at a concentration of 100 ⁇ g/ml were prepared in Delbucco' s PBS containing 0.02% Tween. A negative control aliquot consisting of buffer only (Delbucco' s PBS containing 0.02% Tween) and a positive control aliquot consisting of mAb in Delbucco' s PBS containing 0.02% Tween were also prepared. For each mAb preparation, aliquots were stored at 4 °C, at RT and at 37 °C for a period of 0-8 weeks. 50 ⁇ samples were removed from the aliquots on days 1, 7, 14, 21, 28, 35, 56 and 92 for analysis. A sample was stored at -20°C and used as reference.
- the relative IC50's for the germlined 27B3 mAbs compared to the parental 27B3 are given in table 18 for both ADCC potency and CD70/CD27 blocking potency in the Raji co-culture assay (as described in example 6).
- a figure of ⁇ 1.0 denotes improved IC50 for germlined variant relative to parental 27B3. From these data it can be concluded that germlined variant 4 ID 12 maintained the ADCC potency as well as the CD70/CD27 blocking potency combined with the best T m .
- Table 18 Relative IC50's of germlined 27B3 variants in the 786-0 based ADCC assay and neutralization in Raji based bioassay compared to that of parental mAb clone
- a double gene vector encoding the VH and VL amino acid sequences of germlined 27B3 clone 4 ID 12 was produced (za allotype).
- Nucleotide sequences encoding the heavy chain (SEQ ID NO:344) and light chain (SEQ ID NO:345) of 4 ID 12 are given in Table 30 below.
- Potelligent® CHOK1SV cells were stably transfected with the double gene vector by electroporation. Six rounds of transfection were performed. In each round, the cells from each electroporation were added to 200 mL of chemically defined animal component free (CDACF) medium CM63 and plated out over forty 96-well plates at 50 ⁇ ⁇ per well. The day after transfection, 150 ⁇ ⁇ of the CM63 medium containing the selective agent L- methionine sulphoximine (MSX) was added to each well to give a final MSX
- CDACF chemically defined animal component free
- Cultures of these 70 cell lines were initially expanded in static culture and subsequently into suspension culture. Thirty cell lines that exhibited acceptable growth were selected and evaluated further in a batch shake-flask culture productivity screen. Cultures were gassed on days 4, 6, 8 and 10 and harvested on day 12. The concentration of antibody in the harvest supernatant samples was determined in HPLC using Protein A containing column. The antibody concentrations in the samples from the 30 cell lines ranged from
- Table 24 Summary of growth and productivity data for 20 selected cell lines, expressing the APvGX-110 antibody, grown in CDACF fed-batch shake-flask cultures. Maximum Viability Antibody Specific
- Example 18 Affinity of CD70 mAbs 18.1 Affinity for cancer cell lines expressing CD70
- the third column of the table shows whether ARGX-110 binds with low (+), medium (++) or high (+++) affinity to the various cell lines tested.
- the FACS signal (MFI) for ARGX- 110 is divided by the FACS signal (MFI) for SGN70 for the experiment carried out at 37 °C.
- Table 25 Binding of CD70 mAbs ARGX-110 and SGN70 to cancer call lines
- CLL chronic lymphocytic leukaemia
- the plate was washed twice with ice-cold PBS and 4% paraformaldehyde was added for 15 minutes at room temperature to fix the cells. Signals were measured by FACS. The results are shown in Figure 16. The results demonstrate that ARGX-110 binds well to the cells from the CLL patients whereas SGN70 almost gave no binding signals.
- Recombinant human CD70 was immobilized on a CM5 Biacore chip.
- Fabs were prepared for the CD70 mAbs ARGX-110, MDX1411 and SGN70 by papain digestion. These Fabs, at a concentration of approximately 100-400 ⁇ g/ml, were diluted 6-fold in HEPES -buffered saline (0.1M HEPES, 1.5M NaCl, 30mM EDTA, 0.5% v/v surfactant P20). They were injected (30 ⁇ 1) and passed through the flow cells at a flow rate of 30 ⁇ 1/ ⁇ . After binding of the Fab to CD70, the off-rate was monitored for a period of 10 minutes. After dissociation, the flow cell surfaces were regenerated by injecting 5 ⁇ 1 of lOmM NaOH.
- Off-rate analysis was done by applying the BIAevaluation software. First, the sensogram of the blank runs were subtracted from those obtained with the coated flow cell. Then the off -rate was determined for a time range of 10 minutes using the Fit kinetics application and the Kd value was calculated. The off rates are summarized in Table 26.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- General Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Rheumatology (AREA)
- Hematology (AREA)
- Dermatology (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Physical Education & Sports Medicine (AREA)
- Urology & Nephrology (AREA)
- Pain & Pain Management (AREA)
- Oncology (AREA)
- Heart & Thoracic Surgery (AREA)
- Cardiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (20)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA2828753A CA2828753C (en) | 2011-03-16 | 2012-03-16 | Antibodies to cd70 |
| ES12710486.7T ES2670874T3 (es) | 2011-03-16 | 2012-03-16 | Anticuerpos contra CD70 |
| BR112013021562-3A BR112013021562B1 (pt) | 2011-03-16 | 2012-03-16 | Anticorpos para cd70 |
| US14/005,113 US9765148B2 (en) | 2011-03-16 | 2012-03-16 | Antibodies to CD70 |
| SI201231335T SI2686347T1 (en) | 2011-03-16 | 2012-03-16 | Antibodies to cd70 |
| RU2013146106/10A RU2604196C2 (ru) | 2011-03-16 | 2012-03-16 | Антитела против cd70 |
| CN201280013552.5A CN103596979B (zh) | 2011-03-16 | 2012-03-16 | 针对cd70的抗体 |
| JP2013558466A JP5982409B2 (ja) | 2011-03-16 | 2012-03-16 | Cd70に対する抗体 |
| DK12710486.7T DK2686347T3 (en) | 2011-03-16 | 2012-03-16 | Antibodies against CD70 |
| AU2012228194A AU2012228194B2 (en) | 2011-03-16 | 2012-03-16 | Antibodies to CD70 |
| EP12710486.7A EP2686347B1 (en) | 2011-03-16 | 2012-03-16 | Antibodies to cd70 |
| PL12710486T PL2686347T3 (pl) | 2011-03-16 | 2012-03-16 | Przeciwciała przeciwko CD70 |
| IL228001A IL228001B (en) | 2011-03-16 | 2013-08-18 | Antibodies to cd70 |
| US14/073,462 US8834882B2 (en) | 2011-03-16 | 2013-11-06 | Antibodies to CD70 |
| US14/163,752 US9765149B2 (en) | 2011-03-16 | 2014-01-24 | Antibodies to CD70 |
| US14/626,038 US11072665B2 (en) | 2011-03-16 | 2015-02-19 | Antibodies to CD70 |
| CY20181100783T CY1120471T1 (el) | 2011-03-16 | 2018-07-27 | Αντισωματα κατα του cd70 |
| US16/278,522 US11434298B2 (en) | 2011-03-16 | 2019-02-18 | Antibodies to CD70 |
| US17/811,645 US20230265201A1 (en) | 2011-03-16 | 2022-07-11 | Antibodies to cd70 |
| US19/292,687 US20260042856A1 (en) | 2011-03-16 | 2025-08-06 | Antibodies to cd70 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161453390P | 2011-03-16 | 2011-03-16 | |
| US61/453,390 | 2011-03-16 | ||
| US201161503871P | 2011-07-01 | 2011-07-01 | |
| US61/503,871 | 2011-07-01 |
Related Child Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/005,113 A-371-Of-International US9765148B2 (en) | 2011-03-16 | 2012-03-16 | Antibodies to CD70 |
| US14073462 A-371-Of-International | 2012-03-16 | ||
| US14/073,462 Continuation US8834882B2 (en) | 2011-03-16 | 2013-11-06 | Antibodies to CD70 |
| US201414005113A Division | 2011-03-16 | 2014-01-24 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2012123586A1 true WO2012123586A1 (en) | 2012-09-20 |
Family
ID=45878935
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2012/054733 Ceased WO2012123586A1 (en) | 2011-03-16 | 2012-03-16 | Antibodies to cd70 |
Country Status (18)
| Country | Link |
|---|---|
| US (7) | US9765148B2 (enExample) |
| EP (1) | EP2686347B1 (enExample) |
| JP (2) | JP5982409B2 (enExample) |
| CN (1) | CN103596979B (enExample) |
| AU (1) | AU2012228194B2 (enExample) |
| BR (1) | BR112013021562B1 (enExample) |
| CA (1) | CA2828753C (enExample) |
| CY (1) | CY1120471T1 (enExample) |
| DK (1) | DK2686347T3 (enExample) |
| ES (1) | ES2670874T3 (enExample) |
| HU (1) | HUE039849T2 (enExample) |
| IL (1) | IL228001B (enExample) |
| PL (1) | PL2686347T3 (enExample) |
| PT (1) | PT2686347T (enExample) |
| RU (1) | RU2604196C2 (enExample) |
| SI (1) | SI2686347T1 (enExample) |
| TR (1) | TR201807202T4 (enExample) |
| WO (1) | WO2012123586A1 (enExample) |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015032906A2 (en) | 2013-09-05 | 2015-03-12 | Bionovion Holding B.V. | Cd70-binding peptides and method, process and use relating thereto |
| JP2016500251A (ja) * | 2012-12-03 | 2016-01-12 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | 免疫調節Fc融合タンパク質の抗癌活性の増強 |
| WO2017044752A1 (en) * | 2015-09-10 | 2017-03-16 | University Of Pittsburgh-Of The Commonwealth System Of Higher Education | Anti-fibrotic effect of cd70 |
| WO2018229303A1 (en) | 2017-06-16 | 2018-12-20 | Argenx Bvba | Use of anti cd70 antibody argx-110 to treat acute myeloid leukaemia |
| WO2019087115A1 (en) | 2017-10-31 | 2019-05-09 | Staten Biotechnology B.V. | Anti-apoc3 antibodies and methods of use thereof |
| WO2019141732A1 (en) | 2018-01-16 | 2019-07-25 | Argenx Bvba | Cd70 combination therapy |
| WO2019149743A1 (en) | 2018-01-30 | 2019-08-08 | Cellectis | Combination comprising allogeneic immune cells deficient for an antigen present on both t-cells and pathological cells and therapeutic antibody against said antigen |
| WO2019152705A1 (en) * | 2018-02-01 | 2019-08-08 | Pfizer Inc. | Antibodies specific for cd70 and their uses |
| US10391168B1 (en) * | 2014-08-22 | 2019-08-27 | University Of Bern | Anti-CD70 combination therapy |
| WO2020127503A1 (en) | 2018-12-18 | 2020-06-25 | Argenx Bvba | Cd70 and venetoclax, a bcl-2 inhibitor, combination therapy for treating acute myeloid leukemia |
| US11072665B2 (en) | 2011-03-16 | 2021-07-27 | Argenx Bvba | Antibodies to CD70 |
| WO2022002019A1 (zh) | 2020-06-30 | 2022-01-06 | 江苏恒瑞医药股份有限公司 | 抗cd70抗体及其应用 |
| WO2022023379A1 (en) | 2020-07-28 | 2022-02-03 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Methods and compositions for preventing and treating a cancer |
| US11396551B2 (en) | 2018-02-01 | 2022-07-26 | Pfizer Inc. | Chimeric antigen receptors targeting CD70 |
| US11613584B1 (en) | 2021-10-13 | 2023-03-28 | Immuneonco Biopharmaceuticals (Shanghai) Inc. | Antibodies binding CD70, preparation and use thereof |
| EP4273169A4 (en) * | 2020-12-31 | 2025-02-12 | Keymed Biosciences Co.,Ltd. | DEVELOPMENT AND USE OF A FUNCTIONALLY ENHANCED ANTIBODY BLOCKING AGENT |
Families Citing this family (26)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPH08935B2 (ja) | 1991-03-15 | 1996-01-10 | 新日本製鐵株式会社 | 線材コイルの脱水素処理装置 |
| CN102076865B (zh) | 2008-05-02 | 2016-03-16 | 西雅图基因公司 | 用于制造核心岩藻糖基化降低的抗体和抗体衍生物的方法和组合物 |
| EP2992331A4 (en) * | 2013-04-30 | 2017-03-29 | Université de Montréal | Novel biomarkers for acute myeloid leukemia |
| KR102390359B1 (ko) * | 2014-09-29 | 2022-04-22 | 삼성전자주식회사 | 폴리펩타이드, 이를 포함하는 항 VEGF 항체 및 항 c-Met/항 VEGF 이중 특이 항체 |
| GB201611123D0 (en) * | 2016-06-27 | 2016-08-10 | Euremab Srl | Anti met antibodiesand uses thereof |
| US11166985B2 (en) | 2017-05-12 | 2021-11-09 | Crispr Therapeutics Ag | Materials and methods for engineering cells and uses thereof in immuno-oncology |
| BR112019023608A2 (pt) | 2017-05-12 | 2020-05-26 | Crispr Therapeutics Ag | Materiais e métodos para células manipuladas e seus usos em imuno-oncologia |
| EP3790629A1 (en) | 2018-05-11 | 2021-03-17 | CRISPR Therapeutics AG | Methods and compositions for treating cancer |
| AU2019387566A1 (en) * | 2018-11-30 | 2021-06-17 | Dana-Farber Cancer Institute, Inc. | Chimeric antigen receptor factories and methods of use thereof |
| AU2020267057A1 (en) | 2019-04-30 | 2021-11-18 | Crispr Therapeutics Ag | Allogeneic cell therapy of B cell malignancies using genetically engineered T cells targeting CD19 |
| RU2738802C1 (ru) * | 2019-08-21 | 2020-12-17 | Общество с ограниченной ответственностью "Международный Биотехнологический Центр "Генериум" | Определяющие комплементарность участки для связывания cd3 и содержащая их биспецифическая антигенсвязывающая молекула |
| BR112022013445A2 (pt) * | 2020-01-08 | 2022-09-13 | Univ Texas | Método de modificação de células exterminadoras naturais para direcionar tumores cd70-positivos |
| CN111909966B (zh) * | 2020-04-01 | 2021-09-21 | 苏州克睿基因生物科技有限公司 | 一种制备经修饰的免疫细胞的方法 |
| EP4243839A1 (en) | 2020-11-13 | 2023-09-20 | Catamaran Bio, Inc. | Genetically modified natural killer cells and methods of use thereof |
| CN116490608A (zh) | 2020-12-01 | 2023-07-25 | 苏州克睿基因生物科技有限公司 | 靶向cd70的抗原结合蛋白及其应用 |
| CN115260303B (zh) * | 2021-05-31 | 2025-04-22 | 百奥赛图(北京)医药科技股份有限公司 | Cd70基因人源化非人动物的构建方法及应用 |
| CN116375865A (zh) * | 2021-06-17 | 2023-07-04 | 南京蓝盾生物科技有限公司 | 具有增强的adcp效应的抗cd70抗体及其应用 |
| WO2024040195A1 (en) | 2022-08-17 | 2024-02-22 | Capstan Therapeutics, Inc. | Conditioning for in vivo immune cell engineering |
| WO2024102954A1 (en) | 2022-11-10 | 2024-05-16 | Massachusetts Institute Of Technology | Activation induced clipping system (aics) |
| CN120513259A (zh) * | 2023-01-16 | 2025-08-19 | 上海华奥泰生物药业股份有限公司 | 靶向cd70的抗体或结合cd70的抗原结合片段及其制备方法和应用 |
| AU2024279278A1 (en) | 2023-05-31 | 2025-12-18 | Capstan Therapeutics, Inc. | Lipid nanoparticle formulations and compositions |
| WO2025076113A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Ionizable cationic lipids with conserved spacing and lipid nanoparticles |
| IL327045A (en) | 2023-10-05 | 2026-05-01 | Capstan Therapeutics Inc | Structure-restricted ionizable cationic lipids and lipid nanoparticles |
| US20250302763A1 (en) | 2024-02-22 | 2025-10-02 | Capstan Therapeutics, Inc. | Immune engineering amplification |
| WO2025217452A1 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
| WO2025217454A2 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles |
Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5892019A (en) | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
| WO2004073656A2 (en) | 2003-02-20 | 2004-09-02 | Seattle Genetics, Inc. | Anti-cd70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders |
| WO2006044643A2 (en) | 2004-10-15 | 2006-04-27 | Seattle Genetics, Inc. | Anti-cd70 antibody and its use for the treatment and prevention of cancer and immune disorders |
| WO2006113909A2 (en) * | 2005-04-19 | 2006-10-26 | Seattle Genetics, Inc. | Humanized anti-cd70 binding agents and uses thereof |
| WO2007038637A2 (en) | 2005-09-26 | 2007-04-05 | Medarex, Inc. | Human monoclonal antibodies to cd70 |
| WO2008074004A2 (en) | 2006-12-14 | 2008-06-19 | Medarex, Inc. | Human antibodies that bind cd70 and uses thereof |
| WO2009145606A1 (en) | 2008-05-28 | 2009-12-03 | U-Protein Express B.V. | Method for the production of proteins or protein fragments |
| US20100129362A1 (en) | 2004-10-15 | 2010-05-27 | Seattle Genetics, Inc. | Treatment of psoriatic arthritis with anti-cd70 antibody |
Family Cites Families (63)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5859205A (en) * | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| US5573924A (en) | 1992-09-08 | 1996-11-12 | Immunex Corporation | CD27 ligand |
| DE19747418C1 (de) | 1997-10-27 | 1999-07-15 | Deutsches Krebsforsch | Inhibitor-Protein des wnt-Signalwegs |
| US6500633B1 (en) | 2000-04-26 | 2002-12-31 | Atairgin Technologies, Inc. | Method of detecting carcinomas |
| US20030148321A1 (en) | 2001-08-24 | 2003-08-07 | Iris Pecker | Methods and kits for diagnosing and monitoring hematopoietic cancers |
| AU2002351828A1 (en) | 2001-11-05 | 2003-05-19 | Deutsches Krebsforschungszentrum | Novel genetic markers for leukemias |
| US20050118656A1 (en) | 2001-11-27 | 2005-06-02 | Terrett Jonathan A. | Methods for diagnosis and treatment of epithelial-derived cancers |
| US7261892B2 (en) | 2001-11-27 | 2007-08-28 | Celltech R&D Limited | Methods for diagnosis and treatment of epithelial-derived cancers |
| US8404716B2 (en) | 2002-10-15 | 2013-03-26 | Celgene Corporation | Methods of treating myelodysplastic syndromes with a combination therapy using lenalidomide and azacitidine |
| US8039218B2 (en) | 2002-11-14 | 2011-10-18 | John Wayne Cancer Institute | Detection of cancer cells in body fluids |
| US20080025989A1 (en) | 2003-02-20 | 2008-01-31 | Seattle Genetics, Inc. | Anti-cd70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders |
| EP1606317B1 (en) | 2003-03-24 | 2010-07-28 | ZymoGenetics, Inc. | Anti-il-22ra antibodies and binding partners and methods of using in inflammation |
| MXPA06014075A (es) * | 2004-06-03 | 2007-03-15 | Novimmune Sa | Anticuerpos anti-cd3 y metodos de uso de los mismos. |
| US7641903B2 (en) | 2004-10-15 | 2010-01-05 | Seattle Genetics, Inc. | Anti-CD70 antibody and its use for the treatment and prevention of cancer and immune disorders |
| EA015706B1 (ru) | 2004-10-22 | 2011-10-31 | Займоджинетикс, Инк. | Моноклональное антитело или его фрагмент, связывающиеся с полипептидом il-22ra, гуманизированное антитело, полученное из указанного антитела, гибридомы, продуцирующие антитело, и применение указанного антитела |
| EP2386854A1 (en) | 2005-04-19 | 2011-11-16 | Prediction Sciences LLC | Diagnostic markers of breast cancer treatment and progression and methods of use thereof |
| US20080280297A1 (en) | 2005-07-15 | 2008-11-13 | The Trustees Of Columbia University In The City Of | Compositions and Methods for Differential Diagnosis of Chronic Lymphocytic Leukemia |
| CN101370830A (zh) * | 2005-09-26 | 2009-02-18 | 米德列斯公司 | 抗cd70的人单克隆抗体 |
| US7723477B2 (en) | 2005-10-31 | 2010-05-25 | Oncomed Pharmaceuticals, Inc. | Compositions and methods for inhibiting Wnt-dependent solid tumor cell growth |
| WO2007064919A2 (en) * | 2005-12-02 | 2007-06-07 | Genentech, Inc. | Binding polypeptides with restricted diversity sequences |
| CN105837690A (zh) | 2006-06-12 | 2016-08-10 | 新兴产品开发西雅图有限公司 | 具有效应功能的单链多价结合蛋白 |
| DK2099823T4 (da) * | 2006-12-01 | 2022-05-09 | Seagen Inc | Målbindingsmiddelvarianter og anvendelser deraf |
| AR062123A1 (es) * | 2007-07-27 | 2008-10-15 | Inst Nac De Tecnologia Agropec | Dominio vhh monomerico derivado de anticuerpos de camelidos anti-vp6 dominio dimerico, metodo de inmunodeteccion de rotavirus, composiciones, metodos de prevencion y tratamiento de infecciones con rotavirus |
| KR100807069B1 (ko) | 2007-09-21 | 2008-02-25 | 고려대학교 산학협력단 | 암 치료용 의약 조성물 |
| CN101854924A (zh) | 2007-11-05 | 2010-10-06 | 诺瓦提斯公司 | 测量wnt活化以及治疗wnt相关癌症的方法和组合物 |
| KR101674097B1 (ko) * | 2008-04-11 | 2016-11-08 | 시애틀 지네틱스, 인크. | 췌장, 난소 및 다른 암의 검출 및 치료 |
| GB2461546B (en) * | 2008-07-02 | 2010-07-07 | Argen X Bv | Antigen binding polypeptides |
| WO2010014948A1 (en) | 2008-08-01 | 2010-02-04 | The University Of Utah Research Foundation | Methods of treatment using wnt inhibitors |
| US20110190157A1 (en) | 2008-08-15 | 2011-08-04 | The Regents Of The University Of California | Biomarkers for Diagnosis and Treatment of Chronic Lymphocytic Leukemia |
| TWI506037B (zh) | 2008-09-26 | 2015-11-01 | Oncomed Pharm Inc | 捲曲結合劑類及彼等之用途 |
| AU2009329501B2 (en) * | 2008-12-19 | 2015-11-26 | Ablynx N.V. | Genetic immunization for producing immunoglobulins against cell-associated antigens such as P2X7, CXCR7 or CXCR4 |
| ES2571235T3 (es) | 2009-04-10 | 2016-05-24 | Kyowa Hakko Kirin Co Ltd | Procedimiento para el tratamiento de un tumor sanguíneo que utiliza el anticuerpo anti-TIM-3 |
| EP2464232B1 (en) | 2009-08-10 | 2015-10-07 | Samumed, LLC | Indazole inhibitors of the wnt signal pathway and therapeutic uses thereof |
| US20120178111A1 (en) | 2009-09-23 | 2012-07-12 | Diamandis Eleftherios P | Methods and compositions for the detection of lung cancers |
| NZ599438A (en) | 2009-11-19 | 2013-12-20 | Merck Serono Sa | Humanized antibodies against human il-22ra |
| ES2705015T3 (es) | 2009-12-29 | 2019-03-21 | Kyowa Hakko Kirin Co Ltd | Anticuerpo anti-CD27 |
| GB2476681B (en) | 2010-01-04 | 2012-04-04 | Argen X Bv | Humanized camelid VH, VK and VL immunoglobulin domains |
| WO2011155607A1 (ja) | 2010-06-11 | 2011-12-15 | 協和発酵キリン株式会社 | 抗tim-3抗体 |
| WO2012098407A1 (en) | 2011-01-19 | 2012-07-26 | Cantargia Ab | Anti - il1rap antibodies and their use for treating human |
| PL2686347T3 (pl) | 2011-03-16 | 2018-10-31 | Argenx Bvba | Przeciwciała przeciwko CD70 |
| WO2013006490A2 (en) | 2011-07-01 | 2013-01-10 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to tim3 |
| ES2806146T3 (es) | 2011-09-22 | 2021-02-16 | Amgen Inc | Proteínas de unión al antígeno CD27L |
| GB2504139B (en) * | 2012-07-20 | 2014-12-31 | Argen X Bv | Antibodies to highly conserved targets produced by the immunisation of Camelidae species |
| WO2013093508A2 (en) | 2011-12-22 | 2013-06-27 | Oslo University Hospital Hf | Wnt pathway inhibitors |
| BR122020002414B1 (pt) | 2012-03-15 | 2022-03-03 | Janssen Biotech, Inc | Uso de anticorpos anti-cd27 humanos |
| CN104394884A (zh) | 2012-03-21 | 2015-03-04 | 爱瑞泰克药物公司 | 用于治疗急性髓细胞白血病(aml)的药剂 |
| US9801851B2 (en) | 2012-05-23 | 2017-10-31 | St. Jude Children's Research Hospital | Methods and compositions for the treatment of BCR-ABL positive lymphoblastic leukemias |
| US9556144B2 (en) | 2012-06-15 | 2017-01-31 | Curegenix, Inc. | Compound as WNT signaling inhibitor, composition, and use thereof |
| EP2977386A1 (en) | 2012-08-31 | 2016-01-27 | Argen-X Nv | Method for producing antibody molecules having inter-species, intra-target cross-reactivity |
| WO2014045101A1 (en) | 2012-09-21 | 2014-03-27 | Cellzome Gmbh | Tetrazolo quinoxaline derivatives as tankyrase inhibitors |
| US20150315279A1 (en) | 2012-12-21 | 2015-11-05 | Cellerant Therapeutics, Inc. | Antibodies that bind membrane-bound il1rap |
| LT2956173T (lt) | 2013-02-14 | 2017-06-26 | Bristol-Myers Squibb Company | Tubulizino junginiai, gavimo ir panaudojimo būdai |
| AU2015210750B2 (en) | 2014-01-31 | 2020-08-20 | Children's Medical Center Corporation | Antibody molecules to TIM-3 and uses thereof |
| WO2015138600A2 (en) | 2014-03-11 | 2015-09-17 | The Board Of Trustees Of The Leland Stanford Junior University | Anti sirp-alpha antibodies and bi-specific macrophage enhancing antibodies |
| US20160200815A1 (en) | 2015-01-05 | 2016-07-14 | Jounce Therapeutics, Inc. | Antibodies that inhibit tim-3:lilrb2 interactions and uses thereof |
| EP3125645A1 (en) | 2015-07-31 | 2017-02-01 | Bleckmann GmbH & Co. KG | Flange assembly for securing a heating device to a fluid container |
| EA039859B1 (ru) | 2015-07-31 | 2022-03-21 | Эмджен Рисерч (Мюник) Гмбх | Биспецифические конструкты антител, связывающие egfrviii и cd3 |
| TWI717375B (zh) | 2015-07-31 | 2021-02-01 | 德商安美基研究(慕尼黑)公司 | Cd70及cd3抗體構築體 |
| WO2017044752A1 (en) | 2015-09-10 | 2017-03-16 | University Of Pittsburgh-Of The Commonwealth System Of Higher Education | Anti-fibrotic effect of cd70 |
| KR20250099459A (ko) | 2015-11-03 | 2025-07-01 | 얀센 바이오테크 인코포레이티드 | Pd-1과 특이적으로 결합하는 항체 및 그의 용도 |
| US11027021B2 (en) | 2016-03-15 | 2021-06-08 | Seagen Inc. | Combinations of PBD-based antibody drug conjugates with Bcl-2 inhibitors |
| GB2567613A (en) | 2017-06-16 | 2019-04-24 | Argenx Bvba | Treatment for acute myeloid leukaemia |
| GB201800649D0 (en) | 2018-01-16 | 2018-02-28 | Argenx Bvba | CD70 Combination Therapy |
-
2012
- 2012-03-16 PL PL12710486T patent/PL2686347T3/pl unknown
- 2012-03-16 DK DK12710486.7T patent/DK2686347T3/en active
- 2012-03-16 ES ES12710486.7T patent/ES2670874T3/es active Active
- 2012-03-16 WO PCT/EP2012/054733 patent/WO2012123586A1/en not_active Ceased
- 2012-03-16 TR TR2018/07202T patent/TR201807202T4/tr unknown
- 2012-03-16 EP EP12710486.7A patent/EP2686347B1/en active Active
- 2012-03-16 HU HUE12710486A patent/HUE039849T2/hu unknown
- 2012-03-16 CN CN201280013552.5A patent/CN103596979B/zh active Active
- 2012-03-16 JP JP2013558466A patent/JP5982409B2/ja active Active
- 2012-03-16 PT PT127104867T patent/PT2686347T/pt unknown
- 2012-03-16 US US14/005,113 patent/US9765148B2/en active Active
- 2012-03-16 RU RU2013146106/10A patent/RU2604196C2/ru active
- 2012-03-16 CA CA2828753A patent/CA2828753C/en active Active
- 2012-03-16 SI SI201231335T patent/SI2686347T1/en unknown
- 2012-03-16 BR BR112013021562-3A patent/BR112013021562B1/pt active IP Right Grant
- 2012-03-16 AU AU2012228194A patent/AU2012228194B2/en active Active
-
2013
- 2013-08-18 IL IL228001A patent/IL228001B/en active IP Right Grant
- 2013-11-06 US US14/073,462 patent/US8834882B2/en active Active
-
2014
- 2014-01-24 US US14/163,752 patent/US9765149B2/en active Active
-
2015
- 2015-02-19 US US14/626,038 patent/US11072665B2/en active Active
-
2016
- 2016-05-24 JP JP2016103443A patent/JP6261651B2/ja active Active
-
2018
- 2018-07-27 CY CY20181100783T patent/CY1120471T1/el unknown
-
2019
- 2019-02-18 US US16/278,522 patent/US11434298B2/en active Active
-
2022
- 2022-07-11 US US17/811,645 patent/US20230265201A1/en not_active Abandoned
-
2025
- 2025-08-06 US US19/292,687 patent/US20260042856A1/en active Pending
Patent Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5892019A (en) | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
| WO2004073656A2 (en) | 2003-02-20 | 2004-09-02 | Seattle Genetics, Inc. | Anti-cd70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders |
| WO2006044643A2 (en) | 2004-10-15 | 2006-04-27 | Seattle Genetics, Inc. | Anti-cd70 antibody and its use for the treatment and prevention of cancer and immune disorders |
| US20100129362A1 (en) | 2004-10-15 | 2010-05-27 | Seattle Genetics, Inc. | Treatment of psoriatic arthritis with anti-cd70 antibody |
| WO2006113909A2 (en) * | 2005-04-19 | 2006-10-26 | Seattle Genetics, Inc. | Humanized anti-cd70 binding agents and uses thereof |
| WO2007038637A2 (en) | 2005-09-26 | 2007-04-05 | Medarex, Inc. | Human monoclonal antibodies to cd70 |
| WO2008074004A2 (en) | 2006-12-14 | 2008-06-19 | Medarex, Inc. | Human antibodies that bind cd70 and uses thereof |
| WO2009145606A1 (en) | 2008-05-28 | 2009-12-03 | U-Protein Express B.V. | Method for the production of proteins or protein fragments |
Non-Patent Citations (63)
| Title |
|---|
| ADAM ET AL., BR J CANCER, vol. 95, 2006, pages 298 - 306 |
| ADAM ET AL., BR. J. CANCER, vol. 95, 2006, pages 298 - 306 |
| ADAM ET AL., BRITISH JOURNAL OF CANCER, vol. 95, 2006, pages 298 - 306 |
| ADAM P J ET AL: "CD70 (TNFSF7) is expressed at high prevalence in renal cell carcinomas and is rapidly internalised on antibody binding", BRITISH JOURNAL OF CANCER, HARCOURT PUBLISHERS, vol. 95, no. 3, 7 August 2006 (2006-08-07), pages 298 - 306, XP002440598, ISSN: 0007-0920, DOI: 10.1038/SJ.BJC.6603222 * |
| BACA ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684 |
| BOWMAN ET AL., IMMUNOL, vol. 152, 1994, pages 1756 - 61 |
| CARON ET AL., J. EXP. MED., vol. 176, 1992, pages 1191 - 1195 |
| CHAN; CARTER, NATURE REVIEWS: IMMUNOLOGY, vol. 10, 2010, pages 301 - 316 |
| CHOMCZYNSKI P ET AL., ANAL. BIOCHEM., vol. 162, 1987, pages 156 - 159 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 227, 1992, pages 799 - 817 |
| DE HAARD H ET AL., BIOL. CHEM., vol. 274, 1999 |
| DE HAARD H ET AL., J. BACT., vol. 187, 2005, pages 4531 - 4541 |
| FRENCH RUTH R ET AL: "Eradication of lymphoma by CD8 T cells following anti-CD40 monoclonal antibody therapy is critically dependent on CD27 costimulation", BLOOD, AMERICAN SOCIETY OF HEMATOLOGY, US, vol. 109, no. 11, 1 June 2007 (2007-06-01), pages 4810 - 4815, XP002582844, ISSN: 0006-4971, [retrieved on 20070220], DOI: 10.1182/BLOOD-2006-11-057216 * |
| GOODWIN, R.G. ET AL., CELL, vol. 73, 1993, pages 447 - 56 |
| GRAHAM ET AL., J. GEN. VIROL., vol. 36, 1977, pages 59 |
| HARLOW; LANE: "Antibodies, A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS, pages: 567 - 569 |
| HELD-FEINDT; MENTLEIN, INT J CANCER, vol. 98, 2002, pages 352 - 6 |
| HINTZEN ET AL., J. IMMUNOL., vol. 152, 1994, pages 1762 - 1773 |
| HISHIMA ET AL., AM J SURG PATHOL., vol. 24, 2000, pages 742 - 6 |
| HOLLIGER; HUDSON, NATURE BIOTECHNOL., vol. 23, 2005, pages 1126 - 36 |
| IIDA ET AL., CLIN CANCER RES., vol. 12, no. 9, 2006, pages 2879 - 2887 |
| J IMMUNOL, vol. 183, 2009, pages 1851 - 1861 |
| JUNKER ET AL., J UROL., vol. 173, 2005, pages 2150 - 3 |
| KABAT ET AL., J. BIOL. CHEM., vol. 252, 1977, pages 6609 - 6616 |
| KABAT ET AL., SEQUENCES OF PROTEIN OF IMMUNOLOGICAL INTEREST., 1991 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1983, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| LEFRANC ET AL., NAR, vol. 27, 1999, pages 209 - 212 |
| LENS ET AL., BR J HAEMATOL., vol. 106, 1999, pages 491 - 503 |
| MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745 |
| MARTIN ET AL., J. MOL. BIOL., vol. 263, 1996, pages 800 - 815 |
| MATHER ET AL., ANNALS N.Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68 |
| MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251 |
| MCEARCHERN ET AL., BLOOD, vol. 109, 2007 |
| MCEARCHERN ET AL., BLOOD, vol. 109, 2007, pages 1185 - 1192 |
| MCEARCHERN ET AL., CLIN CANCER RES, vol. 14, no. 23, 2008, pages 7763 - 72 |
| MCEARCHERN JULIE A ET AL: "Preclinical characterization of SGN-70, a humanized antibody directed against CD70", CLINICAL CANCER RESEARCH, THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, US, vol. 14, no. 23, 1 December 2008 (2008-12-01), pages 7763 - 7772, XP002556891, ISSN: 1078-0432, DOI: 10.1158/1078-0432.CCR-08-0493 * |
| MOREA ET AL., METHODS, vol. 20, 2000, pages 267 - 279 |
| NAKAJIMA ET AL., J. NEUROIMMUNOL., vol. 109, 2000, pages 188 - 96 |
| NATSUME ET AL., DRUG DESIGN DEVELOPMENT AND THERAPY, vol. 3, 2009, pages 7 - 16 |
| ONO ET AL., MOL. IMMUNOL., vol. 36, 1999, pages 387 - 395 |
| OSHIMA ET AL., INT. IMMUNOL., vol. 10, 1998, pages 517 - 26 |
| QU, CLIN. CANCER RES., vol. 5, 1999, pages 3095 - 3100 |
| ROUX ET AL., J. IMMUNOL., vol. 161, 1998, pages 4083 |
| SHOPES, B., J. IMMUNOL., vol. 148, 1992, pages 2918 - 2922 |
| SLOAN ET AL., AM J PATHOL., vol. 164, 2004, pages 315 - 23 |
| STEMMER ET AL., GENE, vol. 164, 1995, pages 49 - 53 |
| STEVENSON ET AL., ANTI-CANCER DRUG DESIGN, vol. 3, 1989, pages 219 - 230 |
| TATUSOVA ET AL.: "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS MICROBIOL LETT., vol. 174, pages 247 - 250, Retrieved from the Internet <URL:http://www.ncbi.nlm.nih.gov/ gorf/bl2.html> |
| TESSELAAR ET AL., J. IMMUNOL., vol. 170, 2003, pages 33 - 40 |
| THE JOURNAL OF IMMUNOLOGY, vol. 183, 2009, pages 1851 - 1861 |
| TOMLINSON ET AL., EMBO J., vol. 14, 1995, pages 4628 - 38 |
| TOMLINSON ET AL., EMBO J., vol. 14, 1995, pages 4628 - 4638 |
| TRAMONTANO ET AL., J. MOL. BIOL, vol. 215, 1990, pages 175 - 182 |
| TRAMONTANO ET AL., PROTEINS, vol. 6, 1989, pages 382 - 94 |
| TSURUSHITA ET AL., J. IMMUNOL. METHODS, vol. 295, 2004, pages 9 - 19 |
| URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 |
| WANG ET AL., JOURNAL OF PHARMACEUTICAL SCIENCES, vol. 96, 2007, pages L-26 |
| WILLIAMS ET AL., J. MOL. BIOL., vol. 264, 1996, pages 220 - 232 |
| WILLIAMS ET AL., J. MOL. BIOL., vol. 264, 1996, pages 220 - 32, Retrieved from the Internet <URL:http:Hwww.bioc.uzh.ch/antibody/Sequences/Germlines/VBase-hVL.html> |
| WYZGOL ET AL., J. IMMUNOL., vol. 183, 2009, pages 1851 - 1861 |
| YAMANE-OHNUKI; SATOH, MABS, vol. 1, no. 3, 2009, pages 230 - 236 |
Cited By (40)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11072665B2 (en) | 2011-03-16 | 2021-07-27 | Argenx Bvba | Antibodies to CD70 |
| US11434298B2 (en) | 2011-03-16 | 2022-09-06 | argenx BV | Antibodies to CD70 |
| JP2016500251A (ja) * | 2012-12-03 | 2016-01-12 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | 免疫調節Fc融合タンパク質の抗癌活性の増強 |
| JP7132858B2 (ja) | 2012-12-03 | 2022-09-07 | ブリストル-マイヤーズ スクイブ カンパニー | 免疫調節Fc融合タンパク質の抗癌活性の増強 |
| JP2019073534A (ja) * | 2012-12-03 | 2019-05-16 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | 免疫調節Fc融合タンパク質の抗癌活性の増強 |
| JP2021113197A (ja) * | 2012-12-03 | 2021-08-05 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | 免疫調節Fc融合タンパク質の抗癌活性の増強 |
| WO2015032906A3 (en) * | 2013-09-05 | 2015-04-30 | Bionovion Holding B.V. | Cd70-binding peptides and method, process and use relating thereto |
| JP2016531920A (ja) * | 2013-09-05 | 2016-10-13 | アデュロ・バイオテック・ホールディングス・ヨーロッパ・ベスローテン・フエンノートシャップAduro Biotech Holdings, Europe B.V. | Cd70結合ペプチドおよびそれに関連する方法、プロセスおよび用途 |
| WO2015032906A2 (en) | 2013-09-05 | 2015-03-12 | Bionovion Holding B.V. | Cd70-binding peptides and method, process and use relating thereto |
| US11571475B1 (en) | 2014-08-22 | 2023-02-07 | University Of Bern | Anti-CD70 and BCR-ABL inhibitor combination therapy |
| US10391168B1 (en) * | 2014-08-22 | 2019-08-27 | University Of Bern | Anti-CD70 combination therapy |
| WO2017044752A1 (en) * | 2015-09-10 | 2017-03-16 | University Of Pittsburgh-Of The Commonwealth System Of Higher Education | Anti-fibrotic effect of cd70 |
| EP4389142A3 (en) * | 2017-06-16 | 2024-08-21 | argenx BV | Use of anti cd70 antibody argx-110 to treat acute myeloid leukaemia |
| KR102799514B1 (ko) * | 2017-06-16 | 2025-04-23 | 아르제넥스 비브이 | 급성 골수성 백혈병(acute myeloid leukaemia) 치료를 위한 항 cd70-항체 argx-110의 용도 |
| KR20200024823A (ko) * | 2017-06-16 | 2020-03-09 | 아르제넥스 비브이비에이 | 급성 골수성 백혈병(acute myeloid leukaemia) 치료를 위한 항 cd70-항체 argx-110의 용도 |
| AU2018285731B2 (en) * | 2017-06-16 | 2021-11-04 | University Of Bern | Use of anti CD70 antibody ARGX-110 to treat acute myeloid leukaemia |
| EP4389142A2 (en) | 2017-06-16 | 2024-06-26 | argenx BV | Use of anti cd70 antibody argx-110 to treat acute myeloid leukaemia |
| EP3638696B1 (en) | 2017-06-16 | 2024-03-06 | Argenx BVBA | Use of anti cd70 antibody argx-110 to treat acute myeloid leukaemia |
| WO2018229303A1 (en) | 2017-06-16 | 2018-12-20 | Argenx Bvba | Use of anti cd70 antibody argx-110 to treat acute myeloid leukaemia |
| WO2019087115A1 (en) | 2017-10-31 | 2019-05-09 | Staten Biotechnology B.V. | Anti-apoc3 antibodies and methods of use thereof |
| US12180293B2 (en) | 2018-01-16 | 2024-12-31 | argenx BV | CD70 combination therapy |
| EP4275702A2 (en) | 2018-01-16 | 2023-11-15 | Argenx BVBA | Cd70 combination therapy |
| WO2019141732A1 (en) | 2018-01-16 | 2019-07-25 | Argenx Bvba | Cd70 combination therapy |
| US11530271B2 (en) | 2018-01-16 | 2022-12-20 | argenx BV | CD70 combination therapy |
| WO2019149743A1 (en) | 2018-01-30 | 2019-08-08 | Cellectis | Combination comprising allogeneic immune cells deficient for an antigen present on both t-cells and pathological cells and therapeutic antibody against said antigen |
| WO2019152705A1 (en) * | 2018-02-01 | 2019-08-08 | Pfizer Inc. | Antibodies specific for cd70 and their uses |
| IL276397B1 (en) * | 2018-02-01 | 2026-05-01 | Pfizer Inc | CD70-specific antibodies and their uses |
| US11396551B2 (en) | 2018-02-01 | 2022-07-26 | Pfizer Inc. | Chimeric antigen receptors targeting CD70 |
| US11987634B2 (en) | 2018-02-01 | 2024-05-21 | Pfizer Inc. | Antibodies specific for CD70 and their uses |
| US11377500B2 (en) | 2018-02-01 | 2022-07-05 | Pfizer Inc. | Antibodies specific for CD70 and their uses |
| AU2019215075B2 (en) * | 2018-02-01 | 2025-12-04 | Pfizer Inc. | Antibodies specific for CD70 and their uses |
| US12152081B2 (en) | 2018-02-01 | 2024-11-26 | Pfizer Inc. | Chimeric antigen receptors targeting CD70 |
| WO2020127503A1 (en) | 2018-12-18 | 2020-06-25 | Argenx Bvba | Cd70 and venetoclax, a bcl-2 inhibitor, combination therapy for treating acute myeloid leukemia |
| US11712468B2 (en) | 2018-12-18 | 2023-08-01 | argenx BV | CD70 combination therapy |
| EP4218761A1 (en) | 2018-12-18 | 2023-08-02 | Argenx BVBA | Cd70 and venetoclax, a bcl-2 inhibitor, combination therapy for treating acute myeloid leukemia |
| WO2022002019A1 (zh) | 2020-06-30 | 2022-01-06 | 江苏恒瑞医药股份有限公司 | 抗cd70抗体及其应用 |
| WO2022023379A1 (en) | 2020-07-28 | 2022-02-03 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Methods and compositions for preventing and treating a cancer |
| EP4273169A4 (en) * | 2020-12-31 | 2025-02-12 | Keymed Biosciences Co.,Ltd. | DEVELOPMENT AND USE OF A FUNCTIONALLY ENHANCED ANTIBODY BLOCKING AGENT |
| EP4166571A1 (en) * | 2021-10-13 | 2023-04-19 | ImmuneOnco Biopharmaceuticals (Shanghai) Inc. | Antibodies binding cd70, preparation and use thereof |
| US11613584B1 (en) | 2021-10-13 | 2023-03-28 | Immuneonco Biopharmaceuticals (Shanghai) Inc. | Antibodies binding CD70, preparation and use thereof |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230265201A1 (en) | Antibodies to cd70 | |
| US10676535B2 (en) | Anti c-Met antibodies | |
| US20160207996A1 (en) | Antibodies to complex targets | |
| US10696741B2 (en) | Anti-IL-22R antibodies | |
| GB2543729A (en) | Antibodies to IL-24 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12710486 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2828753 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2012228194 Country of ref document: AU Date of ref document: 20120316 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2013558466 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012710486 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2013146106 Country of ref document: RU Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14005113 Country of ref document: US |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112013021562 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112013021562 Country of ref document: BR Kind code of ref document: A2 Effective date: 20130823 |