WO2011150133A2 - Fibronectin based scaffold proteins having improved stability - Google Patents

Fibronectin based scaffold proteins having improved stability Download PDF

Info

Publication number
WO2011150133A2
WO2011150133A2 PCT/US2011/038013 US2011038013W WO2011150133A2 WO 2011150133 A2 WO2011150133 A2 WO 2011150133A2 US 2011038013 W US2011038013 W US 2011038013W WO 2011150133 A2 WO2011150133 A2 WO 2011150133A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
polypeptide
acid sequence
domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/038013
Other languages
English (en)
French (fr)
Other versions
WO2011150133A3 (en
Inventor
Ray Camphausen
John O'loughlin
Bernice Yeung
Yihong Zhang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bristol Myers Squibb Co
Original Assignee
Bristol Myers Squibb Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Bristol Myers Squibb Co filed Critical Bristol Myers Squibb Co
Priority to ES11731571.3T priority Critical patent/ES2573108T3/es
Priority to CN201180036862.4A priority patent/CN103180339B/zh
Priority to JP2013512226A priority patent/JP6023703B2/ja
Priority to EP11731571.3A priority patent/EP2576615B1/en
Priority to US13/699,458 priority patent/US9562089B2/en
Publication of WO2011150133A2 publication Critical patent/WO2011150133A2/en
Publication of WO2011150133A3 publication Critical patent/WO2011150133A3/en
Anticipated expiration legal-status Critical
Priority to US15/385,222 priority patent/US10273286B2/en
Priority to US16/298,493 priority patent/US11161893B2/en
Priority to US17/489,391 priority patent/US20220119495A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/78Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7155Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/20Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • Fibronectin based scaffolds are a family of proteins capable of evolving to bind any compound of interest. These proteins, which generally make use of a scaffold derived from a fibronectin type III (Fn3) or Fn3-like domain, function in a manner characteristic of natural or engineered antibodies (that is, polyclonal, monoclonal, or single-chain antibodies) and, in addition, possess structural advantages. Specifically, the structure of these antibody mimics has been designed for optimal folding, stability, and solubility, even under conditions that normally lead to the loss of structure and function in antibodies.
  • An example of fibronectin-based scaffold proteins are AdnectinsTM (Adnexus, a wholly owned subsidiary of Bristol-Myers Squibb).
  • Fibronectin is a large protein which plays essential roles in the formation of extracellular matrix and cell-cell interactions; it consists of many repeats of three types (types I, II, and III) of small domains (Baron et al., 1991).
  • Fn3 itself is the paradigm of a large subfamily which includes portions of cell adhesion molecules, cell surface hormone and cytokine receptors, chaperones, and carbohydrate-binding domains.
  • Fibronectin type III (Fn3) domains comprise, in order from N-terminus to C-terminus, a beta or beta-like strand, A; a loop, AB; a beta or beta-like strand, B; a loop, BC; a beta or betalike strand, C; a loop, CD; a beta or beta-like strand, D; a loop, DE; a beta or beta-like strand, E; a loop, EF; a beta or beta-like strand, F; a loop, FG; and a beta or beta-like strand, G. Any or all of loops AB, BC, CD, DE, EF and FG may participate in target binding.
  • the BC, DE, and FG loops are both structurally and functionally analogous to the complementarity determining regions (CDRs) from immunoglobulins.
  • CDRs complementarity determining regions
  • U.S. Patent No. 7,115,396 describes Fn3 domain proteins wherein alterations to the BC, DE, and FG loops result in high affinity TNFa binders.
  • U.S. Publication No. 2007/0148126 describes Fn3 domain proteins wherein alterations to the BC, DE, and FG loops result in high affinity VEGFR2 binders.
  • Protein pharmaceuticals may be associated with physical and chemical instability during their production, purification, storage and delivery. These instability issues can adversely impact the biological properties associated with the protein therapeutic, thereby reducing the efficacy of that protein therapeutic.
  • One aspect of the application provides for novel fibronectin based scaffold proteins that are associated with increased stability, including reduced fragmentation and/or reduced aggregation.
  • the fibronectin based scaffold proteins provided herein comprise a fibronectin type III tenth ( 10 Fn3) domain, wherein the 10 Fn3 domain comprises an amino acid sequence having at least 60% identity to SEQ ID NO: 1 and binds to a target molecule with a K D of less than 100 nM, and wherein the 10 Fn3 domain further comprises a C-terminal tail that does not contain a DK sequence.
  • the C-terminal tail comprises the amino acid sequence of SEQ ID NO: 4.
  • the C-terminal tail further comprises a cysteine residue.
  • the C-terminal tail comprises the sequence of SEQ ID NO: 5.
  • the fibronectin based scaffold proteins bind to a target that is not bound by a wild-type 10 Fn3 domain. In certain embodiments, fibronectin based scaffold proteins do not bind one or more of EGFR, human serum albumin or PCSK9. In certain embodiments, fibronectin based scaffold proteins that comprise a single 10 Fn3 domain do not bind one or more of EGFR, human serum albumin or PCSK9. In certain embodiments, multivalent fibronectin based scaffold proteins do not bind to one or more of the following combinations of target molecules: i) EGFR and IGF-IR; ii) EGFR and any other target protein; or iii) human serum albumin and any other target protein.
  • the 10 Fn3 domains of the fibronectin based scaffold protein further comprises an N-terminal extension comprising from 1-10 amino acids.
  • the 10 Fn3 domain of the fibronectin based scaffold protein comprises a sequence selected from the group consisting of: M, MG, G, and any of SEQ ID NOs: 19-21 and 26-31.
  • the fibronectin based scaffold proteins further comprise a second 10 Fn3 domain, wherein the second 10 Fn3 domain comprises an amino acid sequence having at least 60% identity to SEQ ID NO: 1 and binds to a target molecule with a K D of less than 100 nM, and wherein the second 10 Fn3 domain further comprises a C-terminal tail that does not contain a DK sequence.
  • the second 10 Fn3 domain comprises a C- terminal tail comprising the amino acid sequence of SEQ ID NO: 4.
  • the first and second 10 Fn3 domains bind to different targets.
  • the second 10 Fn3 domain further comprises an N-terminal extension comprising from 1-10 amino acids.
  • the N-terminal extension comprises a sequence selected from the group consisting of: M, MG, G, and any of SEQ ID NOs: 19-21 and 25-31.
  • the first and second 10 Fn3 domains are connected by a polypeptide linker comprising from 1-30 amino acids.
  • the polypeptide linker is selected from the group consisting of: a glycine-serine based linker, a glycine-proline based linker, a proline-alanine linker and a Fn-based linker.
  • the fibronectin based scaffold protein comprises one or more 10 Fn3 domains comprising a loop, AB; a loop, BC; a loop, CD; a loop, DE; a loop, EF; and a loop, FG and each, independently, have at least one loop selected from loop BC, DE, and FG with an altered amino acid sequence relative to the sequence of the corresponding loop of the human 10 Fn3 domain.
  • the 10 Fn3 domains comprise an amino acid sequence that is at least 50, 60, 70, or 80% identical to the naturally occurring human 10 Fn3 domain represented by SEQ ID NO: 1.
  • the fibronectin based scaffold protein is a dimer comprising two 10 Fn3 domains.
  • the application provides for novel fibronectin based scaffold protein dimers that are associated with reduced protein fragmentation as compared to the fibronectin based scaffold protein dimers described in PCT application WO 2009/142773.
  • the fibronectin based scaffold protein dimer comprises the amino acid sequence of SEQ ID NO: 48.
  • Nl and N2 are optional N-terminal extensions independently comprising from 0-10 amino acids;
  • Dl and D2 are independently selected from the group consisting of: (i) a tenth fibronectin type III domain ( 10 Fn3) domain having at least 95% identity with the amino acid sequence set forth in SEQ ID NO: 2, wherein said 10 Fn3 domain binds to IGF-IR with a K D of less than 500 nM, and (ii) a 10 Fn3 domain having at least 95% identity with the amino acid sequence set forth in SEQ ID NO: 3, wherein said 10 Fn3 domain binds to VEGFR2 with a K D of less than 500 nM;
  • L is a polypeptide linker comprising from 0-30 amino acid residues;
  • CI comprises the amino acid sequence set forth in SEQ ID NO: 4;
  • C2 comprises the amino acid sequence set
  • the fibronectin based scaffold protein dimers have the structure N1-D1-C1-L-N2-D2-C2, wherein Dl comprises a 10 Fn3 domain having at least 95% identity with the amino acid sequence set forth in SEQ ID NO: 2, and D2 comprises a 10 Fn3 domain having at least 95% identity with the amino acid sequence set forth in SEQ ID NO: 3.
  • the fibronectin based scaffold protein dimers have the structure N1-D1-C1-L-N2- D2-C2, wherein Dl comprises a 10 Fn3 domain having at least 95% identity with the amino acid sequence set forth in SEQ ID NO: 3, and D2 comprises a 10 Fn3 domain having at least 95% identity with the amino acid sequence set forth in SEQ ID NO: 2.
  • the fibronectin based scaffold protein dimers have the structure N1-D1-C1-L-N2-D2-C2, wherein C2 comprises the amino acid sequence of SEQ ID NO: 6.
  • the fibronectin based scaffold protein dimers have the structure N1-D1-C1-L-N2-D2-C2, wherein Nl comprises an amino acid sequence selected from the group consisting of: M, MG, G, and any one of SEQ ID NOs: 19-21 and 26-31. In exemplary embodiments, Nl comprises the amino acid sequence of SEQ ID NO: 19. In some embodiments, the fibronectin based scaffold protein dimers have the structure N1-D1-C1-L-N2- D2-C2, wherein N2 comprises an amino acid sequence selected from the group consisting of: M, MG, G, and any one of SEQ ID NOs: 19-21 and 26-31. In exemplary embodiments, N2 comprises the amino acid sequence of SEQ ID NO: 20.
  • the fibronectin based scaffold protein dimers have the structure N1-D1-C1-L-N2-D2-C2, wherein L is a polypeptide linker selected from the group consisting of: a glycine-serine based linker, a glycine-proline based linker, a proline-alanine linker and a Fn-based linker.
  • L comprises the amino acid sequence of SEQ ID NO: 7.
  • the fibronectin based scaffold proteins further comprise one or more pharmacokinetic (PK) moieties selected from: a polyoxyalkylene moiety, a human serum albumin binding protein, sialic acid, human serum albumin, transferrin, IgG, an IgG binding protein, and an Fc fragment.
  • PK pharmacokinetic
  • the PK moiety is a polyoxyalkylene moiety and said polyoxyalkylene moiety is polyethylene glycol (PEG).
  • the PEG moiety is covalently linked to the fibronectin based scaffold protein via a Cys or Lys amino acid.
  • the PEG is between about 0.5 kDa and about 100 kDa.
  • the application provides pharmaceutically acceptable compositions comprising a fibronectin based scaffold protein.
  • the composition is essentially pyrogen free.
  • the composition is substantially free of microbial contamination making it suitable for in vivo administration.
  • the composition may be formulated, for example, for IV, IP or subcutaneous administration.
  • the composition comprises a physiologically acceptable carrier.
  • the pH of the composition is between 4.0-6.5.
  • the pH of the composition is between 4.0-5.5.
  • the pH of the composition is 5.5.
  • the pH of the composition is 4.0.
  • the concentration of the fibronectin based scaffold protein is 5 mg/ml in the composition.
  • the application provides a pharmaceutical formulation comprising a fibronectin based scaffold protein, wherein the formulation comprises at least 5 mg/ml of the fibronectin based scaffold protein, has a pH of 4.0, and is suitable for intravenous administration.
  • the pharmaceutical formulation is stable for at least 4 weeks at 25 °C.
  • the pharmaceutical formulation has less than 4% fragmentation.
  • the formulation has less than 4% aggregates.
  • the application provides a method for treating a hyperproliferative disorder in a subject comprising administering to a subject in need thereof a therapeutically effective amount of any of the compositions as described herein.
  • the application provides a nucleic acid encoding a fibronectin based scaffold protein as described herein.
  • Vectors containing polynucleotides for such proteins are included as well. Suitable vectors include, for example, expression vectors.
  • a further aspect of the application provides for a cell, comprising a polynucleotide, vector, or expression vector, encoding a fibronectin based scaffold protein. Sequences are preferably optimized to maximize expression in the cell type used.
  • expression is in a bacterial cell.
  • expression is in a mammalian cell.
  • expression is in E. coli.
  • the cell expresses a fibronectin based scaffold protein.
  • the polynucleotides encoding fibronectin based scaffold proteins are codon optimized for expression in the selected cell type. Also provided are methods for producing a fibronectin based scaffold protein as described herein, comprising culturing a host cell comprising a nucleic, vector, or expression vector, comprising a nucleic acid encoding the fibronectin based scaffold protein and recovering the expressed fibronectin based scaffold protein from the culture.
  • FIG. 1 Size exclusion-high pressure liquid chromatography (SE-HPLC) data showing the amount of protein aggregation over time for two concentrations of pegylated V/I(DK+) (SEQ ID NO: 22).
  • the pegylated protein was stored at 4 °C for 12 months in 10 mM succinic acid, 5% sorbitol, pH 5.5 at 3 mg/mL protein concentration.
  • FIG. 1 SE-HPLC data showing the amount of protein fragmentation over time for two concentrations of pegylated V/I(DK+) (SEQ ID NO: 22).
  • the pegylated protein was stored at 4 °C for 12 months in 10 mM succinic acid, 5% sorbitol, pH 5.5 at 3 mg/mL protein concentration.
  • FIG. 3 SE-HPLC data showing the effect of pH on protein aggregation over time for pegylated V/I(DK+) (SEQ ID NO: 22).
  • the pegylated protein was stored at 25 °C for 3 weeks in a formulation containing 50 mM NaCl, with 20 mM sodium acetate (for pH 4 and 5) or 20 mM sodium phosphate (for pH 6 and 7).
  • FIG. 4 SE-HPLC data showing the effect of pH on protein fragmentation over time for pegylated V/I(DK+) (SEQ ID NO: 22).
  • the pegylated protein was stored at 25 °C for 3 weeks in a formulation containing 50 mM NaCl, with 20 mM sodium acetate (for pH 4 and 5) or 20 mM sodium phosphate (for pH 6 and 7).
  • FIG. 1 Reverse phase-high pressure liquid chromatography (RP-HPLC) profile showing the sites of cleavage of pegylated V/I(DK+) molecule (SEQ ID NO: 22) after storage at 25 °C for 4 weeks in 10 mM acetate, 150 mM NaCl at pH 5.5.
  • protein cleavage occurs directly following positions D95, D106, D180 and D200, with cleavage predominantly occurring directly following sites D95 and D200.
  • the pegylated protein was stored for 4 week at 25 °C in 10 mM sodium acetate, 150 mM sodium chloride, pH 5.5 at 5 mg/mL protein concentration.
  • FIG. 6 SE-HPLC data showing the effect of pH on protein aggregation over time for the pegylated E/I(DK+) (SEQ ID NO: 23).
  • the pegylated protein was stored for 4 week at 25 °C in 10 mM succinic acid, 5% sorbitol, pH 4.0, 4.5 and 5.5.
  • FIG. 7 SE-HPLC data showing the effect of pH on the amount of protein fragmentation over time for the pegylated E/I(DK+) (SEQ ID NO: 23).
  • the pegylated protein was stored for 4 week at 25 °C in 10 mM succinic acid, 5% sorbitol, pH 4.0, 4.5 and 5.5.
  • Figure 8 RP-HPLC profile showing the sites of cleavage of the pegylated E/I(DK+) (SEQ ID NO: 23) after storage at 25 °C for 4 weeks in 10 mM succinic acid, 5% sorbitol, pH 4.0, 5 mg/mL protein concentration. As indicated in the figure, protein cleavage occurs directly following positions D95, D199 and D218.
  • FIG. 9 SE-HPLC data demonstrating showing the effect of pH on protein aggregation over time for various fibronectin based scaffold protein constructs.
  • the level of aggregation for various fibronectin based scaffold proteins was tested at either pH 5.5 or pH 4.0 during storage for 4 weeks at 25 °C.
  • E/I(DK+) is SEQ ID NO: 23;
  • E/I(DK-, no C-term) is SEQ ID NO: 24;
  • E/I(2DK-) is SEQ ID NO: 25; and
  • V/I(DK+) is SEQ ID NO: 22.
  • FIG. 10 RP-HPLC data showing the amount of fragmentation of various fibronectin based scaffold proteins at different pHs during storage for 4 weeks at 25 °C.
  • Fibronectin based scaffold proteins that contain DK sequences are more susceptible to fragmentation at pH 4.0 as compared to pH 5.5.
  • Fibronectin based scaffold proteins that do not contain DK sequences are more resistant to fragmentation at pH 4.0 as compared to fibronectin based scaffold proteins that contain DK sequences.
  • E/I(DK+) is SEQ ID NO: 23;
  • E/I(DK-, no C-term) is SEQ ID NO: 24;
  • E/I(2DK-) is SEQ ID NO: 25; and
  • V/I(DK+) is SEQ ID NO: 22.
  • FIG. 15 Clip region of a RP-HPLC overlaid chromatogram of VI(DK+) (SEQ ID NO: 56) and VI(DK-) (SEQ ID NO: 57), after incubation for 2 months at 25 °C.
  • the total % clips for VI(DK+) is 16%, whereas for VI(DK-) it is 6.9%.
  • polypeptide By a “polypeptide” is meant any sequence of two or more amino acids, regardless of length, post-translation modification, or function. "Polypeptide,” “peptide,” and “protein” are used interchangeably herein. Polypeptides can include natural amino acids and non-natural amino acids such as those described in U.S. Patent No. 6,559,126, incorporated herein by reference.
  • Polypeptides can also be modified in any of a variety of standard chemical ways (e.g., an amino acid can be modified with a protecting group; the carboxy-terminal amino acid can be made into a terminal amide group; the amino-terminal residue can be modified with groups to, e.g., enhance lipophilicity; or the polypeptide can be chemically glycosylated or otherwise modified to increase stability or in vivo half-life).
  • Polypeptide modifications can include the attachment of another structure such as a cyclic compound or other molecule to the polypeptide and can also include polypeptides that contain one or more amino acids in an altered configuration (i.e., R or S; or, L or D).
  • Percent (%) amino acid sequence identity herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in a selected sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared.
  • % amino acid sequence identity values are obtained as described below by using the sequence comparison computer program ALIGN-2.
  • the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087, and is publicly available through Genentech, Inc., South San Francisco, Calif.
  • the ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
  • the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows: 100 times the fraction X/Y where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A.
  • the term "therapeutically effective amount” refers to an amount of a drug effective to treat a disease or disorder in a mammal.
  • the therapeutically effective amount of the drug may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the disorder.
  • the drug may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic.
  • efficacy in vivo can, for example, be measured by assessing the time to disease progression (TTP) and/or determining the response rates (RR).
  • the half-life of an amino acid sequence or compound can generally be defined as the time taken for the serum concentration of the polypeptide to be reduced by 50%, in vivo, for example due to degradation of the sequence or compound and/or clearance or sequestration of the sequence or compound by natural mechanisms.
  • the half-life can be determined in any manner known per se, such as by pharmacokinetic analysis.
  • Suitable techniques will be clear to the person skilled in the art, and may for example generally involve the steps of suitably administering to the primate a suitable dose of the amino acid sequence or compound to be treated; collecting blood samples or other samples from said primate at regular intervals; determining the level or concentration of the amino acid sequence or compound of the invention in said blood sample; and calculating, from (a plot of) the data thus obtained, the time until the level or concentration of the amino acid sequence or compound of the invention has been reduced by 50% compared to the initial level upon dosing.
  • Half-life can be expressed using parameters such as the tl/2-alpha, tl/2-beta and the area under the curve (AUC).
  • an “increase in half-life” refers to an increase in any one of these parameters, such as any two of these parameters, or essentially all three these parameters.
  • An “increase in half-life” in particular refers to an increase in the tl/2- beta, either with or without an increase in the tl/2-alpha and/or the AUC or both.
  • the present application describes improved fibronectin based scaffold proteins that are associated with increased stability.
  • the fibronectin based scaffold proteins described herein comprise one or more human tenth fibronectin type III domains that have been modified so as to bind to one or more desired targets.
  • the present application also describes improved VEGFR2/IGF-IR bispecific fibronectin based scaffold protein dimers that are associated with increased stability, comprising two human tenth fibronectin type III domains, one that has been modified so as to bind specifically to VEGFR2 and one that has been modified so as to bind specifically to IGF-IR.
  • PCT application WO 2009/142773 describes fibronectin scaffold multimers that may be linked covalently or non-covalently and that bind both VEGFR2 and IGF-IR.
  • the present application relates, in part, to the surprising discovery that bispecific fibronectin based scaffold proteins that bind to VEGFR2 and IGF-IR experience a high frequency of fragmentation at certain aspartate residues.
  • aspartate residues directly followed by a lysine residue are more sensitive to cleavage in fibronectin based scaffold proteins as compared to aspartate residues followed by other amino acids.
  • the application also relates to the surprising discovery that the degree of fragmentation of VEGFR2/IGF-IR binding fibronectin based scaffold proteins is considerably higher than the degree of fragmentation associated with a related fibronectin based scaffold protein, i.e., a bispecific EGFR/IGF-IR binding fibronectin based scaffold protein dimer, despite identical storage conditions and a high percentage of shared sequence identity between these similar proteins.
  • the application also demonstrates that fragmentation of a model fibronectin based scaffold protein can be markedly reduced if the DK sites are removed or modified to substitute the aspartate residue for a different amino acid, e.g. glutamic acid.
  • improved compositions of fibronectin based scaffold proteins that have increased stability during storage.
  • Fn3 refers to a type III domain from fibronectin.
  • An Fn3 domain is small, monomeric, soluble, and stable. It lacks disulfide bonds and, therefore, is stable under reducing conditions.
  • the overall structure of Fn3 resembles the immunoglobulin fold.
  • Fn3 domains comprise, in order from N-terminus to C-terminus, a beta or beta-like strand, A; a loop, AB; a beta or betalike strand, B; a loop, BC; a beta or beta-like strand, C; a loop, CD; a beta or beta-like strand, D; a loop, DE; a beta or beta-like strand, E; a loop, EF; a beta or beta-like strand, F; a loop, FG; and a beta or beta-like strand, G.
  • the seven antiparallel ⁇ -strands are arranged as two beta sheets that form a stable core, while creating two "faces" composed of the loops that connect the beta or beta-like strands.
  • Loops AB, CD, and EF are located at one face and loops BC, DE, and FG are located on the opposing face. Any or all of loops AB, BC, CD, DE, EF and FG may participate in ligand binding. There are at least 15 different modules of Fn3, and while the sequence homology between the modules is low, they all share a high similarity in tertiary structure.
  • AdnectinsTM (Adnexus, a Bristol-Myers Squibb Company) are ligand binding scaffold proteins based on the tenth fibronectin type III domain, i.e., the tenth module of Fn3, ( 10 Fn3).
  • the amino acid sequence of the naturally occurring human 10 Fn3 is set forth in SEQ ID NO: 37: SDF i?DIEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATIS GLKPGVD YTIT V Y AVTGRGD SPAS SKPI SIN YRT (SEQ ID NO: 37) (the AB, CD and EF loops are underlined, and the BC, FG, and DE loops are emphasized in bold).
  • the AB loop corresponds to residues 15-16
  • the BC loop corresponds to residues 21-30
  • the CD loop corresponds to residues 39-45
  • the DE loop corresponds to residues 51-56
  • the EF loop corresponds to residues 60-66
  • the FG loop corresponds to residues 76-87. See e.g., Xu et al, Chemistry & Biology 2002 9:933-942.
  • the BC, DE and FG loops align along one face of the molecule and the AB, CD and EF loops align along the opposite face of the molecule.
  • beta strand A corresponds to residues 9-14
  • beta strand B corresponds to residues 17-20
  • beta strand C corresponds to residues 31-38
  • beta strand D corresponds to residues 46-50
  • beta strand E corresponds to residues 57-59
  • beta strand F corresponds to residues 67-75
  • beta strand G corresponds to residues 88-94.
  • the strands are connected to each other through the corresponding loop, e.g., strands A and B are connected via loop AB in the order: strand A, loop AB, strand B, etc.
  • the first 8 amino acids of SEQ ID NO: 37 may be deleted while still retaining binding activity of the molecule.
  • Residues involved in forming the hydrophobic core (the "core amino acid residues") in SEQ ID NO: 37 include the amino acids corresponding to the following amino acids of SEQ ID NO: 37: L8, V10, A13, L18, 120, W22, Y32, 134, Y36, F48, V50, A57, 159, L62, Y68, 170, V72, A74, 188, 190 and Y92, wherein the core amino acid residues are represented by the single letter amino acid code followed by the position at which they are located within SEQ ID NO: 37. See e.g., Dickinson et al, J. Mol. Biol. 236: 1079-1092 (1994).
  • Fn3 domains are structurally and functionally analogous to antibodies, specifically the variable region of an antibody. While 10 Fn3 domains may be described as "antibody mimics" or “antibody-like proteins", they do offer a number of advantages over conventional antibodies. In particular, they exhibit better folding and thermostability properties as compared to antibodies, and they lack disulphide bonds, which are known to impede or prevent proper folding under certain conditions.
  • the BC, DE, and FG loops of 10 Fn3 domains are analogous to the complementary determining regions (CDRs) from immunoglobulins. Alteration of the amino acid sequence in these loop regions changes the binding specificity of 10 Fn3. 10 Fn3 domains with modifications in the AB, CD and EF loops may also be made in order to produce a molecule that binds to a desired target.
  • the protein sequences outside of the loops are analogous to the framework regions from immunoglobulins and play a role in the structural conformation of the 10 Fn3. Alterations in the framework-like regions of 10 Fn3 are permissible to the extent that the structural conformation is not so altered as to disrupt ligand binding.
  • amino acid residues corresponding to residues 21-30, 51-56, and 76- 87 of SEQ ID NO: 37 define the BC, DE and FG loops, respectively.
  • residues 21-30, 51-56, and 76- 87 of SEQ ID NO: 37 define the BC, DE and FG loops, respectively.
  • residues 21-30, 51-56, and 76- 87 of SEQ ID NO: 37 define the BC, DE and FG loops, respectively.
  • a desired target such as VEGFR2 or IGF-IR.
  • the BC loop may be defined by amino acids corresponding to residues 23- 29 of SEQ ID NO: 37
  • the DE loop may be defined by amino acids corresponding to residues 52-55 of SEQ ID NO: 37
  • the FG loop may be defined by amino acids corresponding to residues 77-86 of SEQ ID NO: 37.
  • the FG loop of the VEGFR2 binder having SEQ ID NO: 3 has the same length FG loop as the wild-type 10 Fn3 domain, i.e., the 10 residues 77-86 of SEQ ID NO: 37 were replaced with the ten residues 69-78 of SEQ ID NO: 3.
  • the FG loop of the IGF-IR binder having SEQ ID NO: 2 is shorter in length than the corresponding FG loop of the wild-type 10 Fn3 domain, i.e., the 10 residues 77-86 of SEQ ID NO: 37 were replaced with the six residues 69-74 of SEQ ID NO: 2.
  • the FG loop of the EGFR binder having SEQ ID NO: 39 is longer in length than the corresponding FG loop of the wild-type 10 Fn3 domain, i.e., the 10 residues 77-86 of SEQ ID NO: 37 were replaced with the fifteen residues 69-83 of SEQ ID NO: 39.
  • one or more loops selected from BC, DE, and FG may be extended or shortened in length relative to the corresponding loop in wild-type human 10 Fn3.
  • the length of the loop may be extended by from 2-25 amino acids.
  • the length of the loop may be decreased by 1-11 amino acids.
  • the FG loop of 10 Fn3 is 12 residues long, whereas the corresponding loop in antibody heavy chains ranges from 4-28 residues. To optimize antigen binding, therefore, the length of the FG loop of 10 Fn3 may be altered in length as well as in sequence to cover the CDR3 range of 4-28 residues to obtain the greatest possible flexibility and affinity in antigen binding.
  • one or more residues of the integrin-binding motif "arginine-glycine-aspartic acid” (RGD) may be substituted so as to disrupt integrin binding.
  • RGD arginine-glycine-aspartic acid
  • the RGD sequence is replaced by a polar amino acid-neutral amino acid-acidic amino acid sequence (in the N-terminal to C -terminal direction).
  • the RGD sequence is replaced with SGE.
  • the non-ligand binding sequences of 10 Fn3, i.e., the " 10 Fn3 scaffold" may be altered provided that the 10 Fn3 domain retains ligand binding function and/or structural stability.
  • one or more of Asp 7, Glu 9, and Asp 23 are replaced by another amino acid, such as, for example, a non-negatively charged amino acid residue (e.g., Asn, Lys, etc.).
  • a non-negatively charged amino acid residue e.g., Asn, Lys, etc.
  • the 10 Fn3 scaffold may be modified by one or more conservative substitutions. As many as 5%, 10%, 20% or even 30% or more of the amino acids in the 10 Fn3 scaffold may be altered by a conservative substitution without substantially altering the affinity of the 10 Fn3 for a ligand.
  • the scaffold may comprise anywhere from 0-15, 0-10, 0-8, 0-6, 0-5, 0- 4, 0-3, 1-15, 1-10, 1-8, 1-6, 1-5, 1-4, 1-3, 2-15, 2-10, 2-8, 2-6, 2-5, 2-4, 5-15, or 5-10 conservative amino acid substitutions.
  • the scaffold modification preferably reduces the binding affinity of the 10 Fn3 binder for a ligand by less than 100-fold, 50- fold, 25-fold, 10-fold, 5-fold, or 2-fold. It may be that such changes will alter the immunogenicity of the 10 Fn3 in vivo, and where the immunogenicity is decreased, such changes will be desirable.
  • conservative substitutions are residues that are physically or functionally similar to the corresponding reference residues. That is, a conservative substitution and its reference residue have similar size, shape, electric charge, chemical properties including the ability to form covalent or hydrogen bonds, or the like.
  • conservative substitutions are those fulfilling the criteria defined for an accepted point mutation in Dayhoff et al., Atlas of Protein Sequence and Structure 5:345-352 (1978 & Supp.).
  • Examples of conservative substitutions are substitutions within the following groups: (a) valine, glycine; (b) glycine, alanine; (c) valine, isoleucine, leucine; (d) aspartic acid, glutamic acid; (e) asparagine, glutamine; (f) serine, threonine; (g) lysine, arginine, methionine; and (h) phenylalanine, tyrosine.
  • the application provides fibronectin based scaffold proteins, e.g., polypeptides comprising at least one 10 Fn3 domain and having a C-terminal tail that lacks a DK sequence.
  • the fibronectin based scaffold proteins comprise a 10 Fn3 domain having a C-terminal tail comprising the amino acid sequence of SEQ ID NO: 4.
  • Such fibronectin based scaffold proteins have improved stability relative to fibronectin based scaffolds containing one or more DK sequences.
  • a fibronectin based scaffold protein comprises a 10 Fn3 domain having at least 40%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, or 90% identity to the human 10 Fn3 domain having the amino acid sequence of SEQ ID NO: 1. Much of the variability will generally occur in one or more of the loops.
  • Each of the beta or beta-like strands of a 10 Fn3 domain in a fibronectin based scaffold protein may comprise, consist essentially of, or consist of an amino acid sequence that is at least 80%, 85%, 90%>, 95% or 100% identical to the sequence of a corresponding beta or beta-like strand of SEQ ID NO: 1 , provided that such variation does not disrupt the stability of the polypeptide in physiological conditions.
  • the 10 Fn3 domain binds to a desired target with a KD of less than 500 nM, 100 nM, 1 nM, 500 pM, 100 pM or less.
  • the fibronectin based scaffold protein binds specifically to a target that is not bound by a wild-type 10 Fn3 domain, particularly the wild-type human 10 Fn3 domain.
  • the disclosure provides polypeptides comprising a 10 Fn3 domain, wherein the 10 Fn3 domain comprises a loop, AB; a loop, BC; a loop, CD; a loop, DE; a loop, EF; and a loop, FG; and has at least one loop selected from loop BC, DE, and FG with an altered amino acid sequence relative to the sequence of the corresponding loop of the human 10 Fn3 domain.
  • the BC and FG loops are altered.
  • the BC, DE, and FG loops are altered, i.e., the 10 Fn3 domain comprises non-naturally occurring loops.
  • altered is meant one or more amino acid sequence alterations relative to a template sequence (i.e., the corresponding human fibronectin domain) and includes amino acid additions, deletions, and substitutions. Altering an amino acid sequence may be accomplished through intentional, blind, or spontaneous sequence variation, generally of a nucleic acid coding sequence, and may occur by any technique, for example, PCR, error-prone PCR, or chemical DNA synthesis.
  • one or more loops selected from BC, DE, and FG may be extended or shortened in length relative to the corresponding human fibronectin loop.
  • the length of the loop may be extended by from 2-25 amino acids.
  • the length of the loop may be decreased by 1-1 1 amino acids.
  • the FG loop of 10 Fn3 is 12 residues long, whereas the corresponding loop in antibody heavy chains ranges from 4-28 residues. To optimize antigen binding, therefore, the length of the FG loop of a 10 Fn3 domain may be altered in length as well as in sequence to cover the CDR3 range of 4-28 residues to obtain the greatest possible flexibility and affinity in antigen binding.
  • the fibronectin based scaffold protein comprises a 10 Fn3 domain having an amino acid sequence at least 80, 85, 90, 95, 98, or 100% identical to the non-loop regions of SEQ ID NO: 1 , wherein at least one loop selected from BC, DE, and FG is altered.
  • the altered BC loop has up to 10 amino acid substitutions, up to 4 amino acid deletions, up to 10 amino acid insertions, or a combination thereof.
  • the altered DE loop has up to 6 amino acid substitutions, up to 4 amino acid deletions, up to 13 amino acid insertions, or a combination thereof.
  • the FG loop has up to 12 amino acid substitutions, up to 11 amino acid deletions, up to 25 amino acid insertions, or a combination thereof.
  • the fibronectin based scaffold protein comprises a 10 Fn3 domain that is defined generally by following the sequence:
  • the BC loop is represented by X x
  • the DE loop is represented by X y
  • the FG loop is represented by X z .
  • X represents any amino acid and the subscript following the X represents an integer of the number of amino acids.
  • x, y and z may each independently be anywhere from 2-20, 2-15, 2-10, 2-8, 5-20, 5-15, 5-10, 5-8, 6-20, 6-15, 6-10, 6-8, 2-7, 5-7, or 6-7 amino acids.
  • x is 7 amino acids
  • y is 4 amino acids
  • z is 6, 10 or 15 amino acids.
  • sequences of the beta strands may have anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, deletions or additions across all 7 scaffold regions relative to the corresponding amino acids shown in SEQ ID NO: 38.
  • sequences of the beta strands may have anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 conservative substitutions across all 7 scaffold regions relative to the corresponding amino acids shown in SEQ ID NO: 38.
  • the core amino acid residues are fixed and any substitutions, conservative substitutions, deletions or additions occur at residues other than the core amino acid residues.
  • the EIEK tail (SEQ ID NO: 4) shown in bold is fixed.
  • the amino acids immediately flanking the loop regions e.g., the non-underlined residues
  • each residues may be substituted with a sequence having the same number of amino acids or with a larger amino acid sequence (e.g., insertions of 0-10, 0-8, 0-5, 0-3, or 0-2 amino acid residues).
  • the non-underlined residues are part of the loop region and therefore are amenable to substitution without significantly affecting the structure of the 10 Fn3 domain.
  • the 10 Fn3 domains generally begin with amino acid number 1 of SEQ ID NO: 37.
  • domains with amino acid deletions are also encompassed by the invention.
  • the first eight amino acids of SEQ ID NO: 37 are deleted. Additional sequences may also be added to the N- or C-terminus of a 10 Fn3 domain having amino acids corresponding to 1-94 of SEQ ID NO: 37 or amino acids 9-94 of SEQ ID NO: 37.
  • an additional MG sequence may be placed at the N-terminus of a 10 Fn3 domain. The M will usually be cleaved off, leaving a G at the N-terminus.
  • the N-terminal extension consists of an amino acid sequence selected from the group consisting of: M, MG, G, and any of SEQ ID NOs: 19-21.
  • the 10 Fn3 domain may optionally comprise an N-terminal extension of from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length.
  • N-terminal extensions include (represented by the single letter amino acid code) M, MG, G, MGVSDVPRDL (SEQ ID NO: 19), VSDVPRDL (SEQ ID NO: 20), and GVSDVPRDL (SEQ ID NO: 21), or N-terminal truncations of any one of SEQ ID NOs: 19, 20 or 21.
  • a Met-Gly sequence is added to the N-terminus of a 10 Fn3 domain, the M will usually be cleaved off, leaving a G at the N-terminus.
  • the fibronectin based scaffold proteins provided herein comprise a 10 Fn3 domain having a C-terminal tail sequence comprising the amino acid sequence of SEQ ID NO: 4.
  • Exemplary C-terminal tails include polypeptides that are from 1-20, 1-15, 1-10, 1-8, 1-5, or 1-4 amino acids in length.
  • tail sequences include, for example, polypeptides comprising, consisting essentially of, or consisting of, EIEK (SEQ ID NO: 4), EGSGC (SEQ ID NO: 5), EIEKPCQ (SEQ ID NO: 6), EIEKPSQ (SEQ ID NO: 32), EIEKP (SEQ ID NO: 33), EIEKPS (SEQ ID NO: 34), or EIEKPC (SEQ ID NO: 35).
  • EIEK SEQ ID NO: 4
  • EGSGC SEQ ID NO: 5
  • EIEKPCQ SEQ ID NO: 6
  • EIEKPSQ SEQ ID NO: 32
  • EIEKP SEQ ID NO: 33
  • EIEKPS SEQ ID NO: 34
  • EIEKPC EIEKPC
  • the C-terminal tail comprises a residue that facilitates modification by PEG, i.e., a lysine or cysteine residue.
  • the C-terminal tail lacks a DK sequence and comprises a cysteine residue.
  • the fibronectin based scaffold proteins comprise a 10 Fn3 domain having both an N-terminal extension and a C-terminal tail.
  • a His6-tag may be placed at the N-terminus or the C-terminus.
  • the fibronectin based scaffold protein comprises a 10 Fn3 domain that binds to VEGFR2.
  • the fibronectin based scaffold protein binds to VEGFR2 with a K D of less than 500 iiM and the BC loop comprises the amino acid sequence of SEQ ID NO: 43, the DE comprises the amino acid sequence of SEQ ID NO: 44, the FG loop comprises the amino acid sequence of SEQ ID NO: 45, and the protein comprises a C- terminal tail that lacks a DK sequence.
  • the C-terminal tail comprises EIEK (SEQ ID NO: 4), EGSGC (SEQ ID NO: 5), EIEKPCQ (SEQ ID NO: 6), EIEKPSQ (SEQ ID NO: 32), EIEKP (SEQ ID NO: 33), EIEKPS (SEQ ID NO: 34), or EIEKPC (SEQ ID NO: 35).
  • the C-terminal tail comprises EIEK (SEQ ID NO: 4) or EIEKPCQ (SEQ ID NO: 6).
  • the fibronectin based scaffold protein is a multivalent protein that comprises two or more 10 Fn3 domains.
  • a multivalent fibronectin based scaffold protein may comprise 2, 3 or more 10 Fn3 domains that are covalently associated.
  • the fibronectin based scaffold protein is a bispecific or dimeric protein comprising two 10 Fn3 domains.
  • a multivalent fibronectin based protein scaffold comprises a first 10 Fn3 domain that binds to a first target molecule and a second 10 Fn3 domain that binds to a second target molecule.
  • the first and second target molecules may be the same or different target molecules.
  • the 10 Fn3 domains i.e., the binding loops
  • the first and second 10 Fn3 domains may be the same or different. Therefore, the first and second 10 Fn3 domains may bind to the same target but at different epitopes.
  • each 10 Fn3 domain of a multivalent fibronectin based protein scaffold binds to a desired target with a K D of less than 500 nM, 100 nM, 1 nM, 500 pM, 100 pM or less. In exemplary embodiments, each 10 Fn3 domain of a multivalent fibronectin based protein scaffold binds specifically to a target that is not bound by a wild-type 10 Fn3 domain, particularly the wild-type human 10 Fn3 domain.
  • the 10 Fn3 domains in a multivalent fibronectin based scaffold protein may be connected by a polypeptide linker.
  • exemplary polypeptide linkers include polypeptides having from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, or 1-2 amino acids. Specific examples of suitable polypeptide linkers are described further herein.
  • the linker may be a C-terminal tail polypeptide as described herein, an N-terminal extension polypeptide as described herein, a linker polypeptide as described below, or any combination thereof.
  • a multivalent fibronectin based scaffold protein comprises two or more 10 Fn3 domains, wherein each domain comprises a C-terminal tail that does not contain a DK sequence.
  • a multivalent fibronectin based scaffold protein comprises two or more 10 Fn3 domains, wherein each domain comprises a C-terminal tail that does not contain a DK sequence and does contain a residue suitable for addition of a PEG moiety, such as a lysine or cysteine residue.
  • a multivalent fibronectin based scaffold protein comprises two or more 10 Fn3 domains, wherein each domain comprises a C-terminal tail comprising the amino acid sequence of SEQ ID NO: 4.
  • a multivalent fibronectin based scaffold protein comprises two or more 10 Fn3 domains, wherein the N- terminal 10 Fn3 domain comprises a C-terminal tail comprising the amino acid sequence of SEQ ID NO: 4 and the C-terminal 10 Fn3 domain comprises a C-terminal tail comprising the amino acid sequence of EIEK (SEQ ID NO: 4), EGSGC (SEQ ID NO: 5), EIEKPCQ (SEQ ID NO: 6), EIEKPSQ (SEQ ID NO: 32), EIEKP (SEQ ID NO: 33), EIEKPS (SEQ ID NO: 34), or EIEKPC (SEQ ID NO: 35).
  • the fibronectin based scaffold proteins provided herein having increased stability may bind to a therapeutically desirable target, such as, for example, TNFa, VEGFR2, IGF-IR, or EGFR.
  • a fibronectin based scaffold protein does not bind to one or more of the following targets: EGFR, IGF-IR, HSA and PCSK9, or a fragment of any of the foregoing.
  • a fibronectin based scaffold protein comprising a single 10 Fn3 domain does not bind to one or more of the following targets: EGFR, IGF-IR, HSA and PCSK9, or a fragment of any of the foregoing. In certain embodiments, a fibronectin based scaffold protein comprising a single 10 Fn3 domain does not bind to any of the following targets: EGFR, IGF-IR, HSA and PCSK9, or a fragment of any of the foregoing.
  • a fibronectin based scaffold protein comprising two 10 Fn3 domains does not bind one or more of the following targets: EGFR, IGF-IR, HSA and PCSK9, or a fragment of any of the foregoing. In certain embodiments, a fibronectin based scaffold protein comprising two 10 Fn3 domains does not bind one or more of the following combinations of target molecules: i) EGFR and IGF-IR; ii) EGFR and any other target protein; or iii) human serum albumin and any other target protein.
  • a fibronectin based scaffold protein comprising two 10 Fn3 domains does not bind any of the following combinations of target molecules: i) EGFR and IGF-IR; ii) EGFR and any other target protein; or iii) human serum albumin and any other target protein.
  • the fibronectin based scaffold proteins described herein are dimers comprising two 10 Fn3 domains.
  • the application provides V/I fibronectin based scaffold protein dimers comprising a first and second 10 Fn3 domain selected from the group consisting of: (i) a 10 Fn3 domain comprising a BC loop having the amino acid sequence of SEQ ID NO: 40, a DE loop having the amino acid sequence of SEQ ID NO: 41, an FG loop having the amino acid sequence of SEQ ID NO: 42, and a C-terminal tail comprising the amino acid sequence of any one of SEQ ID NOs: 4-6, wherein the 10 Fn3 domain binds IGF- IR; and (ii) a 10 Fn3 domain comprising a BC loop having the amino acid sequence of SEQ ID NO: 43, a DE loop having the amino acid sequence of SEQ ID NO: 44, an FG loop having the amino acid sequence of SEQ ID NO: 45, and a C-terminal tail comprising the amino acid
  • each of the VEGFR2 and IGF-IR binding 10 Fn3 domains binds to its target with a K D of less than 500 nM, 100 nM, 1 nM, 500 pM, 100 pM or less.
  • the V/I fibronectin based scaffold protein dimer comprises in order from N-terminus to C-terminus an IGF-IR binding domain and a VEGFR2 binding domain.
  • the fibronectin based scaffold protein dimer comprises: (i) a first 10 Fn3 domain comprising a BC loop having the amino acid sequence of SEQ ID NO: 40, a DE loop having the amino acid sequence of SEQ ID NO: 41, an FG loop having the amino acid sequence of SEQ ID NO: 42, and a C-terminal tail comprising the amino acid sequence of SEQ ID NO: 4, wherein the 10 Fn3 domain binds IGF-IR; and (ii) a second 10 Fn3 domain comprising a BC loop having the amino acid sequence of SEQ ID NO: 43, a DE loop having the amino acid sequence of SEQ ID NO: 44, an FG loop having the amino acid sequence of SEQ ID NO: 45, and a C-terminal tail comprising the amino acid sequence of SEQ ID NO:
  • each of the VEGFR2 and IGF-IR binding 10 Fn3 domains binds to its target with a K D of less than 500 nM, 100 nM, 1 nM, 500 pM, 100 pM or less.
  • the V/I fibronectin based scaffold protein dimer comprises in order from N-terminus to C-terminus a VEGFR2 binding domain and an IGF-IR binding domain.
  • the fibronectin based scaffold protein dimer comprises: (i) a first 10 Fn3 domain comprising a BC loop having the amino acid sequence of SEQ ID NO: 43, a DE loop having the amino acid sequence of SEQ ID NO: 44, an FG loop having the amino acid sequence of SEQ ID NO: 45, and a C-terminal tail comprising the amino acid sequence of SEQ ID NO: 4, wherein the 10 Fn3 domain binds VEGFR2; and (ii) a second 10 Fn3 domain comprising a BC loop having the amino acid sequence of SEQ ID NO: 40, a DE loop having the amino acid sequence of SEQ ID NO: 41, an FG loop having the amino acid sequence of SEQ ID NO: 42, and a C-terminal tail comprising the amino acid sequence of SEQ ID NO:
  • the V/I fibronectin based scaffold protein dimer comprises a first and second 10 Fn3 domain selected from the group consisting of: (i) a 10 Fn3 domain comprising, consisting essentially of, or consisting of an amino acid sequence having at least 90%, 95%, 97%, 98%, 99% or 100% identity with SEQ ID NO: 2, wherein the 10 Fn3 domain comprises, consists essentially of, or consists of a C-terminal tail having the amino acid sequence of any one of SEQ ID NOs: 4-6, and wherein the 10 Fn3 domain binds IGF-IR; and (ii) a 10 Fn3 domain comprising, consisting essentially of, or consisting of an amino acid sequence having at least 90%, 95%, 97%, 98%, 99% or 100% identity with SEQ ID NO: 3, wherein the 10 Fn3 domain comprises, consists essentially of, or consists of a C-terminal tail having the amino acid sequence of any one of SEQ ID NOs: 4-6, and where
  • each of the VEGFR2 and IGF-IR binding 10 Fn3 domains binds to its target with a K D of less than 500 nM, 100 nM, 1 nM, 500 pM, 100 pM or less.
  • the first and second 10 Fn3 domains are connected via a polypeptide linker.
  • the V/I fibronectin based scaffold protein dimer comprises an N-terminal VEGFR2 binding 10 Fn3 domain and a C-terminal IGF-IR binding 10 Fn3 domain.
  • the V/I fibronectin based scaffold protein dimer comprises an N-terminal IGF-IR binding 10 Fn3 domain and a C-terminal VEGFR2 binding 10 Fn3 domain.
  • the N-terminal 10 Fn3 domain comprises a C-terminal tail having the amino acid sequence of SEQ ID NO: 4 and the C-terminal 10 Fn3 domain comprises a C-terminal tail having the amino acid sequence of SEQ ID NO: 6.
  • a V/I fibronectin based scaffold protein dimer comprises the amino acid sequence of any one of SEQ ID NOs: 48-55. In other embodiments, a V/I fibronectin based scaffold protein dimer comprises the amino acid sequence of SEQ ID NO: 48. In some embodiments, a V/I fibronectin based scaffold protein dimer comprises an amino acid sequence having at least 70, 75, 80, 85, 90, 95, 97, 98, 99 or 100% identity with the amino acid sequence of any one of SEQ ID NOs: 48-55.
  • a V/I fibronectin based scaffold protein dimer comprises a polypeptide having the structure N1-D1-C1-L-N2-D2-C2, wherein Nl and N2 are optional N- terminal extensions independently comprising from 0-10 amino acids, wherein Dl and D2 are independently selected from the group consisting of: (i) a tenth fibronectin type III domain ( 10 Fn3) domain having at least 90%, 95%, 97%, 98%, 99% or 100% identity with the amino acid sequence set forth in SEQ ID NO: 2, wherein said 10 Fn3 domain binds to IGF-IR with a K D of less than 500 nM, 100 nM, 1 nM, 500 pM, 100 pM or less, and (ii) a 10 Fn3 domain having at least 90%, 95%, 97%, 98%, 99% or 100% identity with the amino acid sequence set forth in SEQ ID NO: 3, wherein said 10 Fn3 domain binds to VEGFR2 with a
  • the Dl or D2 region is a 10 Fn3 domain that binds to VEGFR2 comprising a BC loop having the amino acid sequence of SEQ ID NO: 43, a DE loop having the amino acid sequence of SEQ ID NO: 44, and an FG loop having the amino acid sequence of SEQ ID NO: 45, wherein the 10 Fn3 domain binds to VEGFR2 with a K D of less than 100 nM.
  • the Dl or D2 region is a VEGFR2 binder represented by the following amino acid sequence:
  • the sequence of the BC, DE and FG loops have a fixed sequence as shown in bold (e.g., a BC loop having the amino acid sequence of SEQ ID NO: 43, a DE loop having the amino acid sequence of SEQ ID NO: 44, and an FG loop having the amino acid sequence of SEQ ID NO: 45) and the remaining sequence which is underlined (e.g., the sequence of the 7 beta strands and the AB, CD and EF loops) has anywhere from 0 to 20, from 0 to 15, from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, conservative substitutions, deletions or additions relative to the corresponding amino acids shown in SEQ ID NO: 3.
  • the core amino acid residues are fixed and any substitutions, conservative substitutions, deletions or additions occur at residues other than the core amino acid residues.
  • the 10 Fn3 domain that binds to VEGFR2 may optionally be linked to an N-terminal extension (Nl or N2) of from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length.
  • N-terminal extensions include (represented by the single letter amino acid code) M, MG, G, MGVSDVPRDL (SEQ ID NO: 19), VSDVPRDL (SEQ ID NO: 20), and GVSDVPRDL (SEQ ID NO: 21), or N-terminal truncations of any one of SEQ ID NOs: 19, 20 or 21.
  • Nl comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 19.
  • N2 comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 20.
  • the 10 Fn3 domain that binds to VEGFR2 may optionally comprise a C-terminal tail (CI or C2).
  • the C-terminal tails of the fibronectin based scaffold protein dimers of the claimed invention do not contain a DK sequence.
  • Exemplary C-terminal tails include polypeptides that are from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length.
  • Specific examples of C-terminal tails include EIEKPSQ (SEQ ID NO: 32), EIEKPCQ (SEQ ID NO: 6), and EIEK (SEQ ID NO: 4).
  • suitable C-terminal tails may be a C-terminally truncated fragment of SEQ ID NOs: 4, 6 or 32, including, for example, one of the following amino acid sequences (represented by the single letter amino acid code): EIE, EIEKP (SEQ ID NO: 33), EIEKPS (SEQ ID NO: 34), or EIEKPC (SEQ ID NO: 35).
  • Other suitable C-terminal tails include, for example, ES, EC, EGS, EGC, EGSGS (SEQ ID NO: 36), or EGSGC (SEQ ID NO: 5).
  • CI comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 4.
  • C2 comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 4, 5 or 6.
  • CI comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 4
  • C2 comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 6.
  • the 10 Fn3 domain that binds to VEGFR2 comprises both an N-terminal extension and a C-terminal tail.
  • Nl begins with Gly or Met-Gly
  • CI does not contain a cysteine residue
  • N2 does not start with a Met
  • C2 comprises a cysteine residue.
  • Specific examples of 10 Fn3 domains that bind to VEGFR2 are polypeptides comprising: (i) the amino acid sequence set forth in SEQ ID NO: 3, or (ii) an amino acid sequence having at least 85%, 90%, 95%, 97%, 98%, or 99% identity with the amino acid sequence set forth in SEQ ID NO: 3.
  • the Dl or D2 region is a 10 Fn3 domain that binds to IGF-IR comprising a BC loop having the amino acid sequence of SEQ ID NO: 40, a DE loop having the amino acid sequence of SEQ ID NO: 41, and an FG loop having the amino acid sequence of SEQ ID NO: 42, wherein the 10 Fn3 domain binds to IGF-IR with a K D of less than 100 nM.
  • the Dl or D2 region is an IGF-IR binder represented by the following amino acid sequence:
  • the sequence of the BC, DE and FG loops have a fixed sequence as shown in bold (e.g., a BC loop having the amino acid sequence of SEQ ID NO: 40, a DE loop having the amino acid sequence of SEQ ID NO: 41, and an FG loop having the amino acid sequence of SEQ ID NO: 42) and the remaining sequence which is underlined (e.g., the sequence of the 7 beta strands and the AB, CD and EF loops) has anywhere from 0 to 20, from 0 to 15, from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, conservative substitutions, deletions or additions relative to the corresponding amino acids shown in SEQ ID NO: 2.
  • the core amino acid residues are fixed and any substitutions, conservative substitutions, deletions or additions occur at residues other than the core amino acid residues.
  • the 10 Fn3 domain that binds to IGF-IR may optionally be linked to an N-terminal extension (Nl or N2) of from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length.
  • N-terminal extensions include (represented by the single letter amino acid code) M, MG, G, MGVSDVPRDL (SEQ ID NO: 19), VSDVPRDL (SEQ ID NO: 20), and GVSDVPRDL (SEQ ID NO: 21), or N-terminal truncations of any one of SEQ ID NOs: 19, 20 or 21.
  • Nl comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 19.
  • N2 comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 20.
  • the 10 Fn3 domain that binds to IGF-IR may optionally comprise a C-terminal tail (CI or
  • the C-terminal tails of the fibronectin based scaffold protein dimers of the claimed invention do not contain a DK sequence.
  • Exemplary C-terminal tails include polypeptides that are from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length.
  • Specific examples of C-terminal tails include EIEKPSQ (SEQ ID NO: 32), EIEKPCQ (SEQ ID NO: 6), and EIEK (SEQ ID NO: 4).
  • suitable C-terminal tails may be a C-terminally truncated fragment of SEQ ID NOs: 4, 6 or 32, including, for example, one of the following amino acid sequences (represented by the single letter amino acid code): EIE, EIEKP (SEQ ID NO: 33), EIEKPS (SEQ ID NO: 34), or EIEKPC (SEQ ID NO: 35).
  • Other suitable C-terminal tails include, for example, ES, EC, EGS, EGC, EGSGS (SEQ ID NO: 36), or EGSGC (SEQ ID NO: 5).
  • CI comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 4.
  • C2 comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 4, 5 or 6.
  • CI comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 4
  • C2 comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 6.
  • the 10 Fn3 domain that binds to IGF-IR comprises both an N- terminal extension and a C-terminal tail.
  • Nl begins with Gly or Met-Gly
  • CI does not contain a cysteine residue
  • N2 does not start with a Met
  • C2 comprises a cysteine residue.
  • Specific examples of 10 Fn3 domains that bind to IGF-IR are polypeptides comprising: (i) the amino acid sequence set forth in SEQ ID NO: 2, or (ii) an amino acid sequence having at least 85%, 90%, 95%, 97%, 98%, or 99% identity with the amino acid sequence set forth in SEQ ID NO: 2.
  • the L region is a polypeptide linker.
  • exemplary polypeptide linkers include polypeptides having from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, or 1-2 amino acids. Specific examples of suitable polypeptide linkers are described further herein.
  • the linker may be a C-terminal tail polypeptide as described herein, an N-terminal extension polypeptide as described herein, or a combination thereof.
  • one or more of Nl, N2, L, CI or C2 may comprise an amino acid residue suitable for pegylation, such as a cysteine or lysine residue.
  • C2 comprises at least one amino acid suitable for pegylation, such as a cysteine or lysine residue.
  • suitable polypeptide linkers are described further below.
  • fibronectin based scaffold protein dimers having the structure N1-D1-C1- L-N2-D2-C2 are polypeptides comprising: (i) the amino acid sequence set forth in any one of SEQ ID NOs: 48-55, or (ii) an amino acid sequence having at least 85%, 90%, 95%, 97%, 98%, or 99% identity with any one of SEQ ID NOs: 48-55.
  • fibronectin based scaffold protein dimers will have the structure N1-D1-L-N2-D2, wherein Dl and D2 each comprise an amino acid sequence having the following sequence:
  • the BC loop is represented by X x
  • the DE loop is represented by X y
  • the FG loop is represented by X z .
  • the sequences of the beta strands may have anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, deletions or additions across all 7 scaffold regions relative to the corresponding amino acids shown in SEQ ID NO: 38.
  • the sequences of the beta strands may have anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 conservative substitutions across all 7 scaffold regions relative to the corresponding amino acids shown in SEQ ID NO: 38.
  • the core amino acid residues are fixed and any substitutions, conservative substitutions, deletions or additions occur at residues other than the core amino acid residues.
  • the EIEK tail (SEQ ID NO: 4) shown in bold is fixed.
  • the amino acids immediately flanking the loop regions may each independently be substituted or deleted.
  • each residues may be substituted with a sequence having the same number of amino acids or with a larger amino acid sequence (e.g., insertions of 0-10, 0-8, 0-5, 0-3, or 0-2 amino acid residues).
  • the non-underlined residues are part of the loop region and therefore are amenable to substitution without significantly affecting the structure of the 10 Fn3 domain.
  • a fibronectin based scaffold protein dimer has the structure Nl- D1-L-N2-D2, wherein Dl and D2 are selected from the group consisting of: (i) a 10 Fn3 domain comprising SEQ ID NO: 38, wherein X x comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 40, X y comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 41, and X z comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 42; and (ii) a 10 Fn3 domain comprising SEQ ID NO: 38, wherein X x comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 43, X y comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 44, and X z comprises, consists essentially of, or consists of the amino acid sequence of
  • a fibronectin based scaffold protein dimer has the structure N1-D1-L-N2-D2, wherein Dl comprises the amino acid sequence of SEQ ID NO: 38, wherein X x comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 40, X y comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 41, and X z comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 42, and wherein D2 comprises the amino acid sequence of SEQ ID NO: 38, wherein X x comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 43, X y comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 44, and X z comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 45.
  • a fibronectin based scaffold protein dimer has the structure N1-D1-L-N2-D2, wherein Dl comprises the amino acid sequence of SEQ ID NO: 38, wherein X x comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 43, X y comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 44, and X z comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 45; and wherein D2 comprises the amino acid sequence of SEQ ID NO: 38, wherein X x comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 40, X y comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 41, and X z comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 42.
  • a fibronectin based scaffold protein dimer having the structure N1-D1-L-N2-D2 further comprises a C-terminal tail.
  • the C- terminal tail comprises a residue suitable for addition of a PEG moiety, e.g., a lysine or cysteine residue.
  • the C-terminal tail comprises the sequence PCQ.
  • the L domain of a fibronectin based scaffold protein dimer having the structure N1-D1-L-N2-D2 is a polypeptide linker.
  • Exemplary polypeptide linkers include polypeptides having from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, or 1-2 amino acids. Specific examples of suitable polypeptide linkers are described further herein.
  • Nl and N2 are N-terminal extensions as described herein above.
  • the fibronectin based scaffold protein dimers described herein have increased stability either in vitro, in vivo or both. In certain embodiments, the fibronectin based scaffold protein dimers described herein have reduced fragmentation and/or decreased aggregation during storage in solution. In certain embodiments, the fibronectin based scaffold protein dimers described herein have increased serum half-life.
  • the fibronectin based scaffold protein dimers described herein have reduced fragmentation relative to a fibronectin based scaffold protein dimer comprising a DK sequence.
  • the fibronectin based scaffold protein dimers described herein have increased stability relative to a fibronectin based scaffold protein dimer having one or more DK sequences in any one of: a C-terminal tail, an N-terminal extension or a linker between two 10 Fn3 domains.
  • the fibronectin based scaffold protein dimers are generally more stable than fibronectin based scaffold protein dimers having a DK sequence in one or both C-terminal tail regions, e.g., comprising a tail having SEQ ID NO: 46 after the first and/or second 10 Fn3 subunit.
  • the fibronectin based scaffold protein dimers described herein have reduced fragmentation relative to a fibronectin based scaffold protein dimer having the formula N1-D1-C1-L-N2-D2-C2, wherein CI and/or C2 comprise SEQ ID NO: 46. Fragmentation may be assessed, for example, using RP-HPLC analysis, as described in Example 3.
  • the fibronectin based scaffold protein dimers described herein exhibit less than 7%, 6%, 5%, 4%, 3.5%, 3%>, 2%> or less fragmentation upon storage in solution for four weeks at pH 4.0. In certain embodiments, the fibronectin based scaffold protein dimers described herein exhibit a level of fragmentation that is reduced by at least 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80% or more relative to an equivalent version of the fibronectin based scaffold protein dimer that contains one or more DK sequences.
  • the fibronectin based scaffold protein dimers described herein exhibit a serum half-life that is increased by at least 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80% or more relative to the serum half-life of a an equivalent version of the fibronectin based scaffold protein dimer that contains one or more DK sequences.
  • the fibronectin based scaffold protein dimers described herein exhibit a serum half-life that is increased by at least 2-fold, 3-fold, 5-fold, 10-fold, or more relative to the serum half-life of a an equivalent version of the fibronectin based scaffold protein dimer that contains one or more DK sequences.
  • an E/I fibronectin based scaffold protein dimer comprising one 10 Fn3 domain that binds to EGFR and one 10 Fn3 domain that binds to IGF-IR.
  • an E/I fibronectin based scaffold protein dimer comprises the amino acid sequence of any one of SEQ ID NOs: 22-25.
  • an E/I fibronectin based scaffold protein dimer comprises the amino acid sequence of SEQ ID NO: 25.
  • an E/I fibronectin based scaffold protein dimer comprises an amino acid sequence having at least 70, 75, 80, 85, 90, 95, 97, 98, 99 or 100% identity with the amino acid sequence of any one of SEQ ID NOs: 22-25.
  • the application provides multivalent fibronectin based scaffold proteins comprising at least two 10 Fn3 domains linked via a polypeptide linker.
  • the application provides fibronectin based scaffold dimers comprising two 10 Fn3 domains linked via a polypeptide linker (L).
  • the polypeptides comprise an N-terminal domain comprising a first 10 Fn3 domain and a C-terminal domain comprising a second 10 Fn3 domain.
  • the first and second 10 Fn3 domains may be directly or indirectly linked via a polypeptide linker (L).
  • Additional linkers or spacers e.g., SEQ ID NOS: 4, 6 or 32, may be introduced at the C-terminus of the first 10 Fn3 domain between the 10 Fn3 domain and the polypeptide linker. Additional linkers or spacers may be introduced at the N-terminus of the second 10 Fn3 domain between the 10 Fn3 domain and the polypeptide linker.
  • Suitable linkers for joining the 10 Fn3 domains are those which allow the separate domains to fold independently of each other forming a three dimensional structure that permits high affinity binding to a target molecule.
  • suitable linkers that meet these requirements comprise glycine-serine based linkers, glycine-proline based linkers, proline-alanine based linkers as well as the linker SEQ ID NO: 7.
  • the Examples described in WO 2009/142773 demonstrate that Fn3 domains joined via these linkers retain their target binding function.
  • the linker is a glycine-serine based linker. These linkers comprise glycine and serine residues and may be between 8 and 50, 10 and 30, and 10 and 20 amino acids in length.
  • linkers examples include SEQ ID NOs: 8-12.
  • the polypeptide linker is selected from SEQ ID NOs: 8 and 9.
  • the linker is a glycine-proline based linker. These linkers comprise glycine and proline residues and may be between 3 and 30, 10 and 30, and 3 and 20 amino acids in length. Examples of such linkers include SEQ ID NOs: 13, 14 and 15.
  • the linker is a proline-alanine based linker. These linkers comprise proline and alanine residues and may be between 3 and 30, 10 and 30, 3 and 20 and 6 and 18 amino acids in length. Examples of such linkers include SEQ ID NOs: 16, 17 and 18.
  • the optimal linker length and amino acid composition may be determined by routine experimentation by methods well known in the art.
  • the polypeptide linker is SEQ ID NO: 7.
  • the linker does not contain any DK sequences.
  • the application provides for fibronectin based scaffold proteins further comprising a pharmacokinetic (PK) moiety.
  • PK pharmacokinetic
  • Pharmokinetics encompasses properties of a compound including, by way of example, absorption, distribution, metabolism, and elimination by a subject. Improved pharmacokinetics may be assessed according to the perceived therapeutic need. Often it is desirable to increase bioavailability and/or increase the time between doses, possibly by increasing the time that a protein remains available in the serum after dosing. In some instances, it is desirable to improve the continuity of the serum concentration of the protein over time (e.g., decrease the difference in serum concentration of the protein shortly after administration and shortly before the next administration).
  • the fibronectin based scaffold proteins may be attached to a moiety that reduces the clearance rate of the polypeptide in a mammal (e.g., mouse, rat, or human) by greater than three-fold relative to the unmodified polypeptide.
  • a mammal e.g., mouse, rat, or human
  • Other measures of improved pharmacokinetics may include serum half-life, which is often divided into an alpha phase and a beta phase. Either or both phases may be improved significantly by addition of an appropriate moiety.
  • a PK moiety refers to any protein, peptide, or moiety that affects the pharmacokinetic properties of a biologically active molecule when fused to the biologically active molecule.
  • PK moieties that tend to slow clearance of a protein from the blood include polyoxyalkylene moieties, e.g., polyethylene glycol, sugars (e.g., sialic acid), and well-tolerated protein moieties (e.g., Fc, Fc fragments, transferrin, or serum albumin).
  • the fibronectin based scaffold proteins may be fused to albumin or a fragment (portion) or variant of albumin as described in U.S. Publication No. 20070048282.
  • the PK moiety is a serum albumin binding protein such as those described in U.S. Publication Nos. 2007/0178082 and 2007/0269422.
  • the PK moiety is a serum immunoglobulin binding protein such as those described in U.S. Publication No. 2007/0178082.
  • the fibronectin based scaffold proteins may be attached to a PK moiety comprising a nonproteinaceous polymer.
  • the polymer is polyethylene glycol ("PEG"), polypropylene glycol, or polyoxyalkylenes, as described in U.S. Patent Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or 4,179,337.
  • the polymer is a PEG moiety.
  • PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Kara, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138- 161).
  • the term "PEG” is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented by the formula: X— 0(CH 2 CH 2 0) n _iCH 2 CH 2 OH (1), where n is 20 to 2300 and X is H or a terminal modification, e.g., a Ci_ 4 alkyl.
  • the PEG of the invention terminates on one end with hydroxy or methoxy, i.e., X is H or CH 3 ("methoxy PEG").
  • a PEG can contain further chemical groups which are necessary for binding reactions; which results from the chemical synthesis of the molecule; or which is a spacer for optimal distance of parts of the molecule.
  • such a PEG can consist of one or more PEG side-chains which are linked together. PEGs with more than one PEG chain are called multiarmed or branched PEGs. Branched PEGs can be prepared, for example, by the addition of polyethylene oxide to various polyols, including glycerol, pentaerythriol, and sorbitol.
  • a four-armed branched PEG can be prepared from pentaerythriol and ethylene oxide.
  • Branched PEG are described in, for example, European Published Application No. 473084A and U.S. Patent No. 5,932,462.
  • One form of PEGs includes two PEG side-chains (PEG2) linked via the primary amino groups of a lysine (Monfardini, C, et al, Bioconjugate Chem. 6 (1995) 62-69).
  • PEG conjugation to peptides or proteins generally involves the activation of PEG and coupling of the activated PEG-intermediates directly to target proteins/peptides or to a linker, which is subsequently activated and coupled to target proteins/peptides (see Abuchowski, A. et al, J. Biol. Chem., 252, 3571 (1977) and J. Biol. Chem., 252, 3582 (1977), Zalipsky, et al, and Harris et. al., in: Poly(ethylene glycol) Chemistry: Biotechnical and Biomedical Applications; (J. M. Harris ed.) Plenum Press: New York, 1992; Chap.21 and 22). It is noted that a fibronectin based scaffold protein containing a PEG molecule is also known as a conjugated protein, whereas the protein lacking an attached PEG molecule can be referred to as unconjugated.
  • PEG size of PEG utilized will depend on several factors including the intended use of the fibronectin based scaffold protein. Larger PEGs are preferred to increase half life in the body, blood, non-blood extracellular fluids or tissues. For in vivo cellular activity, PEGs of the range of about 10 to 60 kDa are preferred, as well as PEGs less than about 100 kDa and more preferably less than about 60 kDa, though sizes greater than about 100 kDa can be used as well. For in vivo imaging applications, smaller PEGs, generally less than about 20 kDa, may be used that do not increase half life as much as larger PEGs so as to permit quicker distribution and less half life.
  • a variety of molecular mass forms of PEG can be selected, e.g., from about 1,000 Daltons (Da) to 100,000 Da (n is 20 to 2300), for conjugating to fibronectin based scaffold proteins.
  • the number of repeating units "n" in the PEG is approximated for the molecular mass described in Daltons. It is preferred that the combined molecular mass of PEG on an activated linker is suitable for pharmaceutical use. Thus, in one embodiment, the molecular mass of the PEG molecules does not exceed 100,000 Da.
  • each PEG molecule has the same molecular mass of 12,000 Da (each n is about 270)
  • the total molecular mass of PEG on the linker is about 36,000 Da (total n is about 820).
  • the molecular masses of the PEG attached to the linker can also be different, e.g., of three molecules on a linker two PEG molecules can be 5,000 Da each (each n is about 110) and one PEG molecule can be 12,000 Da (n is about 270).
  • one PEG moiety is conjugated to the fibronectin based scaffold protein.
  • the PEG moiety is about 20, 30, 40, 50, 60, 70, 80, or 90 KDa.
  • the PEG moiety is about 40 KDa.
  • PEGylated fibronectin based scaffold proteins contain one, two or more PEG moieties.
  • the PEG moiety(ies) are bound to an amino acid residue which is on the surface of the protein and/or away from the surface that contacts the target ligand.
  • the combined or total molecular mass of PEG in a pegylated fibronectin based scaffold protein is from about 3,000 Da to 60,000 Da, or from about 10,000 Da to 36,000 Da.
  • the PEG in a pegylated fibronectin based scaffold protein is a substantially linear, straight-chain PEG.
  • PEG poly(ethylene glycol)
  • a suitable molecular mass for PEG e.g., based on how the pegylated fibronectin based scaffold protein will be used therapeutically, the desired dosage, circulation time, resistance to proteolysis, immunogenicity, and other considerations.
  • a fibronectin based scaffold protein is covalently linked to one polyethylene glycol) group of the formula:—CO— (CH 2 ) X — (OCH 2 CH 2 ) m — OR, with the -CO (i.e. carbonyl) of the poly(ethylene glycol) group forming an amide bond with one of the amino groups of the binding polypeptide; R being lower alkyl; x being 2 or 3; m being from about 450 to about 950; and n and m being chosen so that the molecular weight of the conjugate minus the binding polypeptide is from about 10 to 40 kDa.
  • a fibronectin based scaffold protein's ⁇ -amino group of a lysine is the available (free) amino group.
  • carbonate esters of PEG are used to form the PEG- fibronectin based scaffold protein conjugates.
  • ⁇ , ⁇ '-disuccinimidylcarbonate (DSC) may be used in the reaction with PEG to form active mixed PEG-succinimidyl carbonate that may be subsequently reacted with a nucleophilic group of a linker or an amino group of a fibronectin based scaffold protein (see U.S. Patent No. 5,281,698 and U.S. Patent No. 5,932,462).
  • l,l '-(dibenzotriazolyl)carbonate and di-(2-pyridyl)carbonate may be reacted with PEG to form PEG-benzotriazolyl and PEG-pyridyl mixed carbonate (U.S. Patent No. 5,382,657), respectively.
  • Pegylation of a fibronectin based scaffold protein can be performed according to the methods of the state of the art, for example by reaction of the fibronectin based scaffold protein with electrophilically active PEGs (supplier: Shearwater Corp., USA, world wide web at shearwatercorp.com).
  • Preferred PEG reagents of the present invention are, e.g., N- hydroxysuccinimidyl propionates (PEG-SPA), butanoates (PEG-SBA), PEG-succinimidyl propionate or branched N-hydroxysuccinimides such as mPEG2-NHS (Monfardini, C, et al, Bioconjugate Chem. 6 (1995) 62-69).
  • PEG-SPA N- hydroxysuccinimidyl propionates
  • PEG-SBA butanoates
  • PEG-succinimidyl propionate or branched N-hydroxysuccinimides such as m
  • PEG molecules may be coupled to sulfhydryl groups on a fibronectin based scaffold protein (Sartore, L., et al, Appl. Biochem. BiotechnoL, 27, 45 (1991); Morpurgo et al, Biocon. Chem., 7, 363-368 (1996); Goodson et al, Bio/Technology (1990) 8, 343; U.S. Patent No. 5,766,897).
  • U.S. Patent Nos. 6,610,281 and 5,766,897 describes exemplary reactive PEG species that may be coupled to sulfhydryl groups.
  • the pegylated fibronectin based scaffold protein is produced by site-directed pegylation, particularly by conjugation of PEG to a cysteine moiety.
  • the Cys residue may be positioned at the N-terminus, between the N-terminus and the most N-terminal beta or beta-like strand, at the C-terminus, or between the C-terminus and the most C-terminal beta or beta-like strand of the fibronectin based scaffold protein.
  • the fibronectin based scaffold protein is a dimer and the Cys residue may be positioned at the N-terminus, between the N-terminus and the most N-terminal beta or beta-like strand, at the C-terminus, or between the C-terminus and the most C-terminal beta or beta-like strand of either binding domain of the fibronectin based scaffold protein dimer.
  • the Cys residue may be positioned at the N-terminus of the fibronectin based scaffold protein dimer, between the N-terminus and the most N-terminal beta or beta-like strand of the fibronectin based scaffold protein dimer (i.e., of the N-terminal binding domain of the fibronectin based scaffold protein dimer), or at the C-terminus of the fibronectin based scaffold protein dimer, or between the C-terminus and the most C-terminal beta or beta-like strand of the fibronectin based scaffold protein dimer (i.e., of the C-terminal binding domain of the fibronectin based scaffold protein dimer).
  • a Cys residue may be situated at other positions as well, particularly any of the loops that do not participate in target binding or between two binding domains of a multivalent fibronectin based scaffold protein.
  • a PEG moiety may also be attached by other chemistry, including by conjugation to amines.
  • cysteine residues are native to the fibronectin based scaffold protein, whereas in other embodiments, one or more cysteine residues are engineered into the fibronectin based scaffold protein.
  • Mutations may be introduced into a fibronectin based scaffold protein coding sequence to generate cysteine residues. This might be achieved, for example, by mutating one or more amino acid residues to cysteine.
  • Preferred amino acids for mutating to a cysteine residue include serine, threonine, alanine and other hydrophilic residues.
  • the residue to be mutated to cysteine is a surface-exposed residue.
  • fibronectin based scaffold proteins may be predicted by comparing the amino acid sequences of fibronectin based scaffold proteins, given that the crystal structure of the tenth fn3 domain framework based on which fibronectin based scaffold proteins are designed has been solved (see Dickinson, et al, J. Mol. Biol. 236(4): 1079-92 (1994)) and thus the surface-exposed residues identified.
  • cysteine residues are introduced into fibronectin based scaffold protein at or near the N- and/or C-terminus, or within loop regions.
  • Pegylation of cysteine residues may be carried out using, for example, PEG-maleimide, PEG-vinylsulfone, PEG-iodoacetamide, or PEG-orthopyridyl disulfide.
  • the pegylated fibronectin based scaffold protein comprises a PEG molecule covalently attached to the alpha amino group of the N-terminal amino acid.
  • Site specific N-terminal reductive amination is described in Pepinsky et al, (2001) JPET, 297,1059, and U.S. Patent No. 5,824,784.
  • the use of a PEG-aldehyde for the reductive amination of a protein utilizing other available nucleophilic amino groups is described in U.S. Patent No. 4,002,531, in Wieder et al, (1979) J. Biol. Chem. 254,12579, and in Chamow et al, (1994) Bioconjugate Chem. 5, 133.
  • pegylated fibronectin based scaffold proteins comprise one or more PEG molecules covalently attached to a linker, which in turn is attached to the alpha amino group of the amino acid residue at the N-terminus of the fibronectin based scaffold protein.
  • a fibronectin based scaffold protein is pegylated at the C-terminus.
  • a protein is pegylated at the C-terminus by the introduction of C- terminal azido-methionine and the subsequent conjugation of a methyl-PEG-triarylphosphine compound via the Staudinger reaction.
  • a fibronectin based scaffold protein is pegylated in a C-terminal tail region as described further herein.
  • Exemplary C-terminal tails include, for example, a polypeptide having any one of SEQ ID NOs: 5, 6 or 35.
  • compositions in which, for example, at least ninety-two percent or at least ninety-six percent of the conjugates are mono-PEG species may be desired.
  • the percentage of mono-PEG conjugates is from ninety percent to ninety-six percent.
  • the PEG in a pegylated fibronectin based scaffold protein is not hydrolyzed from the pegylated amino acid residue using a hydroxylamine assay, e.g., 450 mM hydroxylamine (pH 6.5) over 8 to 16 hours at room temperature, and is thus stable.
  • a hydroxylamine assay e.g., 450 mM hydroxylamine (pH 6.5) over 8 to 16 hours at room temperature
  • greater than 80% of the composition is stable mono-PEG-fibronectin based scaffold protein, more preferably at least 90%, and most preferably at least 95%.
  • the pegylated fibronectin based scaffold proteins will preferably retain at least about 25%, 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified protein.
  • biological activity refers to its ability to bind to one or more target molecules, as assessed by K D , k on or k off .
  • the pegylated fibronectin based scaffold protein shows an increase in binding to one or more target molecules relative to unpegylated fibronectin based scaffold protein.
  • the serum clearance rate of PEG-modified fibronectin based scaffold proteins may be decreased by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or even 90%, relative to the clearance rate of the unmodified fibronectin based scaffold protein.
  • the PEG-modified fibronectin based scaffold protein may have a half-life (ti/ 2 ) which is enhanced relative to the half-life of the unmodified fibronectin based scaffold protein.
  • the half-life of PEG-modified fibronectin based scaffold protein may be enhanced by at least 10%, 20%, 30%>, 40%>, 50%>, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 400% or 500%, or even by 1000% relative to the half- life of the unmodified fibronectin based scaffold protein.
  • the protein half-life is determined in vitro, such as in a buffered saline solution or in serum.
  • the protein half-life is an in vivo half life, such as the half-life of the fibronectin based scaffold protein in the serum or other bodily fluid of an animal.
  • the application provides fibronectin based scaffold proteins comprising a fibronectin type III domain that bind a human target, such as, for example, TNF-alpha, EGFR, VEGFR2, IGF-IR, or other proteins.
  • a human target such as, for example, TNF-alpha, EGFR, VEGFR2, IGF-IR, or other proteins.
  • One way to rapidly make and test Fn3 domains with specific binding properties is the nucleic acid-protein fusion technology of Adnexus, a Bristol- Myers Squibb Company.
  • PROfusionTM Such in vitro expression and tagging technology, termed PROfusionTM, that exploits nucleic acid-protein fusions (RNA- and DNA-protein fusions) may be used to identify novel polypeptides and amino acid motifs that are important for binding to proteins.
  • Nucleic acid-protein fusion technology is a technology that covalently couples a protein to its encoding genetic information.
  • RNA-protein fusion technology and fibronectin-based scaffold protein library screening methods see Szostak et al., U.S. Patent Nos.: 6,258,558; 6,261,804; 6,214,553; 6,281,344; 6,207,446; 6,518,018; PCT Publication Nos. WO00/34784; WO01/64942; WO02/032925; and Roberts and Szostak, Proc Natl. Acad. Sci. 94:12297-12302, 1997, herein incorporated by reference.
  • Nucleic acids encoding any of the various fibronectin based scaffold proteins disclosed herein may be synthesized chemically, enzymatically or recombinantly. Codon usage may be selected so as to improve expression in a cell. Such codon usage will depend on the cell type selected. Specialized codon usage patterns have been developed for E. coli and other bacteria, as well as mammalian cells, plant cells, yeast cells and insect cells. See for example: Mayfield et al, Proc Natl Acad Sci U S A. 2003 Jan 21;100(2):438-42; Sinclair et al. Protein Expr Purif. 2002 Oct;26(l):96-105; Connell ND. Curr Opin Biotechnol. 2001 Oct;12(5):446-9; Makrides et al. Microbiol Rev. 1996 Sep;60(3):512-38; and Sharp et al. Yeast. 1991 Oct;7(7):657-78.
  • the DNA encoding the polypeptide is operably linked to suitable transcriptional or translational regulatory elements derived from mammalian, viral, or insect genes.
  • suitable transcriptional or translational regulatory elements include a transcriptional promoter, an optional operator sequence to control transcription, a sequence encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation.
  • the ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants are additionally incorporated.
  • the fibronectin based scaffold proteins described herein may be produced recombinantly not only directly, but also as a fusion polypeptide with a heterologous polypeptide, which is preferably a signal sequence or other polypeptide having a specific cleavage site at the N- terminus of the mature protein or polypeptide.
  • a heterologous polypeptide which is preferably a signal sequence or other polypeptide having a specific cleavage site at the N- terminus of the mature protein or polypeptide.
  • the heterologous signal sequence selected preferably is one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell.
  • the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase, lpp, or heat-stable enterotoxin II leaders.
  • a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase, lpp, or heat-stable enterotoxin II leaders.
  • yeast secretion the native signal sequence may be substituted by, e.g., the yeast invertase leader, a factor leader (including Saccharomyces and Kluyveromyces alpha-factor leaders), or acid phosphatase leader, the C. albicans glucoamylase leader, or the signal described in PCT Publication No. WO90/ 13646.
  • mammalian signal sequences as well as viral secretory leaders for example, the herpes simplex gD signal, are available.
  • the DNA for such precursor regions may be ligated
  • Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells.
  • this sequence is one that enables the vector to replicate independently of the host chromosomal DNA, and includes origins of replication or autonomously replicating sequences.
  • origins of replication or autonomously replicating sequences are well known for a variety of bacteria, yeast, and viruses.
  • the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, the 2 micron plasmid origin is suitable for yeast, and various viral origins (SV40, polyoma, adenovirus, VSV or BPV) are useful for cloning vectors in mammalian cells.
  • the origin of replication component is not needed for mammalian expression vectors (the SV40 origin may typically be used only because it contains the early promoter).
  • Selection genes may contain a selection gene, also termed a selectable marker.
  • Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media, e.g., the gene encoding D-alanine racemase for Bacilli.
  • a suitable selection gene for use in yeast is the trpl gene present in the yeast plasmid YRp7 (Stinchcomb et al., Nature, 282:39 (1979)).
  • the trpl gene provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan, for example, ATCC No. 44076 or PEP4-1. Jones, Genetics, 85: 12 (1977).
  • the presence of the trpl lesion in the yeast host cell genome then provides an effective environment for detecting transformation by growth in the absence of tryptophan.
  • Leu2-deficient yeast strains (ATCC 20,622 or 38,626) are complemented by known plasmids bearing the Leu2 gene.
  • Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to the nucleic acid encoding the fibronectin-based scaffold protein.
  • Promoters suitable for use with prokaryotic hosts include the phoA promoter, beta- lactamase and lactose promoter systems, alkaline phosphatase, a tryptophan (trp) promoter system, and hybrid promoters such as the tac promoter.
  • trp tryptophan
  • Other known bacterial promoters are suitable. Promoters for use in bacterial systems also will contain a Shine-Dalgarno (S.D.) sequence operably linked to the DNA encoding the fibronectin based scaffold protein.
  • Promoter sequences are known for eukaryotes. Virtually all eukaryotic genes have an AT -rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated. Another sequence found 70 to 80 bases upstream from the start of transcription of many genes is a CNCAAT region where N may be any nucleotide. At the 3' end of most eukaryotic genes is an AATAAA sequence that may be the signal for addition of the poly A tail to the 3' end of the coding sequence. All of these sequences are suitably inserted into eukaryotic expression vectors.
  • suitable promoting sequences for use with yeast hosts include the promoters for 3-phosphoglycerate kinase or other glycolytic enzymes, such as enolase, glyceraldehyde-3- phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose- 6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase.
  • 3-phosphoglycerate kinase or other glycolytic enzymes such as enolase, glyceraldehyde-3- phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose- 6-phosphate isomerase, 3-phosphoglycerate mutase, pyruv
  • yeast promoters which are inducible promoters having the additional advantage of transcription controlled by growth conditions, are the promoter regions for alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, degradative enzymes associated with nitrogen metabolism, metallothionein, glyceraldehyde-3 -phosphate dehydrogenase, and enzymes responsible for maltose and galactose utilization.
  • Suitable vectors and promoters for use in yeast expression are further described in EP Patent Publication No. 73,657.
  • Yeast enhancers also are advantageously used with yeast promoters.
  • Transcription from vectors in mammalian host cells can be controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and most preferably Simian Virus 40 (SV40), from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin promoter, from heat-shock promoters, provided such promoters are compatible with the host cell systems.
  • viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and most preferably Simian Virus 40 (SV
  • the early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment that also contains the SV40 viral origin of replication.
  • the immediate early promoter of the human cytomegalovirus is conveniently obtained as a Hindlll E restriction fragment.
  • a system for expressing DNA in mammalian hosts using the bovine papilloma virus as a vector is disclosed in U.S. Patent No. 4,419,446. A modification of this system is described in U.S. Patent No. 4,601,978.
  • Enhancer sequences are now known from mammalian genes (globin, elastase, albumin, .alpha.- fetoprotein, and insulin). Typically, however, one will use an enhancer from a eukaryotic cell virus. Examples include the SV40 enhancer on the late side of the replication origin (bp 100- 270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
  • the enhancer may be spliced into the vector at a position 5 ' or 3' to the polypeptide-encoding sequence, but is preferably located at a site 5' from the promoter.
  • Expression vectors used in eukaryotic host cells will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5' and, occasionally 3', untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding the polypeptide.
  • One useful transcription termination component is the bovine growth hormone polyadenylation region. See W094/11026 and the expression vector disclosed therein.
  • the recombinant DNA can also include any type of protein tag sequence that may be useful for purifying the fibronectin based scaffold protein.
  • protein tags include but are not limited to a histidine tag, a FLAG tag, a myc tag, an HA tag, or a GST tag.
  • Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts can be found in Cloning Vectors: A Laboratory Manual, (Elsevier, New York, 1985), the relevant disclosure of which is hereby incorporated by reference.
  • the expression construct is introduced into the host cell using a method appropriate to the host cell, as will be apparent to one of skill in the art.
  • a variety of methods for introducing nucleic acids into host cells are known in the art, including, but not limited to, electroporation; transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (where the vector is an infectious agent).
  • Suitable host cells include prokaryotes, yeast, mammalian cells, or bacterial cells.
  • Suitable bacteria include gram negative or gram positive organisms, for example, E. coli or Bacillus spp. Yeast, preferably from the Saccharomyces species, such as S. cerevisiae, may also be used for production of polypeptides.
  • Various mammalian or insect cell culture systems can also be employed to express recombinant proteins. Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow and Summers, (Bio/Technology, 6:47, 1988).
  • suitable mammalian host cell lines include endothelial cells, COS-7 monkey kidney cells, CV-1, L cells, CI 27, 3T3, Chinese hamster ovary (CHO), human embryonic kidney cells, HeLa, 293, 293T, and BHK cell lines.
  • Purified fibronectin based scaffold proteins are prepared by culturing suitable host/vector systems to express the recombinant proteins. For many applications, the small size of the fibronectin based scaffold proteins would make expression in E. coli the preferred method for expression. The fibronectin based scaffold protein is then purified from culture media or cell extracts.
  • Host cells are transformed with the herein-described expression or cloning vectors for protein production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
  • the host cells used to produce the fibronectin based scaffold proteins may be cultured in a variety of media.
  • Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium ((MEM), (Sigma)), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), (Sigma)) are suitable for culturing the host cells.
  • any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as GENTAMYCINTM drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
  • the culture conditions such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
  • Fibronectin based scaffold proteins disclosed herein can also be produced using cell-free translation systems.
  • the nucleic acids encoding the fibronectin based scaffold protein must be modified to allow in vitro transcription to produce mRNA and to allow cell-free translation of the mRNA in the particular cell-free system being utilized (eukaryotic such as a mammalian or yeast cell-free translation system or prokaryotic such as a bacterial cell-free translation system).
  • Fibronectin based scaffold proteins can also be produced by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd ed., 1984, The Pierce Chemical Co., Rockford, IL). Modifications to the fibronectin based scaffold protein can also be produced by chemical synthesis.
  • the fibronectin based scaffold proteins disclosed herein can be purified by isolation/purification methods for proteins generally known in the field of protein chemistry. Non-limiting examples include extraction, recrystallization, salting out (e.g., with ammonium sulfate or sodium sulfate), centrifugation, dialysis, ultrafiltration, adsorption chromatography, ion exchange chromatography, hydrophobic chromatography, normal phase chromatography, reversed-phase chromatography, gel filtration, gel permeation chromatography, affinity chromatography, electrophoresis, countercurrent distribution or any combinations of these.
  • fibronectin based scaffold proteins may be exchanged into different buffers and/or concentrated by any of a variety of methods known to the art, including, but not limited to, filtration and dialysis.
  • the purified fibronectin based scaffold protein is preferably at least 85% pure, more preferably at least 95% pure, and most preferably at least 98%> pure. Regardless of the exact numerical value of the purity, the fibronectin based scaffold protein is sufficiently pure for use as a pharmaceutical product.
  • the application provides fibronectin based scaffold proteins labeled with a detectable moiety.
  • the fibronectin based scaffold proteins may be used for a variety of diagnostic applications.
  • the detectable moiety can be any one which is capable of producing, either directly or indirectly, a detectable signal.
  • the detectable moiety may be a radioisotope, such as H3, C14, C13, P32, S35, or 1131; a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin; or an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase.
  • any method known in the art for conjugating a protein to the detectable moiety may be employed, including those methods described by Hunter, et al, Nature 144:945 (1962); David, et al, Biochemistry 13: 1014 (1974); Pain, et al, J. Immunol. Meth. 40:219 (1981); and Nygren, J. Histochem. and Cytochem. 30:407 (1982).
  • conjugation chemistry well know in the art including chemistry compatible with proteins, such as chemistry for specific amino acids, such as Cys and Lys.
  • a linking group or reactive group is used.
  • linking groups are well known in the art and include disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups.
  • Preferred linking groups are disulfide groups and thioether groups depending on the application.
  • a Cys can be engineered in a location to allow for activity of the protein to exist while creating a location for conjugation.
  • Fibronectin based scaffold proteins linked with a detectable moiety also are useful for in vivo imaging.
  • the polypeptide may be linked to a radio-opaque agent or radioisotope, administered to a subject, preferably into the bloodstream, and the presence and location of the labeled protein in the subject is assayed.
  • This imaging technique is useful, for example, in the staging and treatment of malignancies when the fibronectin based scaffold protein binds to a target associated with cancer.
  • the fibronectin based scaffold protein may be labeled with any moiety that is detectable in a subject, whether by nuclear magnetic resonance, radiology, or other detection means known in the art.
  • Fibronectin based scaffold proteins also are useful as affinity purification agents.
  • the fibronectin based scaffold proteins are immobilized on a suitable support, such a Sephadex resin or filter paper, using methods well known in the art.
  • Fibronectin based scaffold proteins can be employed in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays (Zola, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC Press, Inc., 1987)).
  • the disclosure provides methods for detecting a target molecule in a sample, such as VEGFR2, IGF-IR or EGFR.
  • a method may comprise contacting the sample with a fibronectin based scaffold protein described herein, wherein said contacting is carried out under conditions that allow fibronectin based scaffold protein-target complex formation; and detecting said complex, thereby detecting said target in said sample.
  • Detection may be carried out using any technique known in the art, such as, for example, radiography, immunological assay, fluorescence detection, mass spectroscopy, or surface plasmon resonance.
  • the sample will often be a biological sample, such as a biopsy, and particularly a biopsy of a tumor, a suspected tumor.
  • the sample may be from a human or other mammal.
  • the fibronectin based scaffold protein may be labeled with a labeling moiety, such as a radioactive moiety, a fluorescent moiety, a chromogenic moiety, a chemiluminescent moiety, or a hapten moiety.
  • the fibronectin based scaffold protein may be immobilized on a solid support.
  • the application provides fibronectin based scaffold proteins useful in the treatment of disorders.
  • the diseases or disorders that may be treated will be dictated by the binding specificity of the fibronectin based scaffold protein.
  • the application also provides methods for administering fibronectin based scaffold proteins to a subject.
  • the subject is a human.
  • the fibronectin based scaffold proteins are pharmaceutically acceptable to a mammal, in particular a human.
  • a "pharmaceutically acceptable" polypeptide refers to a polypeptide that is administered to an animal without significant adverse medical consequences.
  • fibronectin based scaffold proteins examples include 10 Fn3 domains that lack the integrin- binding domain (RGD) and 10 Fn3 domains that are essentially endotoxin or pyrogen free or have very low endotoxin or pyrogen levels.
  • RGD integrin- binding domain
  • fibronectin based scaffold proteins in particular fibronectin based scaffold proteins that bind to IGF-IR, VEGFR2 and/or EGFR, are useful in treating disorders such as cancer.
  • the fibronectin based scaffold proteins are useful in treating cancers associated with IGF-IR, VEGFR2 and/or EGFR mutations or expression levels.
  • administration of a fibronectin based scaffold protein treats an antiproliferative disorder in a subject.
  • administration of a fibronectin based scaffold protein inhibits tumor cell growth in vivo.
  • the tumor cell may be derived from any cell type including, without limitation, epidermal, epithelial, endothelial, leukemia, sarcoma, multiple myeloma, or mesodermal cells.
  • Examples of common tumor cell lines for use in xenograft tumor studies include A549 (non-small cell lung carcinoma) cells, DU- 145 (prostate) cells, MCF-7 (breast) cells, Colo 205 (colon) cells, 3T3/IGF-IR (mouse fibroblast) cells, NCI H441 cells, HEP G2 (hepatoma) cells, MDA MB 231 (breast) cells, HT-29 (colon) cells, MDA-MB-435s (breast) cells, U266 cells, SH-SY5Y cells, Sk-Mel-2 cells, NCI- H929, RPM 18226, and A431 cells.
  • the fibronectin based scaffold protein inhibits tumor cell growth relative to the growth of the tumor in an untreated animal. In some embodiments, the fibronectin based scaffold protein inhibits tumor cell growth by 50, 60, 70, 80% or more relative to the growth of the tumor in an untreated animal. In some embodiments, the inhibition of tumor cell growth is measured at least 7 days or at least 14 days after the animals have started treatment with the fibronectin based scaffold protein. In some embodiments, another antineoplastic agent is administered to the animal with the fibronectin based scaffold protein.
  • the disclosure provides methods for administering fibronectin based scaffold protein for the treatment and/or prophylaxis of tumors and/or tumor metastases, where the tumor is selected from the group consisting of brain tumor, tumor of the urogenital tract, tumor of the lymphatic system, stomach tumor, laryngeal tumor, monocytic leukemia, lung adenocarcinoma, small-cell lung carcinoma, pancreatic cancer, glioblastoma and breast carcinoma, without being restricted thereto.
  • the disclosure provides methods for administering fibronectin based scaffold proteins for the treatment of cancerous diseases selected from the group consisting of squamous cell carcinoma, bladder cancer, stomach cancer, liver cancer, kidney cancer, colorectal cancer, breast cancer, head cancer, neck cancer, oesophageal cancer, gynecological cancer, thyroid cancer, lymphoma, chronic leukemia and acute leukemia.
  • cancerous diseases selected from the group consisting of squamous cell carcinoma, bladder cancer, stomach cancer, liver cancer, kidney cancer, colorectal cancer, breast cancer, head cancer, neck cancer, oesophageal cancer, gynecological cancer, thyroid cancer, lymphoma, chronic leukemia and acute leukemia.
  • a fibronectin based scaffold protein binds to a target involved in inflammatory response and/or autoimmune disorders, such as, for example, tumor necrosis factor (TNF) alpha.
  • TNF tumor necrosis factor
  • Such fibronectin based scaffold proteins may be useful for treating autoimmune disorders such as rheumatoid arthritis, ankylosing spondylitis, Crohn's disease, psoriasis and refractory asthma.
  • compositions comprising the fibronectin based scaffold proteins described herein, wherein the composition is essentially endotoxin or pyrogen free.
  • Therapeutic formulations comprising fibronectin based scaffold proteins are prepared for storage by mixing the described proteins having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of aqueous solutions, lyophilized or other dried formulations.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyidimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine,
  • formulations herein may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
  • the fibronectin based scaffold proteins may also be entrapped in microcapsule prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsule and poly-(methylmethacylate) microcapsule, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • the application provides stable compositions of fibronectin based scaffold proteins having a pH of 4.0-6.5. In other embodiments, the application provides stable compositions of fibronectin based scaffold proteins having a pH of 4.0-5.5. In other embodiments, the application provides stable compositions of fibronectin based scaffold proteins having a pH of 5.5. In other embodiments, the application provides stable compositions of fibronectin based scaffold proteins having a pH of 4.0. In particular, the application provides stable compositions of fibronectin based scaffold proteins that have reduced fragmentation and/or low levels of aggregation during storage in solution.
  • the fibronectin based scaffold proteins described herein having increased stability at pH 4.0 while at the same time exhibition decreased levels of aggregation at pH 4.0 as compared to a pH of 5.5.
  • Such stable, soluble formulations having a pH of 4.0 are particularly suitable for intravenous administration.
  • the protein concentration in such stable formulations is at least 3mg/mL. In exemplary embodiments, the protein concentration in such stable formulations is at least 5 mg/rnL.
  • the protein concentration in such stable formulations ranges from 3-10 mg/mL, 3-8 mg/mL, 3-6 mg/mL, 3-5 mg/mL, 4-10 mg/mL, 4-8 mg/mL, 4-6 mg/mL, 5-10 mg/mL, 5-8 mg/mL, or 5-6 mg/mL.
  • the stable formulations of fibronectin based scaffold proteins have reduced aggregation relative to an equivalent formulation of a fibronectin based scaffold protein at a higher pH.
  • the stable formulations may exhibit at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, or less aggregation during storage in solution for 4 weeks at pH 4.0 relative to the level of aggregation seen during storage of the fibronectin based scaffold protein during storage for 4 weeks at pH 5.5 or higher.
  • the stable formulations of fibronectin based scaffold proteins have less than 10%>, 8%, 7%, 6%, 5%, 4%, 3%, 2%>, 1%), or less aggregates after storage at 25°C for at least 4 weeks.
  • the stable formulations of fibronectin based scaffold proteins have less than 7%, 6%), 5%, 4%, 3.5%, 3%, 2% or less fragmentation upon storage in solution for four weeks at pH 4.0 and 25 °C. In certain embodiments, the stable formulations of fibronectin based scaffold proteins have less than 5% fragmentation and less than 5% aggregation during storage in solution at 25 °C for at least 4 weeks. In exemplary embodiments, the stable formulations of fibronectin based scaffold proteins have less than 4% fragmentation and less than 4% aggregation during storage in solution at 25 °C for at least 4 weeks.
  • the formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
  • Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the fibronectin based scaffold proteins described herein, which matrices are in the form of shaped articles, e.g., films, or microcapsule. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Patent No.
  • copolymers of L-glutamic acid and y ethyl-L-glutamate non- degradable ethylene-vinyl acetate
  • degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate)
  • poly-D-(-)-3-hydroxybutyric acid While polymers such as ethylene- vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
  • encapsulated proteins When encapsulated proteins remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37°C, resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S--S bond formation through thio- disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
  • each fibronectin based scaffold protein will be dependent on the identity of the protein, the preferred dosages can range from about 10 mg/square meter to about 2000 mg/square meter, more preferably from about 50 mg/square meter to about 1000 mg/square meter.
  • the fibronectin based scaffold proteins are administered to a subject, in a pharmaceutically acceptable dosage form. They can be administered intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes.
  • the protein may also be administered by intratumoral, peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects.
  • Suitable pharmaceutically acceptable carriers, diluents, and excipients are well known and can be determined by those of skill in the art as the clinical situation warrants.
  • Suitable carriers, diluents and/or excipients include: (1) Dulbecco's phosphate buffered saline, pH about 7.4, containing about 1 mg/ml to 25 mg/ml human serum albumin, (2) 0.9% saline (0.9% w/v NaCl), and (3) 5% (w/v) dextrose.
  • the methods of the present invention can be practiced in vitro, in vivo, or ex vivo.
  • fibronectin based scaffold proteins may occur as described above for therapeutic applications.
  • Suitable pharmaceutically acceptable carriers, diluents, and excipients for co-administration will be understood by the skilled artisan to depend on the identity of the particular therapeutic agent being co-administered.
  • the fibronectin based scaffold protein When present in an aqueous dosage form, rather than being lyophilized, the fibronectin based scaffold protein typically will be formulated at a concentration of about 0.1 mg/ml to 100 mg/ml, although wide variation outside of these ranges is permitted.
  • the appropriate dosage of fibronectin based scaffold proteins will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the fibronectin based scaffold proteins are administered for preventive or therapeutic purposes, the course of previous therapy, the patient's clinical history and response to the fibronectin based scaffold protein, and the discretion of the attending physician.
  • the fibronectin based scaffold protein is suitably administered to the patient at one time or over a series of treatments.
  • Short Tail (SEQ ID NO: 4)
  • EGSGC Cys Tail (SEQ ID NO: 6)
  • GGGGS GGGGS GGGGS (GGGGS) 5 (SEQ ID NO: 11)
  • GPGPGPG (SEQ ID NO: 14)
  • GPGPGPGPGPGPG (SEQ ID NO : 15)
  • PA3 linker (SEQ ID NO: 16)
  • GVSDVPRDL (SEQ ID NO: 21)
  • VEGFR2/IGF-IR Binder (SEQ ID NO : 22)
  • EIEKPSQ (SEQ ID NO: 32)
  • EIEKP (SEQ ID NO: 33)
  • IGF-IR BC Loop (SEQ ID NO: 40)
  • VEGFR2 BC Loop (SEQ ID NO: 43)
  • VEGFR2 FG Loop (SEQ ID NO: 45)
  • EIDKPCQ (SEQ ID NO: 47) I-Fn-V(2DK-) with Cys tail (SEQ ID NO: 48)
  • I-GS5-V(2DK-) with ser or cys tail (SEQ ID NO: 50) MGVSDVPRDLEVVAATPTSLLISWSARL VARYYRITYGETGGNSPVQEFTVPK VYT ATISGLKPGVDYTITVYAVTRFRDYOPISINYRTEIE GSGSGSGSVSDVPRDLEVVA ATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGLKPGVDYTITVY AVTDGRNGRLLSIPISINYRTEIEKPXO.
  • X serine or cysteine
  • V-Fn-I(2DK-) with ser tail SEQ ID NO: 52
  • V-Fn-I(2DK-) with cys tail (SEQ ID NO: 53)
  • V-GS5-I(2DK-) with ser or cys tail (SEQ ID NO: 54)
  • GVSDVPRDLEVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVOEFTVPKNVYTAT ISGLKPGVDYTITVY A VTRFRD YOPISINYRTEIEKPSTSTSTVSDVPRDLEVVAATPTSL LISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGLKPGVDYTITVYAVTDG RNGRLLSIPISINYRTEIEKPCO
  • V/I binders VEGFR2/IGF-IR binders
  • E/I binders EGFR/IGF-IR binders
  • SEQ ID NO: 22 is the amino acid sequence of the V/I(DK+) bivalent construct that was first described in WO 2009/142773.
  • V/I(DK+) comprises fibronectin domains that bind to IGF- IR and VEGFR2.
  • the IGF-IR binding fibronectin core has the sequence set forth in SEQ ID NO: 2 and the VEGFR2 binding fibronectin core has the sequence set forth in SEQ ID NO: 3.
  • the two domains are connected by a polypeptide linker derived from the amino acid sequence that connects the first and second Fn3 domains in human fibronectin (SEQ ID NO: 7).
  • the I binding subunit of V/I(DK+) contains a C-terminal extension (CI) having the amino acid sequence SEQ ID NO: 46, i.e., containing a DK site.
  • the V binding subunit of V/I(DK+) contains a C-terminal extension (C2) having the amino acid sequence of SEQ ID NO: 47, i.e., containing a DK site.
  • SEQ ID NO: 23 is the amino acid sequence of the E/I(DK+) bivalent construct.
  • E/I(DK+) comprises fibronectin domains that bind to IGF-IR and EGFR.
  • the IGF-IR binding fibronectin core has the sequence set forth in SEQ ID NO: 2 and the EGFR2 binding fibronectin core has the sequence set forth in SEQ ID NO: 39.
  • the two domains are linked by a glycine- serine polypeptide linker having SEQ ID NO: 9.
  • the I binding subunit of E/I(DK+) contains a C-terminal extension (CI) having the amino acid sequence SEQ ID NO: 46, i.e., containing a DK site.
  • the E binding subunit of E/I(DK+) contains a C-terminal extension (C2) having the amino acid sequence of SEQ ID NO: 47, i.e., containing a DK site.
  • SEQ ID NO: 24 is the amino acid sequence of the E/I(DK-, no C-term) bivalent construct.
  • the E/I(DK-, no C-term) comprises the IGF-IR core (SEQ ID NO: 2) and EGFR core (SEQ ID NO: 39) linked by a glycine-serine linker (SEQ ID NO: 9).
  • the IGF-IR binding subunit contains a C-terminal extension (CI) having the amino acid sequence SEQ ID NO: 4, i.e., containing an EK site rather than a DK site.
  • the EGFR binding subunit contains a C- terminal extension (C2) having the amino acid sequence of SEQ ID NO: 5, i.e., lacking a DK site.
  • SEQ ID NO: 25 is the amino acid sequence of the E/I(2DK-) bivalent construct.
  • E/I(2DK-) comprises the IGF-IR core (SEQ ID NO: 2) and EGFR core (SEQ ID NO: 39) linked by a glycine-serine linker (SEQ ID NO: 9).
  • the IGF-IR binding subunit contains a C-terminal extension (CI) having the amino acid sequence SEQ ID NO: 4, i.e., containing an EK site rather than a DK site.
  • the EGFR binding subunit contains a C-terminal extension (C2) having the amino acid sequence of SEQ ID NO: 6, i.e., containing an EK site rather than a DK site.
  • E/I bivalent constructs are expressed in E. coli cells in soluble form.
  • the inclusion bodies are recovered by cell disruption and centrifugation.
  • the E/I proteins are filtered and captured using column chromatography.
  • the purified protein is then covalently linked to a PEG via maleimide chemistry at a single cysteine residue.
  • the PEGylated product is then polished using column chromatography and formulated using tangential flow filtration.
  • V/I bivalent constructs For expression of V/I bivalent constructs, a nucleotide sequence encoding the construct is cloned into an inducible expression vector and is expressed into intracellular inclusion bodies in E. coli cells.
  • Cell bank vials generated from a culture of a single plated colony are used to inoculate a shake flask culture as an inoculum for a large-scale fermentor.
  • a seed fermentor is used for an inoculum culture, depending on the final fermentation volume.
  • the large-scale fermentation contains a growth phase to accumulate biomass and a production phase to generate the fibronectin based scaffold proteins.
  • intracellular inclusion bodies are released from harvested cells using a microfluidizer and recovered by centrifugation, followed by washes with buffer and water.
  • the purification process for the bivalent constructs uses a Guanidine-HCl based resolubolization of inclusion bodies, followed by refolding the protein.
  • the refolded protein is filtered and loaded onto a cation exchange chromatography column.
  • the product is then purified using a hydrophobic interaction column and the resulting elution pool is PEGylated by the addition of the PEG reagent to produce PEGylated protein.
  • the PEGylated protein is then purified over a second cation exchange chromatography column.
  • the elution is concentrated to a target protein concentration and then exchanged into the formulation buffer using ultrafiltration/diafiltration (UF/DF).
  • UF/DF ultrafiltration/diafiltration
  • the UF/DF product is filtered using a final 0.22 ⁇ filter.
  • the filtered product is then filled into vials to produce the final drug product.
  • V/I(DK+) protein was formulated in 10 mM succinic acid, 5% sorbitol at pH 5.5. V/I protein concentration was either at 3 mg/mL or at 5 mg/ml. Samples were stored at 4°C for a period of 12 months, with samples being collected and analyzed at 1 month, 6 weeks, 2 months, 3 months, 6 months, 9 months and 12 months.
  • the amount of aggregation is measured by assessing the percentage of total protein that has formed aggregates (measured as High Molecular Weight (“HMW”) species) over time. Aggregation was determined using Size Exclusion-High Performance Liquid Chromatography (SE-HPLC) analysis to assess the levels of HMW over time. SE-HPLC analysis was conducted using a Superdex 200 10/300 GL column, with a mobile phase of 0.2M potassium phosphate, 0.15 M sodium chloride, 0.02% sodium azide, pH 6.8. Flow rate was 0.5 mL/min with detection at 280 nm. The effects of protein concentration on aggregation of V/I protein over time (0-12 months) is depicted in Figure 1. V/I(DK+) aggregates at a rate of 0.3%/month at a concentration of 3 mg/mL. Higher protein concentration (5mg/ml) leads to a faster aggregation rate.
  • HMW High Molecular Weight
  • Fragmentation is measured by assessing percentage of total protein that has been fragmented, or "clipped", over time. Levels of clipped protein were determined by utilizing Reversed Phase-High Performance Liquid Chromatography (RP-HPLC). RP-HPLC was performed using a Varian PLRP-S column (4.6*250mm, 300 A pore size, 5 ⁇ particle size). Separation of the various species is achieved via a gradient comprised of water/acetonitrile/trifluoroacetic acid. Flow rate was 1.0 mL/min. Dual detection was conducted at 280 nm (for protein-related species) and with evaporative light scattering (ELS, for PEG-related species). Figure 2 demonstrates that fragmentation of V/I(DK+) was found to be less dependent on protein concentration than was aggregation. The fragmentation rate for V/I(DK+) was ⁇ 0.1%/month at 4°C.
  • V/I(DK+) having a protein concentration of 3 mg/mL would be preferred over a concentration of 5 mg/mL in order to minimize aggregation and to ensure sufficient stability for one year.
  • V/I(DK+) protein was formulated in 50 mM sodium chloride, with the buffer component being 20 mM sodium acetate (for pH 4 and 5) or 20 mM sodium phosphate (for pH 6 and 7), and was stored at 25°C.
  • V/I(DK+) protein was formulated in 10 mM sodium acetate, 150 mM sodium chloride, pH 5.5, at 5 mg/mL protein concentration.
  • LC-MS was performed according to the RP-HPLC method described in Example 3 followed by coupling to a Thermo LTQ ion trap mass spectrometer (MS). The HPLC eluent was split 1 :5 with 0.2 mL/min flow diverted into the MS. On-line detection at 280 nm was maintained.
  • Figure 5 depicts the LC-MS data from this experiment and demonstrates that several aspartate (D) residues are involved in fragmentation, with D95 and D200 being the predominant sites at which fragmentation occurs. It should be noted that while there are several D residues throughout the V/I(DK+) protein (e.g. D5, D9, DUO), only the D95 and D200 residues are immediately followed by a lysine residue. "VI des Met" indicates a cleavage event occurring at the maleimide bond of the PEG conjugation as a result of heat stress. Based on these experiments, aggregation and fragmentation are best balanced by fixing the formulation pH at 5.5, however, neither degradation pathway (aggregation and fragmentation) could be eliminated by relying on this pH level alone.
  • Example 5 Evaluation of Aggregation and Fragmentation on E/I Proteins
  • E/I(DK+) was formulated in 10 mM succinic acid, 5% sorbitol and at pH 4.0, 4.5 or 5.5.
  • E/I(DK+) was formulated into the desired formulation via tangential flow filtration (TFF) using a 30kD MWCO membrane. At least six dia-volumes of buffer were exchanged to achieve the final formulation. Concentration of the resulting protein was verified by A280 and adjusted to 5 mg/mL with additional formulation buffer. Formulated E/I(DK+) was sterile filtered in a laminar flow hood, and filled into sterilized glass vials for stability monitoring. The vials were capped and crimped, followed by placement into temperature-controlled incubators at 4, 25 and 37 °C.
  • Table 2 illustrates that higher concentrations (7 mg/ml) of E/I(DK+) were associated with a higher percentage of aggregate formation (lower percentage of monomers) after 4 weeks. Table 2 also demonstrates that by reducing pH along with protein concentration, the percent of aggregation can be further decreased.
  • E/I(DK+) was formulated in 10 mM succinic acid, 5% sorbitol, pH 4.0, at 5 mg/mL protein concentration and was maintained at 25 °C to induce protein stress.
  • Figure 8 depicts the LC-MS data from this experiment and demonstrates that several aspartate (D) residues are involved in fragmentation, including D95 and D218 (the homologous position to D200 in V/I(DK+)). Fragmentation was also observed at D199.
  • the D199 site is specific to these E/I molecules and is not found in V/I molecules, as it is located within the FG binding loop of the EGFR-binding region.
  • Example 6 Evaluation of Aggregation and Fragmentation in DK Minus E/I Variants
  • E/I binders SEQ ID NOs: 23-25 were formulated and their physical (aggregation) and chemical (fragmentation) stability was compared to each other under identical conditions (see Table 1). Based upon the characterization of the D95 and D218 clipped sites observed in E/I(DK+) (Example 5), and based on the fact that these DK clip sites are located in the structurally nonessential C-terminal tails, two different E/I constructs were generated in which the C-terminal tail DK sites were removed or substituted.
  • the E/I(DK+) molecule (SEQ ID NO: 23) is the control E/I binder that contains a C- terminal tail comprising DK sites (D95 and D218) after each of the two binding domains.
  • the physical and chemical stability of this molecule was characterized in Example 5.
  • the E/I(DK-, no C-term) molecule (SEQ ID NO: 24) does not contain any DK sites.
  • the aspartate at position 95 was mutated to a glutamic acid, and the EIDKPCQ tail (SEQ ID NO: 47) was replaced with an EGSGC tail (SEQ ID NO: 5).
  • the E/I(2DK-) molecule (SEQ ID NO: 25) also does not contain any DK sites.
  • the aspartates at positions 95 and 218 have been replaced with glutamic acids.
  • V/I(DK+) was included in this study as a control.
  • E/I proteins (SEQ ID NOs: 23-25) were formulated in 10 mM succinic acid, 5% sorbitol at pH 4.0.
  • E/I(DK+) (SEQ ID NO: 23) and V/I(DK+) (SEQ ID NO: 22) were formulated in 10 mM succinic acid, 5% sorbitol at pH 5.5.
  • Surfactant was not found to be necessary based on a preliminary surfactant screen.
  • E/I(DK+) was formulated into the desired formulation via tangential flow filtration (TFF) using a 30kD MWCO membrane. At least six dia- volumes of buffer were exchanged to achieve the final formulation.
  • Concentration of the resulting protein was verified by A280 and adjusted to 5 mg/mL with additional formulation buffer.
  • Each formulated bivalent construct was sterile filtered in a laminar flow hood, and filled into sterilized glass vials for stability monitoring. The vials were capped and crimped, followed by placement into temperature-controlled incubators at 4, 25 and 37 °C.
  • FIG. 10 shows lower clip rates at pH 5.5 than at pH 4.0 for E/I(DK+) at 25 °C.
  • the highest clip rate was seen in E/I(DK+) at pH 4.0, which was significantly minimized when the formulation pH was increased to pH 5.5.
  • aggregation rate was highest at pH 5.5 for this molecule.
  • the clip rates at pH 4.0 decreased by approximately 3-fold as compared to E/I(DK+) at the same pH.
  • V/I(DK+) displayed a higher degree of fragmentation as compared to E/I(DK+) at the same pH (pH 5.5) indicating that although the V/I(DK+) and E/I(DK+) molecules are similar, the V/I(DK+) molecule is more susceptible to fragmentation.
  • E/I(2DK-) was formulated in 10 mM succinic acid, 5% sorbitol, pH 4.0, at 5 mg/mL protein concentration and was maintained at 25°C to induce protein stress.
  • Figure 12 depicts the LC-MS data from this experiment and demonstrates that similar to E/I (DK-, no C- term), the predominant aspartate residues involved in fragmentation in E/I(2DK-) were D199, D82 and D193.
  • the percentage of total clips was more than halved in E/I(2DK-) after 4 weeks, as compared to E/I (DK+) after this same period (3.5% compared to 7.5%).
  • the D199 site is located within the FG binding loop of the EGFR- binding region. As such, D199 likely is necessary for binding function and will be difficult to remove from the E/I(2DK-) or E/I(DK-, no C-term) molecules.
  • VEGFR-IGFR VEGFR-IGFR
  • the stability of two VEGFR-IGFR (VI) fibronectin based scaffold proteins has been compared.
  • the first construct is VI(DK+) (SEQ ID NO: 56), and the second construct VI(DK-) (SEQ ID NO: 57) contains substitution of aspartic acid with glutamic acid at positions 94 and 199 of SEQ ID NO: 56.
  • Both molecules were formulated at 3 mg/mL protein concentration, in 10 mM succinic acid, 5% sorbitol, at pH 4.0, 4.5 and 5.5. Limited stability of these formulations was performed at 4 and 25°C for up to two months, with periodic time points pulled for analysis by SE-HPLC and RP-HPLC. In addition, LC-MS characterization was performed on the 2-month 25°C samples in order to determine the exact clipped sites in both proteins.
  • the clip rate per week for VI(DK+) increases by 3.3-fold when the formulation pH is decreased from 5.5 to 4.0, whereas for the VI(DK-) molecule, this rate increases by 1.6-fold, due to the elimination of the major clip sites at two positions. Therefore, with these amino acid substitutions, the clip rate in the VI fibronectin based scaffold protein has decreased by about 50% over the same stability period when the pH 4 formulation is used.
  • the aggregation rates per week for VI(DK+) and VI(DK-) decrease by 86- and 216-fold, respectively, when the formulation pH is decreased from 5.5 to 4.0. The pH effect on aggregation rate, therefore, is more drastic than on the clip rate in VI fibronectin based scaffold proteins.
  • VI(DK-) While some clips remain identical between the two molecules, the major clip sites at D94 and D199 have been eliminated in VI(DK-), bringing the level of total clips to 6.9% after 2 months of stress at 25 °C. On the other hand, the total clips in VI(DK+) remained high at 16.0% over the same stability period. Other clips at low level have also been identified in VI(DK-), which are not found in VI(DK+).
  • the clip rate of VI(DK+) at pH 4.0 was 1.6 fold and 3.3 fold faster than the clip rate of VI(DK+) at pH 4.5 and 5.5, respectively.
  • the clip rate of VI(DK-) at pH 4.0 was 1.5 fold and 1.6 fold faster than the clip rate of VI(DK-) at pH 4.5 and 5.5, respectively.
  • Table 6 Comparison of Aggregation Rates in VI(DK+) and VI(DK-).
  • the agreggation rates of VI(DK+) at pH 4.5 and 5.0 were 4.4 fold and 86 fold faster, respectively, than the agreggation rate of VI(DK+) at pH 4.0.
  • the agreggation rates of VI(DK-) at pH 4.5 and 5.0 were 4.0 fold and 216 fold faster, respectively, than the agreggation rate of VI(DK-) at pH 4.0.
  • the stability results obtained on two versions of the VI fibronectin based scaffold proteins demonstrate the effectiveness and benefits of selective substitutions of problematic aspartic acids to glutamic acids, for the purpose of eliminating specific chemical degradation in the fibronectin based scaffold protein. With the major chemical degradation eliminated through this approach, better biophysical stability in fibronectin based scaffold proteins may now be achieved through formulation at the lower pH.
  • the results from the current study with VI, as well as those previously obtained from EI bi-functional fibronectin based scaffold proteins demonstrate the necessity in eliminating certain aspartic acid residues known to be prone to clipping, which in turn allows for formulations at acidic pH to be used in order to maximize the biophysical stability in the fibronectin based scaffold proteins.
  • Vial Fill and Stability Each formulated protein was sterile filtered in a laminar flow hood, and filled into sterilized glass vials for stability monitoring. The vials were capped and crimped, followed by placement into temperature-controlled incubators at 4 and 25 °C.
  • SE-HPLC Size Exclusion HPLC
  • Reversed Phase HPLC (RP-HPLC) : The analysis was performed using a Varian PLRP-S column (4.6*250mm, 300 A pore size, 5 ⁇ particle size). Separation of the various species is achieved via a gradient comprised of water/acetonitrile/trifluoroacetic acid. Flow rate was 1.0 mL/min. Dual detection was conducted at 280 nm (for protein-related species) and with evaporative light scattering (ELS, for PEG-related species).
  • ELS evaporative light scattering
  • LC-MS Characterization of clipped sites was performed using a Jupiter CI 8 column (4.6*250mm, 300 A pore size, 5 ⁇ particle size) coupled to a Thermo LTQ ion trap mass spectrometer (MS). The HPLC eluent was split 1 :5 with 0.2 mL/min flow diverted into the MS. On-line detection at 280 nm was maintained.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Oncology (AREA)
  • Hematology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
PCT/US2011/038013 2010-05-26 2011-05-26 Fibronectin based scaffold proteins having improved stability Ceased WO2011150133A2 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
ES11731571.3T ES2573108T3 (es) 2010-05-26 2011-05-26 Proteínas de armazón a base de fibronectina que tienen estabilidad mejorada
CN201180036862.4A CN103180339B (zh) 2010-05-26 2011-05-26 具有改善的稳定性的基于纤连蛋白的支架蛋白质
JP2013512226A JP6023703B2 (ja) 2010-05-26 2011-05-26 改善された安定性を有するフィブロネクチンをベースとする足場タンパク質
EP11731571.3A EP2576615B1 (en) 2010-05-26 2011-05-26 Fibronectin based scaffold proteins having improved stability
US13/699,458 US9562089B2 (en) 2010-05-26 2011-05-26 Fibronectin based scaffold proteins having improved stability
US15/385,222 US10273286B2 (en) 2010-05-26 2016-12-20 Fibronectin based scaffold proteins having improved stability
US16/298,493 US11161893B2 (en) 2010-05-26 2019-03-11 Fibronectin based scaffold proteins having improved stability
US17/489,391 US20220119495A1 (en) 2010-05-26 2021-09-29 Fibronectin based scaffold proteins having improved stability

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US34866310P 2010-05-26 2010-05-26
US34864710P 2010-05-26 2010-05-26
US61/348,663 2010-05-26
US61/348,647 2010-05-26

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/699,458 A-371-Of-International US9562089B2 (en) 2010-05-26 2011-05-26 Fibronectin based scaffold proteins having improved stability
US15/385,222 Continuation US10273286B2 (en) 2010-05-26 2016-12-20 Fibronectin based scaffold proteins having improved stability

Publications (2)

Publication Number Publication Date
WO2011150133A2 true WO2011150133A2 (en) 2011-12-01
WO2011150133A3 WO2011150133A3 (en) 2012-03-08

Family

ID=44583357

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/038013 Ceased WO2011150133A2 (en) 2010-05-26 2011-05-26 Fibronectin based scaffold proteins having improved stability

Country Status (6)

Country Link
US (4) US9562089B2 (enExample)
EP (2) EP2576615B1 (enExample)
JP (2) JP6023703B2 (enExample)
CN (1) CN103180339B (enExample)
ES (1) ES2573108T3 (enExample)
WO (1) WO2011150133A2 (enExample)

Cited By (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012158678A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
WO2012158739A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Improved methods for the selection of binding proteins
US8728483B2 (en) 2008-05-22 2014-05-20 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins
US8853154B2 (en) 2012-09-13 2014-10-07 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US8969289B2 (en) 2010-05-03 2015-03-03 Bristol-Myers Squibb Company Serum albumin binding molecules
US9017655B2 (en) 2008-11-24 2015-04-28 Bristol-Myers Squibb Company Bispecific EGFR/IGFIR binding molecules
WO2015143156A1 (en) * 2014-03-20 2015-09-24 Bristol-Myers Squibb Company Stabilized fibronectin based scaffold molecules
EP2951206A2 (en) * 2013-02-01 2015-12-09 Bristol-Myers Squibb Company Fibronectin based scaffold proteins
US20150376229A1 (en) * 2013-02-12 2015-12-31 Bristol-Myers Squibb Company Tangential flow filtration based protein refolding methods
US9234028B2 (en) 2008-02-14 2016-01-12 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US9328157B2 (en) 2003-12-05 2016-05-03 Bristol-Myers Squibb Company Inhibitors of type 2 vascular endothelial growth factor receptors
WO2016094945A1 (en) * 2014-12-15 2016-06-23 Monash University Highly stable polypeptide scaffolds
US9416170B2 (en) 2011-10-31 2016-08-16 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9469676B2 (en) 2011-04-13 2016-10-18 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
US9562089B2 (en) 2010-05-26 2017-02-07 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US20170348397A1 (en) * 2016-06-03 2017-12-07 Janssen Biotech, Inc. Serum Albumin-Binding Fibronectin Type III Domains
US10065987B2 (en) 2013-02-12 2018-09-04 Bristol-Myers Squibb Company High pH protein refolding methods
WO2018204617A1 (en) * 2017-05-03 2018-11-08 Bristol-Myers Squibb Company Stable formulations of fibronectin based scaffold domain proteins that bind to myostatin
US10221232B2 (en) 2006-11-22 2019-03-05 Bristol-Myers Squibb Company Methods of treating cancer by administering IGF-IR binding molecules
US10442851B2 (en) 2014-03-20 2019-10-15 Bristol-Myers Squibb Company Serum albumin-binding fibronectin type III domains
US10766946B2 (en) 2015-09-23 2020-09-08 Bristol-Myers Squibb Company Fast-off rate serum albumin binding fibronectin type III domains
US10787498B2 (en) 2013-02-06 2020-09-29 Bristol-Myers Squibb Company Fibronectin type III domain proteins with enhanced solubility
US12351619B2 (en) 2019-12-18 2025-07-08 Aro Biotherapeutics Company Serum albumin-binding fibronectin type III domains and uses thereof

Families Citing this family (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102478402B1 (ko) 2013-10-14 2022-12-15 얀센 바이오테크 인코포레이티드 시스테인 조작된 피브로넥틴 iii형 도메인 결합 분자
EP3171886A4 (en) * 2014-07-21 2018-01-24 The Arizona Board of Regents On Behalf of the University of Arizona Ang-(1-7) derviative oligopeptides and methods for using and producing the same
US10183055B2 (en) 2014-07-21 2019-01-22 Arizona Board Of Regents On Behalf Of The University Of Arizona Ang-(1-7) derivative oligopeptides for the treatment of pain and other indications
US11229713B2 (en) 2014-11-25 2022-01-25 Bristol-Myers Squibb Company Methods and compositions for 18F-radiolabeling of biologics
CN114591420A (zh) 2014-11-25 2022-06-07 百时美施贵宝公司 用于成像的新型pd-l1结合多肽
CN105753945B (zh) * 2014-12-15 2019-04-09 清华大学无锡应用技术研究院 一种连接肽及其应用
CN104894091B (zh) * 2015-06-19 2018-08-21 北京理工大学 一种人工设计糖基修饰提高酶热稳定性的方法
WO2017210302A1 (en) 2016-06-01 2017-12-07 Bristol-Myers Squibb Company Pet imaging with pd-l1 binding polypeptides
US10994033B2 (en) 2016-06-01 2021-05-04 Bristol-Myers Squibb Company Imaging methods using 18F-radiolabeled biologics
WO2017223180A2 (en) * 2016-06-21 2017-12-28 Janssen Biotech, Inc. Cysteine engineered fibronectin type iii domain binding molecules
US10611823B2 (en) 2016-12-14 2020-04-07 Hanssen Biotech, Inc CD137 binding fibronectin type III domains
KR102568559B1 (ko) 2016-12-14 2023-08-18 얀센 바이오테크 인코포레이티드 Cd8a-결합 섬유결합소 iii형 도메인
EP3554535A4 (en) 2016-12-14 2020-10-21 Janssen Biotech, Inc. PD-L1 BINDING FIBRONECTIN TYPE III DOMAINS
WO2021076574A2 (en) 2019-10-14 2021-04-22 Aro Biotherapeutics Company Fn3 domain-sirna conjugates and uses thereof
US12491255B2 (en) 2019-10-14 2025-12-09 Aro Biotherapeutics Company EPCAM binding fibronectin type III domains
WO2021076546A1 (en) 2019-10-14 2021-04-22 Aro Biotherapeutics Company Cd71 binding fibronectin type iii domains
CA3214552A1 (en) 2021-04-14 2022-10-20 Russell C. Addis Cd71 binding fibronectin type iii domains
US12239710B2 (en) 2021-04-14 2025-03-04 Aro Biotherapeutics Company FN3 domain-siRNA conjugates and uses thereof
EP4613763A1 (en) * 2022-11-04 2025-09-10 Chuang, Woei-jer Protein derived from fibronectin type iii domain, and use thereof

Citations (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4002531A (en) 1976-01-22 1977-01-11 Pierce Chemical Company Modifying enzymes with polyethylene glycol and product produced thereby
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4301144A (en) 1979-07-11 1981-11-17 Ajinomoto Company, Incorporated Blood substitute containing modified hemoglobin
USRE30985E (en) 1978-01-01 1982-06-29 Serum-free cell culture media
EP0073657A1 (en) 1981-08-31 1983-03-09 Genentech, Inc. Preparation of hepatitis B surface antigen in yeast
US4419446A (en) 1980-12-31 1983-12-06 The United States Of America As Represented By The Department Of Health And Human Services Recombinant DNA process utilizing a papilloma virus DNA as a vector
US4496689A (en) 1983-12-27 1985-01-29 Miles Laboratories, Inc. Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer
US4560655A (en) 1982-12-16 1985-12-24 Immunex Corporation Serum-free cell culture medium and process for making same
US4601978A (en) 1982-11-24 1986-07-22 The Regents Of The University Of California Mammalian metallothionein promoter system
WO1987000195A1 (en) 1985-06-28 1987-01-15 Celltech Limited Animal cell culture
US4640835A (en) 1981-10-30 1987-02-03 Nippon Chemiphar Company, Ltd. Plasminogen activator derivatives
US4657866A (en) 1982-12-21 1987-04-14 Sudhir Kumar Serum-free, synthetic, completely chemically defined tissue culture media
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
US4767704A (en) 1983-10-07 1988-08-30 Columbia University In The City Of New York Protein-free culture medium
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
WO1990003430A1 (en) 1988-09-23 1990-04-05 Cetus Corporation Cell culture medium for enhanced cell growth, culture longevity and product expression
US4927762A (en) 1986-04-01 1990-05-22 Cell Enterprises, Inc. Cell culture medium with antioxidant
WO1990013646A1 (fr) 1989-04-28 1990-11-15 Transgene S.A. Application de nouveaux fragments d'adn en tant que sequence codant pour un peptide signal pour la secretion de proteines matures par des levures recombinantes, cassettes d'expression, levures transformees et procede de preparation de proteines correspondant
EP0473084A2 (en) 1990-08-28 1992-03-04 Sumitomo Pharmaceuticals Company, Limited Polyethylene glycol derivatives, their modified peptides, methods for producing them and use of the modified peptides
US5122469A (en) 1990-10-03 1992-06-16 Genentech, Inc. Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins
WO1994001451A2 (en) 1992-07-13 1994-01-20 Bionebraska, Inc. Method for modification of recombinant polypeptides
US5281698A (en) 1991-07-23 1994-01-25 Cetus Oncology Corporation Preparation of an activated polymer ester for protein conjugation
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US5382657A (en) 1992-08-26 1995-01-17 Hoffmann-La Roche Inc. Peg-interferon conjugates
US5766897A (en) 1990-06-21 1998-06-16 Incyte Pharmaceuticals, Inc. Cysteine-pegylated proteins
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
WO1998056915A2 (en) 1997-06-12 1998-12-17 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
WO2000034784A1 (en) 1998-12-10 2000-06-15 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
WO2000034787A1 (en) 1998-12-10 2000-06-15 The University Of Nottingham Cancer detection method and reagents
US6207446B1 (en) 1997-01-21 2001-03-27 The General Hospital Corporation Selection of proteins using RNA-protein fusions
US6261804B1 (en) 1997-01-21 2001-07-17 The General Hospital Corporation Selection of proteins using RNA-protein fusions
WO2001064942A1 (en) 2000-02-29 2001-09-07 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
WO2002004523A2 (en) 2000-07-11 2002-01-17 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US20020044921A1 (en) 2000-09-29 2002-04-18 Seoju Lee Pegylated interleukin-10
WO2002032925A2 (en) 2000-10-16 2002-04-25 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
WO2002081497A2 (en) 2001-04-04 2002-10-17 University Of Rochester αξβ3 INTEGRIN-BINDING POLYPEPTIDE MONOBODIES AND THEIR USE
US6559126B2 (en) 2000-03-31 2003-05-06 Institut Pasteur Peptides blocking vascular endothelial growth factor (VEGF)-mediated angiogenesis, polynucleotides encoding said peptides and methods of use thereof
US6610281B2 (en) 1993-11-12 2003-08-26 Shearwater Corporation Water soluble activated polymers containing an active ethyl sulfone moiety for modification of surfaces and molecules
US20030186385A1 (en) 2000-11-17 2003-10-02 Shohei Koide Method of identifying polypeptide monobodies which bind to target proteins and use thereof
US7115396B2 (en) 1998-12-10 2006-10-03 Compound Therapeutics, Inc. Protein scaffolds for antibody mimics and other binding proteins
US20070048282A1 (en) 2004-02-09 2007-03-01 Human Genome Sciences, Inc. Albumin fusion proteins
US20070148126A1 (en) 2003-12-05 2007-06-28 Yan Chen Inhibitors of type 2 vascular endothelial growth factor receptors
US20070178082A1 (en) 2002-11-08 2007-08-02 Ablynx N.V. Stabilized single domain antibodies
US20070269422A1 (en) 2006-05-17 2007-11-22 Ablynx N.V. Serum albumin binding proteins with long half-lives
WO2008031098A1 (en) 2006-09-09 2008-03-13 The University Of Chicago Binary amino acid libraries for fibronectin type iii polypeptide monobodies
WO2008066752A2 (en) 2006-11-22 2008-06-05 Adnexus, A Bristol-Myers Squibb R & D Company Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including igf-ir
WO2008097497A2 (en) 2007-02-02 2008-08-14 Adnexus, A Bristol-Myers Squibb R & D Company Vegf pathway blockade
WO2009142773A2 (en) 2008-05-22 2009-11-26 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins

Family Cites Families (111)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6361943B1 (en) 1996-10-17 2002-03-26 Mitsubishi Chemical Corporation Molecule that homologizes genotype and phenotype and utilization thereof
US6018030A (en) 1986-11-04 2000-01-25 Protein Polymer Technologies, Inc. Peptides comprising repetitive units of amino acids and DNA sequences encoding the same
US5770697A (en) 1986-11-04 1998-06-23 Protein Polymer Technologies, Inc. Peptides comprising repetitive units of amino acids and DNA sequences encoding the same
US5641648A (en) 1986-11-04 1997-06-24 Protein Polymer Technologies, Inc. Methods for preparing synthetic repetitive DNA
US5514581A (en) 1986-11-04 1996-05-07 Protein Polymer Technologies, Inc. Functional recombinantly prepared synthetic protein polymer
US4863457A (en) 1986-11-24 1989-09-05 Lee David A Drug delivery device
US4997652A (en) 1987-12-22 1991-03-05 Visionex Biodegradable ocular implants
US5164188A (en) 1989-11-22 1992-11-17 Visionex, Inc. Biodegradable ocular implants
WO1992002536A1 (en) 1990-08-02 1992-02-20 The Regents Of The University Of Colorado Systematic polypeptide evolution by reverse translation
KR0185215B1 (ko) 1990-11-30 1999-05-01 요시다 쇼오지 서방성 안구삽입용 약제
US5773574A (en) 1990-12-03 1998-06-30 The Scripps Research Institute Polypeptides for promoting cell attachment
US5235041A (en) 1990-12-28 1993-08-10 Protein Polymer Technologies, Inc. Purification of structurally ordered recombinant protein polymers
JPH04108827U (ja) 1991-03-04 1992-09-21 カシオ計算機株式会社 電子機器におけるスライドスイツチ構造
US5792742A (en) 1991-06-14 1998-08-11 New York University Fibrin-binding peptide fragments of fibronectin
WO1993003172A1 (en) 1991-08-01 1993-02-18 University Research Corporation Systematic polypeptide evolution by reverse translation
WO1994017097A1 (en) 1993-01-19 1994-08-04 Regents Of The University Of Minnesota Synthetic fibronectin fragments as inhibitors of retroviral infections
CA2118515A1 (en) 1993-02-26 1994-02-23 Yuichiro Ogura Biodegradable scleral plug
AU8124694A (en) 1993-10-29 1995-05-22 Affymax Technologies N.V. In vitro peptide and antibody display libraries
US5443505A (en) 1993-11-15 1995-08-22 Oculex Pharmaceuticals, Inc. Biocompatible ocular implants
US5516522A (en) 1994-03-14 1996-05-14 Board Of Supervisors Of Louisiana State University Biodegradable porous device for long-term drug delivery with constant rate release and method of making the same
US5559000A (en) 1995-01-18 1996-09-24 The Scripps Research Institute Encoded reaction cassette
US6369116B1 (en) 1995-06-02 2002-04-09 Oculex Pharmaceuticals, Inc. Composition and method for treating glaucoma
US5869079A (en) 1995-06-02 1999-02-09 Oculex Pharmaceuticals, Inc. Formulation for controlled release of drugs by combining hydrophilic and hydrophobic agents
DE19646372C1 (de) 1995-11-11 1997-06-19 Evotec Biosystems Gmbh Genotyp und Phänotyp koppelnde Verbindung
JP3556050B2 (ja) 1996-06-24 2004-08-18 株式会社大井製作所 ドアクロージャ
GB9618960D0 (en) 1996-09-11 1996-10-23 Medical Science Sys Inc Proteases
US5922676A (en) 1996-09-20 1999-07-13 The Burnham Institute Methods of inhibiting cancer by using superfibronectin
US6348333B1 (en) 1997-01-17 2002-02-19 Toa Gosei Co., Ltd. VEGF-binding KDR polypeptide
WO1998049198A1 (en) 1997-04-30 1998-11-05 Enzon, Inc. Single-chain antigen-binding proteins capable of glycosylation, production and uses thereof
US6159722A (en) 1997-12-03 2000-12-12 Boehringer Mannheim Gmbh Chimeric serine proteases
WO1999051773A1 (en) 1998-04-03 1999-10-14 Phylos, Inc. Addressable protein arrays
US20030045681A1 (en) 1998-05-11 2003-03-06 Anthony J. Zelano Specific binding molecules for scintigraphy, conjugates containing them and therapeutic method for treatment of angiogenesis
WO2000064946A2 (en) 1999-04-28 2000-11-02 Board Of Regents, The University Of Texas System Compositions and methods for cancer treatment by selectively inhibiting vegf
HK1045334A1 (zh) 1999-07-27 2002-11-22 Phylos, Inc. 缩氨酸受体结紮方法
AU2001268481A1 (en) 2000-06-15 2001-12-24 Board Of Regents, The University Of Texas System Regulatable, catalytically active nucleic acids
WO2002043785A2 (en) 2000-11-29 2002-06-06 Oculex Pharmaceuticals, Inc. Intraocular implants for preventing transplant rejection in the eye
US6509027B2 (en) 2001-02-12 2003-01-21 Supergen, Inc. Injectable pharmaceutical composition comprising coated particles of camptothecin
WO2002088171A2 (en) 2001-04-26 2002-11-07 Avidia Research Institute Combinatorial libraries of monomer domains
AU2002342672A1 (en) 2001-09-11 2003-03-24 Nascacell Gmbh Method for screening for inhibitors of protein/protein interaction and corresponding ribozymes
US20080193445A1 (en) 2002-01-18 2008-08-14 Liliane Goetsch Novel anti-IGF-IR antibodies and uses thereof
NZ534378A (en) 2002-02-22 2006-10-27 Schering Corp Pharmaceutical formulations of antineoplastic agents, in particular temozolomide, processes of making and using the same
ATE475431T1 (de) 2002-03-04 2010-08-15 Imclone Llc Kdr-spezifische humane antikörper und deren anwendung
WO2003104418A2 (en) 2002-06-06 2003-12-18 Research Corporation Technologies, Inc. Reconstituted polypeptides
EP2365001A3 (en) 2003-05-01 2012-03-28 Imclone LLC Fully human antibodies directed against the human insulin-like growth factor-1 receptor
US7053701B2 (en) 2003-11-04 2006-05-30 Vice Michael W Power amplifier output stage with multiple power states and improved efficiency
JP5261638B2 (ja) 2003-11-17 2013-08-14 テレズィゴロジー インク. 締付具
US20080220049A1 (en) 2003-12-05 2008-09-11 Adnexus, A Bristol-Myers Squibb R&D Company Compositions and methods for intraocular delivery of fibronectin scaffold domain proteins
US20070059336A1 (en) 2004-04-30 2007-03-15 Allergan, Inc. Anti-angiogenic sustained release intraocular implants and related methods
WO2005110374A1 (en) 2004-04-30 2005-11-24 Allergan, Inc. Intraocular drug delivery systems containing a therapeutic component, a cyclodextrin, and a polymeric component
US20050244469A1 (en) 2004-04-30 2005-11-03 Allergan, Inc. Extended therapeutic effect ocular implant treatments
US20060182783A1 (en) 2004-04-30 2006-08-17 Allergan, Inc. Sustained release intraocular drug delivery systems
EP1786918A4 (en) 2004-07-17 2009-02-11 Imclone Systems Inc NEW BISPECIFIC ANTIBODY TETRAVALENT
US7597884B2 (en) 2004-08-09 2009-10-06 Alios Biopharma, Inc. Hyperglycosylated polypeptide variants and methods of use
WO2006041942A2 (en) 2004-10-04 2006-04-20 Qlt Usa, Inc. Ocular delivery of polymeric delivery formulations
JP2008521911A (ja) 2004-12-02 2008-06-26 シェーリング コーポレイション 癌の処置において髄腔内にテモゾロミド処方物を使用する方法
WO2006091209A2 (en) 2005-02-23 2006-08-31 Merrimack Pharmaceuticals, Inc. Bispecific binding agents for modulating biological activity
FR2888850B1 (fr) 2005-07-22 2013-01-11 Pf Medicament Nouveaux anticorps anti-igf-ir et leurs applications
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
US20070072933A1 (en) 2005-09-26 2007-03-29 Peyman Gholam A Delivery of an ocular agent
US8097438B2 (en) 2005-10-07 2012-01-17 The Regents Of The University Of California Nucleic acids encoding modified cytochrome P450 enzymes and methods of use thereof
CA2602577C (en) 2005-10-18 2015-03-31 Allergan, Inc. Ocular therapy using glucocorticoid derivatives selectively penetrating posterior segment tissues
WO2007053807A2 (en) 2005-10-31 2007-05-10 Wisconsin Alumni Research Foundation Calcitriol for treating intraocular diseases associated with angiogenesis
ATE463512T1 (de) 2005-11-09 2010-04-15 Morphosys Ag Identifizierung und charakterisierung von funktionsblockierenden anti-ed-b-fibronektin antikörpern
EP3811965A1 (en) 2005-11-23 2021-04-28 Acceleron Pharma, Inc. Activin-actriia antagonists in use for promoting bone growth
EP2397148A3 (en) 2006-02-02 2012-04-25 Allergan, Inc. Compositions and methods for the treatment of ophthalmic disease
CN101384279B (zh) 2006-02-24 2012-02-22 奇斯药制品公司 抗淀粉样蛋白免疫原性组合物、方法和用途
KR20090005010A (ko) 2006-04-21 2009-01-12 트랜스진 에스.에이. Hpv-18-기재의 유두종바이러스 백신
PT2511301T (pt) 2006-08-04 2018-03-08 Medimmune Ltd Anticorpos humanos para erbb2
US7882645B2 (en) 2006-08-07 2011-02-08 Boring Colette R System and method for making an applique
US20110143953A1 (en) 2006-10-16 2011-06-16 Arizona Board Of Regents, A Body Corporate Of The State Of Arizona Synthetic Antibodies
US8476243B2 (en) * 2006-12-29 2013-07-02 Transderm, Inc. Methods and compositions for treating keratin hyperproliferative disorders
EP2129397B1 (en) 2007-03-02 2018-10-31 Amgen, Inc. Methods and compositions for treating tumor diseases
US11078262B2 (en) 2007-04-30 2021-08-03 Allergan, Inc. High viscosity macromolecular compositions for treating ocular conditions
EP2738257A1 (en) 2007-05-22 2014-06-04 Amgen Inc. Compositions and methods for producing bioactive fusion proteins
US8680019B2 (en) 2007-08-10 2014-03-25 Protelica, Inc. Universal fibronectin Type III binding-domain libraries
US8470966B2 (en) 2007-08-10 2013-06-25 Protelica, Inc. Universal fibronectin type III binding-domain libraries
WO2009023184A2 (en) 2007-08-10 2009-02-19 Protelix, Inc. Universal fibronectin type iii binding-domain libraries
JP2010538972A (ja) 2007-08-20 2010-12-16 ブリストル−マイヤーズ スクイブ カンパニー 転移性癌の処置のためのvegfr−2阻害剤の使用
EP3241846B1 (en) 2007-10-04 2022-02-23 ZymoGenetics, Inc. B7 family member zb7h6 and related compositions and methods
RU2010121967A (ru) 2007-10-31 2011-12-10 Медиммун, Ллк (Us) Белковые каркасные структуры
WO2009073115A1 (en) 2007-11-28 2009-06-11 Bristol-Myers Squibb Company Combination vegfr2 therapy with mtor inhibitors
AU2008345674A1 (en) 2007-12-19 2009-07-09 Centocor, Ortho Biotech Inc. Alternative scaffold protein fusions phage display via fusion to pIX of M13 phage
KR20100111283A (ko) 2007-12-27 2010-10-14 노파르티스 아게 개선된 피브로넥틴계 결합 분자 및 그들의 용도
AU2009213141A1 (en) 2008-02-14 2009-08-20 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
EP2274331B1 (en) 2008-05-02 2013-11-06 Novartis AG Improved fibronectin-based binding molecules and uses thereof
US8415291B2 (en) 2008-10-31 2013-04-09 Centocor Ortho Biotech Inc. Anti-TNF alpha fibronectin type III domain based scaffold compositions, methods and uses
DK2356269T3 (en) 2008-10-31 2016-08-15 Janssen Biotech Inc FIBRONECTIN TYPE III DOMAIN-BASED SCAFFOLD COMPOSITIONS, PROCEDURES AND APPLICATIONS
TWI496582B (zh) 2008-11-24 2015-08-21 必治妥美雅史谷比公司 雙重專一性之egfr/igfir結合分子
US20110275535A1 (en) 2008-12-16 2011-11-10 Novartis Ag Yeast Display Systems
WO2010093771A1 (en) 2009-02-11 2010-08-19 Bristol-Myers Squibb Company Combination vegfr2 therapy with temozolomide
WO2010093627A2 (en) 2009-02-12 2010-08-19 Centocor Ortho Biotech Inc. Fibronectin type iii domain based scaffold compositions, methods and uses
US8067201B2 (en) 2009-04-17 2011-11-29 Bristol-Myers Squibb Company Methods for protein refolding
WO2011020033A2 (en) 2009-08-13 2011-02-17 Massachusetts Institute Of Technology Engineered proteins including mutant fibronectin domains
ES2860453T3 (es) 2009-10-30 2021-10-05 Novartis Ag Bibliotecas universales del dominio de unión del lado inferior de la fibronectina de tipo III
WO2011051466A1 (en) 2009-11-02 2011-05-05 Novartis Ag Anti-idiotypic fibronectin-based binding molecules and uses thereof
US20110123545A1 (en) 2009-11-24 2011-05-26 Bristol-Myers Squibb Company Combination of vegfr2 and igf1r inhibitors for the treatment of proliferative diseases
WO2011092233A1 (en) 2010-01-29 2011-08-04 Novartis Ag Yeast mating to produce high-affinity combinations of fibronectin-based binders
CA2788972A1 (en) 2010-02-12 2011-08-18 University Of Rochester Antigenic mimics of discontinuous epitopes of pathogen recognized by broadly neutralizing antibodies
WO2011103105A1 (en) 2010-02-18 2011-08-25 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind il-23
SG10201505470QA (en) 2010-04-13 2015-08-28 Medimmune Llc Trail r2-specific multimeric scaffolds
UY33331A (es) * 2010-04-13 2011-10-31 Bristol Myers Squibb Company Una Corporacion Del Estado De Delaware Proteinas de dominio de armazon basadas en fibronectina que se unen a pcsk9
PT2571531T (pt) 2010-04-30 2016-08-31 Janssen Biotech Inc Composições do domínio da fibronectina estabilizadas, métodos e utilizações
TW201138808A (en) 2010-05-03 2011-11-16 Bristol Myers Squibb Co Serum albumin binding molecules
ES2573108T3 (es) 2010-05-26 2016-06-06 Bristol-Myers Squibb Company Proteínas de armazón a base de fibronectina que tienen estabilidad mejorada
EP3222631A3 (en) 2010-07-30 2017-11-22 Novartis AG Fibronectin cradle molecules and libraries thereof
EP2655411A1 (en) 2010-12-22 2013-10-30 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind il-23
SMT201700025T1 (it) 2011-04-13 2017-03-08 Bristol Myers Squibb Co Proteine di fusione ad fc comprendenti nuovi raccordi o arrangiamenti
US20140187488A1 (en) 2011-05-17 2014-07-03 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
ES2848531T3 (es) 2011-05-17 2021-08-10 Bristol Myers Squibb Co Métodos mejorados para la selección de proteínas de unión
KR102142385B1 (ko) 2011-09-27 2020-08-10 얀센 바이오테크 인코포레이티드 대체 결합 표면을 가진 피브로넥틴 유형 iii 반복체 기반의 단백질 스캐폴드
PL3835310T3 (pl) * 2012-09-13 2024-06-03 Bristol-Myers Squibb Company Białka domeny rusztowania oparte na fibronektynie wiążące się z miostatyną

Patent Citations (54)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4002531A (en) 1976-01-22 1977-01-11 Pierce Chemical Company Modifying enzymes with polyethylene glycol and product produced thereby
USRE30985E (en) 1978-01-01 1982-06-29 Serum-free cell culture media
US4301144A (en) 1979-07-11 1981-11-17 Ajinomoto Company, Incorporated Blood substitute containing modified hemoglobin
US4419446A (en) 1980-12-31 1983-12-06 The United States Of America As Represented By The Department Of Health And Human Services Recombinant DNA process utilizing a papilloma virus DNA as a vector
EP0073657A1 (en) 1981-08-31 1983-03-09 Genentech, Inc. Preparation of hepatitis B surface antigen in yeast
US4640835A (en) 1981-10-30 1987-02-03 Nippon Chemiphar Company, Ltd. Plasminogen activator derivatives
US4601978A (en) 1982-11-24 1986-07-22 The Regents Of The University Of California Mammalian metallothionein promoter system
US4560655A (en) 1982-12-16 1985-12-24 Immunex Corporation Serum-free cell culture medium and process for making same
US4657866A (en) 1982-12-21 1987-04-14 Sudhir Kumar Serum-free, synthetic, completely chemically defined tissue culture media
US4767704A (en) 1983-10-07 1988-08-30 Columbia University In The City Of New York Protein-free culture medium
US4496689A (en) 1983-12-27 1985-01-29 Miles Laboratories, Inc. Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
WO1987000195A1 (en) 1985-06-28 1987-01-15 Celltech Limited Animal cell culture
US4927762A (en) 1986-04-01 1990-05-22 Cell Enterprises, Inc. Cell culture medium with antioxidant
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
WO1990003430A1 (en) 1988-09-23 1990-04-05 Cetus Corporation Cell culture medium for enhanced cell growth, culture longevity and product expression
WO1990013646A1 (fr) 1989-04-28 1990-11-15 Transgene S.A. Application de nouveaux fragments d'adn en tant que sequence codant pour un peptide signal pour la secretion de proteines matures par des levures recombinantes, cassettes d'expression, levures transformees et procede de preparation de proteines correspondant
US5766897A (en) 1990-06-21 1998-06-16 Incyte Pharmaceuticals, Inc. Cysteine-pegylated proteins
EP0473084A2 (en) 1990-08-28 1992-03-04 Sumitomo Pharmaceuticals Company, Limited Polyethylene glycol derivatives, their modified peptides, methods for producing them and use of the modified peptides
US5122469A (en) 1990-10-03 1992-06-16 Genentech, Inc. Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins
US5281698A (en) 1991-07-23 1994-01-25 Cetus Oncology Corporation Preparation of an activated polymer ester for protein conjugation
WO1994001451A2 (en) 1992-07-13 1994-01-20 Bionebraska, Inc. Method for modification of recombinant polypeptides
US5382657A (en) 1992-08-26 1995-01-17 Hoffmann-La Roche Inc. Peg-interferon conjugates
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US6610281B2 (en) 1993-11-12 2003-08-26 Shearwater Corporation Water soluble activated polymers containing an active ethyl sulfone moiety for modification of surfaces and molecules
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
US6214553B1 (en) 1997-01-21 2001-04-10 Massachusetts General Hospital Libraries of protein encoding RNA-protein fusions
US6207446B1 (en) 1997-01-21 2001-03-27 The General Hospital Corporation Selection of proteins using RNA-protein fusions
US6258558B1 (en) 1997-01-21 2001-07-10 The General Hospital Corporation Method for selection of proteins using RNA-protein fusions
US6261804B1 (en) 1997-01-21 2001-07-17 The General Hospital Corporation Selection of proteins using RNA-protein fusions
US6281344B1 (en) 1997-01-21 2001-08-28 The General Hospital Corporation Nucleic acid-protein fusion molecules and libraries
US6518018B1 (en) 1997-01-21 2003-02-11 The General Hospital Corporation RNA-antibody fusions and their selection
WO1998056915A2 (en) 1997-06-12 1998-12-17 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US7115396B2 (en) 1998-12-10 2006-10-03 Compound Therapeutics, Inc. Protein scaffolds for antibody mimics and other binding proteins
WO2000034787A1 (en) 1998-12-10 2000-06-15 The University Of Nottingham Cancer detection method and reagents
WO2000034784A1 (en) 1998-12-10 2000-06-15 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
WO2001064942A1 (en) 2000-02-29 2001-09-07 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
US6559126B2 (en) 2000-03-31 2003-05-06 Institut Pasteur Peptides blocking vascular endothelial growth factor (VEGF)-mediated angiogenesis, polynucleotides encoding said peptides and methods of use thereof
WO2002004523A2 (en) 2000-07-11 2002-01-17 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US20020044921A1 (en) 2000-09-29 2002-04-18 Seoju Lee Pegylated interleukin-10
WO2002032925A2 (en) 2000-10-16 2002-04-25 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
US20030186385A1 (en) 2000-11-17 2003-10-02 Shohei Koide Method of identifying polypeptide monobodies which bind to target proteins and use thereof
WO2002081497A2 (en) 2001-04-04 2002-10-17 University Of Rochester αξβ3 INTEGRIN-BINDING POLYPEPTIDE MONOBODIES AND THEIR USE
US20070178082A1 (en) 2002-11-08 2007-08-02 Ablynx N.V. Stabilized single domain antibodies
US20070148126A1 (en) 2003-12-05 2007-06-28 Yan Chen Inhibitors of type 2 vascular endothelial growth factor receptors
US20070048282A1 (en) 2004-02-09 2007-03-01 Human Genome Sciences, Inc. Albumin fusion proteins
US20070269422A1 (en) 2006-05-17 2007-11-22 Ablynx N.V. Serum albumin binding proteins with long half-lives
WO2008031098A1 (en) 2006-09-09 2008-03-13 The University Of Chicago Binary amino acid libraries for fibronectin type iii polypeptide monobodies
WO2008066752A2 (en) 2006-11-22 2008-06-05 Adnexus, A Bristol-Myers Squibb R & D Company Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including igf-ir
WO2008097497A2 (en) 2007-02-02 2008-08-14 Adnexus, A Bristol-Myers Squibb R & D Company Vegf pathway blockade
WO2009142773A2 (en) 2008-05-22 2009-11-26 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins

Non-Patent Citations (51)

* Cited by examiner, † Cited by third party
Title
"Cloning Vectors: A Laboratory Manual", 1985, ELSEVIER
"Remington's Pharmaceutical Sciences", 1980
ABUCHOWSKI, A. ET AL., J. BIOL. CHEM., vol. 252, 1977, pages 3571
BARNES ET AL., ANAL. BIOCHEM., vol. 102, 1980, pages 255
BATORI ET AL., PROTEIN ENG., vol. 15, no. 12, 2002, pages 1015 - 20
BORK ET AL., J MOL BIOL., vol. 242, no. 4, 30 September 1994 (1994-09-30), pages 309 - 20
BORK, DOOLITTLE, PROC NATL ACAD SCI U S A., vol. 89, no. 19, 1 October 1992 (1992-10-01), pages 8990 - 4
CAMPBELL, SPITZFADEN, STRUCTURE, vol. 2, no. 5, 15 May 1994 (1994-05-15), pages 333 - 7
CAZALIS ET AL.: "C-Terminal Site-Specific PEGylation of a Truncated Thrombomodulin Mutant with Retention of Full Bioactivity", BIOCONJUG CHEM., vol. 15, no. 5, 2004, pages 1005 - 1009, XP002515520, DOI: doi:10.1021/BC049903Y
CHAMOW ET AL., BIOCONJUGATE CHEM., vol. 5, 1994, pages 133
CONNELL ND., CURR OPIN BIOTECHNOL., vol. L2, no. 5, October 2001 (2001-10-01), pages 446 - 9
DAVID ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 1014
DAYHOFF ET AL., ATLAS OF PROTEIN SEQUENCE AND STRUCTURE, vol. 5, 1978, pages 345 - 352
DICKINSON ET AL., J. MOL. BIOL., vol. 236, 1994, pages 1079 - 1092
DICKINSON ET AL., J. MOL. BIOL., vol. 236, no. 4, 1994, pages 1079 - 92
F. AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1987, GREEN PUBLISHING AND WILEY-INTERSCIENCE
GOODSON ET AL., BIO/TECHNOLOGY, vol. 8, 1990, pages 343
HAM ET AL., METH. ENZ., vol. 58, 1979, pages 44
HARPEZ, CHOTHIA, J MOL BIOL., vol. 238, no. 4, 13 May 1994 (1994-05-13), pages 528 - 39
HUNTER ET AL., NATURE, vol. 144, 1962, pages 945
J. BIOL. CHEM., vol. 252, 1977, pages 3582
JONES, GENETICS, vol. 85, 1977, pages 12
JOSHI ET AL., JOURNAL OF PHARMACEUTICAL SCIENCES, vol. 94, no. 9, 2005
KENNETH, A ET AL.: "Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists"
KOIDE ET AL., BIOCHEMISTRY, vol. 40, no. 34, 2001, pages 10326 - 33
LUCKOW, SUMMERS, BIO/TECHNOLOGY, vol. 6, 1988, pages 47
M GIBALDI, D PERRON: "Pharmacokinetics", 1982, MARCEL DEKKER
MAKRIDES ET AL., MICROBIOL REV., vol. 60, no. 3, September 1996 (1996-09-01), pages 512 - 38
MAYFIELD ET AL., PROC NATL ACAD SCI U S A., vol. 100, no. 2, 21 January 2003 (2003-01-21), pages 438 - 42
MONFARDINI, C. ET AL., BIOCONJUGATC CHCM., vol. 6, 1995, pages 62 - 69
MONFARDINI, C. ET AL., BIOCONJUGATE CHEM., vol. 6, 1995, pages 62 - 69
MORPURGO ET AL., BIOCON. CHEM., vol. 7, 1996, pages 363 - 368
N.V. KATRE, ADVANCED DRUG DELIVERY REVIEWS, vol. 10, 1993, pages 91 - 114
NYGREN, J., HISTOCHEM. AND CYTOCHEM., vol. 30, 1982, pages 407
PAIN ET AL., J. IMMUNOL. METH., vol. 40, 1981, pages 219
PEPINSKY ET AL., JPET, vol. 297, 2001, pages 1059
PETERS ET AL.: "Pharmacokinete analysis: A Practical Approach", 1996
REYES ET AL., NATURE, vol. 297, 1982, pages 598 - 601
ROBERTS, SZOSTAK, PROC NATL. ACAD. SCI., vol. 94, 1997, pages 12297 - 12302
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", vol. 1-3, 1989, COLD SPRING HARBOR LABORATORY PRESS
SANDLER, KARO: "Polymer Synthesis", vol. 3, ACADEMIC PRESS, pages: 138 - 161
SARTORE, L. ET AL., APPL. BIOCHEM. BIOTECHNOL., vol. 27, 1991, pages 45
SHARP ET AL., YEAST, vol. 7, no. 7, October 1991 (1991-10-01), pages 657 - 78
SINCLAIR ET AL., PROTEIN EXPR PURIF., vol. 26, no. 1, October 2002 (2002-10-01), pages 96 - 105
SOLA, J. PHARM SCI, vol. 98, no. 4, 2009, pages 1223 - 1245
STINCHCOMB ET AL., NATURE, vol. 282, 1979, pages 39
WIEDER ET AL., J. BIOL. CHEM., vol. 254, 1979, pages 12579
XU ET AL., CHEMISTRY & BIOLOGY, vol. 9, 2002, pages 933 - 942
YANIV, NATURE, vol. 297, 1982, pages 17 - 18
ZALIPSKY, HARRIS ET AL.: "Poly(ethylene glycol) Chemistry: Biotechnical and Biomedical Applications", 1992, PLENUM PRESS
ZOLA: "Monoclonal Antibodies: A Manual of Techniques", 1987, CRC PRESS, INC., pages: 147 - 158

Cited By (80)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10995131B2 (en) 2003-12-05 2021-05-04 Bristol-Myers Squibb Company Libraries of modified fibronectin type III tenth domain-containing polypeptides
US9862758B2 (en) 2003-12-05 2018-01-09 Bristol-Myers Quibb Company Inhibitors of type 2 vascular endothelial growth factor receptors
US9328157B2 (en) 2003-12-05 2016-05-03 Bristol-Myers Squibb Company Inhibitors of type 2 vascular endothelial growth factor receptors
US11149077B2 (en) 2006-11-22 2021-10-19 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR
US10221232B2 (en) 2006-11-22 2019-03-05 Bristol-Myers Squibb Company Methods of treating cancer by administering IGF-IR binding molecules
US9234028B2 (en) 2008-02-14 2016-01-12 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US9920108B2 (en) 2008-02-14 2018-03-20 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US10781247B2 (en) 2008-02-14 2020-09-22 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US8728483B2 (en) 2008-05-22 2014-05-20 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins
US9902762B2 (en) 2008-05-22 2018-02-27 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins
US10774130B2 (en) 2008-05-22 2020-09-15 Bristol-Myers Squibb Company Method of treating cancer by administering multivalent fibronectin based scaffold domain proteins
US10183987B2 (en) 2008-11-24 2019-01-22 Bristol-Myers Squibb Company Polynucleotides encoding bispecific EGFR/IGF-IR binding molecules
US9017655B2 (en) 2008-11-24 2015-04-28 Bristol-Myers Squibb Company Bispecific EGFR/IGFIR binding molecules
EP3029064A1 (en) * 2008-11-24 2016-06-08 Bristol-Myers Squibb Company Bispecific egfr/igfir binding molecules
US10954286B2 (en) 2008-11-24 2021-03-23 Bristol-Myers Squibb Company Bispecific EGFR/IGFIR binding molecules
US9771411B2 (en) 2008-11-24 2017-09-26 Bristol-Myers Squibb Company Method of treating cancer by administering EGFR and EGFR/IGFIR binding molecules
US10221438B2 (en) 2010-05-03 2019-03-05 Bristol-Myers Squibb Company Serum albumin binding molecules
US9540424B2 (en) 2010-05-03 2017-01-10 Bristol-Myers Squibb Company Serum albumin binding molecules
US10934572B2 (en) 2010-05-03 2021-03-02 Bristol-Myers Squibb Company Serum albumin binding molecules
US8969289B2 (en) 2010-05-03 2015-03-03 Bristol-Myers Squibb Company Serum albumin binding molecules
US11161893B2 (en) 2010-05-26 2021-11-02 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US9562089B2 (en) 2010-05-26 2017-02-07 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US10273286B2 (en) 2010-05-26 2019-04-30 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US9469676B2 (en) 2011-04-13 2016-10-18 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
US10214579B2 (en) 2011-04-13 2019-02-26 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
US10150962B2 (en) 2011-05-17 2018-12-11 Bristol-Myers Squibb Company Methods for the selection of binding proteins
US10898538B2 (en) 2011-05-17 2021-01-26 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
US11913137B2 (en) 2011-05-17 2024-02-27 Bristol-Myers Squibb Company Methods for the selection of binding proteins
WO2012158678A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
US9347058B2 (en) 2011-05-17 2016-05-24 Bristol-Myers Squibb Company Methods for the selection of binding proteins
US11060085B2 (en) 2011-05-17 2021-07-13 Bristol-Myers Squibb Company Methods for the selection of binding proteins
EP3318880A1 (en) 2011-05-17 2018-05-09 Bristol-Myers Squibb Company Improved methods for the selection of binding proteins
WO2012158739A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Improved methods for the selection of binding proteins
US9765132B2 (en) 2011-10-31 2017-09-19 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US11408093B2 (en) 2011-10-31 2022-08-09 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9522951B2 (en) 2011-10-31 2016-12-20 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US11279751B2 (en) 2011-10-31 2022-03-22 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9416170B2 (en) 2011-10-31 2016-08-16 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US10464995B2 (en) 2011-10-31 2019-11-05 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US10604556B2 (en) 2011-10-31 2020-03-31 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9493546B2 (en) 2012-09-13 2016-11-15 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US10245302B2 (en) 2012-09-13 2019-04-02 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US10406212B2 (en) 2012-09-13 2019-09-10 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US8853154B2 (en) 2012-09-13 2014-10-07 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US11813315B2 (en) 2012-09-13 2023-11-14 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US8933199B2 (en) 2012-09-13 2015-01-13 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US8993265B2 (en) 2012-09-13 2015-03-31 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US9662373B2 (en) 2012-09-13 2017-05-30 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US11447538B2 (en) 2013-02-01 2022-09-20 Bristol-Myers Squibb Company Fibronectin based scaffold proteins
EP2951206A2 (en) * 2013-02-01 2015-12-09 Bristol-Myers Squibb Company Fibronectin based scaffold proteins
US10787498B2 (en) 2013-02-06 2020-09-29 Bristol-Myers Squibb Company Fibronectin type III domain proteins with enhanced solubility
US11512124B2 (en) 2013-02-06 2022-11-29 Bristol-Myers Squibb Company Fibronectin type III domain proteins with enhanced solubility
US11345722B2 (en) 2013-02-12 2022-05-31 Bristol-Myers Squibb Company High pH protein refolding methods
US11053278B2 (en) 2013-02-12 2021-07-06 Bristol-Myers Squibb Company Tangential flow filtration based protein refolding methods
US10065987B2 (en) 2013-02-12 2018-09-04 Bristol-Myers Squibb Company High pH protein refolding methods
US10183967B2 (en) * 2013-02-12 2019-01-22 Bristol-Myers Squibb Company Tangential flow filtration based protein refolding methods
US20150376229A1 (en) * 2013-02-12 2015-12-31 Bristol-Myers Squibb Company Tangential flow filtration based protein refolding methods
US11407815B2 (en) 2014-03-20 2022-08-09 Bristol-Myers Squibb Company Stabilized fibronectin based scaffold molecules
KR102494646B1 (ko) 2014-03-20 2023-01-31 브리스톨-마이어스 스큅 컴퍼니 안정화된 피브로넥틴 기반 스캐폴드 분자
US10450363B2 (en) 2014-03-20 2019-10-22 Bristol-Myers Squibb Company Stabilized fibronectin based scaffold molecules
US10442851B2 (en) 2014-03-20 2019-10-15 Bristol-Myers Squibb Company Serum albumin-binding fibronectin type III domains
EP3647322A1 (en) * 2014-03-20 2020-05-06 Bristol-Myers Squibb Company Stabilized fibronectin based scaffold molecules
US11203630B2 (en) 2014-03-20 2021-12-21 Bristol-Myers Squibb Company Serum albumin-binding fibronectin type III domains
CN106795214A (zh) * 2014-03-20 2017-05-31 百时美施贵宝公司 稳定化的基于纤连蛋白的支架分子
WO2015143156A1 (en) * 2014-03-20 2015-09-24 Bristol-Myers Squibb Company Stabilized fibronectin based scaffold molecules
KR20160138133A (ko) * 2014-03-20 2016-12-02 브리스톨-마이어스 스큅 컴퍼니 안정화된 피브로넥틴 기반 스캐폴드 분자
CN106795214B (zh) * 2014-03-20 2022-09-02 百时美施贵宝公司 稳定化的基于纤连蛋白的支架分子
WO2016094945A1 (en) * 2014-12-15 2016-06-23 Monash University Highly stable polypeptide scaffolds
US10766946B2 (en) 2015-09-23 2020-09-08 Bristol-Myers Squibb Company Fast-off rate serum albumin binding fibronectin type III domains
US11434275B2 (en) 2015-09-23 2022-09-06 Bristol-Myers Squibb Company Fast-off rate serum albumin binding fibronectin type III domains
US10925932B2 (en) 2016-06-03 2021-02-23 Janssen Biotech, Inc. Serum albumin-binding fibronectin type III domains
US20170348397A1 (en) * 2016-06-03 2017-12-07 Janssen Biotech, Inc. Serum Albumin-Binding Fibronectin Type III Domains
US11833190B2 (en) 2016-06-03 2023-12-05 Janssen Biotech, Inc. Serum albumin-binding fibronectin type III domains
EP3463430A4 (en) * 2016-06-03 2020-02-12 Janssen Biotech, Inc. SERUM ALBUMIN BINDING FIBRONECTIN TYPE III DOMAINS
IL270233B1 (en) * 2017-05-03 2023-10-01 Bristol Myers Squibb Co Stable formulations of proteins based on the scaffolding region of fibronectin that bind to myostatin
WO2018204617A1 (en) * 2017-05-03 2018-11-08 Bristol-Myers Squibb Company Stable formulations of fibronectin based scaffold domain proteins that bind to myostatin
IL270233B2 (en) * 2017-05-03 2024-02-01 Bristol Myers Squibb Co Stable formulations of proteins based on the scaffolding region of fibronectin that bind to myostatin
AU2018261154B2 (en) * 2017-05-03 2024-05-02 Bristol-Myers Squibb Company Stable formulations of fibronectin based scaffold domain proteins that bind to myostatin
TWI897843B (zh) * 2017-05-03 2025-09-21 美商必治妥美雅史谷比公司 結合至肌肉生長抑制素以纖維連接蛋白為主之支架結構域蛋白質的穩定調配物
US12351619B2 (en) 2019-12-18 2025-07-08 Aro Biotherapeutics Company Serum albumin-binding fibronectin type III domains and uses thereof

Also Published As

Publication number Publication date
US20170166627A1 (en) 2017-06-15
JP2016052315A (ja) 2016-04-14
US20190263892A1 (en) 2019-08-29
CN103180339A (zh) 2013-06-26
EP3091028A1 (en) 2016-11-09
EP2576615B1 (en) 2016-03-30
JP2013534812A (ja) 2013-09-09
ES2573108T3 (es) 2016-06-06
US11161893B2 (en) 2021-11-02
CN103180339B (zh) 2016-04-27
WO2011150133A3 (en) 2012-03-08
US20130184212A1 (en) 2013-07-18
US20220119495A1 (en) 2022-04-21
EP2576615A2 (en) 2013-04-10
US10273286B2 (en) 2019-04-30
US9562089B2 (en) 2017-02-07
JP6023703B2 (ja) 2016-11-09

Similar Documents

Publication Publication Date Title
US11161893B2 (en) Fibronectin based scaffold proteins having improved stability
US11408093B2 (en) Fibronectin binding domains with reduced immunogenicity
TWI508736B (zh) 結合至il-23之以纖維連接蛋白為主之架構域蛋白質
US20230242617A1 (en) Fibronectin based scaffold proteins
US10898538B2 (en) Methods for maintaining pegylation of polypeptides
JP2013531613A (ja) Pcsk9に結合するフィブロネクチンベースのスカフォールドドメインタンパク質

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201180036862.4

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11731571

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2011731571

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2013512226

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 10247/CHENP/2012

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 13699458

Country of ref document: US