WO2011034660A1 - Class i anti-cea antibodies and uses thereof - Google Patents

Class i anti-cea antibodies and uses thereof Download PDF

Info

Publication number
WO2011034660A1
WO2011034660A1 PCT/US2010/043663 US2010043663W WO2011034660A1 WO 2011034660 A1 WO2011034660 A1 WO 2011034660A1 US 2010043663 W US2010043663 W US 2010043663W WO 2011034660 A1 WO2011034660 A1 WO 2011034660A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
cea
fragment
cancer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2010/043663
Other languages
English (en)
French (fr)
Inventor
Hans J. Hansen
Chien-Hsing Chang
David M. Goldenberg
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Immunomedics Inc
Original Assignee
Immunomedics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Immunomedics Inc filed Critical Immunomedics Inc
Priority to CN201080039267.1A priority Critical patent/CN102482701B/zh
Priority to EP10817617.3A priority patent/EP2478110B1/en
Priority to CA2774260A priority patent/CA2774260C/en
Priority to IN1663DEN2012 priority patent/IN2012DN01663A/en
Publication of WO2011034660A1 publication Critical patent/WO2011034660A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3007Carcino-embryonic Antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/55Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6807Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6813Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin the drug being a peptidic cytokine, e.g. an interleukin or interferon
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6815Enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • A61K47/6819Plant toxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • A61K47/6829Bacterial toxins, e.g. diphteria toxins or Pseudomonas exotoxin A
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6853Carcino-embryonic antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/001Preparation for luminescence or biological staining
    • A61K49/0013Luminescence
    • A61K49/0017Fluorescence in vivo
    • A61K49/005Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
    • A61K49/0058Antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/22Echographic preparations; Ultrasonic imaging preparations
    • A61K49/221Echographic preparations; Ultrasonic imaging preparations characterised by the targeting agent or modifying agent linked to the acoustically-active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/088Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins conjugates with carriers being peptides, polyamino acids or proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1027Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against receptors, cell-surface antigens or cell-surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1093Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody conjugates with carriers being antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1093Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody conjugates with carriers being antibodies
    • A61K51/1096Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody conjugates with carriers being antibodies radioimmunotoxins, i.e. conjugates being structurally as defined in A61K51/1093, and including a radioactive nucleus for use in radiotherapeutic applications
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3076Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/515Complete light chain, i.e. VL + CL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the invention relates to compositions for and methods of treating cancers that express CEACAM 5 (carcinoembryonic antigen, "CEA") and/or CEACAM6 (NCA-90), such as medullary thyroid cancer (MTC), colorectal cancers, hepatocellular carcinoma, gastric cancer, lung cancer, head-and-neck cancers, bladder cancer, prostate cancer, breast cancer, pancreatic cancer, uterine cancer, ovarian cancer, hematopoietic cancers, leukemia and other cancers in which CEACAM5 and/or CEACAM6 are expressed.
  • MTC medullary thyroid cancer
  • MTC medullary thyroid cancer
  • MTC medullary thyroid cancer
  • MTC medullary thyroid cancer
  • MTC medullary thyroid cancer
  • MTC medullary thyroid cancer
  • MTC medullary thyroid cancer
  • MTC medullary thyroid cancer
  • MTC medullary thyroid cancer
  • MTC medullary thyroid cancer
  • MTC medullary thyroid
  • the methods comprise administering a Class I anti-CEA antibody or fragment that targets both CEACAM5 and CEACAM6, preferably in combination with at least one other therapeutic agent, such as another antibody, a chemotherapeutic agent, a radioactive agent, an antisense oligonucleotide, an
  • the Class I anti-CEA MAb may be administered prior to, with or after administering the therapeutic agent.
  • the Class I anti-CEA antibody is a chimeric, humanized or human monoclonal antibody (MAb) comprising the light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: 1); GTSTLAS (SEQ ID NO:2); and QQWSYNPPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIANKANGHTTDYSPSVKG (SEQ ID NO:5); and DMGIRWNFDV (SEQ ID NO:6).
  • MAb chimeric, humanized or human monoclonal antibody
  • the chimeric, humanized or human Class I anti-CEA MAb retains the binding affinity characteristics and specificities of a parental murine Class I anti-CEA MAb, but possesses more of the antigenic and effector properties of a human antibody.
  • CEA (CEACAM5) is an oncofetal antigen commonly expressed in a number of epithelial cancers, most commonly those arising in the colon but also in the breast, lung, pancreas, thyroid (medullary type) and ovary (Goldenberg et al., J. Natl. Cancer Inst. 57: 1 1- 22, 1976; Shively, et al., Crit. Rev. Oncol. Hematol. 2:355-399, 1985).
  • the human CEA gene family is composed of 7 known genes belonging to the CEACAM subgroup. These subgroup members are mainly associated with the cell membrane and show a complex expression pattern in normal and cancerous tissues.
  • the CEACAM5 gene also known as CD66e, codes for the CEA protein (Beauchemin et al., Exp Cell Res 252:243, 1999).
  • CEACAM5 was first described in 1965 as a gastrointestinal oncofetal antigen (Gold et al., J Exp Med 122:467-481 , 1965), but is now known to be overexpressed in a majority of carcinomas, including those of the gastrointestinal tract, the respiratory and genitourinary systems, and breast cancer (Goldenberg et al., J Natl Cancer Inst. 57: 1 1 -22, 1976; Shively and Beatty, Crit Rev Oncol Hematol 2:355-99, 1985).
  • CEACAM6 also called CD66c or NCA-90 is a non-specific cross-reacting
  • CEACAM6 glycoprotein antigen that shares some, but not all, antigenic determinants with CEACAM5 (Kuroki et al, Biochem Biophys Res Comm 182:501-06, 1992).
  • CEACAM6 is expressed on granulocytes and epithelia from various organs, and has a broader expression zone in proliferating cells of hyperplastic colonic polyps and adenomas, compared with normal mucosa, as well as by many human cancers (Scholzel et al, Am J Pathol 157: 1051 -52, 2000; Kuroki et al., Anticancer Res 19:5599-5606, 1999).
  • CEACAM6 Relatively high serum levels of CEACAM6 are found in patients with lung, pancreatic, breast, colorectal, and hepatocellular carcinomas. The amount of CEACAM6 does not correlate with the amount of CEACAM5 expressed (Kuroki et al, Anticancer Res 19:5599-5606, 1999).
  • CEACAM6 Expression of CEACAM6 in colorectal cancer correlates inversely with cellular differentiation (Ilantzis et al., Neoplasia 4: 151-63, 2002) and is an independent prognostic factor associated with a higher risk of relapse (Jantscheff et al., J Clin Oncol 21 :3638-46, 2003). Both CEACAM5 and CEACAM6 have a role in cell adhesion, invasion and metastasis.
  • CEACAM5 has been shown to be involved in both homophilic (CEA to CEA) and heterophilic (CEA binding to non-CEA molecules) interactions (Bechimol et al., Cell 57:327-34, 1989; Oikawa et al., Biochem Biophys Res Comm 164:39-45, 1989), suggesting to some that it is an intercellular adhesion molecule involved in cancer invasion and metastasis (Thomas et al., Cancer Lett 92:59-66, 1995). These reactions were completely inhibited by the Fab' fragment of an anti-CEACAM5 antibody (Oikawa et al, Biochem Biophys Res Comm 164:39-45, 1989).
  • CEACAM6 also exhibits homotypic binding with other members of the CEA family and heterotypic interactions with integrin receptors (Stanners and Fuks, In: Cell Adhesion and Communication by the CEA Family, (Stanners ed.) Vol. 5, pp. 57-72, Harwood Academic Publ., Amsterdam, 1998). Antibodies that target the N-domain of CEACAM6 interfere with cell-cell interactions (Yamanka et al. Biochem Biophys Res Comm 219:842-47, 1996). Many breast, pancreatic, colonic and non-small-cell lung cancer (NSCLC) cell lines express
  • CEACAM6 and anti-CEACAM6 antibody inhibits in vitro migration, invasion, and adhesion of antigen-positive cells (Blumenthal et al, Cancer Res 65:8809- 17, 2005).
  • Anti-CEA antibodies are classified into different categories, depending on their cross- reactivity with antigens other than CEA. Anti-CEA antibody classification was described by Primus and Goldenberg, U.S. Patent No. 4,818,709 (incorporated herein by reference from Col. 3, line 5 through Col. 26, line 49 of US 4,818,709). The classification of anti-CEA antibodies is determined by their binding to CEA, meconium antigen (MA) and nonspecific crossreacting antigen (NCA). Class I anti-CEA antibodies bind to all three antigens. Class II antibodies bind to MA and CEA, but not to NCA. Class HI antibodies bind only to CEA (U.S. 4,818,709).
  • each class of anti-CEA antibody examples include MN-3, MN-15 and NP-1 (Class I); MN-2, NP-2 and NP-3 (Class II); and MN-14 and NP-4 (Class III) (U.S. 4,818,709; Blumenthal et al. BMC Cancer 7:2 (2007)).
  • MN-15 antibody binds to the A1B 1 domain of CEA
  • MN-3 antibody binds to the N- terminal domain of CEA
  • MN-14 antibody binds to the A3B3 (CD66e) domain of CEA (Blumenthal et al. BMC Cancer 7:2 (2007)).
  • MN-3 and MN-15 are both Class I anti-CEA antibodies, reactive with NCA, MA and CEA, but bind respectively to the N-terminal and A1B 1 domains of CEA. Primus and Goldenberg (U.S.
  • Anti-CEA antibodies have been suggested for therapeutic treatment of a variety of cancers.
  • MTC medullary thyroid cancer
  • confined to the thyroid gland is generally treated by total thyroidectomy and central lymph node dissection.
  • disease recurs in approximately 50% of these patients.
  • prognosis of patients with unresectable disease or distant metastases is poor, less than 30% survive 10 years (Rossi et al., Amer. J. Surgery, 139:554 (1980); Samaan et al., J. Clin. Endocrinol. Metab., 67:801 (1988); Schroder et al, Cancer, 61 :806 (1988)).
  • the Class III anti-CEA antibody MN-14 has been reported to be effective for therapy of human medullary thyroid carcinoma in an animal xenograft model system, when used in conjunction with pro-apoptotic agents such as DTIC, CPT-1 1 and 5-fluorouracil (U.S. Patent Application Serial No. 10/680,734, the Examples section of which is incorporated herein by reference).
  • the Class III anti-CEA antibody reportedly sensitized cancer cells to therapy with
  • chemotherapeutic agent alone USSN 10/680,734.
  • Anti-CEA antibodies of different classes such as MN-3, MN-14 and MN-15 have been proposed for use in treating a variety of tumors.
  • the present invention provides compositions and methods for effective anti-cancer therapy utilizing Class I anti-CEA MAbs, such as chimeric, humanized or human antibodies comprising the light chain variable region CDR sequences SASSRVSYIH (SEQ ID NOT); GTSTLAS (SEQ ID NO:2); and QQWSYNPPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIAN ANGHTTDYSPSVKG (SEQ ID NO:5); and DMGIRWNFDV (SEQ ID NO:6), which are capable of binding to both CEACAM5 and CEACAM6.
  • Class I anti-CEA MAbs such as chimeric, humanized or human antibodies comprising the light chain variable region CDR sequences SASSRVSYIH (SEQ ID NOT); GTSTLAS (SEQ ID NO:2); and QQWSYNPPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIAN ANG
  • the Class I anti-CEA MAb is humanized, and used in combination with a therapeutic agent, particularly a chemotherapeutic agent, to yield an effective therapeutic treatment for CEACAM5- or CEACAM6-expressing cancers with minimal toxicity.
  • a therapeutic agent particularly a chemotherapeutic agent
  • the separate administration of Class I antibody and therapeutic agent provides enhanced results and the versatility and the flexibility to tailor individual treatment methods.
  • the present invention concerns a composition
  • a composition comprising at least one chimeric, humanized or human Class I anti-CEA MAb or antigen-binding fragment thereof.
  • the fragment may be selected from the group consisting of F(ab')2, Fab', Fab, Fv, scFv fragments and single domain antibodies (VHH).
  • the Class I anti-CEA MAb is a chimeric, humanized or human monoclonal antibody or fragment thereof that comprises the light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l); GTSTLAS (SEQ ID NO:2); and
  • variable region sequences of the chimeric, humanized or human Class I anti-CEA antibody are attached to human IgGl or IgG4 constant region sequences.
  • the chimeric, humanized or human Class I anti-CEA MAb or antigen-binding fragment thereof may be one that blocks or competes for binding to
  • chimeric antibodies retain the framework region (FR) sequences of a parent murine antibody, while humanized and human antibodies will generally have human antibody FR sequences.
  • the humanized Class I anti-CEA MAb comprises the heavy chain FR sequences of the human KOL antibody and the light chain FR sequences of the human REI antibody.
  • the substituted murine FR residues may include one or more amino acid residues selected from heavy chain amino acid residues 28, 29, 30, 48 and 49 of SEQ ID NO: 10 and light chain amino acid residues 21 , 47 and 60 of SEQ ID NO:9.
  • the humanized Class I anti- CEA MAb comprises the variable region sequences of SEQ ID NO:7 and SEQ ID NO:8, while the chimeric Class I anti-CEA MAb comprises the variable region sequences of SEQ ID NO:9 and SEQ ID NO: 10.
  • the Class I anti-CEA antibody will bind to CEA, MA and NCA and will also bind to human granulocytes.
  • the Class I anti-CEA MAb binds to both
  • CEACAM5 and CEACAM6 are chimeric, humanized, or human.
  • the antibody will preferably retain the binding specificity of a parental murine Class I anti-CEA MAb.
  • the Class I anti-CEA MAb may be conjugated to at least one therapeutic agent and/or diagnostic agent to form an immunoconjugate.
  • immunoconjugates are of use for delivering therapeutic and/or diagnostic agents to a
  • CEACAM5- or CEACAM6-expressing cancer cell and/or for therapy or diagnosis of cancer.
  • the Class I anti-CEA MAb may be administered as a "naked" (unconjugated) antibody. Either naked antibodies or immunoconjugates may be administered before, simultaneously with or after another therapeutic anti-cancer agent.
  • kits for diagnosing or treating cancer comprising administering a Class I anti-CEA antibody or fragment thereof to a subject.
  • the antibody may be conjugated to at least one diagnostic agent. After allowing the labeled antibody to bind to CEA-expressing cells, the distribution of bound antibody may be imaged or otherwise determined.
  • the Class I anti- CEA antibody may be conjugated to at least one therapeutic agent and the immunoconjugate administered to a patient.
  • the Class I anti-CEA antibody may be part of a bispecific or multispecific antibody.
  • Such antibodies may contain at least one binding site for a tumor- associated antigen, such as CEA, and at least one other binding site for a hapten attached to a targetable construct.
  • a tumor-associated antigen such as CEA
  • Such bispecific or multispecific antibodies may be used in pretargeting methods for diagnosis or treatment of cancer, as discussed in more detail below.
  • the bispecific or multispecific antibody may be administered to a subject and allowed to localize to a CEACAM5- or CEACAM6-expressing tumor.
  • a clearing agent may optionally be added to enhance clearance of unbound antibody from the circulation.
  • a targetable construct conjugated to a therapeutic and/or diagnostic agent may be administered to the subject to bind to the antibody localized at the tumor site. Delivery of diagnostic agents using a Class I anti-CEA antibody may be performed as part of an endoscopic, intravascular or intraoperative procedure.
  • the therapeutic agent is selected from the group consisting of a naked antibody, a cytotoxic agent, a drug, a radionuclide, boron atoms, an immunomodulator, a photoactive therapeutic agent, an immunoconjugate, a hormone, an enzyme, an antisense oligonucleotide or a combination thereof, optionally formulated in a pharmaceutically acceptable vehicle.
  • the therapeutic agent is a cytotoxic agent selected from a drug or a toxin.
  • the drug may possess a pharmaceutical properly selected from the group consisting of antimitotic, alkylating, antimetabolite, antiangiogenic, apoptotic, alkaloid, COX-2, and antibiotic agents and combinations thereof.
  • the drug is selected from the group consisting of nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas, triazenes, folic acid analogs, anthracyclines, taxanes, COX-2 inhibitors, pyrimidine analogs, purine analogs, antimetabolites, antibiotics,
  • oligonucleotides may include siRNA or RNAi molecules. Many examples of therapeutic oligonucleotides are known in the art and any such known example may be attached to a subject Class I anti-CEA antibody or fragment thereof.
  • the toxin can be selected from the group consisting of ricin, abrin, alpha toxin, saporin, ribonuclease (RNase), DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, gelonin, diphtheria toxin, Pseudomonas exotoxin and Pseudomonas endotoxin.
  • an immunomodulator is administered prior to the administration of a therapeutically effective amount of a Class I anti-CEA monoclonal antibody or fragment thereof alone or a Class I anti-CEA monoclonal antibody and at least one therapeutic agent.
  • Immunomodulators may be selected from the group consisting of a cytokine, a stem cell growth factor, a lymphotoxin, an hematopoietic factor, a colony stimulating factor (CSF), an interferon (IFN), a stem cell growth factor, erythropoietin, thrombopoietin and a combination thereof.
  • the lymphotoxin is tumor necrosis factor (TNF)
  • the hematopoietic factor is an interleukin (IL)
  • the colony stimulating factor is granulocyte-colony stimulating factor (G-CSF) or granulocyte macrophage-colony stimulating factor (GM-CSF)
  • the interferon is interferon-a, - ⁇ or - ⁇
  • the stem cell growth factor is designated "S I factor.”
  • cytokines include growth hormones such as human growth hormone, N- methionyl human growth hormone, and bovine growth hormone; parathyroid hormone; thyroxine; insulin; proinsulin; relaxin; prorelaxin; glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH); hepatic growth factor; prostaglandin, fibroblast growth factor; prolactin; placental lactogen, OB protein; tumor necrosis factor-a and - B; mullerian-inhibiting substance; mouse gonadotropin-associated peptide; inhibin; activin; vascular endothelial growth factor; integrin; thrombopoietin (TPO); nerve growth factors such as NGF-B; platelet-growth factor;
  • growth hormones such as human growth hormone, N- methionyl human growth hormone, and bovine growth hormone
  • parathyroid hormone such as thyroxine
  • insulin proinsulin
  • TGFs transforming growth factors
  • TGF- a and TGF- 6 insulin-like growth factor-I and -II
  • EPO erythropoietin
  • osteoinductive factors interferons such as interferon-a, - ⁇ , and - ⁇
  • colony stimulating factors CSFs
  • ILs interleukins
  • cytokine includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native sequence cytokines.
  • Administration of a cytokine prior to, simultaneous with, or subsequent to exposure to a cytotoxic agent that results in myeloid or hematopoietic toxicity is described in U.S. Patent No. 5, 120,525, the Examples section of which is incorporated herein by reference.
  • the therapeutic agent is a radionuclide that has an energy between 20 and 10,000 keV.
  • the radionuclide is selected from the group consisting of m In, 177 Lu, 212 Bi, 213 Bi, 21 1 At, 62 Cu, 67 Cu, " ⁇ , 125 I, 131 1, 32 P, 33 P, 47 Sc, , n Ag, 67 Ga, 142 Pr, 153 Sm, 161 Tb, 166 Dy, ,66 Ho, 186 Re, 188 Re, 189 Re, 212 Pb, 2 3 Ra, 225 Ac, 59 Fe, 75 Se, 77 As, 89 Sr, 99 Mo, 105 Rh, ,09 Pd, 143 Pr, 149 Pm, 169 Er, 194 Ir, 198 Au, 199 Au, and 21 1 Pb.
  • the methods of the instant invention may further comprise administering to a subject, either concurrently or sequentially, a therapeutically effective amount of a second humanized, chimeric, human or murine monoclonal antibody or fragment thereof.
  • the second MAb may bind to a tumor-associated antigen (TAA) selected from the group consisting of carbonic anhydrase IX, CCCL19, CCCL21, CSAp, CD1, CDla, CD2, CD3, CD4, CD5, CD8, CD1 1A, CD14, CD15, CD16, CD18, CD19, IGF-1R, CD20, CD21 , CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD45, CD46, CD52, CD54, CD55, CD59, CD64, CD66a-e, CD67, CD70, CD74, CD79a, CD80, CD83, CD95, CD126, CD133, CD138, CD147, CD 154,
  • the methods may comprise administering to a subject, either concurrently or sequentially, a therapeutically effective amount of a second humanized, chimeric or human monoclonal antibody or fragment thereof selected from the group consisting of a Class I or Class II or Class III anti-CEA monoclonal antibody or fragment thereof.
  • a second antibody or fragment is administered concurrently with the Class I anti-CEA antibody, it may be administered as a separate molecule or alternatively as part of a bispecific or multispecific antibody construct with the Class I anti-CEA antibody.
  • the second MAb may be selected from any of a wide variety of anti-cancer antibodies known in the art, including but not limited to hPAM4 (U.S. Patent No. 7,282,567), hA20 (U.S. Patent No. 7, 151, 164), hA19 (U.S. Patent No. 7, 109,304), WMMU31 (U.S. Patent No.
  • the second MAb may also be selected from any anti-hapten antibody known in the art, including but not limited to h679 (U.S. Patent No. 7,429,381) and 734 (U.S. Patent No. 7,405,320) or h734 (U.S. Patent No.
  • the bispecific or multispecific antibodies or other antibody constructs may be produced as fusion proteins or by use of the Dock-and-Lock (DNL) technology, as described in more detail below.
  • DNL Dock-and-Lock
  • Compositions and methods for production and use of DNL constructs have been reported (see, e.g., U.S. Patent Nos. 7,521 ,056; 7,527,787; 7,534,866; 7,550, 143 and 7,666,400 and U.S. Patent Application Serial Nos. 12/418,877;
  • DNL complexes are formed by attachment of a selected effector to an anchoring domain (AD) or dimerization and docking domain (DDD) peptide sequence.
  • AD anchoring domain
  • DDD dimerization and docking domain
  • any effector moiety may be attached to a DDD or AD sequence, including antibodies or antibody fragments, peptides, proteins, enzymes, toxins, therapeutic agents, diagnostic agents, immunomodulators, polymers such as polyethylene glycol (PEG), cytokines, chemokines, growth factors, hormones and any other type of molecule or complex.
  • PEG polyethylene glycol
  • the DNL complex may comprise an antibody or fragment thereof comprising light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l); GTSTLAS (SEQ ID NO:2); and QQWSYNPPT (SEQ ID NQ:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIAN ANGHTTDYSPSVKG (SEQ ID NO:5); and DMGIRWNFDV (SEQ ID NO:6).
  • the DNL complex may further comprise a cytokine or a polyethylene glycol moiety.
  • FIG. 1 illustrates an exemplary comparative CEA binding curve for chimeric MN-15 (cMN-15) vs. the parental murine MN-15 antibody.
  • FIG. 2 shows a comparison of the heavy chain variable region sequences of the human KOL antibody (SEQ ID NO:38), the murine MN-15 antibody (SEQ ID NO: 10), and the humanized MN-15 antibody (hMN-15) (SEQ ID NO:8).
  • CDR sequences are boxed and differences between the human KOL and murine MN-15 FR sequences are indicated by underlining in the murine MN-15 sequence.
  • Murine FR amino acids that are retained in the hMN-15 sequence are indicated by underlining in the hMN-15 sequence.
  • FIG. 3 shows a comparison of the light chain variable region sequences of the human REI antibody (SEQ ID NO:39), the murine MN-15 antibody (SEQ ID NO:9), and the humanized MN-15 antibody (hMN-15) (SEQ ID NO: 7).
  • CDR sequences are boxed and differences between the human REI and murine MN-15 FR sequences are indicated by underlining in the murine MN-15 sequence.
  • Murine FR amino acids that are retained in the hMN-15 sequence are indicated by underlining in the hMN-15 sequence.
  • FIG. 4 illustrates an exemplary comparative CEA binding curve for humanized MN-15 (hMN- 15) vs. the parental murine MN-15 antibody.
  • FIG. 5 shows a schematic structural drawing of the domains of CEACAM5 (left) and CEACAM 6 (right). The epitopes recognized by MN-15, MN-3 and M -14 antibodies on CEACAM5 and CEACAM6 are as noted.
  • FIG. 6 shows the results of an in vitro endothelial cell adhesion assay. Percentage adhesion of various tumor cells with varying amounts of expressed CEACAM5 and CEACAM6 to HUVEC cells in the absence or presence of MN-15 Fab', MN-3 Fab', or Ag8 Fab' control. Cells were labeled with 1 yi MvaL of 3 H-thymidine and added to HUVEC cultures and incubated for 30 minutes at 37°C. Samples were washed thrice with PBS to remove unattached cells. Attached tumor cells were solubilized with 0.1 N NaOH and radioactivity was measured in a ⁇ -scintillation counter. The cpm attached/total cpm added (attaching potential) was determined. Results of a typical study are presented. Cell lines used include BT-20
  • FIG. 7 illustrates an exemplary in vivo micrometastasis study.
  • the present invention provides methods of treatment in which a chimeric, humanized or human Class I anti-CEA antibody or fragment thereof is administered to a subject with cancer.
  • the methods are of use to treat cancers that express CEACAM5 (CEA) and/or CEACAM6, since Class I anti-CEA antibodies bind to both antigens.
  • CEA CEACAM5
  • CEACAM6 CEACAM5
  • the antibodies may be administered as naked (unconjugated) antibodies or as immunoconjugates attached to one or more therapeutic agents.
  • the naked antibodies may be administered prior to, simultaneously with or after one or more other therapeutic anti-cancer agents.
  • the method is useful for treating a wide variety of cancers, including but not limited to medullary thyroid carcinoma, colorectal cancers, hepatocellular carcinoma, pancreatic, breast, lung, head-and-neck, bladder, uterine and ovarian cancers, and even cancers that do not express CEACAM5 or CEACAM6 at very high levels.
  • cancers that express CEA at levels of at least 100 ng/g of tissue.
  • Class I anti-CEA antibody or antibody fragment means an antibody or fragment that binds the CEA antigen (or CD66e) and also with normal cross- reactive antigen (NCA), meconium antigen (MA), granulocytes and CD66a-d (see, Primus et al., U.S. Patent No. 4,818,709, incorporated herein by reference).
  • the Class I anti-CEA antibody is a humanized, chimeric or human antibody having light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l); GTSTLAS (SEQ ID NO:2); and QQWSYNPPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIANKANGHTTDYSPSVKG (SEQ ID NO:5); and DMGIRWNFDV (SEQ ID NO:6).
  • SASSRVSYIH SEQ ID NO: l
  • GTSTLAS SEQ ID NO:2
  • QQWSYNPPT SEQ ID NO:3
  • heavy chain variable region CDR sequences DYYMS SEQ ID NO:4
  • FIANKANGHTTDYSPSVKG SEQ ID NO:5
  • DMGIRWNFDV SEQ ID NO:6
  • the mechanism of tumor cell killing by the naked Class I anti-CEA antibody is not known with certainty and likely involves several mechanisms. It is hypothesized that the naked antibody alone or in combination with a therapeutic agent may affect tumor growth by blocking biological activities of their respective antigen or by stimulating natural immunological functions, such as antibody-dependent cell-mediated cytotoxicity (ADCC) or complement- mediated lysis. Additionally, the naked antibody alone or in combination with the therapeutic agent may treat and control the cancer by inhibiting cell growth and cell cycle progression, inducing apoptosis, inhibiting angiogenesis, inhibiting metastatic activity, and/or affecting tumor cell adhesion.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • the anti-CEA antibody or fragment thereof may be more effective in treating metastases than primary cancers, since the metastases may be more susceptible to antagonists of tumor cell adhesion.
  • the present treatment method provides a treatment plan that may be optimized to provide the maximum anti-tumor activity for individual patients by allowing the titration of the antibody and one or more different therapeutic agents to provide an effective treatment regimen.
  • a preferred naked murine, chimeric, humanized or human Class I anti-CEA antibody may be a monovalent construct, comprising only one binding site for CEACAM5 or CEACAM6.
  • a Fab, Fab' or scFv antibody fragment comprising light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l);
  • GTSTLAS SEQ ID NO:2
  • QQWSYNPPT SEQ ID NO:3
  • heavy chain variable region CDR sequences DYYMS SEQ ID NO:4
  • FIANKANGHTTDYSPSVKG SEQ ID NO:5
  • DMGIRWNFDV SEQ ID NO:6
  • Such monovalent constructs may be conjugated to a polymer, such as PEG, to extend its serum half-life, using techniques described in detail below.
  • Another alternative monovalent antibody fragment may contain a human IgG4 constant region and hinge.
  • the native IgG4 sequence may be modified by replacing cysteine residues with serine residues, as discussed in McDonagh et al., (2006, Protein Eng Des Sel 19:299-307).
  • a monovalent antibody fragment may be constructed by the DNL technique, also described in detail below.
  • An antibody refers to a full-length (i.e., naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes) immunoglobulin molecule (e.g., an IgG antibody) or an immunologically active (i.e., specifically binding) portion of an immunoglobulin molecule, like an antibody fragment.
  • immunoglobulin molecule e.g., an IgG antibody
  • immunologically active i.e., specifically binding
  • an antibody fragment is a portion of an antibody such as F(ab') 2 , Fab', Fab, Fv, scFv (single chain Fv) and the like. Regardless of structure, an antibody fragment binds with the same antigen that is recognized by the intact antibody.
  • antibody fragment includes isolated fragments consisting of the variable regions, such as the "Fv” fragments consisting of the variable regions of the heavy and light chains, recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker ("scFv proteins”), and minimal recognition units consisting of the amino acid residues that mimic the hypervariable region.
  • the Fv fragments may be constructed in different ways as to yield multivalent and/or multispecific binding forms. In the former case of multivalent, they react with more than one binding site against the CEA epitope, whereas with multispecific forms, more than one epitope (either of CEA or even against CEA and a different antigen) is bound.
  • a naked antibody is generally an entire antibody which is not conjugated to a therapeutic agent. This is so because the Fc portion of the antibody molecule provides effector or immunological functions, such as complement fixation and ADCC (antibody dependent cell cytotoxicity). However, the Fc portion may not be required for therapeutic function of the antibody, but rather other mechanisms, such as apoptosis, anti-angiogenesis, anti-metastatic activity, anti-adhesion activity, such as inhibition of heterotypic or homotypic adhesion, and interference in signaling pathways, may come into play and interfere with the disease progression.
  • ADCC antibody dependent cell cytotoxicity
  • Naked antibodies include both polyclonal and monoclonal antibodies, and fragments thereof, that include murine antibodies, as well as certain recombinant antibodies, such as chimeric, humanized or human antibodies and fragments thereof. As defined herein, “naked” is synonymous with “unconjugated,” and means not linked or conjugated to any therapeutic agent.
  • a chimeric antibody is a recombinant protein that contains the variable domains of the heavy and light antibody chains, including the complementarity determining regions (CDRs) of an antibody derived from one species, preferably a rodent antibody, while the constant domains of the antibody molecule are derived from those of a human antibody.
  • CDRs complementarity determining regions
  • a humanized antibody is a recombinant protein in which the CDRs from an antibody from one species; e.g., a rodent antibody, are transferred from the heavy and light variable chains of the rodent antibody into human heavy and light variable domains.
  • the constant domains of the antibody molecule are derived from those of a human antibody.
  • a human antibody is an antibody obtained from transgenic mice that have been
  • mice engineered to produce specific human antibodies in response to antigenic challenge.
  • elements of the human heavy and light chain locus are introduced into strains of mice derived from embryonic stem cell lines that contain targeted disruptions of the endogenous heavy chain and light chain loci.
  • the transgenic mice can synthesize human antibodies specific for human antigens, and the mice can be used to produce human antibody-secreting
  • antibody variable domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, and displayed as functional antibody fragments on the surface of the phage particle. Because the filamentous particle contains a single-stranded DNA copy of the phage genome, selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties. In this way, the phage mimics some of the properties of the B cell. Phage display can be performed in a variety of formats, for their review, see e.g. Johnson and Chiswell, Current Opinion in Structural Biology 3 :5564-571 (1993). Human antibodies may also be generated by in vitro activated B cells. See U.S. Patent Nos. 5,567,610 and 5,229,275, which are incorporated in their entirety by reference.
  • a therapeutic agent is a molecule or atom which is administered separately, concurrently or sequentially with an antibody or antibody fragment, and is useful in the treatment of a disease.
  • therapeutic agents include antibodies, antibody fragments,
  • immunoconjugates drugs, enzymes, cytotoxic agents, toxins, nucleases, hormones,
  • immunomodulators include chelators, boron compounds, photoactive agents or dyes, radioisotopes or radionuclides, antisense oligonucleotides or combinations thereof.
  • antibody fusion protein is a recombinantly produced antigen- binding molecule in which one or more of the same or different natural antibody, single-chain antibody or antibody fragment segments with the same or different specificities are linked.
  • a Class I anti-CEA fusion protein comprises at least one CEA binding site.
  • the Class I anti-CEA fusion protein comprises the light chain variable region CDR sequences
  • SASSRVSYIH (SEQ ID NO: l); GTSTLAS (SEQ ID NO:2); and QQWSY PPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4);
  • FIANKANGHTTDYSPSVKG (SEQ ID NO:5); and DMGIRWNFDV (SEQ ID NO:6).
  • Valency of the fusion protein indicates the total number of binding arms or sites the fusion protein has to antigen(s) or epitope(s); i.e., monovalent, bivalent, trivalent or mutlivalent.
  • the multivalency of the antibody fusion protein means that it can take advantage of multiple interactions in binding to an antigen, thus increasing the avidity of binding to the antigen, or to different antigens. Specificity indicates how many different types of antigen or epitope an antibody fusion protein is able to bind; i.e., monospecific, bispecific, trispecific, multispecific.
  • a natural antibody e.g., an IgG
  • a fusion protein may comprise one or more antibodies or fragments thereof linked to a different effector protein or peptide, such as a cytokine, hormone, growth factor, binding protein, binding peptide or other effector.
  • An exemplary fusion protein may comprise an antibody or fragment thereof attached to an AD or DDD peptide, as discussed in detail below.
  • An immunomodulator is a therapeutic agent that when present, alters, suppresses or stimulates the body's immune system.
  • an immunomodulator of use acts to stimulate immune cells to proliferate or become activated in an immune response cascade, such as macrophages, B-cells, and/or T-cells.
  • An example of an immunomodulator as described herein is a cytokine, which is a soluble small protein of approximately 5-20 kDa that is released by one cell population (e.g., primed T-Iymphocytes) on contact with specific antigens, and which acts as an intercellular mediator between cells.
  • cytokines include lymphokines, monokines, interleukins, and several related signalling molecules, such as tumor necrosis factor (TNF) and interferons.
  • TNF tumor necrosis factor
  • Chemokines are a subset of cytokines. Certain interleukins and interferons are examples of cytokines that stimulate T cell or other immune cell proliferation.
  • MAbs Monoclonal antibodies to specific antigens may be obtained by methods known to those skilled in the art. See, for example, Kohler and Milstein, Nature 256: 495 (1975), and Coligan et al. (eds.), CURRENT PROTOCOLS IN IMMUNOLOGY, VOL. 1 , pages 2.5.1- 2.6.7 (John Wiley & Sons 1991) [hereinafter "Coligan"].
  • monoclonal antibodies can be obtained by injecting mice with a composition comprising an antigen, verifying the presence of antibody production by removing a serum sample, removing the spleen to obtain B- lymphocytes, fusing the B-lymphocytes with myeloma cells to produce hybridomas, cloning the hybridomas, selecting positive clones which produce antibodies to the antigen, culturing the clones that produce antibodies to the antigen, and isolating the antibodies from the hybridoma cultures.
  • MAbs can be isolated and purified from hybridoma cultures by a variety of well-established techniques. Such isolation techniques include affinity chromatography with Protein-A Sepharose, size-exclusion chromatography, and ion-exchange chromatography. See, for example, Coligan at pages 2.7.1 -2.7.12 and pages 2.9.1 -2.9.3. Also, see Baines et al., "Purification of Immunoglobulin G (IgG)," in METHODS IN MOLECULAR BIOLOGY, VOL. 10, pages 79-104 (The Humana Press, Inc. 1992).
  • This technique also can be used to raise antibodies to one or more chelating or other hapten moieties, such as In(III)-DTPA chelates.
  • Monoclonal mouse antibodies to an In(III)-di-DTPA are known (U.S. Patent No. 5,256,395 to Barbet).
  • Another method for producing antibodies is by production in the milk of transgenic livestock. See, e.g., Colman, A., Biochem. Soc. Symp., 63: 141-147, 1998; U.S. Patent 5,827,690, both of which are incorporated in their entirety by reference.
  • Two DNA constructs are prepared which contain, respectively, DNA segments encoding paired immunoglobulin heavy and light chains. The DNA segments are cloned into expression vectors that contain a promoter sequence that is preferentially expressed in mammary epithelial cells.
  • Examples include, but are not limited to, promoters from rabbit, cow and sheep casein genes, the cow a- lactoglobulin gene, the sheep ⁇ -lactoglobulin gene and the mouse whey acid protein gene.
  • the inserted fragment is flanked on its 3' side by cognate genomic sequences from a mammary-specific gene. This provides a polyadenylation site and transcript-stabilizing sequences.
  • the expression cassettes are coinjected into the pronuclei of fertilized, mammalian eggs, which are then implanted into the uterus of a recipient female and allowed to gestate. After birth, the progeny are screened for the presence of both transgenes by Southern analysis.
  • both heavy and light chain genes must be expressed concurrently in the same cell.
  • Milk from transgenic females is analyzed for the presence and functionality of the antibody or antibody fragment using standard immunological methods known in the art.
  • the antibody can be purified from the milk using standard methods known in the art.
  • variable genes of the monoclonal antibodies can be cloned from the hybridoma cells, sequenced and subsequently prepared by recombinant techniques.
  • General techniques for cloning murine immunoglobulin variable domains are described, for example, by the publication of Orlandi et al, Proc. Nat'l Acad. Sci. USA 86: 3833 (1989). Humanization and chimerization of murine antibodies and antibody fragments are well known to those skilled in the art.
  • a chimeric antibody is a recombinant protein that contains the variable domains including the CDRs derived from one species of animal, such as a rodent antibody, while the remainder of the antibody molecule; i.e., the constant domains, is derived from a human antibody.
  • the use of antibody components derived from humanized and chimeric monoclonal antibodies alleviates potential problems associated with the immunogenicity of murine constant regions. Techniques for constructing chimeric antibodies are well known to those of skill in the art.
  • a chimeric monoclonal antibody can be humanized by replacing the sequences of the murine FR in the variable domains of the chimeric MAb with one or more different human FR.
  • additional modification might be required in order to restore the original affinity of the murine antibody. This can be accomplished by the replacement of one or more human residues in the FR regions with their murine counterparts to obtain an antibody that possesses good binding affinity to its epitope. See, for example, Tempest et al., Biotechnology 9:266 (1991) and Verhoeyen et al. Science 239: 1534 (1988).
  • the humanized anti-CEA antibody comprises the light chain variable region CDR sequences CDR1 having an amino acid sequence SASSRVSYIH (SEQ ID NO: l); CDR2 having an amino acid sequence GTSTLAS (SEQ ID NO:2); and CDR3 having an amino acid sequence QQWSY PPT (SEQ ID NO:3); and the heavy chain variable region CDR sequences CDR1 having an amino acid sequence DYYMS (SEQ ID NQ:4); CDR2 having an amino acid sequence
  • the humanized anti-CEA antibody comprises the light chain FR sequences of the human REI antibody and the heavy chain FR sequences of the human KOL antibody.
  • the humanized anti-CEA antibody comprises one or more murine FR amino acid residues selected from the heavy chain amino acid residues 28, 29, 30, 48 and 49 of SEQ ID NO: 10 and light chain amino acid residues 21, 47 and 60 of SEQ ID NO:9.
  • a combination of framework sequences from 2 or more different human antibodies can be used for VH and VK FR sequences.
  • the production of humanized MAbs is described, for example, by Jones et al., Nature 321 :522 (1986), Riechmann et al., Nature 332:323 (1988), Verhoeyen et al, Science 239: 1534 (1988), Carter et al., Proc. Nat'l Acad Sci. USA 89:4285 (1992), Sandhu, Crit. Rev. Biotech. 12:437 (1992), and Singer et al., J. Immun. 150:2844 (1993).
  • the affinity of humanized, chimeric and human MAbs to a specific epitope can be increased by mutagenesis of the CDRs, so that a lower dose of antibody may be as effective as a higher dose of a lower affinity MAb prior to mutagenesis. See for example, W00029584A1.
  • a Class I anti-CEA monoclonal antibody is a human antibody.
  • the human anti-CEA MAb, or another human antibody can be obtained from a transgenic non- human animal. See, e.g., Mendez et al, Nature Genetics, 15: 146-156 (1997) and U.S. Patent No. 5,633,425.
  • a human antibody can be recovered from a transgenic mouse possessing human immunoglobulin loci.
  • the mouse humoral immune system is humanized by inactivating the endogenous immunoglobulin genes and introducing human immunoglobulin loci.
  • the human immunoglobulin loci are exceedingly complex and comprise a large number of discrete segments which together occupy almost 0.2% of the human genome.
  • large portions of human heavy- and light-chain loci must be introduced into the mouse genome. This is accomplished in a stepwise process beginning with the formation of yeast artificial
  • chromosomes containing either human heavy- or light-chain immunoglobulin loci in germline configuration. Since each insert is approximately 1 Mb in size, YAC construction requires homologous recombination of overlapping fragments of the immunoglobulin loci.
  • the two YACs, one containing the heavy-chain loci and one containing the light-chain loci, are introduced separately into mice via fusion of YAC containing yeast spheroblasts with mouse embryonic stem cells. Embryonic stem cell clones are then microinjected into mouse blastocysts. Resulting chimeric males are screened for their ability to transmit the YAC through their germline and are bred with mice deficient in murine antibody production.
  • Unrearranged human immunoglobulin genes also can be introduced into mouse embryonic stem cells via microcell-mediated chromosome transfer (MMCT). See, e.g., Tomizuka et al., Nature Genetics, 16: 133 (1997). In this methodology microcells containing human chromosomes are fused with mouse embryonic stem cells. Transferred chromosomes are stably retained, and adult chimeras exhibit proper tissue-specific expression.
  • MMCT microcell-mediated chromosome transfer
  • human antibody fragments may be isolated from a combinatorial immunoglobulin library. See, e.g., Barbas et al., METHODS: A Companion to Methods in Enzymology 2: 1 19 (1991), and Winter et al., Ann. Rev. Immunol.12: 433 (1994). Many of the difficulties associated with generating monoclonal antibodies by B-cell immortalization can be overcome by engineering and expressing antibody fragments in E. coli, using phage display. To ensure the recovery of high affinity, monoclonal antibodies a combinatorial immunoglobulin library must contain a large repertoire size.
  • a typical strategy utilizes mRNA obtained from lymphocytes or spleen cells of immunized mice to synthesize cDNA using reverse transcriptase.
  • the heavy- and light-chain genes are amplified separately by PCR and ligated into phage cloning vectors.
  • Two different libraries are produced, one containing the heavy-chain genes and one containing the light-chain genes.
  • Phage DNA is isolated from each library, and the heavy-and light-chain sequences are ligated together and packaged to form a combinatorial library.
  • Each phage contains a random pair of heavy- and light-chain cDNAs and upon infection of E. coli directs the expression of the antibody chains in infected cells.
  • the phage library is plated, and the antibody molecules present in the plaques are transferred to filters.
  • the filters are incubated with radioactively labeled antigen and then washed to remove excess unbound ligand.
  • a radioactive spot on the autoradiogram identifies a plaque that contains an antibody that binds the antigen.
  • Cloning and expression vectors that are useful for producing a human immunoglobulin phage library can be obtained, for example, from STRATAGENE Cloning Systems (La Jolla, CA).
  • the antibodies are produced as described in Hansen et al., Cancer, 71 :3478 (1993); Hansen et al, U.S. Patent No. 5,874,540; Primus et al, U.S. Patent No.
  • Certain embodiments concern the use of fragments of a Class I anti-CEA antibody, preferably comprising light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l); GTSTLAS (SEQ ID NO:2); and QQWSYNPPT (SEQ ID N0:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIANKANGHTTDYSPSVKG (SEQ ID NO:5); and DMGIRWNFDV (SEQ ID NO:6).
  • Antibody fragments which recognize the same epitope as a parent antibody can be generated by known techniques. For example, antibody fragments can be prepared by proteolytic hydrolysis of an antibody or by expression in E. coli of the DNA coding for the fragment.
  • the antibody fragments are antigen binding portions of an antibody, such as F(ab') 2 , Fab', Fab, Fv, scFv and the like, and can be obtained by pepsin or papain digestion of whole antibodies by conventional methods or by genetic engineering techniques.
  • an antibody fragment can be produced by enzymatic cleavage of antibodies with pepsin to provide a 100 Kd fragment denoted F(ab') 2 .
  • This fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 50 Kd Fab' monovalent fragments.
  • an enzymatic cleavage using papain produces two monovalent Fab fragments and an Fc fragment directly.
  • Fv fragments comprise an association of VR and V L chains. This association can be noncovalent, as described in Inbar et al., Proc. Nat'l. Acad. Sci. U.S.A. 69:2659 (1972).
  • the variable chains can be linked by an intermolecular disulfide bond or cross-linked by chemicals such as glutaraldehyde. See, for example, Sandhu, Crit. Rev. Biotech. 12:437 (1992).
  • the Fv fragments comprise VH and V L chains which are connected by a peptide linker.
  • scFv single-chain antigen binding proteins
  • a CDR is a segment of the variable region of an antibody that is complementary in structure to the epitope to which the antibody binds and is more variable than the rest of the variable region. Accordingly, a CDR is sometimes referred to as hypervariable region.
  • a variable region comprises three CDRs.
  • CDR peptides can be obtained by constructing genes encoding the CDR of an antibody of interest. Such genes are prepared, for example, by using the polymerase chain reaction to synthesize the variable region from RNA of antibody producing cells.
  • VHH Single domain antibodies
  • Single domain antibodies may be obtained, for example, from camels, alpacas or llamas by standard immunization techniques.
  • the VHH may have potent antigen-binding capacity and can interact with novel epitopes that are inacessible to conventional VH-VL pairs.
  • Alpaca serum IgG contains about 50% camelid heavy chain-only IgG antibodies (HCAbs) (Maass et al., 2007).
  • Alpacas may be immunized with known antigens, such as TNF-a, and VHHs can be isolated that bind to and neutralize the target antigen (Maass et al., 2007).
  • PCR primers that amplify virtually all alpaca VHH coding sequences have been identified and may be used to construct alpaca VHH phage display libraries, which can be used for antibody fragment isolation by standard biopanning techniques well known in the art (Maass et al, 2007).
  • the Class I anti-CEA antibody or fragment thereof comprises light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l); GTSTLAS (SEQ ID NO:2); and QQWSY PPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIANKANGHTTDYSPSVKG (SEQ ID NO:5); and DMGIRWNFDV (SEQ ID NO:6).
  • the antibodies can be used to treat any cancer that expresses CEACAM5 and/or CEACAM6.
  • Exemplary CEACAM5 or CEACAM6 expressing carcinomas include without limitation medullary thyroid cancer, colorectal cancer, pancreatic cancer, hepatocellular carcinoma, gastric cancer, lung cancer, head-and neck cancers, urinary bladder cancer, prostate cancer, uterine cancer, endometrial cancer, breast cancer, hematopoietic cancer, leukemia and ovarian cancer.
  • a composition as claimed herein may comprise at least one Class I anti-CEA monoclonal antibody (MAb) or fragment thereof.
  • the composition or method of use may also include at least one therapeutic agent, which may be conjugated to the Class I anti-CEA antibody or not conjugated.
  • the second antibody is non-blocking (i.e., does not block binding of the first Class I anti-CEA antibody or antibody fragment to its target antigen).
  • the Class I anti-CEA monoclonal antibody or fragment thereof is humanized, human or chimeric, wherein the humanized, human or chimeric MAb retains substantially the Class I anti-CEA binding specificity of a murine Class I anti-CEA MAb.
  • the Class I anti-CEA monoclonal antibody or fragment thereof comprises the light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l ); GTSTLAS (SEQ ID NO:2); and QQWSYNPPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIANKANGHTTDYSPSVKG (SEQ ID NO:5); and DMGIRWNFDV (SEQ ID NO:6).
  • the Class I anti-CEA monoclonal antibody or fragment thereof is a humanized antibody that comprises human antibody FR and constant region sequences, preferably with FR sequences from the human REI and KOL antibodies.
  • the framework regions (FRs) preferably comprise at least one amino acid substituted from the corresponding FRs of a murine monoclonal antibody.
  • the humanized antibody or fragment thereof comprises at least one amino acid selected from the group consisting of heavy chain amino acid residues 28, 29, 30, 48 and 49 of SEQ ID NO: 10 and light chain amino acid residues 21, 47 and 60 of SEQ ID NO:9.
  • the amino acid sequence of a preferred humanized antibody comprises the variable region sequences of SEQ ID NO: 7 and SEQ ID NO:8.
  • compositions comprising a chimeric Class I anti-CEA monoclonal antibody or fragment thereof, optionally with at least one therapeutic agent, which may be conjugated or unconjugated.
  • the chimeric antibody or fragment thereof comprises light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l);
  • the chimeric antibody comprises the variable region sequences of SEQ ID NO:9 and SEQ ID NO: 10.
  • compositions comprising a naked murine, humanized, chimeric or human Class I anti- CEA antibody or fragment thereof.
  • the composition may optionally comprise a therapeutic agent, such as a second naked or conjugated anti- CEA antibody or antibody fragment thereof.
  • a second anti-CEA antibody is used, it is non-blocking, i.e., does not block binding of the first Class I anti-CEA antibody or fragment thereof.
  • both anti-CEA antibodies or fragments thereof are non-blocking to each other, allowing both antibodies or fragments thereof to bind to CEA (CD66e).
  • the claimed compositions and methods may comprise an antibody or fragment that binds to the same epitope of CEACAM5 or CEACAM6 as a Class I anti-CEA antibody comprising light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l); GTSTLAS (SEQ ID NO:2); and QQWSYNPPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIANKANGHTTDYSPSVKG (SEQ ID NO:5); and DMGIRWNFDV (SEQ ID NO:6).
  • Evidence of epitope binding may be determined, for example, by competitive binding assays that are well known in the art.
  • anti-CEA antibodies such as Class II or Class III anti-CEA antibodies
  • Class II or Class III anti-CEA antibodies can be used in combination with the Class I anti-CEA antibody , in either a naked or conjugated form.
  • one or more chimeric or humanized Class II or Class III anti-CEA antibodies or fragments thereof may be combined with a Class I anti-CEA antibody or fragment thereof.
  • the second antibody or antibody fragment may be either unconjugated (naked) or conjugated to at least one therapeutic agent (immunocougate).
  • Immunoconjugates can be prepared by indirectly conjugating a therapeutic agent to an antibody component. General techniques are described in Shih et al. Int. J. Cancer, 41 :832 (1988); Shih et al. Int. J. Cancer, 46: 1 101 (1990); and Shih et al, U.S. Patent No. 5,057,313.
  • the general method involves reacting an antibody component having an oxidized carbohydrate portion with a carrier polymer that has at least one free amine function and that is loaded with a plurality of drug, toxin, chelator, boron addends, or other therapeutic agents. This reaction results in an initial Schiff base (imine) linkage, which can be stabilized by reduction to a secondary amine to form the final conjugate.
  • a carrier polymer that has at least one free amine function and that is loaded with a plurality of drug, toxin, chelator, boron addends, or other therapeutic agents.
  • compositions and methods of use comprising a humanized, chimeric, murine or human Class I anti-CEA antibody or fragment thereof and a second antibody or fragment that binds to a different tumor-associated antigen (TAA).
  • TAA tumor-associated antigen
  • the second antibody or fragment thereof binds to a TAA selected from the group consisting of carbonic anhydrase IX, CCCL19, CCCL21 , CSAp, CD1 , CDla, CD2, CD3, CD4, CD5, CD8, CD1 1A, CD14, CD15, CD16, CD18, CD19, IGF-1R, CD20, CD21 , CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD45, CD46, CD52, CD54, CD55, CD59, CD64, CD66a-e, CD67, CD70, CD74, CD79a, CD80, CD83, CD95, CD126, CD133, CD138, CD147, CD154, AFP, PSMA, CEACAM5, CEACAM-6, B7, ED-B of fibronectin, Factor H, FHL-1 , Flt-3, folate receptor, GROB, HMGB-1 , hypoxia
  • carcinomas include medullary thyroid carcinoma, colorectal cancer, pancreatic cancer, breast cancer, hepatocellular carcinoma, ovarian cancer, gastric cancer, prostate cancer, uterine cancer, hematopoietic cancer, leukemia and various lung, head-and-neck, endometrial, bladder, and liver cancers that express CEACAM5 and/or CEACAM6.
  • the CEA levels in these types of cancers are lower than present in medullary thyroid carcinomas but all that is necessary is that the CEACAM5 and/or CEACAM6 levels be sufficiently high so that the Class I anti-CEA therapy provides an effective treatment.
  • Normal colon mucosa has about 100-500 ng/gram but carcinomas expressing CEA at levels of about 5 meg/gram of tissue are suitable for treatment with the methods described herein.
  • contemplated herein is a method for treating cancer comprising administering to a subject, either concurrently or sequentially, a therapeutically effective amount of a Class I anti-CEA monoclonal antibody or fragment thereof and at least one therapeutic agent, optionally formulated in a pharmaceutically acceptable vehicle.
  • the Class I anti-CEA monoclonal antibody or fragment thereof is chimeric, murine, humanized or human, wherein the Class I anti-CEA MAb retains substantially the Class I anti-CEA binding specificity of a parental murine MAb.
  • the Class I anti-CEA antibody comprises light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l);
  • the therapeutic agent is a cytotoxic agent, more preferably an alkylating agent, and most preferably, dacarbazine (DTIC). But in another embodiment, the therapeutic agent may not be DTIC.
  • cytotoxic agents such as 5-fluorouracil, CPT- 1 1 and oxaliplatin can also be used in combinations with these antibodies, especially in the therapy of colorectal cancers. In other cancer types, cancer drugs that are known to be effective are also good candidates for combining with the antibody therapies proposed herein.
  • Also contemplated herein is a method for treating CEACAM5 and/or CEACAM6- expressing cancers comprising administering to a subject, either concurrently or sequentially, a therapeutically effective amount of a first Class I anti-CEA monoclonal antibody or fragment thereof and at least one therapeutic agent, and a naked or conjugated second humanized, chimeric, human or murine monoclonal antibody or fragment thereof, optionally formulated in a pharmaceutically acceptable vehicle.
  • the second antibody or fragment thereof binds to a tumor-associated antigen selected from the group consisting human growth hormone, N-methionyl human growth hormone, bovine growth hormone, parathyroid hormone, thyroxine, insulin, proinsulin, relaxin, prorelaxin, follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), luteinizing hormone (LH), hepatic growth factor, prostaglandin, fibroblast growth factor, prolactin, placental lactogen, OB protein, tumor necrosis factor-a, tumor necrosis factor-B, mullerian-inhibiting substance, mouse gonadotropin-associated peptide, inhibin, activin, vascular endothelial growth factor, integrin, thrombopoietin (TPO), NGF- ⁇ , platelet-growth factor, TGF-a, TGF-B, insulin-like growth factor-I, insulin-like growth factor-II, erythropoietin (EPO),
  • the second antibody or fragment thereof can be a different Class I anti-CEA antibody or fragment thereof that is non-blocking.
  • the second antibody or fragment thereof may be a Class II or Class III anti-CEA antibody or fragment.
  • the antibodies and fragments thereof may be administered either concurrently or sequentially with each other or the therapeutic agent.
  • a naked Class I anti-CEA antibody as described herein can significantly increase the chemosensitivity of cancer cells to one or more therapeutic agents.
  • a naked Class I, anti-CEA antibody comprising light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l); GTSTLAS (SEQ ID NO:2); and QQWSYNPPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIANKANGHTTDYSPSVKG (SEQ ID NO:5); and DMGIRW FDV (SEQ ID NO:6), as described herein, either before or concurrently with a therapeutic agent, such as DTIC, CPT-1 1, 5'-fluorouracil (5-FU) or oxaliplatin, improves a cell's response to a therapeutic agent, such as a cytotoxic drug.
  • a therapeutic agent such as DTIC, CPT-1 1, 5'-fluorouracil (5-FU) or oxaliplatin
  • Multimodal therapies include immunotherapy with a Class I anti-CEA antibody or fragment thereof, and a therapeutic agent, supplemented with administration of an unconjugated or conjugated antibody, unconjugated or conjugated fusion protein, or fragment thereof.
  • an unconjugated humanized, chimeric, murine or human Class I anti-CEA MAb or fragment thereof comprising light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l); GTSTLAS (SEQ ID NQ:2); and QQWSYNPPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIANKANGHTTDYSPSVKG (SEQ ID NO:5); and DMGIRWNFDV (SEQ ID NO:6) may be combined with another naked humanized, murine, chimeric or human Class I anti-CEA antibody (such as an antibody against a different epitope on CEA), or a humanized, chimeric, murine or human Class I anti-CEA antibody immunoconjugate conjugated to a radioisotope, chemotherapeutic agent, cytokine, enzyme, enzyme-inhibitor, hormone or hormone antagonist, metal, toxin, antisense
  • oligonucleotide e.g., anti-bcl-2
  • oligonucleotide e.g., anti-bcl-2
  • a therapeutic agent of use is a drug used in standard cancer chemotherapy, such as taxane or platinum drugs in ovarian cancer, fluorouracil, CPT-1 1 , and oxaloplatin drugs in colorectal cancer, gemcitabine in pancreatic and other cancers, or taxane derivatives in breast cancers.
  • COX-2 inhibitors represent still another class of agents that show activity in combination with typical cytotoxic agents in cancer chemotherapy, and can be used in the same way, but combined in addition with anti-CEA antibodies alone or in combination with other anti-TAA antibodies.
  • these drugs can be used in combination with radiolabeled antibodies, either anti-CEA antibody conjugates or radioimmunoconjugates with other anti- TAA antibodies.
  • a naked Class I anti-CEA antibody or fragment thereof is administered sequentially (either prior to or after) or concurrently with dacarbazine (DTIC), doxorubin, cyclophosphamide or vincristine, or any combination of these.
  • DTIC dacarbazine
  • doxorubin doxorubin
  • cyclophosphamide doxorubin
  • vincristine vincristine
  • DTIC and cylcophosphamide may be administered sequentially or concurrently with a naked Class I anti-CEA antibody or fragment thereof.
  • 5 -fluorouracil in combination with folinic acid, alone or in combination with irinotecan (CPT-1 1) or oxaliplatin is a regimen used to treat colorectal cancer.
  • combination therapy with any of these chemotherapeutic agents and a naked Class I anti-CEA antibody or fragment thereof can be used to treat cancer.
  • other chemotherapeutic agents may be preferred, such as one of the alkylating agents (e.g., DTIC), as well as gemcitabine and other more recent classes of cytotoxic drugs.
  • the chemotherapeutic drugs and a naked Class I anti-CEA antibody or fragment thereof can be administered in any order, or together. In a preferred multimodal therapy, both
  • chemotherapeutic drugs and naked Class I anti-CEA antibodies or fragments thereof are administered before, after, or co-administered with a conjugated or unconjugated anti-CEA antibody, fusion protein, or fragment thereof.
  • the Class I anti-CEA antibody or fragment thereof is a humanized antibody or fragment thereof.
  • a preferred treatment schedule of multimodal treatment is administering both hMN-15 and DTIC for 3 days, and administering only hMN-15 on days 7, 14, 21 and then every 21 days for a treatment duration of 12 months.
  • the doses of hMN-15 are 0.5 - 15 mg/kg body weight per infusion, more preferably 2-8, and still more preferably 3-5 mg/kg per infusion, and the doses of DTIC are as currently applied at the preferred dose clinically, but could also be given at two-thirds or less of the maximum preferred dose in use, thereby decreasing drug-related adverse events.
  • Repeated drug cycles can be given, such as every 1 -6 months, with continuation of the naked antibody therapy, or with different schedules of radiolabeled antibody, drug-conjugated antibody, and inclusion of certain cytokines, such as G-CSF and/or GM-CSF, each dose adjusted so that toxicity to the patient is not enhanced by the therapeutic combination.
  • cytokines such as G-CSF and/or GM-CSF
  • the application of a cytokine growth factor, such as G-CSF may enable even higher doses of myelosuppressive agents, such as radiolabeled antibody or cytotoxic drugs, to be administered, and these schedules and doses may be adjusted for the patients individually, depending on their disease status and prior therapy, bone marrow status and tolerability to additional cytotoxic therapies.
  • the Class I anti-CEA antibody or fragment thereof is administered in a dosage of 100-600 milligrams protein per dose per injection. Still more preferred, the Class I anti-CEA antibody or fragment thereof is administered in a dosage of 300-400 milligrams of protein per dose per injection, with repeated doses preferred.
  • the preferred antibody schedule is infusing once weekly or even less frequently, such as once every other week or even every third week, depending on a number of factors, including the extent of the disease and the amount of CEA circulating in the patient's blood.
  • the Class I anti-CEA antibody comprising light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: 1); GTSTLAS (SEQ ID NO:2); and QQWSY PPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIANKANGHTTDYSPSVKG (SEQ ID N0:5); and DMGIRW FDV (SEQ ID N0:6) may be incorporated into a bispecific or multispecific antibody. Bispecific antibodies are useful in a number of biomedical applications.
  • bispecific antibodies comprising at least one binding site for a tumor-associated antigen (TAA), such as CEACAM 5 and/or CEACAM6, as well as at least one binding site for a targetable construct conjugated to therapeutic or diagnostic agents, are also well known in the art (see, e.g., U.S. Patent Nos. 7,300,644; 7, 138, 103; 7,074,405; 7,052,872; 6,962,702; 6,458,933, the Examples section of each of which is incorporated herein by reference).
  • bispecific antibodies comprising binding moieties targeting two different TAAs, or different epitopes of the same TAA, may be of therapeutic use.
  • Bispecific antibodies comprising the antigen-binding variable region sequences of any known anti-TAA antibody may be utilized, including but not limited to hPAM4 (U.S. Patent No. 7,282,567), hA20 (U.S. Patent No. 7,151, 164), hA19 (U.S. Patent No. 7, 109,304), hIMMU31 (U.S. Patent No. 7,300,655), hLLl (U.S. Patent No. 7,312,318), hLL2 (U.S. Patent No. 7,074,403), hMu-9 (U.S. Patent No. 7,387,772), hL243 (U.S. Patent No.
  • hMN-14 U.S. Patent No. 6,676,924
  • hRS7 U.S. Patent No. 7,238,785
  • hMN-3 U.S. Patent No. 7,541,440
  • hRl U.S. Patent Application Serial No. 12/722,645, filed 3/12/10
  • antibodies of use may be commercially obtained from a wide variety of known sources.
  • a variety of antibody secreting hybridoma lines are available from the American Type Culture Collection (ATCC, Manassas, VA).
  • ATCC American Type Culture Collection
  • VA Manassas
  • a large number of antibodies against various disease targets, including but not limited to tumor-associated antigens, have been deposited at the ATCC and/or have published variable region sequences and are available for use in the claimed methods and compositions. See, e.g., U.S. Patent Nos.
  • antibody sequences or antibody-secreting hybridomas against almost any disease-associated antigen may be obtained by a simple search of the ATCC, NCBI and/or USPTO databases for antibodies against a selected disease-associated target of interest.
  • the antigen binding domains of the cloned antibodies may be amplified, excised, ligated into an expression vector, transfected into an adapted host cell and used for protein production, using standard techniques well known in the art.
  • Bispecific antibodies can be produced by the quadroma method, which involves the fusion of two different hybridomas, each producing a monoclonal antibody recognizing a different antigenic site (Milstein and Cuello, Nature, 1983; 305:537- 540).
  • bispecific antibodies Another method for producing bispecific antibodies uses heterobifunctional cross- linkers to chemically tether two different monoclonal antibodies (Staerz, et al. Nature. 1985; 314:628-631 ; Perez, et al. Nature. 1985; 316:354-356). Bispecific antibodies can also be produced by reduction of each of two parental monoclonal antibodies to the respective half molecules, which are then mixed and allowed to reoxidize to obtain the hybrid structure (Staerz and Bevan. Proc Natl Acad Sci U S A. 1986; 83: 1453- 1457). Another alternative involves chemically cross-linking two or three separately purified Fab' fragments using appropriate linkers. (See, e.g.,
  • Other methods include improving the efficiency of generating hybrid hybridomas by gene transfer of distinct selectable markers via retrovirus-derived shuttle vectors into respective parental hybridomas, which are fused subsequently (DeMonte, et al. Proc Natl Acad Sci U S A. 1990, 87:2941 -2945); or transfection of a hybridoma cell line with expression plasmids containing the heavy and light chain genes of a different antibody.
  • Cognate V H and V L domains can be joined with a peptide linker of appropriate composition and length (usually consisting of more than 12 amino acid residues) to form a single-chain Fv (scFv) with binding activity.
  • a peptide linker of appropriate composition and length usually consisting of more than 12 amino acid residues
  • Methods of manufacturing scFvs are disclosed in U.S. Pat. No. 4,946,778 and U.S. Pat. No. 5, 132,405, the Examples section of each of which is incorporated herein by reference. Reduction of the peptide linker length to less than 12 amino acid residues prevents pairing of VH and VL domains on the same chain and forces pairing of VH and VL domains with complementary domains on other chains, resulting in the formation of functional multimers.
  • Polypeptide chains of VH and VL domains that are joined with linkers between 3 and 12 amino acid residues form predominantly dimers (termed diabodies). With linkers between 0 and 2 amino acid residues, trimers (termed triabodies) and tetramers (termed tetrabodies) are favored, but the exact patterns of oligomerization appear to depend on the composition as well as the orientation of V-domains (VH-1 inker- VL or VL-linker- VH), in addition to the linker length.
  • bispecific or multispecific antibodies or other constructs may be produced using the dock-and-lock technology.
  • the DNL method exploits specific protein/protein interactions that occur between the regulatory (R) subunits of cAMP-dependent protein kinase (PKA) and the anchoring domain (AD) of A-kinase anchoring proteins (AKAPs) (Baillie et al, FEBS Letters. 2005; 579: 3264. Wong and Scott, Nat. Rev. Mol. Cell Biol. 2004; 5: 959).
  • PKA which plays a central role in one of the best studied signal transduction pathways triggered by the binding of the second messenger cAMP to the R subunits
  • the structure of the holoenzyme consists of two catalytic subunits held in an inactive form by the R subunits (Taylor, J. Biol. Chem. 1989;264:8443). Isozymes of PKA are found with two types of R subunits (RI and RII), and each type has a and ⁇ isoforms (Scott, Pharmacol. Ther.
  • R subunits have been isolated only as stable dimers and the dimerization domain has been shown to consist of the first 44 amino-terminal residues (Newlon et al, Nat. Struct. Biol. 1999; 6:222). Binding of cAMP to the R subunits leads to the release of active catalytic subunits for a broad spectrum of serine/threonine kinase activities, which are oriented toward selected substrates through the compartmentalization of PKA via its docking with AKAPs (Scott et al, J. Biol. Chem. 1990;265;21561).
  • AKAP microtubule-associated protein-2
  • the amino acid sequences of the AD are quite varied among individual AKAPs, with the binding affinities reported for RII dimers ranging from 2 to 90 nM (Alto et al, Proc. Natl. Acad. Sci. USA. 2003; 100:4445). AKAPs will only bind to dimeric R subunits.
  • the AD binds to a hydrophobic surface formed by the 23 amino- terminal residues (Colledge and Scott, Trends Cell Biol. 1999; 6:216).
  • the dimerization domain and AKAP binding domain of human Rlla are both located within the same N-terminal 44 amino acid sequence (Newlon et al, Nat. Struct. Biol. 1999;6:222; Newlon et al, EMBO J. 2001 ;20: 1651), which is termed the DDD herein.
  • Entity B is constructed by linking an AD sequence to a precursor of B, resulting in a second component hereafter referred to as b.
  • the dimeric motif of DDD contained in a 2 will create a docking site for binding to the AD sequence contained in b, thus facilitating a ready association of a 2 and b to form a binary, trimeric complex composed of a 2 b.
  • This binding event is made irreversible with a subsequent reaction to covalently secure the two entities via disulfide bridges, which occurs very efficiently based on the principle of effective local concentration because the initial binding interactions should bring the reactive thiol groups placed onto both the DDD and AD into proximity (Chimura et al., Proc. Natl. Acad. Sci. USA.
  • DNL constructs of different stoichiometry may be produced and used, including but not limited to dimeric, trimeric, tetrameric, pentameric and hexameric DNL constructs.
  • fusion proteins A variety of methods are known for making fusion proteins, including nucleic acid synthesis, hybridization and/or amplification to produce a synthetic double-stranded nucleic acid encoding a fusion protein of interest.
  • double-stranded nucleic acids may be inserted into expression vectors for fusion protein production by standard molecular biology techniques (see, e.g. Sambrook et al., Molecular Cloning, A laboratory manual, 2 nd Ed, 1989).
  • the AD and/or DDD moiety may be attached to either the N-terminal or C- terminal end of an effector protein or peptide.
  • site of attachment of an AD or DDD moiety to an effector moiety may vary, depending on the chemical nature of the effector moiety and the part(s) of the effector moiety involved in its physiological activity.
  • Site-specific attachment of a variety of effector moieties may be performed using techniques known in the art, such as the use of bivalent cross-linking reagents and/or other chemical conjugation techniques.
  • Bispecific or multispecific antibodies may be utilized in pre-targeting techniques.
  • Pre- targeting is a multistep process originally developed to resolve the slow blood clearance of directly targeting antibodies, which contributes to undesirable toxicity to normal tissues such as bone marrow.
  • a radionuclide or other therapeutic agent is attached to a small delivery molecule (targetable construct or targetable conjugate) that is cleared within minutes from the blood.
  • a pre-targeting bispecific or multispecific antibody, which has binding sites for the targetable construct as well as a target antigen, is administered first, free antibody is allowed to clear from circulation and then the targetable construct is administered.
  • Pre-targeting methods are well known in the art, for example, as disclosed in Goodwin et al., U.S. Pat. No. 4,863,713; Goodwin et al., J. Nucl. Med. 29:226, 1988; Hnatowich et al., J. Nucl. Med. 28: 1294, 1987; Oehr et al, J. Nucl. Med. 29:728, 1988; Klibanov et al., J. Nucl. Med. 29: 1951 , 1988; Sinitsyn et al., J. Nucl. Med. 30:66, 1989; Kalofonos et al., J. Nucl. Med.
  • a pre-targeting method of treating or diagnosing a disease or disorder in a subject may be provided by: (1) administering to the subject a bispecific antibody or antibody fragment; (2) optionally administering to the subject a clearing composition, and allowing the composition to clear the antibody from circulation; and (3) administering to the subject the targetable construct, containing one or more chelated or chemically bound therapeutic or diagnostic agents.
  • the technique may also be utilized for antibody dependent enzyme prodrug therapy (ADEPT) by administering an enzyme conjugated to a targetable construct, followed by a prodrug that is converted into active form by the enzyme.
  • ADPT antibody dependent enzyme prodrug therapy
  • the antibodies, antibody fragments or fusion proteins described herein may be administered alone, as a "naked" antibody, fragment or fusion protein.
  • the antibody, fragment or fusion protein may be administered before, concurrently with, or after at least one other therapeutic agent.
  • an antibody, fragment or fusion protein may be covalently or non-covalently attached to at least one therapeutic and/or diagnostic agent to form an immunoconjugate.
  • Diagnostic agents are preferably selected from the group consisting of a radionuclide, a radiological contrast agent, a paramagnetic ion, a metal, a fluorescent label, a chemiluminescent label, an ultrasound contrast agent and a photoactive agent. Such diagnostic agents are well known and any such known diagnostic agent may be used.
  • Non-limiting examples of diagnostic agents may include a radionuclide such as "°In, U 1 ln, l 77 Lu, 18 F, 52 Fe, 62 Cu, 64 Cu, 67 Cu, 67 Ga, 68 Ga, 86 Y, 90 Y, 89 Zr, 94m Tc, 9 Tc, 99m Tc, 120 I, 123 I, , 24 I, 125 I, 131 I, 154", 58 Gd, 32 P, U C, , 3 N, 15 0, 186 Re, , 88 Re, 51 Mn, 52m Mn, 55 Co, 72 As, 75 Br, 76 Br, 8 m Rb, 83 Sr, or other gamma-, beta-, or positron-emitters.
  • a radionuclide such as "°In, U 1 ln, l 77 Lu, 18 F, 52 Fe, 62 Cu, 64 Cu, 67 Cu, 67 Ga, 68 Ga, 86 Y, 90 Y,
  • Paramagnetic ions of use may include chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) or erbium (III).
  • Metal contrast agents may include lanthanum (III), gold (III), lead (II) or bismuth (III).
  • Ultrasound contrast agents may comprise liposomes, such as gas filled liposomes.
  • Radiopaque diagnostic agents may be selected from barium compounds, gallium compounds and thallium compounds.
  • fluorescent labels are known in the art, including but not limited to fluorescein isothiocyanate, rhodamine, phycoerytherin, phycocyanin, allophycocyanin, o-phthaldehyde and fluorescamine.
  • Chemiluminescent labels of use may include luminol, isoluminol, an aromatic acridinium ester, an imidazole, an acridinium salt or an oxalate ester.
  • Therapeutic agents are preferably selected from the group consisting of a radionuclide, an immunomodulator, an anti-angiogenic agent, a cytokine, a chemokine, a growth factor, a hormone, a drug, a prodrug, an enzyme, an oligonucleotide, a pro-apoptotic agent, a photoactive therapeutic agent, a cytotoxic agent, which may be a chemotherapeutic agent or a toxin, and a combination thereof.
  • the drugs of use may possess a pharmaceutical property selected from the group consisting of antimitotic, antikinase, alkylating, antimetabolite, antibiotic, alkaloid, anti- angiogenic, pro-apoptotic agents and combinations thereof.
  • Exemplary drugs of use include, but are not limited to, 5-fluorouracil, aplidin, azaribine, anastrozole, anthracyclines, bendamustine, bleomycin, bortezomib, bryostatin-1 , busulfan, calicheamycin, camptothecin, carboplatin, 10-hydroxycamptothecin, carmustine, celebrex, chlorambucil, cisplatin (CDDP), COX-2 inhibitors, irinotecan (CPT-1 1), SN-38, carboplatin, cladribine, camptothecans, cyclophosphamide, cytarabine, dacarbazine, docetaxel,
  • Toxins of use may include ricin, abrin, alpha toxin, saporin, ribonuclease (RNase), e.g., onconase, DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, gelonin, diphtheria toxin, Pseudomonas exotoxin, and Pseudomonas endotoxin.
  • RNase ribonuclease
  • Immunomodulators of use may be selected from a cytokine, a stem cell growth factor, a lymphotoxin, a hematopoietic factor, a colony stimulating factor (CSF), an interferon (IFN), erythropoietin, thrombopoietin and a combination thereof.
  • CSF colony stimulating factor
  • IFN interferon
  • lymphotoxins such as tumor necrosis factor (TNF), hematopoietic factors, such as interleukin (IL), colony stimulating factor, such as granulocyte-colony stimulating factor (G-CSF) or granulocyte macrophage-colony stimulating factor (GM-CSF), interferon, such as interferons-a, - ⁇ or - ⁇ , and stem cell growth factor, such as that designated "SI factor”.
  • TNF tumor necrosis factor
  • IL interleukin
  • colony stimulating factor such as granulocyte-colony stimulating factor (G-CSF) or granulocyte macrophage-colony stimulating factor (GM-CSF)
  • interferon such as interferons-a, - ⁇ or - ⁇
  • stem cell growth factor such as that designated "SI factor”.
  • cytokines include growth hormones such as human growth hormone, N-methionyl human growth hormone, and bovine growth hormone; parathyroid hormone; thyroxine; insulin; proinsulin; relaxin; prorelaxin; glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH); hepatic growth factor;
  • growth hormones such as human growth hormone, N-methionyl human growth hormone, and bovine growth hormone
  • parathyroid hormone such as thyroxine
  • insulin proinsulin
  • relaxin prorelaxin
  • glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH)
  • FSH follicle stimulating hormone
  • TSH thyroid stimulating hormone
  • LH luteinizing hormone
  • prostaglandin fibroblast growth factor; prolactin; placental lactogen, OB protein; tumor necrosis factor-a and - B; mullerian-inhibiting substance; mouse gonadotropin-associated peptide; inhibin; activin; vascular endothelial growth factor; integrin; thrombopoietin (TPO); nerve growth factors such as NGF- ⁇ ; platelet-growth factor; transforming growth factors (TGFs) such as TGF- a and TGF- ⁇ ; insulin-like growth factor-I and -II; erythropoietin (EPO); osteoinductive factors; interferons such as interferon-a, - ⁇ , and - ⁇ ; colony stimulating factors (CSFs) such as macrophage-CSF (M-CSF); interleukins (ILs) such as IL-1 , IL-la, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8
  • Chemokines of use include RANTES, MCAF, MIP1 -alpha, MIPl-Beta and IP- 10.
  • Radioactive isotopes useful for treating diseased tissue include, but are not limited to- m In, 177 Lu, 2, 2 Bi, 213 Bi, 2U At, 62 Cu, 67 Cu, 90 Y, 125 I, 131 1, 32 P, 33 P, 47 Sc, m Ag, 67 Ga, 142 Pr, , 53 Sm, 161 Tb, 166 Dy, , 66 Ho, 186 Re, , 88 Re, 189 Re, 12 Pb, 2 3 Ra, 25 Ac, 59 Fe, 75 Se, 77 As, 89 Sr, "Mo, 105 Rh, 109 Pd, 143 Pr, 149 Pm, 169 Er, 194 Ir, 198 Au, I99 Au, and 2u Pb.
  • the therapeutic radionuclide preferably has a decay energy in the range of 20 to 6,000 keV, preferably in the ranges 60 to 200 keV for an Auger emitter, 100-2,500 keV for a beta emitter, and 4,000-6,000 keV for an alpha emitter.
  • Maximum decay energies of useful beta-particle-emitting nuclides are preferably 20-5,000 keV, more preferably 100-4,000 keV, and most preferably 500-2,500 keV. Also preferred are radionuclides that substantially decay with Auger-emitting particles.
  • beta-particle-emitting nuclides are preferably ⁇ 1 ,000 keV, more preferably ⁇ 100 keV, and most preferably ⁇ 70 keV. Also preferred are radionuclides that substantially decay with generation of alpha-particles.
  • Such radionuclides include, but are not limited to: Dy-152, At-21 1 , Bi-212, Ra-223, Rn-219, Po-215, Bi-21 1 , Ac-225, Fr-221, At-217, Bi-213 and Fm-255. Decay energies of useful alpha-particle- emitting radionuclides are preferably 2,000-10,000 keV, more preferably 3,000-8,000 keV, and most preferably 4,000-7,000 keV. Additional potential radioisotopes of use include n C, 13 N, 15 0, 75 Br, 198 Au, 224 Ac, 1 6 I, 133 I, 77 Br, 1 13m In, 95 Ru, 97 Ru, , 03 Ru, 105 Ru, , 07 Hg, 203 Hg,
  • Some useful diagnostic nuclides may include 124 I, 123 I, 131 I, 18 F, 52 Fe, 62 Cu, 64 Cu, 67 Cu, 67 Ga, 68 Ga, 86 Y, 89 Zr, 94 Tc, 94m Tc, 99m Tc, or m In.
  • Therapeutic agents may include a photoactive agent or dye.
  • Fluorescent compositions such as fluorochrome, and other chromogens, or dyes, such as porphyrins sensitive to visible light, have been used to detect and to treat lesions by directing the suitable light to the lesion. In therapy, this has been termed photoradiation, phototherapy, or photodynamic therapy. See Jori et al. (eds.), PHOTODYNAMIC THERAPY OF TUMORS AND OTHER DISEASES
  • Corticosteroid hormones can increase the effectiveness of other chemotherapy agents, and consequently, they are frequently used in combination treatments.
  • Prednisone and dexamethasone are examples of corticosteroid hormones.
  • anti-angiogenic agents such as angiostatin, baculostatin, canstatin, maspin, anti-VEGF antibodies, anti-PlGF peptides and antibodies, anti-vascular growth factor antibodies, anti-Flk-1 antibodies, anti-Fit- 1 antibodies and peptides, anti-Kras antibodies, anti-cMET antibodies, anti-MIF (macrophage migration-inhibitory factor) antibodies, laminin peptides, fibronectin peptides, plasminogen activator inhibitors, tissue metalloproteinase inhibitors, interferons, interleukin-12, IP- 10, Gro- ⁇ , thrombospondin, 2- methoxyoestradiol, proliferin-related protein, carboxiamidotriazole, CM101 , Marimastat, pentosan polysulphate, angiopoietin-2, interferon-alpha, herbimycin A, PNU145156E, 16K
  • oligonucleotides especially antisense oligonucleotides that preferably are directed against oncogenes and oncogene products of B-cell malignancies, such as bcI-2.
  • Preferred antisense oligonucleotides include those known as siRNA or RNAi.
  • any of the antibodies, antibody fragments or antibody fusion proteins described herein may be conjugated to one or more therapeutic or diagnostic agents.
  • the therapeutic agents do not need to be the same but can be different, e.g. a drug and a radioisotope.
  • 131 I can be incorporated into a tyrosine of an antibody or fusion protein and a drug attached to an epsilon amino group of a lysine residue.
  • Therapeutic and diagnostic agents also can be attached, for example to reduced SH groups and/or to carbohydrate side chains. Many methods for making covalent or non-covalent conjugates of therapeutic or diagnostic agents with antibodies or fusion proteins are known in the art and any such known method may be utilized.
  • a therapeutic or diagnostic agent can be attached at the hinge region of a reduced antibody component via disulfide bond formation.
  • such agents can be attached using a heterobifunctional cross-linker, such as N-succinyl 3-(2-pyridyldithio)propionate (SPDP). Yu et al, Int. J. Cancer 56: 244 (1994).
  • SPDP N-succinyl 3-(2-pyridyldithio)propionate
  • the therapeutic or diagnostic agent can be conjugated via a carbohydrate moiety in the Fc region of the antibody.
  • the carbohydrate group can be used to increase the loading of the same agent that is bound to a thiol group, or the carbohydrate moiety can be used to bind a different therapeutic or diagnostic agent.
  • the Fc region may be absent if the antibody used as the antibody component of the immunoconjugate is an antibody fragment.
  • a carbohydrate moiety into the light chain variable region of a full length antibody or antibody fragment. See, for example, Leung et al, J. Immunol. 154: 5919 (1995); Hansen et al, U.S. Patent No. 5,443,953 (1995), Leung et al, U.S. Patent No. 6,254,868, each incorporated herein by reference.
  • the engineered carbohydrate moiety is used to attach the therapeutic or diagnostic agent.
  • a chelating agent may be attached to an antibody, antibody fragment or fusion protein or to a targetable construct and used to chelate a therapeutic or diagnostic agent, such as a radionuclide.
  • exemplary chelators include but are not limited to DTPA (such as Mx-DTPA), DOTA, TETA, NETA or NOTA.
  • Methods of conjugation and use of chelating agents to attach metals or other ligands to proteins are well known in the art (see, e.g., U.S. Patent No. 7,563,433, the Examples section of which is incorporated herein by reference).
  • radioactive metals or paramagnetic ions may be attached to proteins or peptides by reaction with a reagent having a long tail, to which may be attached a multiplicity of chelating groups for binding ions.
  • a tail can be a polymer such as a polylysine, polysaccharide, or other derivatized or derivatizable chains having pendant groups to which can be bound chelating groups such as, e.g., ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTPA), porphyrins, polyamines, crown ethers, bis- thiosemicarbazones, polyoximes, and like groups known to be useful for this purpose.
  • EDTA ethylenediaminetetraacetic acid
  • DTPA diethylenetriaminepentaacetic acid
  • porphyrins polyamines, crown ethers, bis- thiosemicarbazones, polyoximes, and like groups known to be
  • Chelates may be directly linked to antibodies or peptides, for example as disclosed in U.S. Patent 4,824,659, incorporated herein by reference.
  • Particularly useful metal-chelate combinations include 2-benzyl-DTPA and its monomethyl and cyclohexyl analogs, used with diagnostic isotopes in the general energy range of 60 to 4,000 keV, such as 125 1, 131 1, 123 1, 124 I, 62 Cu, "Cu, , 8 F, 1 1 'In, 67 Ga, 68 Ga, 99m Tc, 9 m Tc, U C, 13 N, 15 0, 76 Br , for radio-imaging.
  • chelates when complexed with non-radioactive metals, such as manganese, iron and gadolinium are useful for MRI.
  • Macrocyclic chelates such as NOTA, DOTA, and TETA are of use with a variety of metals and radiometals, most particularly with radionuclides of gallium, yttrium and copper, respectively.
  • metal-chelate complexes can be made very stable by tailoring the ring size to the metal of interest.
  • Other ring-type chelates such as macrocyclic polyethers, which are of interest for stably binding nuclides, such as 23 Ra for RAIT are encompassed.
  • 18 F-labeling of use in PET scanning techniques for example by reaction of F-18 with a metal or other atom, such as aluminum.
  • the 18 F-A1 conjugate may be complexed with chelating groups, such as DOTA, NOTA or NETA that are attached directly to antibodies or used to label targetable constructs in pre-targeting methods.
  • chelating groups such as DOTA, NOTA or NETA that are attached directly to antibodies or used to label targetable constructs in pre-targeting methods.
  • Such F-18 labeling techniques are disclosed in U.S. Patent No. 7,563,433, the Examples section of which is incorporated herein by reference.
  • compositions comprising murine, humanized, chimeric or human Class I anti-CEA MAbs to be delivered to a subject can comprise one or more pharmaceutically acceptable vehicles, one or more additional ingredients, or some combination of these.
  • the Class I anti- CEA antibodies and fragments thereof can be formulated according to known methods to prepare pharmaceutically useful compositions.
  • Sterile phosphate-buffered saline is one example of a pharmaceutically acceptable vehicle.
  • Other acceptable vehicles are well-known to those in the art.
  • the Class I anti-CEA antibody or fragment thereof can be formulated for intravenous administration via, for example, bolus injection or continuous infusion.
  • Formulations for injection can be presented in unit dosage form, e.g., in ampules or in multi-dose containers, with an added preservative.
  • the compositions can take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • the active ingredient can be in powder form for reconstitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
  • Control release preparations can be prepared through the use of polymers to complex or adsorb the antibody.
  • biocompatible polymers include matrices of poly (ethylene-co-vinyl acetate) and matrices of a polyanhydride copolymer of a stearic acid dimer and sebacic acid. Sherwood et al.,
  • the Class I anti-CEA antibody or fragment thereof may also be administered to a mammal subcutaneously or by other parenteral routes. Moreover, the administration may be by continuous infusion or by single or multiple boluses. In general, the dosage of an administered antibody or fragment thereof for humans will vary depending upon such factors as the patient's age, weight, height, sex, general medical condition and previous medical history. Typically, it is desirable to provide the recipient with a dosage of antibody or fragment thereof that is in the range of from about 0.5 mg/kg to 20 mg kg as a single intravenous infusion, although a lower or higher dosage also may be administered as circumstances dictate.
  • This dosage may be repeated as needed, for example, once per month for 4-10 months, preferably once per every other week for 16 weeks, and more preferably, once per week for 8 weeks. It may also be given less frequently, such as every other week for several months or given more frequently and/or over a longer duration.
  • the dosage may be given through various parenteral routes, with appropriate adjustment of the dose and schedule.
  • the Class I anti-CEA antibody or fragment thereof is administered to a mammal in a therapeutically effective amount to reduce the size of a tumor as compared to untreated controls.
  • the Class I anti CEA antibody or fragment thereof is a humanized antibody or fragment thereof.
  • a suitable subject for the present invention is usually a human, although a non-human mammal or animal subject is also contemplated.
  • An antibody preparation is administered in a "therapeutically effective amount" if the amount administered is physiologically significant.
  • An agent is physiologically significant if its presence results in a detectable change in the physiology of a recipient mammal.
  • an antibody preparation is physiologically significant if its presence invokes an antitumor response.
  • a physiologically significant effect could also be the evocation of a humoral and/or cellular immune response in the recipient mammal.
  • kits containing components suitable for treating or diagnosing diseased tissue in a patient may contain at least one antibody, antibody fragment or fusion protein as described herein. If the composition containing components for administration is not formulated for delivery via the alimentary canal, such as by oral delivery, a device capable of delivering the kit components through some other route may be included.
  • a device capable of delivering the kit components through some other route may be included.
  • an Class I anti-CEA antibody or fragment thereof may be provided in the form of a prefilled syringe or autoinjection pen containing a sterile, liquid formulation or lyophilized preparation of antibody (e.g., Kivitz et al., Clin. Ther. 2006, 28: 1619-29).
  • the kit components may be packaged together or separated into two or more containers.
  • the containers may be vials that contain sterile, lyophilized formulations of a composition that are suitable for reconstitution.
  • a kit may also contain one or more buffers suitable for reconstitution and/or dilution of other reagents.
  • Other containers that may be used include, but are not limited to, a pouch, tray, box, tube, or the like.
  • Kit components may be packaged and maintained sterilely within the containers. Another component that can be included is instructions to a person for use of the kit.
  • Still other embodiments may concern DNA sequences comprising a nucleic acid encoding an antibody, antibody fragment, fusion protein or bispecific antibody.
  • Exemplary sequences that may be encoded and expressed include a Class I anti-CEA MAb or fragment thereof, a fusion protein comprising at least one Class I anti-CEA antibody or fragments thereof, a fusion protein comprising at least one first antibody or fragment and at least one second antibody or fragment.
  • the first and second antibodies may comprise an Class I anti-CEA antibody and/or an antibody against a tumor or B-cell associated antigen such as B7, CD4, CD5, CD8 CD14, CD15, CD16, CD19, CD20, CD21, CD22, CD23, CD25, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD45, CD46, CD52, CD54, CD55, CD59, CD70, CD74, CD80, CD95, CD126, CD133, CD138, CD154, CEACAM6, ED-B fibronectin, IL-2, IL-6, IL-25, MUC 1 , MUC2, MUC3, MUC4, MIF, NCA-66, la, HM1.24, HLA-DR, tenascin, T101, TAC, TRAIL-R1, TRAIL-R2, VEGFR, EGFR, P1GF, ILGF, Flt-3, tenascin, complement factor C5, an oncogene product
  • the Class I antibody, antibody fragment, fusion protein or bispecific antibody comprises the light chain variable region CDR sequences SASSRVSYIH (SEQ ID NO: l); GTSTLAS (SEQ ID NO:2); and QQWSY PPT (SEQ ID NO:3); and heavy chain variable region CDR sequences DYYMS (SEQ ID NO:4); FIANKANGHTTDYSPSVKG (SEQ ID NO:5); and
  • DMGIRW FDV (SEQ ID NO:6).
  • Various embodiments relate to expression vectors comprising the coding DNA sequences.
  • the vectors may contain sequences encoding the light and heavy chain constant regions and the hinge region of a human immunoglobulin to which may be attached chimeric, humanized or human variable region sequences.
  • the vectors may additionally contain promoters that express MAbs in a selected host cell, immunoglobulin enhancers and signal or leader sequences.
  • Vectors that are particularly useful are pdHL2 or GS.
  • the light and heavy chain constant regions and hinge region may be from a human EU myeloma immunoglobulin, where optionally at least one of the amino acid in the allotype positions is changed to that found in a different IgGl allotype, and wherein optionally amino acid 253 of the heavy chain of EU based on the EU number system may be replaced with alanine.
  • a human EU myeloma immunoglobulin where optionally at least one of the amino acid in the allotype positions is changed to that found in a different IgGl allotype, and wherein optionally amino acid 253 of the heavy chain of EU based on the EU number system may be replaced with alanine.
  • VK (variable light chain) and V H (variable heavy chain) sequences for Class I anti- CEA antibodies may be obtained by a variety of molecular cloning procedures, such as RT-PCR, 5 '-RACE, and cDNA library screening.
  • V genes of a Class I anti-CEA MAb from a cell that expresses a murine Class I anti-CEA MAb can be identified by PCR amplification and DNA sequencing.
  • the cloned VL and VH genes can be expressed in cell culture as a chimeric Ab as described by Orlandi et al, (Proc. Natl. Acad. Sci., USA, 86: 3833 (1989)).
  • a humanized Class I anti-CEA MAb can then be designed and constructed as described by Leung et al. (Mol. Immunol., 32: 1413 (1995)).
  • cDNA can be prepared from any known hybridoma line or transfected cell line producing a murine Class I anti-CEA MAb by general molecular cloning techniques (Sambrook et al., Molecular Cloning, A laboratory manual, 2 nd Ed (1989)).
  • the VK sequence for the MAb may be amplified using the primers VK1BACK and VK1FOR (Orlandi et al, 1989) or the extended primer set described by Leung et al. (BioTechniques, 15: 286 (1993)).
  • V H sequences can be amplified using the primer pair VHIBACK VHIFOR (Orlandi et al., 1989) or the primers annealing to the constant region of murine IgG described by Leung et al. (Hybridoma, 13:469 (1994)).
  • PCR reaction mixtures containing 10 ⁇ of the first strand cDNA product, 10 ⁇ of 10X PCR buffer [500 mM KC1, 100 mM Tris-HCl (pH 8.3), 15 mM MgCl 2 , and 0.01% (w/v) gelatin] (Perkin Elmer Cetus, Norwalk, CT), 250 uM of each dNTP, 200 nM of the primers, and 5 units of Taq DNA polymerase (Perkin Elmer Cetus) can be subjected to 30 cycles of PCR. Each PCR cycle preferably consists of denaturation at 94°C for 1 min, annealing at 50°C for 1.5 min, and polymerization at 72°C for 1.5 min.
  • VK and VH fragments can be purified on 2% agarose (BioRad, Richmond, CA).
  • the humanized V genes can be constructed by a combination of long oligonucleotide template syntheses and PCR amplification as described by Leung et al. (Mol. Immunol., 32: 1413 (1995)).
  • PCR products for VK can be subcloned into a staging vector, such as a pBR327-based staging vector, VKpBR, that contains an Ig promoter, a signal peptide sequence and convenient restriction sites to facilitate in-frame ligation of the VK PCR products.
  • PCR products for VH can be subcloned into a similar staging vector, such as the pBluescript-based VHpBS. Individual clones containing the respective PCR products may be sequenced by, for example, the method of Sanger et al. (Proc. Natl. Acad. Sci., USA, 74: 5463 (1977)).
  • VK and VH sequences can be excised from VKpBR and VHpBS, respectively, by double restriction digestion as Hindlll-BamHI fragments.
  • the VK and VH expression cassettes can be ligated into appropriate expression vectors, such as pKh and pGlg, respectively (Leung et al., Hybridoma, 13:469 (1994)).
  • the expression vectors can be co-transfected into an appropriate cell, e.g., myeloma Sp2/0-Agl4 (ATCC, VA), colonies selected for hygromycin resistance, and supernatant fluids monitored for production of a chimeric, humanized or human Class I anti-CEA MAb by, for example, an ELISA assay.
  • the VK and VH expression cassettes can be assembled in the modified staging vectors, VKpBR2 and VHpBS2, excised as Xbal/BamHI and XhoI/BamHI fragments, respectively, and subcloned into a single expression vector, such as pdHL2, as described by Gilles et al. (J Immunol.
  • Co-transfection and assay for antibody secreting clones by ELISA can be carried out as follows. About 10 ⁇ g of VKpKh (light chain expression vector) and 20 ⁇ g of VHpGlg (heavy chain expression vector) can be used for the transfection of 5 X 10 6 SP2/0 myeloma cells by electroporation (BioRad, Richmond, CA) according to Co et al., J. Immunol., 148: 1149 (1992). Following transfection, cells may be grown in 96-well microtiter plates in complete HSFM medium (Life Technologies, Inc., Grand Island, NY) at 37°C, 5% C0 2 .
  • complete HSFM medium Life Technologies, Inc., Grand Island, NY
  • the selection process can be initiated after two days by the addition of hygromycin selection medium (Calbiochem, San Diego, CA) at a final concentration of 500 units/ml of hygromycin. Colonies typically emerge 2-3 weeks post-electroporation. The cultures can then be expanded for further analysis. Transfectoma clones that are positive for the secretion of chimeric, humanized or human heavy chain can be identified by ELISA assay.
  • Antibodies can be isolated from cell culture media as follows. Transfectoma cultures are adapted to serum-free medium. For production of chimeric antibody, cells are grown as a 500 ml culture in roller bottles using HSFM.
  • Cultures are centrifuged and the supernatant filtered through a 0.2 ⁇ membrane.
  • the filtered medium is passed through a protein A column (1 3 cm) at a flow rate of 1 ml/min.
  • the resin is then washed with about 10 column volumes of PBS and protein A- bound antibody is eluted from the column with 0.1 M glycine buffer (pH 3.5) containing 10 mM EDTA.
  • Fractions of 1.0 ml are collected in tubes containing 10 ⁇ of 3 M Tris (pH 8.6), and protein concentrations determined from the absorbance at 280/260 ran. Peak fractions are pooled, dialyzed against PBS, and the antibody concentrated, for example, with the Centricon 30 (Amicon, Beverly, MA).
  • the antibody concentration is determined by ELISA and its concentration adjusted to about 1 mg/ml using PBS. Sodium azide, 0.01% (w/v), is conveniently added to the sample as preservative.
  • NP-1 reacts with NCA (normal cross- reactive antigen), MA (meconium antigen), and CEA (carcinoembryonic antigen) and, in a liquid solution of decreasing ion strength, demonstrates increasing affinity for CEA, a property shared with unadsorbed goat anti-CEA serum and affinity-purified NCA crossreactive antibody purified from goat anti-CEA serum (Primus et al., 1983).
  • NCA normal cross- reactive antigen
  • MA meconium antigen
  • CEA carcinoembryonic antigen
  • NP-2 and NP-3 react with MA and CEA but not with NCA, whereas NP-4 reacts only with CEA (Primus et al., 1983).
  • NP-2 and NP-3 differ because NP-2 binding to CEA is blocked by NP-1 , whereas NP- 1 does not block binding of NP-3 to CEA.
  • MAb reactive with NCA, MA, and CEA were designated as Class I MAb;
  • MAb reactive with MA and CEA but unreactive with NCA were designated as Class II MAb;
  • MAb specific for CEA, being unreactive with NCA and MA were designated as Class III MAb (see, e.g., U.S. Patent No. 4,818,709, the Examples section of which is incorporated herein by reference).
  • the present Example describes the production and characterization of a second generation of anti-CEA antibodies, including the MN- 15 Class I anti-CEA MAb.
  • the immunogen used to produce MN-15 and other second generation anti-CEA antibodies was a partially purified CEA preparation derived from the GW-39 human colon adenocarcinoma xenograft (Hansen et al., 1993, Cancer 71 :3478-85). Tumor was grown in the hind-leg muscle of the golden hamster, excised, frozen, and stored at -20°C. Homogenization of tumor, extraction with perchloric acid, and concentration of the dialyzed extract by
  • mice Harlan, Madison, WI
  • mice Harlan, Madison, WI
  • mice from which the second-generation M series of anti-CEA MAb were derived.
  • Mice first were immunized subcutaneously with 7.5 ⁇ g of CEA in complete Freund adjuvant and then boosted subcutaneously with 7.5 ⁇ g of CEA in incomplete Freund adjuvant on day 3 and boosted intravenously with 7.5 ⁇ g of CEA in saline on days 6 and 9.
  • the first mouse was given 50 ⁇ g of CEA intravenously in saline; on day 23 one animal was killed, the spleen cell suspensions were prepared, and the cells were fused with murine myeloma cells SP2/0-Ag 14 with the use of polyethylene glycol and then cultured in medium containing 8- azaguanine.
  • Hybridoma supernatants were screened for CEA reactive antibody by the ROCHE® 125 I-CEA radioimmunoassay (RIA) in 0.01 and 0.10 M N3 ⁇ 4 acetate buffer. Positive clones were recloned.
  • the granulocyte reactivity of CEA-reactive MAb was determined by whole- blood indirect fluorescent flow cytometric analysis (Sharkey et al. Cancer Res., 1990, 50:2823- 31).
  • MN-2 and MN-6 Two MAb with properties similar to those of NP-2 and NP-3, designated MN-2 and MN-6, were selected for additional development.
  • a third MAb, MN-3 reacted with granulocytes but, unlike NP-1 and NP-2, did not demonstrate ion sensitivity for CEA binding; it also was selected for development.
  • the mouse used in the second fusion was immunized on days 1, 3, 6, and 9, as described above. It was given 65 ⁇ g of CEA in saline intravenously on day 278 and 90 ⁇ g of CEA in saline on day 404. It was killed on day 407.
  • the fusion and screening protocols were the same as those used for the first mouse.
  • the second fusion yielded one clone (MN- 14) that had properties consistent with those of NP-4 in that it was unreactive with granulocytes, bound only 30-40% of 125 I-CEA in the ROCHE® CEA RIA, and demonstrated no ion sensitivity of CEA binding in the RIA.
  • the MAb were purified from ascites fluid raised in CD2F1 mice (Charles River Laboratories, Wilmington, MA) by protein A and ion-exchange column chromatography at 4°C. All of the MAb were of the IgGl isotype with kappa light chains, as determined by double gel diffusion.
  • the amount of probe bound to CEA was determined by washing out the unbound probe, adding substrate (o-phenylenediamine/hydrogen peroxide), adding acid to stop the reaction, and quantitating the color product by reading the adsorbance at 490 nm.
  • Horseradish peroxidase was conjugated to MAb NP-4, MN-3, MN-6, and MN-14, as described previously for NP-3 (Hansen et al., Clin Chem 1989, 35: 146-51). All conjugates were diluted to match the dose-response curve established previously with the NP-3- horseradish peroxidase probe. Probes made with NP-4, MN-3, MN-6, and MN-14 all gave linear dose-response curves with the GW-39 CEA standard.
  • Meconium was homogenized in 10 volumes of deionized water and the mixture centrifuged at 40,000 X g for 30 minutes. The supernatant was decanted from the pellet and stored at -20°C.
  • the amount of MA plus CEA (in ng/ml) in the MA standard was determined by assay with the NP-l/NP-3 EIA.
  • the amount of CEA (in ng/ml) in the MA standard was determined with the NP-l NP-4 assay and found to be 15% of the total MA/CEA activity determined with the NP-l/NP-3 EIA.
  • Blocking studies were performed with the same conditions described for quantification of CEA. To assess blocking of binding of the enzyme probes, microwells were charged with CEA by use of 25 ng/ml of the CEA standard. Unlabeled MAb were added to MAb-enzyme conjugates, and the EIA assay was completed as described for quantitation of CEA with the NP- 3 probe.
  • Immunoreactivity with blood lymphocytes was determined by live-cell indirect immunofluorescence, with the use of the whole blood staining method developed for use with the ORTHO SPECTRUM® II 1 flow cytometer (Ortho Diagnostic Systems, Inc., Raritan, NJ). Tissue reactivity of the MAb was determined by immunohistologic examination performed on frozen sections and 5- ⁇ sections cut from tissue embedded in Paraplast-II. Indirect immunofluorescence on frozen sections was performed as previously described, with MAb concentrations of 20 ⁇ g/ml (Pawlak-Byczkowska et al., Cancer Res 1989, 49:4568-77).
  • Immunoperoxidase staining of sections was performed with the avidin-biotin horseradish peroxidase complex method (Vector Laboratories, Burlingame, CA) according to the protocol suggested by the manufacturer, with MAb concentrations of 10 ⁇ g/ml.
  • mice Female athymic mice (nu/nu; Harlan, Indianapolis, IN) were given subcutaneous injections of 0.2 ml of a 10% suspension of GW-39, prepared from the tumor serially propagated in athymic mice. After 2 weeks, the mice were given intravenous injections of approximately 1 ⁇ g of 131 I-labeled NP-4 or MN-14. The animals were killed 7 and 14 days later; the organs were removed and radioactivity in the organs determined as described previously (Sharkey et al., Cancer Res 1990, 50:828s-34s).
  • MAb MN-3 and MN-6 reacted with MA, whereas MN-14 did not detect MA. All of the MAb-horseradish peroxidase probes were titrated with NP-1 -coated microwells charged with 25 ng/ml of CEA to obtain an absorbance of 0.6-0.8. Microwells coated with MN- 15 yielded results identical to those from microwells coated with NP-1. CEA and MA standards were sent as coded specimens to commercial laboratories performing the respective commercial assays.
  • ROCHE® CEA EIA would be specific for CEA because the ROCHE® assay uses MAb T86.44, a MAb that reacts with CEA but not with MA (Neumaier et al., J Immunol 1985, 135 :3604-09). Both the HYBRITECH® and ABBOTT® commercial CEA EIA demonstrated cross-reactivity with MA (not shown).
  • the affinity of radioiodinated MN-14 for CEA was 10 times that of NP-4 as determined by adding increasing amounts of CEA to fixed amounts of MAb and determining free versus bound antibody by high pressure liquid chromatography sizing gel analysis.
  • the 100 ng/ml of radioactive antibody used in this study to determine the affinity of the MAb approximates the serum concentration of antibody present in blood after infusion of 1 ⁇ g of antibody.
  • NP-4 and MN-14 The normal tissue reactivity of NP-4 and MN-14 was found to be identical, with both being unreactive with blood granulocytes, spleen, normal liver, and all other normal tissues except the colon (not shown). Staining of normal colon with both MAb was localized to the glycocalyx of the epithelial cells (not shown). Staining of sections of colorectal carcinoma from 10 different patients and of one lung carcinoma demonstrated identical staining patterns with the two MAb, but more intense staining was observed consistently with MN-14 (not shown).
  • MN-2 strongly stained CEA present in the section of colon carcinoma fixed in formaldehyde solution and embedded in Paraplast (not shown).
  • the pattern of MN-2 staining was similar to that observed with MN-3 and MN-14.
  • the microwells then were washed and the NP-4-horseradish peroxidase probe added, with and without 50 ⁇ g/ml of MN- 14. After incubation, the supernatants in the wells were decanted, the wells were washed, and the assay was completed. Binding of the NP-4 probe was inhibited by greater than 50%. No blocking of binding of the NP-3 probe was demonstrated under similar experimental conditions. Blocking of binding of the NP-3 probe was evaluated with the same protocol used above for NP-4. Both MN-3 and MN-6 blocked binding of the NP-3 probe to CEA.
  • NP-1 and MN-15 appeared to have similar properties, demonstrating high granulocyte reactivity, binding to epitopes of the ion-sensitive CEA determinant, and rapidly effecting capture of CEA from solution when coated on microwells (not shown).
  • NP-2 and MN-2 bind to the ion-sensitive determinant but differ from NP-1 in having much lower reactivity with blood granulocytes and reacting with a granulocyte antigen that was destroyed by conventional tissue processing used in histologic examination (not shown).
  • MN-3 reacted strongly with granulocytes but did not react with the ion-sensitive determinant (not shown).
  • NP-3, MN-6, NP-4, and MN-14 were not reactive with granulocytes or the ion sensitive determinant (not shown).
  • MN-14 meets all of the criteria of a Class III anti-CEA MAb, being unreactive with MA by EIA and not staining normal tissues, with the exception of normal colon.
  • This study adds support to the suggestion that a lack of reactivity with MA is the single most useful parameter for selecting Class III anti-CEA MAb. Blocking experiments alone can be misleading in the classification of CEA MAb, as is apparent from the extensive data published from the International Workshop on epitope reactivity of MAb reactive with CEA (Hammarstrom et al., Cancer Res 1989, 49:4852-58).
  • the Gold Group 1 constructed on the basis of cross-blocking of binding of MAb to CEA, contains Class I, II, and III MAb.
  • MN-14 The affinity of MN-14 is approximately 10-fold greater than that of NP-4, when determined with radioiodinated MAb and identical assay conditions to determine free versus antigen-bound antibody.
  • the affinity determined for NP-4 in this study was significantly lower than reported previously with l25 I-CEA in place of radiolabeled NP-4 (Primus et al., 1983).
  • MN-14 like NP-4 and T86.44, binds less than 50% of radioiodinated CEA. In the case of T86.44, the low binding of 125 I has been ascribed to damage of the T86.44-reactive epitope by radioiodination.
  • MN-3 strongly targets bone marrow granulocytes and is being investigated for radioimmunodetection of occult infection and inflammation.
  • MN-2 and M -6 demonstrated similar deficiencies in radioimmunodetection of CEA-containing cancers, as observed for NP-2 and NP-3.
  • 131 I-MN-2 targeted bone marrow, and l 31 I -MN-6 accreted in the lumen of the normal colon (unpublished results).
  • a second-generation panel of anti-carcinoembryonic antigen (anti-CEA) monoclonal antibodies (MAb) has been generated, and the specificity has been compared with that of the first panel of MAb used to differentiate meconium antigen (MA) from CEA.
  • MN- 15 like its first-generation equivalent, NP-1 , reacted with normal cross-reactive antigen (NCA), MA, and CEA. Both MN- 15 and NP-1 reacted strongly with granulocytes.
  • MN-2 had properties similar to Class II NP-2, being reactive with MA and CEA, cross-blocking binding to CEA by NP-1 , and having low reactivity with granulocytes. Both NP-2 and MN-2 stained granulocytes in frozen tissue sections but showed minimal staining of granulocytes in sections fixed in formaldehyde solution and embedded in Paraplast.
  • MN- 14 demonstrated properties similar to the Class III anti-CEA-specific MAb, NP-4, being unreactive with NCA and MA. MN- 14, as compared with NP-4, demonstrated significantly superior tumor targeting in a human colon tumor xenograft model and consistently stronger staining of frozen sections of colon cancer. A fifth MAb, MN-3, had properties uniquely different from the NP series of MAb, reacting strongly with granulocytes but not demonstrating the liquid-phase ion-sensitivity binding of CEA exhibited by MN-15 and NP-1.
  • murine MN-15 variable region sequences were attached to human IgG l constant region sequences, as described in Leung et al.,
  • FIG. 1 shows the results of a competitive binding study of murine vs. chimeric MN-15, competing with horseradish peroxidase (HRP) labeled murine MN-15.
  • HRP horseradish peroxidase
  • MN-3 (amino terminal) and MN-14 (A3-B3) antibodies which bind to different epitopes of CEA than MN-15 (A1B 1) did not compete for binding with HRP-labeled murine MN-15.
  • human variable FRs were selected based on sequence homology with their murine counterparts. The greatest homology was found with the human KOL V H and REI V K FRs. Oligonucleotides encoding murine MN-15 CDRs were grafted onto these heavy and light chain variable region domains, respectively.
  • the MN-15 CDR sequences included light chain CDR1 (SASSRVSYIH, SEQ ID NOT); CDR2 (GTSTLAS, SEQ ID NO:2); and CDR3 (QQWSYNPPT, SEQ ID NO:3); and heavy chain variable CDR1 (DYYMS, SEQ ID NO:4); CDR2 (FIANKANGHTTDYSPSVKG, SEQ ID NO:5); and CDR3
  • DMGIRWNFDV SEQ ID NO:6
  • the humanized variable region genes were cloned into expression vectors along side human IgGl constant region genes according to Orlandi et al., Proc. Nat'l Acad. Sci. USA 86: 3833 (1989).
  • FIG. 4 shows a comparison of the binding affinities of murine, chimeric and humanized MN-15, in competition with HRP-labeled murine MN-15.
  • the cMN-15 and hMN-15 constructs have virtually identical binding affinities for CEA with the parental murine MN-15 antibody, with dissociation constants in the nanomolar range.
  • Expression vector DNAs may be transfected into SP2/0 by electroporation.
  • Transfectomas secreting the various versions of chimeric or humanized MN-15 are selected and analyzed.
  • the cell line is grown in a 16-liter stirred tank bioreactor system (Sulzer-Chemtech, Woodbury, NY).
  • the culture medium is continuously harvested from the bioreactor through a 0.2 um tangential flow microfiltration hollow fiber unit.
  • the filtered harvest is collected continuously into a 50-liter reservoir, stored at 4°C, from which the medium stream is pumped to a protein-A column to collect the antibody from the product stream.
  • the harvested antibody is purified by a second pass through a protein-A column and, finally, Q- Sepharose (Pharmacia, Inc., Piscatway, NJ).
  • Example 3 Inhibition of Adhesion, Invasion and Metastasis by Antibodies Targeting CEACAM6 (NCA-90) and CEACAM5 (CEA)
  • CEACAM5 and CEACAM6 are overexpressed in many cancers and are associated with adhesion and invasion.
  • the effects of three monoclonal antibodies targeting different epitopes on these antigens (NH 2 -terminal [MN-3] and A1B 1 domains [MN- 15] shared by CEACAM5 and CEACAM6 and the A3B3 domain [MN-14] restricted to CEACAM5) were evaluated in migration, invasion, and adhesion assays in vitro using a panel of human pancreatic, breast, and colonic cancer cell lines, and in the GW-39 human colonic micrometastasis model in vivo.
  • MN- 3 Fab' and MN- 15 Fab' were both effective at inhibiting cell migration.
  • MN-15 Fab' treatment inhibited invasion, reducing cell penetration through an extracellular matrix (ECM).
  • ECM extracellular matrix
  • MN-3 Fab' also decreased invasion but was less effective than MN-15 Fab' in four of five cell lines. All three monoclonal antibody Fabs decreased adhesion of tumor cells to endothelial cells by 49% to 58%.
  • MN- 15 Fab' but not MN-3 or MN-14 Fabs induced a decrease in adhesion of three of six cell lines to the ECM protein, fibronectin, but adhesion to vitronectin, laminin, collagen-I, and collagen-IV was not affected.
  • the eradication of metastatic disease is crucial for achieving survival in most patients with cancer.
  • the metastatic process consists of a series of sequential steps, including invasion of extracellular matrix (ECM), extravasation into vessels, transport in the circulation, adhesion to endothelial cells in a new tissue, extravasation through the vessel wall, and migration and proliferation in response to organ-specific factors at the new site (Fidler, Cancer Res 1990, 50:6130-8).
  • ECM extracellular matrix
  • extravasation into vessels transport in the circulation
  • adhesion to endothelial cells in a new tissue extravasation through the vessel wall
  • migration and proliferation in response to organ-specific factors at the new site
  • Carcinoembryonic antigen (CEA, CEACAM5, and CD66e) is expressed on many cancers (Goldenberg et al., J Natl Cancer Inst 1976, 57: 1 1-22; Gold & Goldenberg, McGill J Med 1997, 3:46-66; Hammarstrom, Semin Cancer Biol 1999, 9:67-81) and has been implicated with malignancy, particularly enhanced metastasis (Yoshioka et al., Jpn J Cancer Res 1998, 89: 177-85; Hashino et al., Clin Exp Metastasis 1994, 12:324-28).
  • CEACAM5 functions as a chemoattractant and as an adhesion molecule (Kim et al., Int J Cancer 1999, 82:880-85), and has been reported to promote the metastatic potential in some experimental tumors (Minami et al., Cancer Res 2001 , 61 :2732-5).
  • CEACAM5 has been shown to be involved in both homophilic (CEACAM5 to CEACAM5) binding between the N domains of antiparallel CEACAM5 molecules on opposite cell surfaces and heterophilic binding (CEACAM5 binding to non-CEACAM5 molecules).
  • Nonspecific cross-reacting antigen (NCA-90, CEACAM6, and CD66c) is a member of the CEA family that is also expressed on many human cancers (Kuroki et al., Anticancer Res 1999, 19:5599-606).
  • CEACAM6 in tumors correlates inversely with cellular differentiation (Ilantzis et al., Neoplasia 2002, 4: 151-63) and is an independent prognostic factor associated with a higher risk of colorectal cancer relapse (Jantscheff et al., J Clin Oncol 2003, 21 :3638- 46).
  • CEACAM6 is also an important protein associated with cell adhesion; its expression on neutrophils is involved in adhesion to cytokine-activated endothelial cells (Kuijpers et al., J Cell Biol 1992, 1 18:457-66). This molecule exhibits homotypic and heterotypic interactions with other members of the CEA family and with integrin receptors. Antibodies targeting the N domain interfere with cell-cell interactions (Yamanka et al., Biochem Biophys Res Commun 1996, 219:842-7).
  • CEACAM6 Silencing the CEACAM6 gene by small interfering RNA enhances cell anoikis, increases caspase activation in response to anchorage-independent conditions, down-regulates the Akt cell survival pathway, and inhibits metastasis in vivo (Duxbury et al, Cancer Res 2004, 64:3987- 93). Expression of this membrane protein is also associated with increased invasiveness through a c-src-dependent mechanism (Duxbury et al., Br J Cancer 2004, 91 : 1384-90). Thus, CEACAM6 may represent a therapeutic target to control malignancy and/or metastasis.
  • Binding peptides have been developed to these regions in an effort to block adhesion (Taheri et al., J Biol Chem 2003, 278: 14632-9).
  • the concentration of peptide required to block cell aggregation was 1 mg/mL or a 25-fold higher molar concentration than the complete antibody, despite the predicted greater penetration of a smaller peptide. This inefficient dose requirement could be due to instability of the small peptide or due to its low affinity.
  • monovalent antibody fragments would be a more effective approach for targeting these domains, because stability of the MAb will likely be greater and the affinity higher than corresponding peptides.
  • Antibody production - MN-15 binds to the A1B 1 domain (Gold group 4) and MN-3 binds to the N domain (Gold group 5) found on both CEACAM5 and CEACAM6, while MN- 14 binds to the A3B3 domain (Gold group 3) only found on CEACAM5 (FIG. 5).
  • MN-3 and MN-15 were used as murine MAbs, whereas MN-14 was included in its humanized form, hMN- 14 or labetuzumab (Sharkey et al., Cancer Res 1995, 55:5935-45).
  • FBS fetal bovine serum
  • Viability was determined by trypan blue exclusion.
  • CEACAM5 and CEACAM6 expression - Cells were harvested from culture and aliquoted into FACSCANTM tubes containing 2 mL Dulbecco's PBS with 0.2% sodium azide and 1 % appropriate blocking serum. Cells were incubated with 10 ⁇ g/mL of hMN-14 anti- CEACAM5 in PBS (+ NaN 3 + 1% blocking serum) for 1 hour on ice, pelleted (1 ,440 rpm x 5 minutes), and supernatant decanted. Some tubes were then incubated with 10 ⁇ g/mL murine MN-15 IgG or MN-3 IgG (to determine CEACAM6 expression) for 1 hour on ice and pelleted.
  • FITC-goat-anti-human for CEACAM5 determination and FITC-goat-anti-mouse for CEACAM6 determination was added (1 :500 secondary antibody in PBS + NaN 3 + 1% blocking serum) for 30 minutes on ice in the dark. Cells were pelleted, washed twice with 2 mL ice-cold PBS + NaN 3 , and resuspended in 1.5% paraformaldehyde. Fluorescence was read on a flow cytometer.
  • CEACAM5 and CEACAM6 expression on GW-39 tumor xenografts was determined by immunohistochemistry using a similar approach of hMN-14 followed by biotinylated GAH to detect CEACAM5 and preincubation with hMN-14 followed by mMN-15 or mMN-3 and biotinylated GAM second antibody to detect CEACAM6 on paraffin sections.
  • Endothelial cell adhesion assay Human umbilical vein endothelial cells (HUVEC; Cambrex, San Diego, CA.) were grown in collagen-coated dishes in EGM Media in a humidified atmosphere with 5% C0 2 at 37°C.
  • IL-1B Interleukin-16
  • BSA bovine serum albumin
  • Tumor cells (1 x 10 6 cells/mL) prelabeled overnight with 3 H- thymidine (100 ⁇ per well using 1.0 ⁇ /mL) were added to HUVEC cultures and incubated for 30 minutes at 37°C with rotation in medium with 20% FBS. Samples were washed thrice with PBS to remove unattached cells. Attached cells were solubilized with 0.1 N NaOH and radioactivity was measured in a B scintillation counter. The cpm attached/total cpm added (attaching potential) was determined.
  • Adhesion to extracellular matrix proteins assay was done using the CYTOMATRIXTM screening kit from CHEMICON® (Kit #ECM205, Temecula, CA). The kit contains 96-well plates with strips coated with fibronectin, vitronectin, laminin, collagen-I, or collagen-IV. Subconfluent cell cultures were used for these studies. Cells (1 x 10 6 cells/mL) were seeded onto coated substrate and incubated at 37°C for 1 hour in a C0 2 incubator in PBS containing Ca 2+ /Mg 2+ (200 ⁇ per well). Adherent cells were fixed and stained.
  • the plate was washed to remove unadhered cells and stained with 100 ⁇ ⁇ per well of MTS (Cell Titer Aq 96, PROMEGA®, Madison, WI) for 5 minutes at room temperature. Excess stain was removed with three PBS washes. Solubilization buffer [100 ⁇ of a 50:50 mixture of 0.1 mol/L NaH 2 PQ"4 (pH 4.5) and 50% ethanol] was added to each well. Relative attachment was determined using absorbance readings ( 540 - ⁇ 570 nm)-
  • Collagen-based invasion assay The assay was done using CHEMICON® Kit (#ECM551, MILLIPORE®, Billerica, MA). Tumor cells at 80% confluence and were serum- starved for 18 to 24 hours before the assay was used. Cells were harvested with 5 mL of 2 mmol/L EDT A/PBS per 100-mm dish and incubated at 37°C for 5 to 15 minutes. Cells were collected into 10 to 20 mL of quenching medium (serum-free DMEM containing 5% BSA) to inactivate trypsin/EDTA from the harvesting buffer.
  • quenching medium serum-free DMEM containing 5% BSA
  • Cells were pelleted, resuspended in quenching medium (1 x 10 6 cells/mL), and appropriate antibody Fabs were added to individual cell aliquots.
  • Cell invasion potential was determined as follows. Baseline invasion and invasion in the presence of a chemoattractant (10% FBS) were measured after a 72-hour incubation period at 37°C in a 5% C0 2 incubator. The bottom side of the collagen-coated polycarbonate membrane insert of the invasion chamber was placed in 400 iL of cell stain for 20 minutes at room temperature and washed. The dye was extracted and transferred into a 96- well microtiter plate for colorimetric measurements ( ⁇ 560 nm)-
  • CEACAM5+/CEACAM6+ GW-39 intrapulmonary micrometastasis model GW-39iv (Sharkey et al., J Natl Cancer Inst 1991 , 83 :627-32; Blumenthal et al., Cancer Res 1992, 52:6036-44).
  • the GW-39 human colonic carcinoma has been maintained as a serially transplanted signet-ring cell cancer line since 1966 (Goldenberg et al., Transplantation 1966, 4:760 ⁇ 1).
  • Stock s.c. GW- 39 tumors grown in nude mice were used to prepare a 10% cell suspension. Cells (30 iL) were injected i.v. into the caudal vein of 5- to 6-week-old female nude mice.
  • mice were pretreated with antibody in vitro (10 ⁇ g/mL) before implantation, and then mice were given one additional dose ( 100 ⁇ g per mouse i.v.) 1 day after implantation. Body weight was monitored weekly and animal survival recorded. Results were analyzed by the Kaplan-Meier estimated survival curves, and significance was determined with the log-rank comparison of survival curves. Median survival time for each treatment group also was determined. All studies used 10 mice per treatment group.
  • CEACAM5 and CEACAM6 expression in cell lines - Flow cytometric analysis of CEACAM5 and CEACAM6 expression in a panel of 31 to 33 commonly used solid tumor cell lines revealed that only 6 of 29 (20.7%) expressed significant amounts of CEACAM5, whereas 16 of 30 (53.3%o) lines were positive for CEACAM6 (Table 1).
  • Two cancer cell lines were CEACAM5+/CEACAM6- (Moser and LNCAP), four were CEACAM5+/CEACAM6+, and 12 were CEACAM5-/CEANCAM6+.
  • the CEACAM6+ cell lines included 7 of 10 breast cancers, one of four ovarian cancers, three of four colon cancers, three of four pancreatic cancers, one of six prostate cancers, and two of four non-small cell lung cancer lines. Many of these tumor lines had >95% of cells expressing the CEACAM6 antigen and, in some cases, expression was very high (MCF of 641 for ZR75-30, 702 for BXPC3, and 476 for CaPAN-1 ). In contrast, the most positive CEACAM5-expressing lines had ⁇ 60% of cells expressing the antigen, with a MCF ⁇ 120.
  • LS 174T and HT-29 cells showed the most migratory activity, whereas ZR75-30, MCF-7, and BXPC3 cells showed very little migration (results not shown).
  • MN-3 and MN-15 intact IgG and Fab' all reduced migration in both cell lines.
  • both antibodies reduced endothelial cell binding of MC A38cea (a human CEA-transfected line) from 1 1.68 ⁇ 0.77% to 6.42 ⁇ 2.1% (MN-3) and 5.53 ⁇ 1.15% (MN-15), being significant (P ⁇ 0.05) for both Fabs (FIG. 6).
  • Both antibodies induced a 49% to 58% adhesion-inhibition in four other cell lines (P ⁇ 0.01 for MN-3 Fab' on MCF-7, HT-29, and BT-20; P ⁇ 0.02 for MN-15 on the same three lines; and P ⁇ 0.05 for both Fabs on Moser cell adhesion to endothelial cells, FIG. 6).
  • An isotype-matched irrelevant antibody Fab' (Ag8) did not affect tumor cell-endothelial cell adhesion nor did the MN-14 anti-CEA Fab'.
  • the magnitude of the anti-adhesion effect did not seem strictly correlated with the amount of CEACAM5 or CEACAM6 expressed, because MN-15 Fab' resulted in a greater decrease in adhesion in HT-29 cells (48%) than with MCF-7 cells (41%) that express much more CEACAM6.
  • MN-15 IgG decreased adhesion of MCF-7, MDA- 468, and CaPAN-1 to fibronectin by 29% (P ⁇ 0.01 ), 51% (P ⁇ 0.001), and 47% (P ⁇ 0.02), respectively, while not affecting the binding of ZR75-30, BXPC3, or Moser to fibronectin.
  • Two of these three MAb-unresponsive cell lines had the lowest baseline adhesion to fibronectin.
  • both the intact IgG and the monovalent Fab' for a given antibody were equally effective.
  • MN-15 Fab' reduced cell invasion of LS174T, MCF-7, ZR75-30, BXPC3, and CaPAN-1 cells by 30% (P ⁇ 0.02), 77% (P ⁇ 0.01 ), 49% (P ⁇ 0.01), 44% (P ⁇ 0.01), and 73% (P ⁇ 0.002), respectively.
  • the A1B 1 domain of CEACAM6 seems to be a more important target than the N domain for the process of tumor cell invasion.
  • mice were near death, rather than sacrificing them at a defined time after treatment and counting the number of lung nodules, median survival time should correlate with amount of lung metastatic disease.
  • a long-term goal of immunotherapy has been to induce antitumor responses against tumor-related antigens.
  • Antibodies that directly perturb signaling mechanisms have shown clinical benefit, such as those directed against the extracellular domains of HER-2/neu, epidermal growth factor receptor, and CD20 (Weiner & Adams, Oncogene 2000, 19:6144-51 ; Alas et al., Cancer Res 2001 , 61 :5137-44).
  • the studies presented herein suggest that instead of being directly therapeutic by immune effector or direct cytostatic mechanisms, MAbs against CEACAM6 inhibit migration, invasion, and adhesion, thereby limiting metastasis.
  • the monovalent Fab' form was used for most of our studies to avoid effector cell function from the Fc region of the MAb and focus on mechanisms implicated in the metastatic process.
  • CEACAM5 is overexpressed in a majority of carcinomas, including those of the gastrointestinal, respiratory and genitourinary systems, and the breast.
  • CEACAM6 may be as good, if not better, as a target for solid tumor antimetastatic therapy.
  • CEACAM6 is expressed in a larger percentage of solid tumor cell lines than CEAC AM5, and the high MCF on many of these lines suggests that more anti-CEACAM6 MAb can be delivered to these tumor cells.
  • the MN- 15 and MN-3 MAbs are useful for tumors that express CEACAM6 or CEACAM5, because they target epitopes that are shared by both antigens.
  • MAbs may therefore have advantages over MAbs like M -14, which only target CEACAM5, or MAbs that are specific for only CEACAM6 and do not cross-react with CEACAM5.
  • Our data are consistent with previous reports that showed a relatively high level of CEACAM6 in the sera of a large number of lung, liver, pancreatic, breast, and colorectal cancer patients (Kuroki et al., Anticancer Res 1999, 19:5599-606).
  • some patients were CEACAM5-/CEACAM6+, further suggesting that CEACAM6 might be a useful independent target.
  • CEACAM6 is expressed on the surface of neutrophils, thus modulating adherence to endothelial-leukocyte adhesion molecule-1 on activated endothelial cells (Kuijpers et al., J Cell Biol 1992, 1 18:457-66).
  • MAbs to different epitopes on CEACAM6 N and A1B 1 domains
  • CEACAM5 can affect cell adhesion to endothelial cells (Gangopadhyay et al.
  • Tumor cells can adhere to other tumor cells, to endothelial cells, as well as to ECM proteins. We have found that the amount of adhesion to a panel of these proteins varied between cell lines and was not related to the type of tumor (e.g., breast and pancreatic) or to the amount of CEACAM5 or CEACAM6 expressed. Tumor cell interactions with ECM proteins are important for migration and invasion and therefore metastasis. For example, tumor cell interactions with fibronectin are involved in the development of secondary tumors inside the bone marrow stroma via the ⁇ 5 ⁇ 1 integrin (Van der Velde-Zimmermann et al., Exp Cell Res 1997, 230: 1 1 1-20).
  • MAbs targeting the N or A3B3 domain did not affect cell adhesion to fibronectin.
  • MAb- mediated CEACAM6 cross-linking resulted in increased ECM adhesion.
  • the targeted epitope was different from the ones studied here.
  • MN-15 or MN-3 MAb therapy compared with our previously reported results with MN-14 anti-CEA IgG (Blumenthal et al, Cancer Immunol Immunother 2005, 54:315-27), is the ability to target tumors that express either CEACAM6, CEACAM5, or both, whereas MN-14 can only be used for CEACAM5+ tumors.
  • MN-14 can only be used for CEACAM5+ tumors.
  • Table 1 many solid tumor lines express CEACAM6 but not CEACAM5 or express more CEACAM6 than CEACAM5. These tumor types are candidates for metastasis-directed MAb therapy with CEACAM6 MAbs.
  • anti-CEACAM5/CEACAM6 MAbs would be available continuously, perhaps using implantable pumps, to maintain a desired level in the circulation.
  • the anti-metastasis and MAb inhibition of adhesion, invasion, and migration is a technology that should be relatively nontoxic, not limited by issues of drug resistance, and easy to apply as an adjuvant with other standard and/or experimental therapy approaches.
  • CEACAM6 is also expressed in normal lung, spleen, and granulocytes (Grunert et al., Int J Cancer 1995, 63 :349-55)
  • the effect of anti-CEACAM6 MAb on normal tissues is one consideration for therapeutic use.
  • CEACAM6-targeted immunotoxin therapy was effective in a tumor-bearing nude mouse model (Duxbury et al., Biochem Biophys Res Commun 2004, 317:837—43), but this model does not express CEACAM6 on normal tissues.
  • anti-CEACAM6/CEACAM5 MAb fragments devoid of effector cell functions and targeting the N and A1B 1 domains of these antigens block migration, adhesion to endothelial cells and ECM, and invasion, and also increase the median survival of mice with intrapulmonary micrometastases of human colonic cancer.
  • antibodies against CEACAM5 and CEACAM6, such as MN-15, may be efficacious in human cancer therapy.
  • CEACAM6 NCA-90
  • CEACAM5 carcinoembryonic antigen, CEA
  • Antigen expression was determined by immunohistochemistry (IHC) using tissue microarrays with MN-15 and MN-3 antibodies targeting the A1B 1- and N-domains of
  • CEACAM6 respectively, and the MN-14 antibody targeting the A3B3 domain of CEACAM5.
  • CEACAM6 For all tumors, the amount of CEACAM6 expressed was greater than that of CEACAM5, and reflected tumor histotype.
  • CEACAM6 expression was similar in prostate cancer and normal tissues. The amount of CEACAM6 in metastatic colon tumors found in liver was higher than in many primary colon tumors. In contrast, CEACAM6 immunostaining of lymph node metastases from breast, colon, or lung tumors was similar to the primary tumor.
  • CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. Based on previous work demonstrating a role for CEACAM6 in tumor cell migration, invasion and adhesion, and formation of distant metastases (Blumenthal et al., Cancer Res 65: 8809-8817, 2005), it may be an important target for antibody-based therapy.
  • CEA human carcinoembryonic antigen family
  • the CEACAM5 gene also known as CD66e, codes for the protein, CEA (Beauchemin et al., Exp Cell Res. 1999, 252:243-249).
  • CEACAM5 was first described in 1965 as a gastrointestinal oncofetal antigen (Gold & Freedman, J Exp Med.
  • CEACAM6 also called CD66c or NCA-90
  • CEACAM5 is a non-specific cross-reacting glycoprotein antigen that shares some antigenic determinants with CEACAM5 (Kuroki et al., Biochem Biophys Res Comm.
  • CEACAM6 also is expressed on granulocytes and epithelia from various organs, and has a broader expression zone in proliferating cells of hyperplastic colonic polyps and adenomas, compared with normal mucosa (Scholzelet al., Am J Pathol. 2000, 157: 1051-1052), as well as by many human cancers (Kuwkiet a ⁇ ., Anticancer Res. 1999, 19:5599-5606; Hinoda et al. J Gastroenterol. 1997, 32:200- 205). Relatively high serum levels of CEACAM6 are found in patients with lung, pancreatic, breast, colorectal, and hepatocellular carcinomas. The amount of CEACAM6 does not correlate with the amount of CEACAM5 expressed (Kuroki et al., Anticancer Res. 1999, 19:5599-5606).
  • CEACAM6 in colorectal cancer correlates inversely with cellular differentiation (Ilantzis et al., Neoplasia. 2002, 4: 151-163) and is an independent prognostic factor associated with a higher risk of relapse (Jantscheff et al., J Clin Oncol. 2003, 21 :3638- 3646). Both CEACAM5 and CEACAM6 have a role in cell adhesion, invasion and metastasis, as discussed in Example 3. The present study used tissue microarray analysis to compare the relative expression of CEACAM5 and CEACAM6 in different histotypes of solid tumors, and compared expression between primary sites and matched metastases in the same patients.
  • MN-15 binds to the A1 B 1 -domain and MN-3 binds to the N-domain found on both CEACAM5 and CEACAM6. MN-14 binds to the A3B3 domain only found on CEACAM5. These antibodies have similar affinities for their target antigens (Hansen et al., Cancer. 1993, 71 :3478-3485). MN-3 and MN-15 were used as murine MAbs, while MN-14 was included in its humanized form, hMN-14 (labetuzumab).
  • Tissue microarravs - ACCUMAXTM tissue arrays were from ISU ABXIS® (Seoul, Korea). The following arrays were used: Breast A202 (II), colon with matching liver metastases A203 (II), lung A206, pancreatic A207, prostate A208, and ovary A213. Additional breast BR1001, colorectal C0991, and lung LC810 arrays of matching primary tumor and lymph node metastases were purchased from US Biomax, Inc. (Rockville, MD). All arrays consisted of duplicate cancer tissue cores of varying histotypes and four non-neoplastic corresponding samples on each slide. There were 45 breast, 40 lung, 26 pancreatic, 40 prostate, and 45 ovarian cancer specimens.
  • metastasis arrays consisted of the following matched cases: 18 normal colon, primary colon cancer and liver metastases, 38 breast and lymph node metastases, 33 colon and lymph node metastases, and 37 lung and lymph node metastases.
  • the first and second scores were then added together resulting in a maximum staining score of 8 for any tissue core.
  • Two independent blinded investigators performed IHC analysis and results were strongly consistent between the two readings. Results were recorded as the mean ⁇ standard deviation for each group.
  • the highest CEACAM6 expression was found in papillary (6.0 ⁇ 2.1) > infiltrating ductal (5.1 ⁇ 2.5) > lobular (4.0 ⁇ 0.8) > phyllodes (2.0 ⁇ 1.0). The differences between papillary and lobular breast cancers were significant at the P ⁇ 0.01 level. The highest CEACAM5 expression was found in papillary samples (1.4 ⁇ 1.4), but was not statistically different from infiltrating ductal or lobular samples. Pyllodes breast cancer is a stromal tumor, usually benign, and should therefore not express CEACAM5 or CEACAM6.
  • CEACAM5 and CEACAM6 expression was assessed in 6 different lung cancers: 5 each of well, moderately and poorly differentiated adenocarcinoma, 5 each of well, moderately and poorly differentiated squamous carcinoma, 3 each of large cell and bronchioalveolar, and 2 each of large cell neuroendocrine and small cell cancer.
  • adenocarcinoma expressed more CEACAM6 than squamous cancer (P ⁇ 0.001).
  • the highest CEACAM6 expression was found in moderately-differentiated adenocarcinoma (7.8 ⁇ 0.4) > well-differentiated
  • adenocarcinoma (6.8 ⁇ 1.0) > small-cell (5.5 ⁇ 0.7) > well-differentiated squamous (5.2 ⁇ 1.0) > moderately-differentiated squamous cancer (4.9 ⁇ 1.1).
  • the highest expression of CEACAM5 was in small-cell lung cancer specimens (5.5 ⁇ 0.7), followed by large-cell neuroendocrine tumors (4.75 ⁇ 3.18).
  • Pancreatic cancer has been the most extensively studied neoplasm with respect to CEACAM6 expression.
  • CEACAM5 and CEACAM6 in pancreatic cancer as a function of tumor cell differentiation.
  • One well-differentiated, 3 well-moderately differentiated, 13 moderately-differentiated, 2 moderately- to poorly-differentiated, and 7 poorly-differentiated tumor cores were studied.
  • CEACAM6 expression did not correlate with disease stage.
  • CEACAM5 expression was lower than CEACAM6 for all histotypes; the highest expression being found in moderately differentiated tumors (4.0 ⁇ 1.4) and the least in the moderate-poor (0.92 ⁇ 1.92) and poorly-differentiated (1.4 ⁇ 1.5) tumors. Only the moderately and the well-moderately differentiated tumors expressed significantly more CEACAM5 than non-neoplastic tissues (P ⁇ 0.002 and P ⁇ 0.005, respectively).
  • ovarian cancer types were studied: 5 each of serous adenocarcinoma, mucinous adenocarcinoma, clear cell carcinoma, and transitional cell carcinoma; 4 each of endometrioid adenocarcinoma and Brenner tumor; and 3 each of yolk sac tumor, granulosa cell tumor, and dysgerminoma.
  • the amount of CEACAM6 in ovarian cancer was highest in mucinous adenocarcinoma (5.6 ⁇ 1.7) > transitional cell (3.8 ⁇ 1.6) > endometrioid (3.6 ⁇ 2.8) > clear cell (3.4 ⁇ 1.8) > yolk sac tumors (2.5 ⁇ 0.5).
  • CEACAM5 levels were significantly higher than all other histotypes (P ⁇ 0.002 compared with endometroid and Brenner tumors, and P ⁇ 0.001 compared with serous, clear cell, transitional and yolk sac).
  • CEACAM6 Much larger amounts of CEACAM6 were found in colon adenocarcinoma (6.2 ⁇ 1.4) compared with non-neoplastic colon (3.0 ⁇ 0.0; P ⁇ 0.002) and CEACAM6 expression exceeded CEACAM5 expression (3.4 ⁇ 0.5; P ⁇ 0.001).
  • CEACAM5 and CEACAM6 are two tumor-associated antigens that play important regulatory roles in cell adhesion and in tumor cell chemosensitivity (Glinsky, Cancer Metastasis Rev. 1998, 17: 177-186; Kraus et al., Oncogene. 2002, 21 :8683-8695; Zhou et al., Cancer Res. 1993, 53 :3817-3822).
  • CEACAM6 overexpression independently predicts poor overall survival and poor disease-free survival, whereas CEACAM5 has not been related significantly to these outcomes (Jantscheff et al., Vol. 37. Eur J Cancer, 2001, 37:S290).
  • CEACAM5 affects expression of various groups of cancer- related genes, especially cell cycle and apoptotic genes, protecting colonic tumor cells from various apoptotic stimuli, such as treatment with 5-fluorouracil (Soeth et al., Clin Cancer Res. 2001 , 7:2022-2030). Therefore, CEACAM5 expression may be a means for cancer cells to overcome apoptosis-inducing therapies. Ordonez et al. have reported that expression of both CEACAM5 and CEACAM6 plays a role in inhibiting apoptosis of cells when deprived of their anchorage to the extracellular matrix, a process known as anoikis (Ordonez et al., Cancer Res. 2000, 60:3419-3424). Increased expression of CEACAM6 correlates with a decrease in sensitivity to drugs, like gemcitabine (Duxbury et al., Cancer Res. 2004, 64:3987-3993).
  • CEACAM5 and/or CEACAM6 may therefore be a novel method of modulating cancer cell chemosensitivity and apoptosis. It has been reported that siRNA to CEACAM6 impairs resistance to anoikis and increases caspase-mediated apoptosis of xenografted tumors (Duxbury et al., Oncogene. 2004, 23 :465-473). Antibody-directed targeting of CEACAM6 may provide a clinically feasible alternative to RNA interference silencing to enhance responsiveness to chemotherapeutic agents in those tumors that express CEACAM6.
  • Our results show that expression is strongly dependent on the histotype of the tumor. Antigen expression in some subtypes is 2-4-fold higher than in normal tissues, while in others, expression is similar to non-neoplastic tissues.
  • VEGF-C and VEGF-D induced lymphogenesis appear to be regulated by VEGF-C and VEGF-D induced lymphogenesis (Detmar & Hirakawa, J Exp Med. 2002, 196:713-718) and a chemokine gradient.
  • Directional movement is related to chemokine receptor expression on tumor cells ( athanson, Cancer. 2003, 98:413- ⁇ 423), but does not involve members of the CEACAM family.
  • CEACAM6 plays an important role in migration, invasion and adhesion (Duxbury et al, Oncogene. 2004, 23 :465-473), steps that are important in the metastatic spread to secondary tissue sites other than lymph nodes.
  • Anti-adhesive molecules that disrupt cell-matrix and cell- cell attachments have been proposed as potential cancer therapeutics based on their ability to interfere with motility, adhesion, and metastatic progression (Blumenthal et al., Cancer Res. 2005, 65:8809-8817; Glinsky, Cancer Metastasis Rev. 1998, 17: 177-186; Kerbel et al., Bulletin de l'institut Pasteur. 1995, 92:248-256).
  • CEACAM6 may also be a useful therapeutic target.
  • Blocking CEACAM6-mediated homotypic and/or heterotypic adhesion may have anti -metastatic and chemosensitizing effects.
  • An alternative approach is to develop an anti-CEACAM6 immunoconjugate as a therapeutic agent for CEACAM6+ tumors (Duxbury et al. Biochem Biophys Res Comm. 2004, 3 17:837-843).
  • CEACAM6 may be a more promising target for antibody-based anti -metastatic and chemosensitizing therapy than CEACAM5 in the solid tumors studied.
  • CEACAM6 may be a useful antigen to target in select subtypes of solid tumors. In colonic cancer, CEACAM6 may play an important role in the development of distant metastases.
  • Example 5 In Vivo Effect of Pretreatment with an Immunomodulator Prior to Treatment With hMN-15 and CPT-11 on Tumor Cell Chemosensitivity
  • GW-39 human colon cancer is grown subcutaneously in a mouse that receives 100,000 units of IFN-gamma twice a day for 4 days. A control mouse with GW-39 tumor is not given IFN.
  • Experimental mice are injected i.v. with a 5% suspension of GW-39 (w/v) from either of the two mice (i.e., with or without IFN treatment) into two groups of eight. Four of each receive tumor from the IFN-treated mice and four from the untreated mice.
  • an irrelvant IgG such as Ag8
  • JR is a 62-year-old man who is refractive to chemotherapy with 5-fluorouracil and leucovorin to reduce his metastases to the liver found at the time of removal of his sigmoid colon cancer.
  • His plasma titer of carcinoembryonic antigen (CEA) at presentation is 34 ng/mL, and computed tomography of the liver shows several small lesions measuring between 2 and 4 cm in diameter in the right lobe. Other radiological studies appear to be normal.
  • Immunotherapy with humanized anti-CEA IgG (hMN-15) monoclonal antibody is begun on a weekly basis for 4 weeks, at an intravenous dose of 300 mg/m 2 infused over 2 hours.
  • the patient receives 2 subcutaneous injections of 200 ⁇ g/m 2 GM-CSF, 3 days apart, and continued twice weekly during the 4 weeks of hMN-15 therapy.
  • both hMN-15 and GM-CSF are given at the same doses every other week for an additional 3 months, but the dose of GM-CSF is increased to 250 ⁇ g/m 2 .
  • diphenhydramine 50 mg orally
  • acetaminophen 500 mg orally
  • the patient is restaged, with CT measurements made of the liver metastases and diverse radiological scans of the rest of the body. Blood is also taken for chemistries and for determination of his blood CEA titer. No areas of disease outside of the liver are noted, but the sum of the diameters of the measurable tumors in the liver appear to decrease by 40 percent, and the patient's blood CEA titer decreases to 18 ng/mL, thus indicating a therapeutic response.
  • Immunotherapy with hMN-15 and GM-CSF are administered for another 2 months, and restaging shows additional decrease in the sum of the diameters of the liver tumors and a fall in the CEA titer to 10 ng/mL. Since tumor decrease is measured as being >65% over the pre-therapy baseline, the therapy is considered to have provided a partial response. After this, the doses are made less frequent, once every month for the next six months, and all studies indicate no change in disease. The patient is then followed for another 10 months, and remains in a partial remission, with no adverse reactions to the therapy, and generally without any symptoms of disease.
  • ST is a 52-year-old woman presenting with liver and lung metastases of colon cancer following resection of the primary tumor. She is placed on a combined chemotherapy and immunotherapy protocol based on the Gramont schedule (de Gramont et al, J Clin Oncol. 2000, 18:2938-47), but with the addition of humanized anti-CEA monoclonal antibody IgGi (hMN- 15). Prior to infusions of the antibody, she receives 50 mg orally of diphenhydramine and 500 mg orally of acetaminophen.
  • She receives a 2-hr infusion of leucovorin (200 mg m 2 /day) followed by a bolus of 5-fluorouracil (400 mg/m 2 /day) and 22-hour continuous infusion of 5- fluorouracil (600 mg/m 2 /day) for 2 consecutive days every 2 weeks, together with oxaliplatin at 85 mg/m 2 as a 2-hr infusion in 250 mL of dextrose 5%, concurrent with leukovorin on day 1 (FOLFOX4 schedule).
  • the patient also receives anti-emetic prophylaxis with a 5- hydroxyltryptamine-3-receptor antagonist.
  • hMN-15 monoclonal anti-CEA antibody is infused over 2 hrs at a dose of 200 mg m 2 , and repeated each week of the 2-week chemotherapy cycle, and every week thereafter for the next month with another chemotherapy cycle.
  • a subcutaneous dose of 5 ⁇ g/kg/day of G-CSF is administered once weekly beginning with the second chemotherapy cycle, and continued at this dose for the duration of immunotherapy with hMN- 15 antibody, over the next 3 months.
  • hMN-15 antibody and filgrastim therapy is given, at the same doses, every other week for the next 3 months, without chemotherapy.
  • the patient is staged 2 months later, and her liver and lung metastases show shrinkage by computed tomography measurements of >80 percent of disease measured in the liver and lungs, as compared to the measurements made prior to therapy.
  • Her blood CEA titer also shows a drop from the pre-therapy level of 63 ng/niL to 9 ng/n L. She is followed over the next 6 months, and her disease appears to be stable, with no new lesions found and no increase in the disease remaining in the liver and lungs.
  • peripheral sensory neuropathy which consists of laryngeopharyngeal dysesthesia.
  • the patient also experiences diarrhea, mucositis, nausea and vomiting during the chemotherapy cycles, but these are not excessive. She does not experience any adverse events when only immunotherapy is administered, and is able to return to full-time activities without any significant restrictions.
  • hMN-15 is administered 3 days prior to CPT-1 1 produces a median survival time increase of an additional 58% above CPT-1 1 alone.
  • Pre-treatment with hMN-15 significantly prolongs survival of animals with low tumor burden in a metastatic model of human breast cancer.
  • the synergistic effect of hMN-15 antibody with CPT-1 1 therapy is surprising.
  • Antibodies are injected i.v., via the lateral tail vein, into the tumor-bearing animals. Tumor size is monitored by weekly measurements of the length, width, and depth of the tumor using a caliper. Tumor volume is calculated as the product of the three measurements.
  • TT bearing nude mice are given DTIC (75 ⁇ g/dose) in combination with a course of treatment of the unlabeled MAb.
  • DTIC is administered for 3 consecutive days at 75 ⁇ g dose as one course, beginning 2 days after s.c. injection of TT cells.
  • hMN-15 MAb treatment is initiated 3 days prior to the first dose of DTIC, at 100 ⁇ g/dose/day for 5 days in the first two weeks, then twice weekly.
  • the DNL technique may be used to make dimers, trimers, tetramers, hexamers, etc. comprising virtually any antibodies or fragments thereof or other effector moieties, such as cytokines.
  • IgG antibodies or Fab antibody fragments may be produced as fusion proteins containing either a DDD or AD sequence.
  • Bispecific antibodies may be formed by combining a Fab-DDD fusion protein of a first antibody with a Fab-AD fusion protein of a second antibody.
  • constructs may be made that combine IgG-AD fusion proteins with Fab-DDD fusion proteins.
  • an antibody or fragment containing a binding site for an antigen associated with a target tissue to be treated, such as a tumor may be combined with a second antibody or fragment that binds a hapten on a targetable construct.
  • the tumor targeting antibody or fragment is a chimeric, humanized or human MN-15 antibody comprising the 6 MN-15 CDR sequences, while the hapten binding moiety may be an anti-HSG or anti- DTPA antibody.
  • the bispecific antibody (DNL construct) is administered to a subject, circulating antibody is allowed to clear from the blood and localize to target tissue, and a targetable construct attached to at least one therapeutic and/or diagnostic agent is added and binds to the localized antibody.
  • Independent transgenic cell lines may be developed for each Fab or IgG fusion protein. Once produced, the modules can be purified if desired or maintained in the cell culture supernatant fluid. Following production, any DDD 2 -fusion protein module can be combined with any AD-fusion protein module to generate a bispecific DNL construct. For different types of constructs, different AD or DDD sequences may be utilized.
  • DDD1 SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ ID NO: 1 1)
  • DDD2 CGHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ ID NO: 12)
  • AD 1 QIEYLAKQIVDNAIQQA (SEQ ID NO: 13)
  • AD2 CGQIEYLAKQIVDNAIQQAGC (SEQ ID NO: 14)
  • the plasmid vector pdHL2 has been used to produce a number of antibodies and antibody-based constructs. (See, Gillies et al., J Immunol Methods (1989), 125: 191-202;
  • the di-cistronic mammalian expression vector directs the synthesis of the heavy and light chains of IgG.
  • the vector sequences are mostly identical for many different IgG-pdHL2 constructs, with the only differences existing in the variable domain (VH and VL) sequences.
  • VH and VL variable domain sequences.
  • these IgG expression vectors can be converted into Fab-DDD or Fab-AD expression vectors.
  • Fab-DDD expression vectors To generate Fab-DDD expression vectors, the coding sequences for the hinge, CH2 and CH3 domains of the heavy chain are replaced with a sequence encoding the first 4 residues of the hinge, a 14 residue Gly-Ser linker and the first 44 residues of human Rlla (referred to as DDD1 , SEQ ID NO: l 1).
  • ADl a sequence encoding the first 4 residues of the hinge, a 15 residue Gly-Ser linker and a 17 residue synthetic AD called AKAP- IS (referred to as ADl , SEQ ID NO: 13), which was generated using bioinformatics and peptide array technology and shown to bind Rlla dimers with a very high affinity (0.4 nM). See Alto, et al. Proc. Natl. Acad. Sci., U.S.A (2003), 100:4445-50.
  • the CHI domain was amplified by PCR using the pdHL2 plasmid vector as a template.
  • the left PCR primer consisted of the upstream (5 ') end of the CHI domain and a SacII restriction endonuclease site, which is 5' of the CHI coding sequence.
  • the right primer consisted of the sequence coding for the first 4 residues of the hinge (PKSC) followed by four glycines and a serine, with the final two codons (GS) comprising a Bam HI restriction site.
  • the 410 bp PCR amplimer was cloned into the pGemT PCR cloning vector (Promega, Inc.) and clones were screened for inserts in the T7 (5') orientation.
  • a duplex oligonucleotide designated (G 4 S) 2 DDD1 ((G 4 S) 2 disclosed as SEQ ID NO: 15), was synthesized by Sigma Genosys (Haverhill, UK) to code for the amino acid sequence of DDD1 preceded by 1 1 residues of the linker peptide, with the first two codons comprising a BamHI restriction site. A stop codon and an EagI restriction site are appended to the 3 'end. The encoded polypeptide sequence is shown below.
  • oligonucleotides designated RIIA1-44 top and RIIA1 -44 bottom, that overlap by 30 base pairs on their 3' ends, were synthesized (Sigma Genosys) and combined to comprise the central 154 base pairs of the 174 bp DDD1 sequence.
  • the oligonucleotides were annealed and subjected to a primer extension reaction with Taq polymerase. Following primer extension, the duplex was amplified by PCR. The amplimer was cloned into pGemT and screened for inserts in the T7 (5 ') orientation.
  • a duplex oligonucleotide designated (G 4 S) 2 -AD1 ((G 4 S) 2 disclosed as SEQ ID NO: 15), was synthesized (Sigma Genosys) to code for the amino acid sequence of AD1 preceded by 1 1 residues of the linker peptide with the first two codons comprising a BamHI restriction site. A stop codon and an EagI restriction site are appended to the 3 'end. The encoded polypeptide sequence is shown below.
  • AKAP-IS Top and AKAP-IS Bottom Two complimentary overlapping oligonucleotides encoding the above peptide sequence, designated AKAP-IS Top and AKAP-IS Bottom, were synthesized and annealed. The duplex was amplified by PCR. The amplimer was cloned into the pGemT vector and screened for inserts in the T7 (5 ') orientation.
  • a 190 bp fragment encoding the DDDl sequence was excised from pGemT with BamHI and Notl restriction enzymes and then ligated into the same sites in CHl -pGemT to generate the shuttle vector CH 1 -DDD 1 -pGemT.
  • a 1 10 bp fragment containing the AD1 sequence was excised from pGemT with BamHI and Notl and then ligated into the same sites in CHl -pGemT to generate the shuttle vector CHl-ADl -pGemT.
  • CHI -DDDl or CH1 -AD1 can be incorporated into any IgG construct in the pdHL2 vector.
  • the entire heavy chain constant domain is replaced with one of the above constructs by removing the SacII/EagI restriction fragment (CH1 -CH3) from pdHL2 and replacing it with the SacII/EagI fragment of CHI -DDDl or CH1-AD1 , which is excised from the respective pGemT shuttle vector.
  • h679-Fd-ADl-pdHL2 is an expression vector for production of h679 Fab with AD1 coupled to the carboxyl terminal end of the CHI domain of the Fd via a flexible Gly/Ser peptide spacer composed of 14 amino acid residues.
  • a pdHL2-based vector containing the variable domains of h679 was converted to h679-Fd-ADl-pdHL2 by replacement of the SacII EagI fragment with the CH1-AD1 fragment, which was excised from the CH1-AD1-SV3 shuttle vector with SacII and Eagl.
  • C-DDDl-Fd-hMN-15-pdHL2 is an expression vector for production of a stable dimer that comprises two copies of a fusion protein C-DDDl-Fab-hMN-15, in which DDDl is linked to hMN-15 Fab at the carboxyl terminus of CHI via a flexible peptide spacer.
  • the plasmid vector hMN15-pdHL2 which is used to produce hMN-15 IgG, is converted to C-DDDl-Fd- hMN-15-pdHL2 by digestion with SacII and Eagl restriction endonucleases to remove the CH1 - CH3 domains and insertion of the CH1-DDD1 fragment, which is excised from the CH1- DDD1-SV3 shuttle vector with SacII and Eagl.
  • AD- and DDD-fusion proteins comprising a Fab fragment of any of such antibodies may be combined, in an approximate ratio of two DDD-fusion proteins per one AD-fusion protein, to generate a trimeric DNL construct comprising two Fab fragments of a first antibody and one Fab fragment of a second antibody.
  • C-DDD2-Fd-hMN- l 5-pdHL2 is an expression vector for production of C-DDD2-Fab- hMN-15, which possesses a dimerization and docking domain sequence of DDD2 appended to the carboxyl terminus of the Fd of hMN-15 via a 14 amino acid residue Gly/Ser peptide linker.
  • the fusion protein secreted is composed of two identical copies of hMN-15 Fab held together by non-covalent interaction of the DDD2 domains.
  • the expression vector is engineered as follows. Two overlapping, complimentary oligonucleotides, which comprise the coding sequence for part of the linker peptide
  • GGGGSGGGCG SEQ ID NO: 18
  • residues 1 -13 of DDD2 SEQ ID NO: 12
  • the oligonucleotides are annealed and phosphorylated with T4 PNK, resulting in overhangs on the 5' and 3' ends that are compatible for ligation with DNA digested with the restriction endonucleases BamHI and Pstl, respectively.
  • the duplex DNA is ligated with the shuttle vector CH 1 -DDD 1 -pGemT, which is prepared by digestion with BamHI and Pstl, to generate the shuttle vector CHl -DDD2-pGemT.
  • a 507 bp fragment is excised from CH l -DDD2-pGemT with SacII and Eagl and ligated with the IgG expression vector hMN15-pdHL2, which is prepared by digestion with SacII and Eagl.
  • the final expression construct is designated C-DDD2-Fd-hMN-15-pdHL2. Similar techniques have been utilized to generated DDD2-fusion proteins of the Fab fragments of a number of different humanized antibodies.
  • the expression vector was engineered as follows. Two overlapping, complimentary oligonucleotides (AD2 Top and AD2 Bottom), which comprise the coding sequence for AD2 and part of the linker sequence, were made synthetically. The oligonucleotides were annealed and phosphorylated with T4 PNK, resulting in overhangs on the 5' and 3' ends that are compatible for ligation with DNA digested with the restriction endonucleases BamHI and Spel, respectively.
  • the duplex DNA was ligated into the shuttle vector CHl -ADl -pGemT, which was prepared by digestion with BamHI and Spel, to generate the shuttle vector CHl-AD2-pGemT.
  • a 429 base pair fragment containing CHI and AD2 coding sequences was excised from the shuttle vector with SacII and Eagl restriction enzymes and ligated into h679-pdHL2 vector that prepared by digestion with those same enzymes.
  • the final expression vector is h679-Fd-AD2- pdHL2.
  • IMP 291 is a synthetic peptide containing the HSG hapten to which the 679 Fab binds (Rossi et al., 2005, Clin Cancer Res 1 l :7122s-29s). SE-HPLC analysis of the IMP 291 unbound fraction demonstrates the removal of a4, a 2 and free kappa chains from the product. Binding studies indicate that the trimeric DNL construct incorporating the hMN-15 antibody binds to CEA and HSG, with affinities similar to the parent MN-15 and 679 antibodies.
  • TF10 DNL construct comprising two copies of a C-DDD2-Fab-hPAM4 and one copy of C-AD2-Fab-679.
  • the cancer-targeting antibody component in TF10 is derived from hPAM4, a humanized anti-pancreatic cancer mucin MAb that has been studied in detail as a radiolabeled MAb (e.g., Gold et al., Clin. Cancer Res. 13: 7380-7387, 2007).
  • the hapten-binding component is derived from h679, a humanized anti-histaminyl-succinyl-glycine (HSG) MAb discussed above.
  • HSG humanized anti-histaminyl-succinyl-glycine
  • ([hPAM4] 2 x h679) antibody was produced using the method disclosed for production of the (anti CEA) 2 x anti HSG bsAb, as described above.
  • the TF10 construct bears two humanized PAM4 Fabs and one humanized 679 Fab.
  • the two fusion proteins (hPAM4-DDD and h679-AD2) were expressed independently in stably transfected myeloma cells.
  • the tissue culture supernatant fluids were combined, resulting in a two-fold molar excess of hPAM4-DDD.
  • the reaction mixture was incubated at room temperature for 24 hours under mild reducing conditions using 1 mM reduced glutathione.
  • the DNL reaction was completed by mild oxidation using 2 mM oxidized glutathione.
  • TF10 was isolated by affinity chromatography using IMP 291 -affigel resin, which binds with high specificity to the h679 Fab.
  • an hMN-15-Fab-AD2 fusion protein which possesses an anchor domain sequence of AD2 (SEQ ID NO: 14) appended to the carboxyl terminal end of the CHI domain via a 14 amino acid residue Gly/Ser peptide linker.
  • An hMN- 15-Fab-AD2 construct may be utilized, for example, to prepare a DNL construct comprising a lower number of hMN-15 subunits and a greater number of other effector moiety subunits, such as a toxin, cytokine, drug or another antibody or antibody fragment.
  • the expression vector is engineered as described above for the h679-Fab-AD2 fusion protein.
  • Two overlapping, complimentary oligonucleotides (AD2 Top and AD2 Bottom), which comprise the coding sequence for AD2 and part of the linker sequence, are made synthetically.
  • the oligonucleotides are annealed and phosphorylated with T4 PNK, resulting in overhangs on the 5' and 3' ends that are compatible for ligation with DNA digested with the restriction endonucleases BamHI and Spel, respectively.
  • duplex DNA is ligated into the shuttle vector CHl -ADl-pGemT, which is prepared by digestion with BamHI and Spel, to generate the shuttle vector CHl-AD2-pGemT.
  • a 429 base pair fragment containing CHI and AD2 coding sequences is excised from the shuttle vector with SacII and Eagl restriction enzymes and ligated into hMN-15-pdHL2 vector prepared by digestion with those same enzymes.
  • the final expression vector is hMN-15-Fd- AD2-pdHL2.
  • the following study demonstrates the feasibility of in vivo imaging using the pretargeting technique with labeled targeting peptides and bispecific antibodies incorporating hMN-15.
  • the hMN-15-679 DNL construct comprising two copies of a C-DDD2-Fab-hMN-l 5 and one copy of C-AD2-Fab-679, is prepared as described in the preceding Example.
  • Nude mice bearing 0.2 to 0.3 g human colon cancer xenografts are imaged, using pretargeting with the hMN- 15-679 DNL construct and an 1 1 ! In-IMP-288 peptide.
  • the results show clearly delineated tumors in animal models using a bsMAb pretargeting method.
  • mice receive different doses of hMN-15-679 DNL construct at 10: 1 or 20: 1 mole ratio to the moles of peptide given, and the next day they are given an " 'in-labeled diHSG peptide (IMP 288).
  • the control animals receive only the l u In-IMP-288 (no pretargeting).
  • the images are taken 3 h after the injection of the labeled peptide and show clear localization of 0.2 - 0.3 g tumors in the pretargeted animals with both doses of DNL construct, with no localization in the animals given the m In-peptide alone.
  • constructs comprising PEGylated forms of antibody or immunoconjugate, for example to increase the serum half-life of the antibody or immunoconjugate moiety.
  • PEGylated constructs may be prepared by the DNL technique.
  • the effector moiety to be PEGylated such as hMN-15 Fab
  • a DDD sequence to generate the DDD module.
  • a PEG reagent of a selected molecular size is derivatized with a complementary AD sequence and the resulting PEG-AD module is combined with the DDD module to produce a PEGylated conjugate that consists of a single PEG tethered site-specifically to two copies of the hMN-15 Fab or other effector moiety via the disulfide bonds formed between DDD and AD.
  • the PEG reagents may be capped at one end with a methoxy group (m-PEG), can be linear or branched, and may contain one of the following functional groups: propionic aldehyde, butyric aldehyde, ortho-pyridylthioester (OPTE), N-hydroxysuccinimide (NHS), thiazolidine-2-thione, succinimidyl carbonate (SC), maleimide, or ortho-pyridyldisulfide (OPPS).
  • OPTE ortho-pyridylthioester
  • NHS N-hydroxysuccinimide
  • SC thiazolidine-2-thione
  • SC succinimidyl carbonate
  • OPPS ortho-pyridyldisulfide
  • effector moieties that may be of interest for PEGylation are enzymes, cytokines, chemokines, growth factors, peptides, aptamers, hemoglobins, antibodies and antibody fragments.
  • PEGylated may be obtained from commercial sources, such as NEKTAR® Therapeutics (Huntsville, AL).
  • IMP350 CGQIEYLAKQIVDNAIQQAGC(SS-tbu)-NH 2 (SEQ ID NO: 19)
  • IMP350 incorporating the sequence of AD2 was made on a 0.1 mmol scale with Sieber Amide resin using Fmoc methodology on a peptide synthesizer.
  • the protected amino acids used were Fmoc-Cys(t-Buthio)-OH, Fmoc-Gly-OH, Fmoc-Ala-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-lle-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Asp(OBut)-OH, Fmoc-Val-OH, Fmoc-lle-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Leu-OH, F
  • IMP350 (0.0104 g) was mixed with 0.1022 g of mPEG-OPTE (20kDa, NEKTAR® Therapeutics) in 7 mL of 1 M Tris buffer at pH 7.81. Acetonitrile, 1 mL, was then added to dissolve some suspended material. The reaction was stirred at room temperature for 3 h and then 0.0527 g of TCEP was added along with 0.0549 g of cysteine. The reaction mixture was stirred for 1.5 h and then purified on a PD-10 desalting column, which was equilibrated with 20% methanol in water. The sample was eluted, frozen and lyophilized to obtain 0.0924 g of crude PEG 20 -1MP350 (MH+ 23508 by MALDI).
  • IMP 360 incorporating the AD2 sequence, was synthesized on a 0.1 mmol scale with Fmoc-Gly-EDANS resin using Fmoc methodology on a peptide synthesizer.
  • the Fmoc-Gly-OH was added to the resin manually using 0.23 g of Fmoc-Gly-OH, 0.29 g of HATU, 26 i of DIEA, 7.5 mL of DMF and 0.57 g of EDANS resin (NOVABIOCHEM®).
  • the reagents were mixed and added to the resin.
  • the reaction was mixed at room temperature for 2.5 hr and the resin was washed with DMF and IPA to remove the excess reagents.
  • the protected amino acids used were Fmoc-Cys(t-Buthio)-OH, Fmoc-Gly-OH, Fmoc- Ala-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc- Asn(Trt)-OH, Fmoc-Asp(OBut)-OH, Fmoc-Val-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc- Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Leu-OH, Fmoc-Tyr(But)-OH, Fmoc-Glu(OBut)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH
  • IMP360 (0.01 15 g) was mixed with 0.1272 g of mPEG-OPTE (20kDa, NEKTAR® Therapeutics) in 7 mL of 1 M tris buffer, pH 7.81. Acetonitrile (1 mL) was then added to dissolve some suspended material. The reaction was stirred at room temperature for 4 h and then 0.0410 g of TCEP was added along with 0.0431 g of cysteine. The reaction mixture was stirred for 1 h and purified on a PD-10 desalting column, which was equilibrated with 20% methanol in water. The sample was eluted, frozen and lyophilized to obtain 0.1471 g of crude IMP362 (MH+ 23713).
  • IMP 360 (0.0103 g) was mixed with 0.1601 g of mPEG- OPTE (30kDa, NEKTAR® Therapeutics) in 7 mL of 1 M tris buffer at pH 7.81. Acetonitrile (1 mL) was then added to dissolve some suspended material. The reaction was stirred at room temperature for 4.5 h and then 0.0423 g of TCEP was added along with 0.0473 g of cysteine. The reaction mixture was stirred for 2 h followed by dialysis for two days. The dialyzed material was frozen and lyophilized to obtain 0.1552 g of crude IMP413 (MH + 34499).
  • the peptide IMP421 , MH + 2891 was made on NOVASYN® TGR resin (487.6 mg, 0.1 12 mmol) by adding the following amino acids to the resin in the order shown: Fmoc-Gly- OH, Fmoc-Cys(t-Buthio)-OH, Fmoc-Gly-OH, Fmoc-Ala-OH, Fmoc-Gln(Trt)-OH, Fmoc- Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Asp(OBut)-OH, Fmoc- Val-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc
  • IMP 421 (SEQ ID NO:21), incorporating the sequence of AD2, was synthesized by standard chemical means. To a solution of 15.2 mg (5.26 ⁇ ) IMP 421 (F.W. 2890.50) and 274.5 mg (6.86 ⁇ ⁇ ⁇ ) mPEG2-MAL-40K in 1 mL of acetonitrile was added 7 mL 1 M Tris pH 7.8 and allowed to react at room temperature for 3 h. The excess mPEG2-MAL-40K was quenched with 49.4 mg L-cysteine, followed by S-S-/Bu deprotection over one hour with 59.1 mg TCEP.
  • the reaction mixture was dialyzed overnight at 2-8 °C using two 3-12 mL capacity 10K SLIDE-A-LYZER® dialysis cassettes (4 ml into each cassette) into 5 L of 5 mM ammonium acetate, pH 5.0. Three more 5 L buffer changes of 5 mM ammonium acetate, pH 5.0 were made the next day with each dialysis lasting at least 21 ⁇ 2 h.
  • the purified product (19.4 mL) was transferred into two 20 mL scintillation vials, frozen and lyophilized to yield 246.7 mg of a white solid.
  • MALDI-TOF gave results of mPEG2-MAL-40K 42,982 and IMP-457 45,500.
  • a DNL structure is prepared having two copies of hMN-15 Fab coupled to a 20 kDa PEG.
  • a DNL reaction is performed by the addition of reduced and lyophilized IMP362 in 10- fold molar excess to hMN-15 Fab-DDD2 in 250 mM imidazole, 0.02% Tween 20, 150 mM NaCl, 1 mM EDTA, 50 mM NaH 2 PC>4, pH 7.5.
  • the reaction mixture is dialyzed against CM Loading Buffer (150 mM NaCl, 20 mM NaAc, pH 4.5) at 4°C in the dark.
  • the solution is loaded onto a 1-mL Hi-Trap CM-FF column
  • AMERSFIAM® which is pre-equilibrated with CM Loading buffer. After sample loading, the column is washed with CM loading buffer to baseline, followed by washing with 15 mL of 0.25 M NaCl, 20 mM NaAc, pH 4.5. The PEGylated hMN-15 is eluted with 12.5 mL of 0.5 M NaCl, 20 mM NaAc, pH 4.5.
  • the conjugation process is analyzed by SDS-PAGE with Coomassie blue staining. Under non-reducing conditions, the Coomassie blue-stained gel reveals the presence of a major band in the reaction mixture, which is absent in the unbound or 0.25 M NaCl wash fraction, but evident in the 0.5 M NaCl fraction. Fluorescence imaging, which is used to detect the EDANS tag on IMP362, demonstrates that the band contains IMP362 and the presence of excess IMP362 in the reaction mixture and the unbound fraction.
  • the DNL reaction results in the site- specific and covalent conjugation of IMP362 with a dimer of hMN-15 Fab.
  • the components of the DNL structures are resolved.
  • the calculated MW of the (hMN-15 Fab) 2 -PEG construct matches that determined by MALDI TOF.
  • the DNL reaction results in a near quantitative yield of a homogeneous product that is > 90% pure after purification by cation-exchange chromatography.
  • Another DNL reaction is performed by the addition of reduced and lyophilized IMP457 in 10-fold molar excess to hMN-15 Fab-DDD2 in 250 mM imidazole, 0.02% Tween 20, 150 raM NaCl, 1 mM EDTA, 50 mM NaH 2 P0 4 , pH 7.5. After 60 h at room temperature, 1 mM oxidized glutathione is added to the reaction mixture, which is then held for an additional 2 h. The mixture is diluted 1 :20 with CM Loading Buffer (150 mM NaCl, 20 mM NaAc, pH 4.5) and titrated to pH 4.5 with acetic acid.
  • CM Loading Buffer 150 mM NaCl, 20 mM NaAc, pH 4.5
  • the solution is loaded onto a 1-mL Hi-Trap CM-FF column (AMERSHAM®), which is pre-equilibrated with CM Loading Buffer. After sample loading, the column is washed with CM Loading Buffer to baseline, followed by washing with 15 mL of 0.25 M NaCl, 20 mM NaAc, pH 4.5.
  • the PEGylated product is eluted with 20 mL of 0.5 M NaCl, 20 mM NaAc, pH 4.5.
  • the DNL construct is concentrated to 2 mL and diafiltered into 0.4 M PBS, pH 7.4.
  • the final PEGylated hMN-15 Fab 2 construct is approximately 90% purity as determined by SDS-PAGE.
  • a DNL construct having two copies of hMN-15 Fab coupled to a 30 kDa PEG is prepared as described immediately above using IMP413 instead of IMP362.
  • the PEGylated hMN-15 Fab 2 DNL construct is purified as described above and obtained in approximately 90% purity.
  • the PEGylated DNL constructs may be used for therapeutic methods as described above for non-PEGylated forms of hMN-15. It is observed that PEGylation of hMN-15 Fab 2 increases the serum half-life of the hMN-15 moiety, as expected.
  • Example 15 Generation of DDD module based on Interferon (IFN)-a2b
  • the cDNA sequence for IFN-a2b was amplified by PCR, resulting in a sequence comprising the following features, in which Xbal and BamHI are restriction sites, the signal peptide is native to IFN-a2b, and 6 His is a hexahistidine tag (SEQ ID NO:37): Xbal— Signal peptide— IFNa2b—6 His— BamHI ("6 His" disclosed as SEQ ID NO:37).
  • the resulting secreted protein consists of IFN-a2b fused at its C-terminus to a polypeptide consisting of SEQ ID NO:22.
  • PCR amplification was accomplished using a full length human IFNa2b cDNA clone (INVITROGEN® Ultimate ORF human clone cat# HORFOlClone ID IOH35221) as a template and the following oligonucleotides as primers:
  • the PCR amplimer was cloned into the PGEMT® vector (PROMEGA®).
  • a DDD2- pdHL2 mammalian expression vector was prepared for ligation with IFN-a2b by digestion with Xbal and Bam HI restriction endonucleases.
  • the IFN-a2b amplimer was excised from
  • IFN-a2b-DDD2-pdHL2 was linearized by digestion with Sail enzyme and stably transfected into Sp EEE myeloma cells by electroporation (see, e.g., U.S. Patent 7,537,930, the Examples section of which is incorporated herein by reference).
  • Two clones were found to have detectable levels of IFN-a2b by ELISA.
  • One of the two clones, designated 95, was adapted to growth in serum-free media without substantial decrease in productivity.
  • the clone was subsequently amplified with increasing methotrexate (MTX) concentrations from 0.1 to 0.8 ⁇ over five weeks.
  • MTX methotrexate
  • Clone 95-5 was expanded to 34 roller bottles containing a total of 20 L of serum-free Hybridoma SFM with 0.8 ⁇ MTX and allowed to reach terminal culture. The supernatant fluid was clarified by centrifugation and filtered (0.2 ⁇ ). The filtrate was diafiltered into I X Binding buffer ( 10 mM imidazole, 0.5 M NaCl, 50 mM NaH 2 P0 4 , pH 7.5) and concentrated to 310 mL in preparation for purification by immobilized metal affinity chromatography (IMAC).
  • I X Binding buffer 10 mM imidazole, 0.5 M NaCl, 50 mM NaH 2 P0 4 , pH 7.5
  • the concentrate was loaded onto a 30-mL Ni-NTA column, which was washed with 500 mL of 0.02% Tween 20 in IX binding buffer and then 290 mL of 30 mM imidazole, 0.02% Tween 20, 0.5 M NaCl, 50 mM NaH 2 P0 , pH 7.5.
  • the product was eluted with 1 10 mL of 250 mM imidazole, 0.02% Tween 20, 150 mM NaCl, 50 mM NaH 2 P0 4 , pH 7.5.
  • Approximately 6 mg of IFNa2b-DDD2 was purified. [0280] The purity of IFN-a2b-DDD2 was assessed by SDS-PAGE under reducing conditions (not shown). IFN-ot2b-DDD2 was the most heavily stained band and accounted for
  • the pdHL2 mammalian expression vector has been used to mediate the expression of many recombinant IgGs.
  • a plasmid shuttle vector was produced to facilitate the conversion of any IgG-pdHL2 vector into a C-H-AD2-IgG-pdHL2 vector.
  • the gene for the Fc was amplified using the pdHL2 vector as a template and the oligonucleotides Fc Bglll Left and Fc Bam-EcoRl Right as primers.
  • the amplimer was cloned in the PGEMT® PCR cloning vector.
  • the Fc insert fragment was excised from PGEMT® and ligated with AD2-pdHL2 vector to generate the shuttle vector Fc-AD2-pdHL2.
  • a DNL reaction is performed by the addition of reduced and lyophilized hMN- 15 IgG- AD2 to IFN-a2b-DDD2 in 250 mM imidazole, 0.02% Tween 20, 150 mM NaCl, 1 mM EDTA, 50 mM NaH 2 P0 4 , pH 7.5. After 6 h at room temperature in the dark, the reaction mixture is dialyzed against CM Loading Buffer (150 mM NaCl, 20 mM NaAc, pH 4.5) at 4°C in the dark. The solution is loaded onto a 1-mL Hi-Trap CM-FF column (AMERSHAM®), which is pre- equilibrated with CM Loading buffer.
  • CM Loading Buffer 150 mM NaCl, 20 mM NaAc, pH 4.5
  • the column is washed with CM loading buffer to baseline, followed by washing with 15 mL of 0.25 M NaCl, 20 mM NaAc, pH 4.5.
  • the product is eluted with 12.5 mL of 0.5 M NaCl, 20 mM NaAc, pH 4.5.
  • the DNL reaction results in the site-specific and covalent conjugation of hMN-15 IgG with a dimer of IFN-a2b. Both the IgG and IFN-ot2b moieties retain their respective physiological activities in the DNL construct.
  • This technique may be used to attach any cytokine or other physiologically active protein or peptide to hMN-15 for targeted delivery to colon cancer or other cancers that express the CEA antigen.
  • C-DDDl -Fd-hMN- 14-pdHL2 is an expression vector for production of a stable dimer that comprises two copies of a fusion protein C-DDDl -Fab-hMN- 14, in which DDD 1 is linked to hMN- 14 Fab at the carboxyl terminus of CHI via a flexible peptide spacer.
  • the plasmid vector hMN14(I)-pdHL2 which has been used to produce hMN-14 IgG, was converted to C- DDDl-Fd-hMN-14-pdHL2 by digestion with SacII and Eagl restriction endonucleases to remove the CH1 -CH3 domains and insertion of the CH1 -DDD1 fragment, which was excised from the CH1 -DDD1-SV3 shuttle vector with SacII and Eagl.
  • C-DDD2-Fd-hMN- 14-pdHL2 is an expression vector for production of C-DDD2-Fab- hMN-14, which possesses a dimerization and docking domain sequence of DDD2 appended to the carboxyl terminus of the Fd via a 14 amino acid residue Gly/Ser peptide linker.
  • the fusion protein secreted is composed of two identical copies of hMN-14 Fab held together by non- covalent interaction of the DDD2 domains.
  • the C-DDD2-Fd-hM -14-pdHL2 vector was transfected into Sp/EEE myeloma cells by electroporation.
  • the di-cistronic expression vector directs the synthesis and secretion of both hMN- 14 kappa light chain and C-DDD2-Fd-hMN-14, which combine to form C-DDD2-Fab- hMN14. Dimerization occurs via the DDD2 moiety, resulting in two reactive sulfhydryl groups provided by the cysteine residue in each DDD2.
  • the cells were plated in 96-well tissue culture plates and transfectant clones were selected with 0.05 .mu.M methotrexate (MTX).
  • Clones were screened for protein expression by ELISA using microtitre plates coated with WI2 (hMN- 14 anti-Id) and detection with goat anti-human Fab-HRP. The highest producing clones had an initial productivity of approximately 100 mg/L. A total of 200 mg of C-DDD2-hMN-14 was purified by protein L affinity chromatography from 1.8 liters of roller bottle culture.
  • hMN-15-Fab-AD2 is prepared as described in Example 12.
  • hMN- 14-Fab-DDD2 is prepared as described above.
  • the two fusion proteins (hMN-14-Fab-DDD2 and hMN-15-Fab- AD2) are expressed independently in stably transfected myeloma cells.
  • the tissue culture supernatant fluids are combined, resulting in a two-fold molar excess of hMN-14-Fab-DDD2.
  • the reaction mixture is incubated at room temperature for 24 hours under mild reducing conditions using 1 mM reduced glutathione.
  • the DNL reaction is completed by mild oxidation using 2 mM oxidized glutathione.
  • the trimeric bispecific DNL construct is isolated by affinity chromatography using an anti-idiotypic antibody against hMN- 14. The complex retains the binding affinities of both the hMN- 14 and hMN- 15 antibodies.
  • hMN-15-Fab-AD2 and hPAM4-Fab-DDD2 are prepared as described in Example 1 1.
  • the two fusion proteins (hPAM4-Fab-DDD2 and hMN-1 -Fab-AD2) are expressed independently in stably transfected myeloma cells.
  • the tissue culture supernatant fluids are combined, resulting in a two-fold molar excess of hPAM4-Fab-DDD2.
  • the reaction mixture is incubated at room temperature for 24 hours under mild reducing conditions using 1 mM reduced glutathione.
  • the DNL reaction is completed by mild oxidation using 2 mM oxidized glutathione.
  • the trimeric bispecific DNL construct is isolated by affinity chromatography using an anti-idiotypic antibody against hMN-15. The complex retains the binding affinities of both the hPAM4 and hMN-15 antibodies.
  • F-labeled proteins or peptides are prepared by a novel technique and used for diagnostic and/or imaging studies, such as PET imaging.
  • the novel technique for 18 F labeling involves preparation of an l s F-metal complex, preferably an 18 F- aluminum complex, which is chelated to a chelating moiety, such as DOTA, NOTA or NETA or derivatives thereof.
  • Chelating moieties may be attached to proteins, peptides or any other molecule using conjugation techniques well known in the art.
  • the 18 F-A1 complex is formed in solution first and then attached to a chelating moiety that is already conjugated to a protein or peptide.
  • the aluminum may be first attached to the chelating moiety and the l8 F added later.
  • Peptides were synthesized by solid phase peptide synthesis using the Fmoc strategy. Groups were added to the side chains of diamino amino acids by using Fmoc/Aloc protecting groups to allow differential deprotection. The Aloe groups were removed by the method of Dangles et. al. (J. Org. Chem. 1987, 52:4984-4993) except that piperidine was added in a 1 : 1 ratio to the acetic acid used. The unsymmetrical tetra-t-butyl DTPA was made as described in McBride et al. (US Patent No. 7,405,320, the Examples section of which is incorporated herein by reference).
  • the tri-t-butyl DOTA, symmetrical tetra-f-butyl DTPA, ITC-benzyl DTPA, -SCN-Bn- NOTA and TACN were obtained from MACROCYCLICS® (Dallas, TX).
  • the DiBocTACN, NODA-GA(/Bu) 3 and the N02A/Bu were purchased from CheMatech (Dijon, France).
  • the Aloc/Fmoc Lysine and Dap (diaminopropionic acid derivatives (also Dpr)) were obtained from CREOSALUS® (Louisville, KY) or BACHEM® (Torrance, CA).
  • the Sieber Amide resin was obtained from NOVABIOCHEM® (San Diego, CA). The remaining Fmoc amino acids were obtained from CREOSALUS®, BACHEM®, PEPTECH® (Burlington, MA), EMD
  • BIOSCIENCES® (San Diego, CA), CHEM IMPEX® (Wood Dale, IL) or NOVABIOCHEM®.
  • the aluminum chloride hexahydrate was purchased from SIGMA-ALDRICH® (Milwaukee, WI).
  • the remaining solvents and reagents were purchased from FISHER SCIENTIFIC® (Pittsburgh, PA) or SIGMA-ALDRICH® (Milwaukee, WI). 18 F was supplied by IB A
  • the first peptide that was prepared and 18 F-labeled was IMP 272: DTPA-Gln-Ala-Lys(HSG)-D-Tyr-Lys(HSG)-NH 2 MH + 1512
  • IMP 272 was synthesized as described (McBride et al., US Patent No. 7,534,431 , the Examples section of which is incorporated herein by reference).
  • Acetate buffer solution - Acetic acid 1.509 g was diluted in ⁇ 160 mL water and the pH was adjusted by the addition of 1 M NaOH then diluted to 250 mL to make a 0.1 M solution at pH 4.03.
  • IMP 272 acetate buffer solution - Peptide 0.001 1 g, 7.28 x 10 "7 mol IMP 272 was dissolved in 364 of the 0.1 M pH 4 acetate buffer solution to obtain a 2 mM stock solution of the peptide.
  • the labeled peptide was purified by applying the labeled peptide solution onto a 1 cc (30 mg) WATERS® HLB column (Part # 186001879) and washing with 300 ⁇ , water to remove unbound F-18.
  • the peptide was eluted by washing the column with 2 x 100 ⁇ 1 : 1 EtOH/H 2 0.
  • the purified peptide was incubated in water at 25 °C and analyzed by reverse phase HPLC (not shown). The HPLC analysis showed that the 18 F-labeled IMP 272 was not stable in water. After 40 min incubation in water about 17% of the 18 F was released from the peptide, while 83% was retained (not shown).
  • the peptide (16 ⁇ 2 mM IMP 272, 48 ⁇ g) was labeled with 18 F and analyzed for antibody binding by size exclusion HPLC.
  • the size exclusion HPLC showed that the peptide bound hMN-14 x 679 but did not bind to the irrelevant bispecific antibody hMN-14 x 734 (not shown).
  • the peptide, IMP 448 D-Ala-D-Lys(HSG)-D-Tyr-D-Lys(HSG)-NH 2 MH + 1009 was made on Sieber Amide resin by adding the following amino acids to the resin in the order shown: Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, the Aloe was cleaved, Fmoc-D-Tyr(But)-OH, Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, the Aloe was cleaved, Fmoc-D-Ala-OH with final Fmoc cleavage to make the desired peptide.
  • the peptide was then cleaved from the resin and purified by HPLC to produce IMP 448, which was then coupled to ITC -benzyl NOTA.
  • the peptide, IMP 448, 0.0757g (7.5 x 10 "5 mol) was mixed with 0.0509 g (9.09 x 10 "5 mol) ITC benzyl NOTA and dissolved in 1 mL water.
  • Potassium carbonate anhydrous (0.2171 g) was then slowly added to the stirred peptide/NOTA solution.
  • the reaction solution was pH 10.6 after the addition of all the carbonate.
  • the reaction was allowed to stir at room temperature overnight.
  • the reaction was carefully quenched with 1 M HC1 after 14 hr and purified by HPLC to obtain 48 mg of IMP 449.
  • the peptide IMP 449 (0.002 g, 1.37 x lO "6 mol) was dissolved in 686 x (2 mM peptide solution) 0.1 M NaOAc pH 4.02. Three microliters of a 2 mM solution of Al in a pH 4 acetate buffer was mixed with 15 ⁇ ih, 1.3 mCi of 18 F. The solution was then mixed with 20 of the 2 mM IMP 449 solution and heated at 105 °C for 15 min.
  • Reverse phase HPLC analysis showed 35% (3 ⁇ 4 ⁇ 10 min) of the activity was attached to the peptide and 65% of the activity was eluted at the void volume of the column (3.1 min, not shown) indicating that the majority of activity was not associated with the peptide.
  • the crude labeled mixture (5 ⁇ ) was mixed with pooled human serum and incubated at 37 °C. An aliquot was removed after 15 min and analyzed by HPLC. The HPLC showed 9.8% of the activity was still attached to the peptide (down from 35%). Another aliquot was removed after 1 hr and analyzed by HPLC. The HPLC showed 7.6% of the activity was still attached to the peptide (down from 35%), which was essentially the same as the 15 min trace (data not shown).
  • 18 F-labeled IMP 449 was stable in TFA solution, which is occasionally used during reverse phase HPLC chromatography. There appears to be a general correlation between stability in TFA and stability in human serum observed for the exemplary 18 F-labeled molecules described herein. These results demonstrate that 18 F-labeled peptide, produced according to the methods disclosed herein, shows sufficient stability in human serum to be successfully used for in vivo labeling and imaging studies, for example using PET scanning to detect labeled cells or tissues. Finally, since IMP 449 peptide contains a thiourea linkage, which is sensitive to radiolysis, several products are observed by RP-HPLC. However, when ascorbic acid is added to the reaction mixture, the side products generated were markedly reduced.
  • 18 F-labeled IMP 449 is prepared as follows. The 18 F, 54.7 mCi in ⁇ 0.5 mL is mixed with 3 iL 2 mM Al in 0.1 M NaOAc pH 4 buffer. After 3 min 10 of 0.05 M IMP 449 in 0.5 M pH 4 NaOAc buffer is added and the reaction is heated in a 96°C heating block for 15 min. The contents of the reaction are removed with a syringe. The crude labeled peptide is then purified by HPLC on a C 18 column. The flow rate is 3 mL/min. Buffer A is 0.1% TFA in water and Buffer B is 90% acetonitrile in water with 0.1% TFA.
  • the gradient goes from 100% A to 75/25 A:B over 15 min. There is about 1 min difference in retention time (3 ⁇ 4) between the labeled peptide, which eluted first and the unlabeled peptide.
  • the HPLC eluent is collected in 0.5 min (mL) fractions.
  • the labeled peptide has a 3 ⁇ 4 between 6 to 9 min depending on the column used.
  • the HPLC purified peptide sample is further processed by diluting the fractions of interest two fold in water and placing the solution in the barrel of a 1 cc WATERS® HLB column.
  • the cartridge is eluted with 3 x 1 mL water to remove acetonitrile and TFA followed by 400 uL 1 : 1 EtOH/3 ⁇ 40 to elute the I8 F-labeled peptide.
  • the purified [A1 18 F] IMP 449 elutes as a single peak on an analytical HPLC Ci 8 column (not shown).
  • mice Female athymic mice (nu/nu) bearing GW-39 xenografts are used for in vivo studies. Three of the mice are injected with hMN-15-679 DNL construct (162 ⁇ g) followed with [Al' 8 F] IMP 449 18 h later.
  • the hMN-15-679 DNL construct is a humanized bispecific antibody of use for tumor imaging studies, with divalent binding to the CEA tumor antigen and monovalent binding to HSG.
  • One mouse is injected with peptide alone. All of the mice are necropsied at 1 h post peptide injection. Tissues are counted immediately.
  • the AD and DDD sequences incorporated into the DNL complexes comprise the amino acid sequences of AD2 (SEQ ID NO: 14) and DDD2 (SEQ ID NO: 12), as described above.
  • sequence variants of the AD and/or DDD moieties may be utilized in construction of the cytokine-MAb DNL complexes. The structure-function relationships of the AD and DDD domains have been the subject of investigation.
  • Alto et al. (2003) performed a bioinformatic analysis of the AD sequence of various AKAP proteins to design an RII selective AD sequence called AKAP-IS (NO: 13), with a binding constant for DDD of 0.4 nM.
  • the AKAP-IS sequence was designed as a peptide antagonist of AKAP binding to PKA. Residues in the AKAP-IS sequence where substitutions tended to decrease binding to DDD are underlined in SEQ ID NO: 13 below.
  • the SuperA AP-IS sequence may be substituted for the AKAP-IS AD moiety sequence to prepare cytokine-MAb DNL constructs.
  • Other alternative sequences that might be substituted for the AKAP-IS AD sequence are shown in SEQ ID NO:28-30. Substitutions relative to the AKAP-IS sequence are underlined. It is anticipated that, as with the AKAP-IS sequence shown in SEQ ID NO: 14, the AD moiety may also include the additional N-terminal residues cysteine and glycine and C-terminal residues glycine and cysteine.
  • Carr et al. examined the degree of sequence homology between different AKAP- binding DDD sequences from human and non-human proteins and identified residues in the DDD sequences that appeared to be the most highly conserved among different DDD moieties. These are indicated below by underlining with reference to the human PKA Rlla DDD sequence of SEQ ID NO: l 1 . Residues that were particularly conserved are further indicated by italics. The residues overlap with, but are not identical to those suggested by Kinderman et al. (2006) to be important for binding to AKAP proteins.
  • the antibodies MN-3 and MN-15 were teseted for recognition of HeLa cells transfected with cDNA coding for CEA (HeLa-CEA2), NCA-90 (HeLa-KNC6/S44) and NCA-95 (HeLa- CGM6/1 ).
  • HeLa-CEA2 cDNA coding for CEA
  • NCA-90 HeLa-KNC6/S44
  • NCA-95 HeLa- CGM6/1
  • HeLa cells transfected with the plasmid pSV2-Neo control HeLa cells, HeLa-NeoA
  • three control antibodies were included:
  • MAb 47 which cross reacts with CEA and NCA-95, but not NCA-90

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Oncology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Physics & Mathematics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Optics & Photonics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Botany (AREA)
  • Acoustics & Sound (AREA)
  • Radiology & Medical Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Diabetes (AREA)
  • Communicable Diseases (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Hematology (AREA)
PCT/US2010/043663 2009-09-16 2010-07-29 Class i anti-cea antibodies and uses thereof Ceased WO2011034660A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
CN201080039267.1A CN102482701B (zh) 2009-09-16 2010-07-29 I类抗-cea抗体及其使用
EP10817617.3A EP2478110B1 (en) 2009-09-16 2010-07-29 Class i anti-cea antibodies and uses thereof
CA2774260A CA2774260C (en) 2009-09-16 2010-07-29 Class i anti-cea antibodies and uses thereof
IN1663DEN2012 IN2012DN01663A (https=) 2009-09-16 2010-07-29

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US24287209P 2009-09-16 2009-09-16
US61/242,872 2009-09-16

Publications (1)

Publication Number Publication Date
WO2011034660A1 true WO2011034660A1 (en) 2011-03-24

Family

ID=43730776

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/043663 Ceased WO2011034660A1 (en) 2009-09-16 2010-07-29 Class i anti-cea antibodies and uses thereof

Country Status (6)

Country Link
US (7) US8287865B2 (https=)
EP (2) EP3009455A1 (https=)
CN (1) CN102482701B (https=)
CA (1) CA2774260C (https=)
IN (1) IN2012DN01663A (https=)
WO (1) WO2011034660A1 (https=)

Cited By (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102911248A (zh) * 2011-08-05 2013-02-06 上海原子科兴药业有限公司 合成1,4-二取代三唑结构的188Re(CO)3标记化合物的方法
WO2015184203A1 (en) 2014-05-29 2015-12-03 Macrogenics, Inc. Tri-specific binding molecules and methods of use thereof
WO2017149143A1 (en) 2016-03-04 2017-09-08 Agency For Science, Technology And Research Anti-lag-3 antibodies
WO2017194265A1 (en) 2016-05-10 2017-11-16 Agency For Science, Technology And Research Anti-CTLA-4 Antibodies
WO2017214092A1 (en) 2016-06-07 2017-12-14 Macrogenics, Inc. Combination therapy
CN110327074A (zh) * 2019-08-02 2019-10-15 无锡海斯凯尔医学技术有限公司 肝脏评价方法、装置、设备及计算机可读存储介质
EP3752196A1 (en) 2018-02-15 2020-12-23 MacroGenics, Inc. Variant cd3-binding domains and their use in combination therapies for the treatment of disease
WO2021023987A1 (en) 2019-08-05 2021-02-11 Autolus Limited Chimeric cytokine receptor
US10954301B2 (en) 2015-12-14 2021-03-23 Macrogenics, Inc. Bispecific molecules having immunoreactivity with PD-1 and CTLA-4, and methods of use thereof
WO2022048883A1 (en) * 2020-09-04 2022-03-10 Merck Patent Gmbh Anti-ceacam5 antibodies and conjugates and uses thereof
JP2022536114A (ja) * 2019-06-04 2022-08-12 普米斯生物技術(珠海)有限公司 抗ceacam5モノクローナル抗体およびその調製方法およびその使用
US11459394B2 (en) 2017-02-24 2022-10-04 Macrogenics, Inc. Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof
WO2023073352A1 (en) 2021-10-25 2023-05-04 Autolus Limited Chimeric cytokine receptor
US11667724B2 (en) 2017-07-07 2023-06-06 Astellas Pharma Inc. Anti-human CEACAM5 antibody Fab fragment
US11773164B2 (en) 2015-03-23 2023-10-03 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Anti-CEACAM6 antibodies and uses thereof
US11795226B2 (en) 2017-12-12 2023-10-24 Macrogenics, Inc. Bispecific CD16-binding molecules and their use in the treatment of disease
EP4338756A2 (en) 2015-08-20 2024-03-20 Autolus Limited Chimeric cytokine receptor
CN118005796A (zh) * 2024-01-19 2024-05-10 南京鼓楼医院 一种靶向癌胚抗原的单域抗体、构建方法及其应用
US12065503B2 (en) 2018-10-10 2024-08-20 Astellas Pharma Inc. Pharmaceutical composition containing tagged site-antihuman antibody fab fragment complex
WO2024194630A1 (en) 2023-03-20 2024-09-26 Autolus Limited A chimeric cytokine receptor, which comprises a truncated il2rbeta and il2rgamma
WO2024243217A1 (en) * 2023-05-25 2024-11-28 BioLegend, Inc. Ceacam6 binding antibodies and antigen-binding fragments thereof
WO2024250924A1 (en) * 2023-06-05 2024-12-12 Nona Biosciences (Suzhou) Co., Ltd. Anti-ceacam5/6 dual-binding antibodies
US12221479B2 (en) 2018-12-19 2025-02-11 Bayer Aktiengesellschaft Pharmaceutical combination of anti CEACAM6 and TIM3 antibodies

Families Citing this family (85)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7527787B2 (en) * 2005-10-19 2009-05-05 Ibc Pharmaceuticals, Inc. Multivalent immunoglobulin-based bioactive assemblies
CN101972478B (zh) * 2002-10-08 2012-10-31 免疫医疗公司 抗体治疗
US9862770B2 (en) * 2005-10-19 2018-01-09 Ibc Pharmaceuticals, Inc. Multivalent antibody complexes targeting IGF-1R show potent toxicity against solid tumors
US20100226884A1 (en) 2009-01-20 2010-09-09 Immunomedics, Inc. Novel Class of Monospecific and Bispecific Humanized Antibodies that Target the Insulin-like Growth Factor Type I Receptor (IGF-1R)
US9272029B2 (en) 2009-03-26 2016-03-01 Ibc Pharmaceuticals, Inc. Interferon lambada-antibody complexes
EP3009455A1 (en) 2009-09-16 2016-04-20 Immunomedics Inc. Class i anti-cea antibodies and uses thereof
WO2012024659A2 (en) * 2010-08-20 2012-02-23 Massachusetts Institute Of Technology Antibody-based constructs directed against tyrosine kinase receptors
US9884909B2 (en) 2010-12-01 2018-02-06 Alderbio Holdings Llc Anti-NGF compositions and use thereof
US9067988B2 (en) 2010-12-01 2015-06-30 Alderbio Holdings Llc Methods of preventing or treating pain using anti-NGF antibodies
US9539324B2 (en) 2010-12-01 2017-01-10 Alderbio Holdings, Llc Methods of preventing inflammation and treating pain using anti-NGF compositions
US9078878B2 (en) 2010-12-01 2015-07-14 Alderbio Holdings Llc Anti-NGF antibodies that selectively inhibit the association of NGF with TrkA, without affecting the association of NGF with p75
US11214610B2 (en) 2010-12-01 2022-01-04 H. Lundbeck A/S High-purity production of multi-subunit proteins such as antibodies in transformed microbes such as Pichia pastoris
JP6190723B2 (ja) 2010-12-01 2017-08-30 アルダーバイオ ホールディングス エルエルシー 抗ngf組成物およびその使用
DK3252076T3 (da) 2011-01-14 2019-12-02 Univ California Diagnostisk anvendelse af antistoffer mod ror-1-protein
WO2012158818A2 (en) 2011-05-16 2012-11-22 Fabion Pharmaceuticals, Inc. Multi-specific fab fusion proteins and methods of use
EP2537933A1 (en) 2011-06-24 2012-12-26 Institut National de la Santé et de la Recherche Médicale (INSERM) An IL-15 and IL-15Ralpha sushi domain based immunocytokines
CA2861335A1 (en) * 2012-01-26 2013-08-01 Ibc Pharmaceuticals, Inc. Targeting interferon-lambda with antibodies potently enhances anti-tumor and anti-viral activities
EP2708556B1 (en) 2012-09-12 2018-11-07 Samsung Electronics Co., Ltd Pharmaceutical composition for the use in a combination therapy for prevention or treatment of c-met or angiogenesis factor induced diseases
CN104837502B (zh) 2012-10-12 2018-08-10 麦迪穆有限责任公司 吡咯并苯并二氮杂卓及其结合物
HUE033369T2 (en) * 2012-11-20 2017-11-28 Sanofi Sa Anti-ceacam5 antibodies and uses thereof
CN105121467B (zh) 2012-12-03 2019-07-05 诺夫免疫股份有限公司 抗cd47抗体及其使用方法
AU2013204922B2 (en) 2012-12-20 2015-05-14 Celgene Corporation Chimeric antigen receptors
US10329350B2 (en) 2012-12-26 2019-06-25 Industrial Technology Research Institute Method for producing a multivalent fab fragment with collagen-like peptide
CA2905181C (en) 2013-03-13 2020-06-02 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof for providing targeted therapy
AU2014240083C1 (en) 2013-03-15 2019-10-24 Celgene Corporation Modified T lymphocytes
DK2986312T3 (da) 2013-04-19 2022-02-14 Cytune Pharma Cytokinafledt behandling med reduceret vaskulært lækagesyndrom
US9717715B2 (en) 2013-11-15 2017-08-01 Samsung Electronics Co., Ltd. Method of combination therapy using an anti-C-Met antibody
US9349535B2 (en) 2013-12-17 2016-05-24 Metastable Materials, Inc. Method and apparatus for manufacturing isotropic magnetic nanocolloids by pulsed laser ablation
EP2915569A1 (en) 2014-03-03 2015-09-09 Cytune Pharma IL-15/IL-15Ralpha based conjugates purification method
JP6531166B2 (ja) 2014-09-10 2019-06-12 メドイミューン・リミテッドMedImmune Limited ピロロベンゾジアゼピン及びそのコンジュゲート
CN117138060A (zh) 2014-10-07 2023-12-01 免疫医疗公司 抗体-药物缀合物的新辅助剂用途
EP3244926B8 (en) 2015-01-14 2024-08-21 The Brigham and Women's Hospital, Inc. Treatment of cancer with anti-lap monoclonal antibodies
EP4257134A3 (en) 2015-06-25 2024-01-24 Immunomedics, Inc. Combining anti-hla-dr or anti-trop-2 antibodies with microtubule inhibitors, parp inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer
PL3316885T3 (pl) 2015-07-01 2021-12-06 Immunomedics, Inc. Immunokoniugaty przeciwciało-sn-38 z linkerem cl2a
CN106432502B (zh) * 2015-08-10 2020-10-27 中山大学 用于治疗cea阳性表达肿瘤的双特异纳米抗体
CN110698560B (zh) * 2015-12-24 2021-11-26 凯惠科技发展(上海)有限公司 一种tpbg抗体及其制备方法、其偶联物和应用
CN109476756B (zh) 2016-03-15 2022-05-31 埃泰美德(香港)有限公司 一种多特异性Fab融合蛋白及其用途
AU2017343377B2 (en) * 2016-10-10 2024-07-11 Agency For Science, Technology And Research Anti-CEACAM6 antibodies and methods of use
CN109862919A (zh) 2016-10-11 2019-06-07 免疫医疗有限公司 抗体-药物缀合物联合免疫介导的治疗剂
WO2018075820A2 (en) 2016-10-20 2018-04-26 Celgene Corporation Cereblon-based heterodimerizable chimeric antigen receptors
TWI780082B (zh) 2016-11-18 2022-10-11 日商安斯泰來製藥股份有限公司 新穎抗人類MUC1抗體Fab片段
CN108341876B (zh) * 2017-01-22 2021-06-04 中国人民解放军第四军医大学 抗人ceacam5单克隆抗体及其制备方法和应用
CN108440668A (zh) * 2017-02-16 2018-08-24 瑞阳(苏州)生物科技有限公司 Fgf21与igf-1的融合蛋白及其应用
EP3398967A1 (en) 2017-05-04 2018-11-07 B Cell Design Antibodies against carcinoembryonic antigen for cancer therapy and diagnosis
US20210017247A1 (en) 2017-07-03 2021-01-21 Torque Therapeutics, Inc. Fusion Molecules Targeting Immune Regulatory Cells and Uses Thereof
BR112019028269A2 (pt) 2017-07-11 2020-07-14 Alexion Pharmaceuticals, Inc. polipeptídeos que se ligam ao componente c5 do complemento ou à albumina sérica e suas proteínas de fusão
EP3694552A1 (en) 2017-10-10 2020-08-19 Tilos Therapeutics, Inc. Anti-lap antibodies and uses thereof
MX2020012351A (es) 2018-05-17 2021-01-29 Astellas Pharma Inc Complejo que tiene fragmento fab de anticuerpo anti-muc1 de humano, enlazador peptido y/o ligando.
CA3098103A1 (en) 2018-05-23 2019-11-28 Adc Therapeutics Sa Molecular adjuvant
EP3802599B1 (en) 2018-06-03 2023-12-20 LamKap Bio beta AG Bispecific antibodies against ceacam5 and cd47
GB201811410D0 (en) 2018-07-12 2018-08-29 F Star Beta Ltd OX40 Binding molecules
GB201811415D0 (en) 2018-07-12 2018-08-29 F Star Beta Ltd Anti-Mesothelin Anti bodies
EP3847196A4 (en) 2018-09-07 2023-01-04 ITabMed (HK) Limited BISPECIFIC ANTIGEN BINDING PROTEINS AND USES THEREOF
WO2020064847A1 (en) 2018-09-26 2020-04-02 Ascendis Pharma A/S Degradable hyaluronic acid hydrogels
EP3863722A2 (en) 2018-10-10 2021-08-18 Tilos Theapeutics, Inc. Anti-lap antibody variants and uses thereof
WO2020132810A1 (en) 2018-12-24 2020-07-02 Generon (Shanghai) Corporation Ltd. Multispecific antigen binding proteins capable of binding cd19 and cd3, and use thereof
JP7524213B2 (ja) * 2019-03-28 2024-07-29 アカデミア シニカ 下痢の防止及び処置における使用のためのビデンスピローサ及びそのファイトケミカル
CN110132937A (zh) * 2019-06-05 2019-08-16 福建师范大学 一种dna链作为信号开关检测重金属离子的制备方法
CN114786776B (zh) 2019-09-18 2026-03-24 拉姆卡普生物阿尔法股份公司 针对ceacam5和cd3的双特异性抗体
CN110713539B (zh) * 2019-09-23 2021-04-16 华道(上海)生物医药有限公司 一种抗癌胚抗原的抗体及其制备方法和用途
US11760801B2 (en) 2019-09-27 2023-09-19 Janssen Biotech, Inc. Anti-CEACAM antibodies and uses thereof
EP3831849A1 (en) 2019-12-02 2021-06-09 LamKap Bio beta AG Bispecific antibodies against ceacam5 and cd47
EP4106813A4 (en) 2020-02-21 2024-03-27 MacroGenics, Inc. CD137 BINDING MOLECULES AND THEIR USES
WO2021178951A1 (en) * 2020-03-06 2021-09-10 H. Lee Moffitt Cancer Center And Research Institute, Inc. Tumor targeted fluorescence guidance for intraoperative margin assessment
CN116621980B (zh) * 2020-10-21 2025-10-28 北京纽安博生物技术有限公司 抗ceacam6单域抗体及其融合蛋白和应用
ES2967381T3 (es) 2020-12-18 2024-04-30 Lamkap Bio Beta Ag Anticuerpos biespecíficos contra CEACAM5 y CD47
AR124414A1 (es) 2020-12-18 2023-03-22 Century Therapeutics Inc Sistema de receptor de antígeno quimérico con especificidad de receptor adaptable
CN114689554A (zh) * 2020-12-31 2022-07-01 中国人民解放军军事科学院防化研究院 一种针对芥子气的荧光示踪复合材料及应用
GB202102396D0 (en) 2021-02-19 2021-04-07 Adc Therapeutics Sa Molecular adjuvant
CN112557662B (zh) * 2021-02-22 2021-07-06 和卓生物科技(上海)有限公司 一种结直肠癌检测试剂盒
EP4305069A4 (en) * 2021-03-08 2025-01-01 University of Pittsburgh - of the Commonwealth System of Higher Education MOLECULES THAT BIND TO CD66E POLYPEPTIDES
EP4385522A1 (en) 2021-08-13 2024-06-19 Kunshan Xinyunda Biotech Co., Ltd. Microtubule inhibitor-based antibody-drug conjugate
CN117881431A (zh) 2021-08-24 2024-04-12 昆山新蕴达生物科技有限公司 一种由可断裂连接子偶联的抗体偶联药物
CN115819596A (zh) * 2021-09-17 2023-03-21 优迈生物科技(连云港)有限公司 一种靶向人ceacam5/6的抗体、制备方法和应用
CN117980327A (zh) 2021-11-03 2024-05-03 杭州多禧生物科技有限公司 抗体的特异性偶联
CN118401258A (zh) 2021-12-09 2024-07-26 昆山新蕴达生物科技有限公司 一种亲和力改善的抗体-药物偶联物、其制备方法及应用
US20230256122A1 (en) * 2021-12-28 2023-08-17 City Of Hope Combination therapy for treating cancer
CN114560944B (zh) * 2022-03-30 2022-08-09 北京科跃中楷生物技术有限公司 胶体金颗粒标记的抗体及其应用
CN114409789B (zh) * 2022-03-30 2022-06-07 北京科跃中楷生物技术有限公司 一种胶体金颗粒标记方法及检测试剂盒
WO2023198019A1 (zh) * 2022-04-12 2023-10-19 盛禾(中国)生物制药有限公司 一种抗ceacam5和ceacam6抗体及其应用
US20250230256A1 (en) 2022-06-16 2025-07-17 Lamkap Bio Beta Ltd Combination therapy of bispecific antibodies against ceacam5 and cd47 and bispecific antibodies against ceacam5 and cd3
CN115960248A (zh) * 2022-07-08 2023-04-14 盛禾(中国)生物制药有限公司 一种二聚体融合蛋白及其应用
KR20250046323A (ko) 2022-08-10 2025-04-02 머크 샤프 앤드 돔 엘엘씨 Nkg2d, cd16 및 ceacam5에 결합하는 단백질
CN116731165B (zh) * 2023-03-23 2024-08-13 北京巴瑞医疗器械有限公司 一种抗血清素抗体及其应用
WO2025257185A1 (en) 2024-06-11 2025-12-18 Abcely Humanized anti-human-carcinoembryonic antigen antibody

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0388914A1 (de) * 1989-03-24 1990-09-26 BEHRINGWERKE Aktiengesellschaft Monoklonale Antikörper (MAK) gegen tumorassoziierte Antigene, ihre Herstellung und Verwendung
WO1992001047A1 (en) * 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1999010494A2 (en) * 1997-08-25 1999-03-04 Genentech, Inc. Agonist antibodies to the thrombopoietin receptor, and their therapeutic uses
WO2002044217A2 (en) * 2000-12-01 2002-06-06 The University Of Nottingham Humanised antibodies and uses thereof
WO2004035537A2 (en) * 2002-10-16 2004-04-29 Euro-Celtique S.A. Antibodies that bind cell-associated ca 125/o772p and methods of use thereof
WO2004056312A2 (en) * 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
WO2007071426A1 (en) * 2005-12-21 2007-06-28 Micromet Ag Pharmaceutical compositions with resistance to soluble cea
WO2007098283A2 (en) * 2006-02-27 2007-08-30 Biogen Idec Ma Inc. Use of antagonists of maif receptor complex molecules and neurotrophic factors for treatment of neurological diseases and disorders
US20090028851A1 (en) * 2004-10-01 2009-01-29 Maxplanck-Gesellschaft Zur Förderung Der Wissensch Novel Antibodies Directed to the Mammalian Eag1 Ion Channel Protein

Family Cites Families (186)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US672015A (en) 1900-10-05 1901-04-16 Alfred Schlatter Automatic switch for groups of transformers.
US4036945A (en) 1976-05-03 1977-07-19 The Massachusetts General Hospital Composition and method for determining the size and location of myocardial infarcts
US4331647A (en) 1980-03-03 1982-05-25 Goldenberg Milton David Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers
US4818709A (en) 1983-01-21 1989-04-04 Primus Frederick J CEA-family antigens, Anti-CEA antibodies and CEA immunoassay
US4824659A (en) 1985-06-07 1989-04-25 Immunomedics, Inc. Antibody conjugates
US5776093A (en) 1985-07-05 1998-07-07 Immunomedics, Inc. Method for imaging and treating organs and tissues
US5525338A (en) 1992-08-21 1996-06-11 Immunomedics, Inc. Detection and therapy of lesions with biotin/avidin conjugates
US5057313A (en) 1986-02-25 1991-10-15 The Center For Molecular Medicine And Immunology Diagnostic and therapeutic antibody conjugates
US6861511B1 (en) 1986-06-04 2005-03-01 Bayer Corporation Detection and quantification of neu related proteins in the biological fluids of humans
US4863713A (en) 1986-06-23 1989-09-05 The Board Of Trustees Of Leland Stanford Jr. Univ. Method and system for administering therapeutic and diagnostic agents
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5567610A (en) 1986-09-04 1996-10-22 Bioinvent International Ab Method of producing human monoclonal antibodies and kit therefor
FR2604092B1 (fr) 1986-09-19 1990-04-13 Immunotech Sa Immunoreactifs destines a cibler les cellules animales pour leur visualisation ou leur destruction in vivo
US6893625B1 (en) 1986-10-27 2005-05-17 Royalty Pharma Finance Trust Chimeric antibody with specificity to human B cell surface antigen
IL85035A0 (en) 1987-01-08 1988-06-30 Int Genetic Eng Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US6511665B1 (en) 1987-11-25 2003-01-28 Immunex Corporation Antibodies to interleukin-1 receptors
US5120525A (en) 1988-03-29 1992-06-09 Immunomedics, Inc. Radiolabeled antibody cytotoxic therapy of cancer
US6362325B1 (en) 1988-11-07 2002-03-26 Advanced Research And Technology Institute, Inc. Murine 4-1BB gene
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US5571714A (en) 1988-12-22 1996-11-05 Celtrix Pharmaceuticals, Inc. Monoclonal antibodies which bind both transforming growth factors β1 and β2 and methods of use
US6432402B1 (en) 1989-05-25 2002-08-13 Sloan-Kettering Institute For Cancer Research Anti-idiotypic antibody which induces an immune response against a glycosphingolipid and use thereof
AU645016B2 (en) 1989-06-02 1994-01-06 Johns Hopkins University School Of Medicine, The Monoclonal antibodies against leukocyte adhesion receptor beta-chain, methods of producing these antibodies and use therefore
US5081235A (en) 1989-07-26 1992-01-14 City Of Hope Chimeric anti-cea antibody
US7041293B1 (en) 1990-04-03 2006-05-09 Genentech, Inc. HIV env antibodies
US5229275A (en) 1990-04-26 1993-07-20 Akzo N.V. In-vitro method for producing antigen-specific human monoclonal antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US6764681B2 (en) 1991-10-07 2004-07-20 Biogen, Inc. Method of prophylaxis or treatment of antigen presenting cell driven skin conditions using inhibitors of the CD2/LFA-3 interaction
US5854416A (en) 1991-11-14 1998-12-29 The United States Of America As Represented By The Department Of Health And Human Services Streptococcus pneumoniae 37-KDA surface adhesin a protein and nucleic acids coding therefor
US5474771A (en) 1991-11-15 1995-12-12 The Trustees Of Columbia University In The City Of New York Murine monoclonal antibody (5c8) recognizes a human glycoprotein on the surface of T-lymphocytes, compositions containing same
JPH07506484A (ja) 1992-01-29 1995-07-20 サイ−クロン,インコーポレーテッド カルチノーマ関連抗原(sk1),sk1に対するモノクローナル抗体,これら抗体を産生する方法及びその使用
CA2131692A1 (en) 1992-03-09 1993-09-16 Sybille Muller An anti-idiotypic antibody and its use in diagnosis and therapy in hiv-related disease
US6129914A (en) 1992-03-27 2000-10-10 Protein Design Labs, Inc. Bispecific antibody effective to treat B-cell lymphoma and cell line
EP0633945B1 (en) 1992-04-03 1998-12-30 Genentech, Inc. ANTIBODIES TO ALPHAvBETA3 INTEGRIN
WO1993021940A1 (en) 1992-05-06 1993-11-11 Immunomedics, Inc. Intraoperative, intravascular and endoscopic tumor and lesion detection and therapy
US6096289A (en) 1992-05-06 2000-08-01 Immunomedics, Inc. Intraoperative, intravascular, and endoscopic tumor and lesion detection, biopsy and therapy
AU4231393A (en) 1992-05-08 1993-12-13 Genentech Inc. Antibodies to leukemia inhibitory factor
US5397703A (en) 1992-07-09 1995-03-14 Cetus Oncology Corporation Method for generation of antibodies to cell surface molecules
MD1367C2 (ro) 1992-11-13 2000-11-30 Idec Pharmaceuticals Corporation Metode de tratament al limfomului celulelor B, anticorpi anti-CD20, hibridom.
CA2163107C (en) 1993-05-17 2001-04-17 David Milton Goldenberg Improved detection and therapy of lesions with biotin/avidin-metal chelating protein conjugates
ATE335072T1 (de) 1993-05-28 2006-08-15 Scripps Research Inst Methoden für inhibition der cd14-abhängigen zellaktivierung
US6084067A (en) 1993-07-26 2000-07-04 Dana-Farber Cancer Institute CTLA4/CD28 ligands and uses therefor
UA40577C2 (uk) 1993-08-02 2001-08-15 Мерк Патент Гмбх Біспецифічна молекула, що використовується для лізису пухлинних клітин, спосіб її одержання, моноклональне антитіло (варіанти), фармацевтичний препарат, фармацевтичний набір (варіанти), спосіб видалення пухлинних клітин
US6468531B1 (en) 1993-09-09 2002-10-22 Duke University Method of promoting cellular function
AU1289795A (en) 1993-11-19 1995-06-06 Baylor College Of Medicine Monoclonal antibodies specific for human interleukin-5
US5443953A (en) 1993-12-08 1995-08-22 Immunomedics, Inc. Preparation and use of immunoconjugates
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
US6432404B1 (en) 1993-12-23 2002-08-13 Icos Corporation Methods of inhibiting locomotor damage following spinal cord injury with α D-specific antibodies
US5922572A (en) 1994-01-25 1999-07-13 Human Genome Sciences, Inc. Polynucleotides encoding haemopoietic maturation factor
US6074642A (en) 1994-05-02 2000-06-13 Alexion Pharmaceuticals, Inc. Use of antibodies specific to human complement component C5 for the treatment of glomerulonephritis
US6100389A (en) 1995-04-21 2000-08-08 Human Genome Sciences, Inc. Polynucleotides encoding a human chemotactic protein
US6303769B1 (en) 1994-07-08 2001-10-16 Immunex Corporation Lerk-5 dna
ES2251723T3 (es) 1994-08-12 2006-05-01 Immunomedics, Inc. Inmunoconjugados y anticuerpos humanizados especificos para linfoma de celulas b y celulas de leucemia.
US5587459A (en) 1994-08-19 1996-12-24 Regents Of The University Of Minnesota Immunoconjugates comprising tyrosine kinase inhibitors
US6458349B1 (en) 1995-06-02 2002-10-01 Human Genome Sciences, Inc. Chemokine β-4 polypeptides
US6174995B1 (en) 1994-08-23 2001-01-16 Haodong Li Human chemokines, CKβ4 and CKβ10/MCP-4
US6709653B1 (en) 1994-09-16 2004-03-23 Human Genome Sciences, Inc. Antibodies specific for human inositol monophosphatase H1
US5874540A (en) 1994-10-05 1999-02-23 Immunomedics, Inc. CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies
US5750370A (en) 1995-06-06 1998-05-12 Human Genome Sciences, Inc. Nucleic acid encoding human endothlein-bombesin receptor and method of producing the receptor
US6538121B1 (en) 1994-11-01 2003-03-25 Human Genome Sciences, Inc. Interleukin-1 β converting enzyme like apoptosis protease-3 and 4
US5677136A (en) 1994-11-14 1997-10-14 Systemix, Inc. Methods of obtaining compositions enriched for hematopoietic stem cells, compositions derived therefrom and methods of use thereof
US6521227B1 (en) 1999-11-18 2003-02-18 Peter L. Hudson Polynucleotides encoding prostatic growth factor and process for producing prostatic growth factor polypeptides
US6537764B1 (en) 1995-01-19 2003-03-25 Children's Medical Center Corporation Method of identifying inhibitors of C—C chemokine receptor 3
US5786204A (en) 1995-01-20 1998-07-28 Human Genome Sciences, Inc. Human prostatic specific reductase
US6312691B1 (en) 1996-01-26 2001-11-06 Jeffrey L. Browning Lymphotoxin-α/β complexes and anti-lympotoxin-β receptor antibodies as anti-tumor agents
US6949244B1 (en) 1995-12-20 2005-09-27 The Board Of Trustees Of The University Of Kentucky Murine monoclonal anti-idiotype antibody 11D10 and methods of use thereof
US5783404A (en) 1995-04-13 1998-07-21 Amgen Inc. Methods and compositions for determining HER-2/neu expression using monoclonal antibodies
US5686292A (en) 1995-06-02 1997-11-11 Genentech, Inc. Hepatocyte growth factor receptor antagonist antibodies and uses thereof
US5773252A (en) 1995-06-05 1998-06-30 Human Genome Sciences, Inc. Fibroblast growth factor 15
US5773292A (en) 1995-06-05 1998-06-30 Cornell University Antibodies binding portions, and probes recognizing an antigen of prostate epithelial cells but not antigens circulating in the blood
US6605441B1 (en) 1995-06-05 2003-08-12 Human Genome Sciences, Inc. Antibodies against fibroblast growth factor 11
AU6223296A (en) 1995-06-07 1996-12-30 Novartis Ag Methods for obtaining compositions enriched for hematopoieti c stem cells and antibodies for use therein
US6340459B1 (en) 1995-12-01 2002-01-22 The Trustees Of Columbia University In The City Of New York Therapeutic applications for the anti-T-BAM (CD40-L) monoclonal antibody 5C8 in the treatment of reperfusion injury in non-transplant recipients
US5783186A (en) 1995-12-05 1998-07-21 Amgen Inc. Antibody-induced apoptosis
US5945309A (en) 1996-03-19 1999-08-31 Human Genome Sciences, Inc. Cytostatin III nucleic acids encoding
EP0888125B1 (en) 1996-03-20 2004-05-26 Immunomedics, Inc. GLYCOSYLATED IgG ANTIBODIES
FR2746398B1 (fr) 1996-03-21 1998-04-30 Bio Merieux Anticorps specifique de staphylococcus aureaus, et utilisations
US6174992B1 (en) 1997-03-21 2001-01-16 Human Genome Sciences, Inc. Human endometrial specific steroid-binding factor I, II and III
US6962981B1 (en) 1996-03-25 2005-11-08 Medarex, Inc. Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen
US6004780A (en) 1996-03-26 1999-12-21 Human Genome Sciences, Inc. Growth factor HTTER36
US6110463A (en) 1996-03-29 2000-08-29 North Carolina State University Anti-Cryptosporidium parvum preparations
US6066617A (en) 1996-04-03 2000-05-23 Human Genome Sciences, Inc. Human cystatin F
AU717020B2 (en) 1996-05-03 2000-03-16 Immunomedics Inc. Targeted combination immunotherapy of cancer
US7011812B1 (en) 1996-05-03 2006-03-14 Immunomedics, Inc. Targeted combination immunotherapy of cancer and infectious diseases
US6136311A (en) 1996-05-06 2000-10-24 Cornell Research Foundation, Inc. Treatment and diagnosis of cancer
US6764688B2 (en) 1996-09-03 2004-07-20 Kaneka Corporation Method for inducing immunosuppressive cells and a culture device to be used therefor
WO1998015579A1 (en) 1996-10-09 1998-04-16 Canterbury Health Limited Dendritic cell-specific antibodies
US6653104B2 (en) 1996-10-17 2003-11-25 Immunomedics, Inc. Immunotoxins, comprising an internalizing antibody, directed against malignant and normal cells
US6812327B1 (en) 1996-10-25 2004-11-02 Human Genome Sciences, Inc. Neutrokine-alpha polypeptides
US6528625B1 (en) 1996-10-28 2003-03-04 Millennium Pharmaceuticals, Inc. Anti-CCR5 antibodies and kits comprising same
US6043348A (en) 1996-11-13 2000-03-28 Lawman; Michael J. P. Antibody recognizing a small subset of human hematopoietic cells
US6455040B1 (en) 1997-01-14 2002-09-24 Human Genome Sciences, Inc. Tumor necrosis factor receptor 5
US6605699B1 (en) 1997-01-21 2003-08-12 Human Genome Sciences, Inc. Galectin-11 polypeptides
US6046031A (en) 1997-01-21 2000-04-04 Human Genome Sciences, Inc. Metalloproteinases
US6342363B1 (en) 1997-01-28 2002-01-29 Human Genome Sciences, Inc. Death domain containing receptor 4 nucleic acids and methods
US6090381A (en) 1997-02-11 2000-07-18 Immunomedics, Inc. Stimulation of an immune response with antibodies labeled with the . .alpha-galactosyl epitope
CA2282410A1 (en) 1997-03-03 1998-10-01 Bristol-Myers Squibb Company Monoclonal antibodies to human cd6
US6919433B2 (en) 1997-03-14 2005-07-19 Human Genome Sciences, Inc. Antibodies to protein HPMBQ91
US6951924B2 (en) 1997-03-14 2005-10-04 Human Genome Sciences, Inc. Antibodies against secreted protein HTEBYII
US6872568B1 (en) 1997-03-17 2005-03-29 Human Genome Sciences, Inc. Death domain containing receptor 5 antibodies
US6306393B1 (en) 1997-03-24 2001-10-23 Immunomedics, Inc. Immunotherapy of B-cell malignancies using anti-CD22 antibodies
US6183744B1 (en) 1997-03-24 2001-02-06 Immunomedics, Inc. Immunotherapy of B-cell malignancies using anti-CD22 antibodies
ES2248898T3 (es) 1997-05-02 2006-03-16 The Government Of The Usa, As Represented By The Secretary, Department Of Health And Human Services Inmunotoxinas que comprenden una proteina onc dirigida contra celulas malignas.
US6284474B1 (en) 1998-04-23 2001-09-04 The Regents Of The University Of California Detection and diagnosis of conditions associated with lung injury
US6372217B1 (en) 1997-06-03 2002-04-16 Regents Of The University Of Minnesota Methods for the treatment of CD7+ viral infection with TXU-7-PAP
US6545130B2 (en) 1997-06-04 2003-04-08 Albert Einstein College Of Medicine Of Yeshiva University Monoclonal antibodies to mycobacterium tuberculosis and a modified ELISA assay
US6358508B1 (en) 1997-06-11 2002-03-19 Human Genome Sciences, Inc. Antibodies to human tumor necrosis factor receptor TR9
WO1999014330A1 (en) 1997-09-18 1999-03-25 Genentech, Inc. DcR3 POLYPEPTIDE, A TNFR HOMOLOG
US6689607B2 (en) 1997-10-21 2004-02-10 Human Genome Sciences, Inc. Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2
US6355244B1 (en) 1997-11-17 2002-03-12 University Of Kentucky Research Foundation Methods and compositions for the treatment of psoriasis
US6610833B1 (en) 1997-11-24 2003-08-26 The Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
WO1999033878A1 (en) 1997-12-25 1999-07-08 Japan Tobacco Inc. Monoclonal antibody against connective tissue growth factor and medicinal uses thereof
US6956107B2 (en) 1998-02-20 2005-10-18 Tanox, Inc. Inhibitors of complement activation
US6861227B2 (en) 1998-03-19 2005-03-01 Human Genome Sciences, Inc. Antibodies to cytokine receptor common gamma chain like
US6200765B1 (en) 1998-05-04 2001-03-13 Pacific Northwest Cancer Foundation Non-invasive methods to detect prostate cancer
US6458933B1 (en) 1998-05-20 2002-10-01 Immunomedics, Inc. Therapeutic using a bispecific antibody
US6881405B2 (en) 1998-06-15 2005-04-19 Altarex Medical Corp. Reagents and methods for inducing an immune response to prostate specific antigen
US7138103B2 (en) 1998-06-22 2006-11-21 Immunomedics, Inc. Use of bi-specific antibodies for pre-targeting diagnosis and therapy
US6962702B2 (en) 1998-06-22 2005-11-08 Immunomedics Inc. Production and use of novel peptide-based agents for use with bi-specific antibodies
US7405320B2 (en) 1998-06-22 2008-07-29 Immunomedics, Inc. Therapeutic and diagnostic conjugates for use with multispecific antibodies
US7387772B1 (en) 1999-06-22 2008-06-17 Immunimedics, Inc. Chimeric, human and humanized anti-CSAP monoclonal antibodies
US7052872B1 (en) 1999-06-22 2006-05-30 Immunomedics, Inc. Bi-specific antibodies for pre-targeting diagnosis and therapy
WO1999066951A2 (en) 1998-06-22 1999-12-29 Immunomedics, Inc. Use of bi-specific antibodies for pre-targeting diagnosis and therapy
US6528269B1 (en) 1998-06-22 2003-03-04 Case Western Reserve University Immunological agents specific for prion protein (PRP)
US6312689B1 (en) 1998-07-23 2001-11-06 Millennium Pharmaceuticals, Inc. Anti-CCR2 antibodies and methods of use therefor
US6572856B1 (en) 1998-09-10 2003-06-03 The University Of Virginia Patent Foundation Methods for the prevention and treatment of cancer using anti-C3b(i) antibodies
WO2000026418A1 (en) 1998-11-05 2000-05-11 The Board Of Trustees Of Leland Stanford Junior University Human pan-hcv human monoclonal antibodies
AU1728800A (en) 1998-11-18 2000-06-05 Genentech Inc. Antibody variants with higher binding affinity compared to parent antibodies
DE69930872T8 (de) 1998-12-21 2007-05-03 Ludwig Institute For Cancer Research Antikörper gegen verkürzten vegf-d und deren verwendungen
US6682736B1 (en) 1998-12-23 2004-01-27 Abgenix, Inc. Human monoclonal antibodies to CTLA-4
US6444790B1 (en) 1998-12-23 2002-09-03 Human Genome Sciences, Inc. Peptidoglycan recognition proteins
US6488930B1 (en) 1999-01-15 2002-12-03 Millennium Pharmaceuticals, Inc. Anti-CCR4 antibodies and methods of use therefor
EP1179541B1 (en) 1999-04-28 2004-06-16 Board Of Regents, The University Of Texas System Compositions and methods for cancer treatment by selectively inhibiting VEGF
US7666400B2 (en) 2005-04-06 2010-02-23 Ibc Pharmaceuticals, Inc. PEGylation by the dock and lock (DNL) technique
US7550143B2 (en) 2005-04-06 2009-06-23 Ibc Pharmaceuticals, Inc. Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses
US7534866B2 (en) 2005-10-19 2009-05-19 Ibc Pharmaceuticals, Inc. Methods and compositions for generating bioactive assemblies of increased complexity and uses
US7527787B2 (en) 2005-10-19 2009-05-05 Ibc Pharmaceuticals, Inc. Multivalent immunoglobulin-based bioactive assemblies
US6946129B1 (en) 1999-06-08 2005-09-20 Seattle Genetics, Inc. Recombinant anti-CD40 antibody and uses thereof
CA2375912C (en) 1999-06-09 2014-03-11 Immunomedics, Inc. Immunotherapy of autoimmune disorders using antibodies which target b-cells
US20020002270A1 (en) 1999-06-16 2002-01-03 Raymond P. Zinkowski Purified antigen for alzheimer's disease, and methods of obtaining and using same
US6355481B1 (en) 1999-06-18 2002-03-12 Emory University Hybridoma cell line and monoclonal antibody for huntingtin protein
US6964854B1 (en) 1999-07-13 2005-11-15 Science & Technology Corporation Compositions and methods useful for the diagnosis and treatment of heparin induced thrombocytopenia/thrombosis
US6693176B1 (en) 1999-07-23 2004-02-17 University Of Massachusetts Antitumor antibodies, proteins, and uses thereof
US6376654B1 (en) 1999-08-13 2002-04-23 Molecular Discoveries, Llc Myeloma cell and ovarian cancer cell surface glycoproteins, antibodies thereto, and uses thereof
US6716966B1 (en) 1999-08-18 2004-04-06 Altarex Corp. Therapeutic binding agents against MUC-1 antigen and methods for their use
US6630144B1 (en) 1999-08-30 2003-10-07 The United States Of America As Represented By The Secretary Of The Army Monoclonal antibodies to Ebola glycoprotein
US6824780B1 (en) 1999-10-29 2004-11-30 Genentech, Inc. Anti-tumor antibody compositions and methods of use
US20030031670A1 (en) 1999-11-08 2003-02-13 Jack R. Wands Diagnosis and treatment of malignant neoplasms
US6835370B2 (en) 1999-11-08 2004-12-28 Rhode Island Hospital Diagnosis and treatment of malignant neoplasms
US6994852B1 (en) 1999-11-12 2006-02-07 Temple University-Of The Commonwealth System Of Higher Education Inhibition of angiogenesis by antibodies against high molecular weight kininogen domain 5
US6994976B1 (en) 1999-11-19 2006-02-07 Tittle Thomas V Tr3-specific binding agents and methods for their use
US6319675B1 (en) 1999-11-24 2001-11-20 Millennium Pharmaceuticals, Inc. Methods for detecting and/or identifying agents which bind and/or modulate function of “bonzo” chemokine receptor
US6835549B2 (en) 2000-02-24 2004-12-28 University Of Medicine & Dentistry Of New Jersey Immunoassay method for the diagnosis of gastric intestinal metaplasia associated with gastric carcinoma
AU2001249410A1 (en) 2000-03-23 2001-10-03 Tanox, Inc. Anti-c2/c2a inhibitors of complement activation
IL152748A0 (en) 2000-05-11 2003-06-24 Altarex Inc Therapeutic method and composition utilizing antigen-antibody complexation and presentation by dendritic cells
CA2412377A1 (en) 2000-06-06 2001-12-13 Bristol-Myers Squibb Company B7-related nucleic acids and polypeptides and their uses for immunomodulation
AU2001278129A1 (en) 2000-07-31 2002-02-13 The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services Specific binding agents for kshv vil-6 that neutralize a biological activity
EP1309627B1 (en) 2000-08-08 2009-09-30 Immunomedics, Inc. Immunotherapy for chronic myelocytic leukemia with naked anti-nca-90 antibody
US7060802B1 (en) 2000-09-18 2006-06-13 The Trustees Of Columbia University In The City Of New York Tumor-associated marker
ATE464374T1 (de) 2000-10-02 2010-04-15 Oklahoma Med Res Found Assay zum schnellen nachweis vom humanen aktivierten protein c und hochspezifischer monoklonaler antikörper dagegen
AU2001296594A1 (en) 2000-10-10 2002-04-22 Tanox, Inc. Inhibition of complement c5 activation for the treatment and prevention of delayed xenograft or acute vascular rejection
BRPI0116728B1 (pt) 2001-01-05 2018-10-30 Pfizer Inc. anticorpos para receptor de fator de crescimento i semelhante à insulina
US6743898B2 (en) 2001-03-15 2004-06-01 Ochsner Clinic Foundation Monoclonal antibodies that suppress B cell growth and/or differentiation
US6824778B2 (en) 2001-04-23 2004-11-30 The United States Of America As Represented By The Secretary Of The Army Prophylactic and therapeutic monoclonal antibodies
US6962813B2 (en) 2001-05-21 2005-11-08 The Brigham And Women's Hospital, Inc. P. aeruginosa mucoid exopolysaccharide specific binding peptides
US7049060B2 (en) 2001-11-05 2006-05-23 Ortho-Clinical Diagnostics, Inc. HCV anti-core monoclonal antibodies
KR101033196B1 (ko) 2002-02-14 2011-05-09 이뮤노메딕스, 인코오포레이티드 항-cd20 항체 및 그 융합 단백질 및 이들의 이용방법
US7282567B2 (en) 2002-06-14 2007-10-16 Immunomedics, Inc. Monoclonal antibody hPAM4
KR101017732B1 (ko) 2002-03-01 2011-02-28 이뮤노메딕스, 인코오포레이티드 내재화 항-cd74 항체 및 그 이용방법
WO2003074566A2 (en) 2002-03-01 2003-09-12 Immunomedics, Inc. Rs7 antibodies
US7563433B2 (en) 2007-01-11 2009-07-21 Immunomedics, Inc. Methods and compositions for F-18 labeling of proteins, peptides and other molecules
CA2494310A1 (en) 2002-08-01 2004-02-12 Immunomedics, Inc. Alpha-fetoprotein immu31 antibodies and fusion proteins and methods of use thereof
US7541440B2 (en) 2002-09-30 2009-06-02 Immunomedics, Inc. Chimeric, human and humanized anti-granulocyte antibodies and methods of use
CN101972478B (zh) 2002-10-08 2012-10-31 免疫医疗公司 抗体治疗
CN101658672B (zh) * 2002-10-08 2017-09-26 免疫医疗公司 用iii类抗cea单克隆抗体和治疗剂进行联合治疗
EP1587835A4 (en) 2003-01-28 2007-03-28 Schering Corp ANTIBODIES WITH SPECIFICITY FOR PLASMA CYTOIDEDENDRITIC CELLS
CN1767860A (zh) 2003-01-31 2006-05-03 免疫医疗公司 施用治疗和诊断剂的方法和组合物
EP2216342B1 (en) 2003-07-31 2015-04-22 Immunomedics, Inc. Anti-CD19 antibodies
US7608425B2 (en) 2004-07-23 2009-10-27 Immunomedics, Inc. Methods for protein expression in mammalian cells in serum-free medium
US7531327B2 (en) 2004-07-23 2009-05-12 Immunomedics, Inc. Methods and compositions for increasing longevity and protein yield from a cell culture
US7537930B2 (en) 2004-07-23 2009-05-26 Immunomedics, Inc. Mammalian cell lines for increasing longevity and protein yield from a cell culture
ES2665422T3 (es) 2005-03-03 2018-04-25 Immunomedics Inc. Anticuerpos L243 humanizados
EP1874824A4 (en) 2005-04-06 2009-12-30 Ibc Pharmaceuticals Inc METHODS OF GENERATING STABLE COMPOUND RELATED COMPLEXES OF HOMODIMERS, HOMOTRATEERS OR DIMER SIZES AND USES THEREOF
JP6049163B2 (ja) 2008-07-21 2016-12-21 イミューノメディクス、インコーポレイテッドImmunomedics, Inc. 改善された治療上の特徴のための抗体の構造変異体
EP3009455A1 (en) * 2009-09-16 2016-04-20 Immunomedics Inc. Class i anti-cea antibodies and uses thereof
CA2895284A1 (en) * 2013-02-07 2014-08-14 Immunomedics, Inc. Pro-drug form (p2pdox) of the highly potent 2-pyrrolinodoxorubicin conjugated to antibodies for targeted therapy of cancer

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0388914A1 (de) * 1989-03-24 1990-09-26 BEHRINGWERKE Aktiengesellschaft Monoklonale Antikörper (MAK) gegen tumorassoziierte Antigene, ihre Herstellung und Verwendung
EP0727435B1 (de) * 1989-03-24 1998-06-03 BEHRINGWERKE Aktiengesellschaft Monoklonale Antikörper (MAK) gegen tumorassoziierte Antigene, ihre Herstellung und Verwendung
WO1992001047A1 (en) * 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1999010494A2 (en) * 1997-08-25 1999-03-04 Genentech, Inc. Agonist antibodies to the thrombopoietin receptor, and their therapeutic uses
WO2002044217A2 (en) * 2000-12-01 2002-06-06 The University Of Nottingham Humanised antibodies and uses thereof
WO2004035537A2 (en) * 2002-10-16 2004-04-29 Euro-Celtique S.A. Antibodies that bind cell-associated ca 125/o772p and methods of use thereof
WO2004056312A2 (en) * 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US20090028851A1 (en) * 2004-10-01 2009-01-29 Maxplanck-Gesellschaft Zur Förderung Der Wissensch Novel Antibodies Directed to the Mammalian Eag1 Ion Channel Protein
WO2007071426A1 (en) * 2005-12-21 2007-06-28 Micromet Ag Pharmaceutical compositions with resistance to soluble cea
WO2007098283A2 (en) * 2006-02-27 2007-08-30 Biogen Idec Ma Inc. Use of antagonists of maif receptor complex molecules and neurotrophic factors for treatment of neurological diseases and disorders

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP2478110A4 *

Cited By (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102911248B (zh) * 2011-08-05 2014-12-10 上海原子科兴药业有限公司 合成1,4-二取代三唑结构的188Re(CO)3标记化合物的方法
CN102911248A (zh) * 2011-08-05 2013-02-06 上海原子科兴药业有限公司 合成1,4-二取代三唑结构的188Re(CO)3标记化合物的方法
US11697684B2 (en) 2014-05-29 2023-07-11 Macrogenics, Inc. Tri-specific binding molecules that specifically bind to multiple cancer antigens
WO2015184203A1 (en) 2014-05-29 2015-12-03 Macrogenics, Inc. Tri-specific binding molecules and methods of use thereof
WO2015184207A1 (en) 2014-05-29 2015-12-03 Macrogenics, Inc. Tri-specific binding molecules that specifically bind to multiple cancer antigens and methods of use thereof
US11820818B2 (en) 2014-05-29 2023-11-21 Macrogenics, Inc. Multi-chain polypeptide-containing tri-specific binding molecules
EP3954703A2 (en) 2014-05-29 2022-02-16 MacroGenics, Inc. Tri-specific binding molecules and methods of use thereof
US10633440B2 (en) 2014-05-29 2020-04-28 Macrogenics, Inc. Multi-chain polypeptide-containing tri-specific binding molecules that specifically bind to multiple cancer antigens
US10647768B2 (en) 2014-05-29 2020-05-12 Macrogenics, Inc. Multi-chain polypeptide-containing tri-specific binding molecules
US11773164B2 (en) 2015-03-23 2023-10-03 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Anti-CEACAM6 antibodies and uses thereof
US11866495B2 (en) 2015-03-23 2024-01-09 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Anti-CEACAM6 antibodies and uses thereof
EP4338756A2 (en) 2015-08-20 2024-03-20 Autolus Limited Chimeric cytokine receptor
US10954301B2 (en) 2015-12-14 2021-03-23 Macrogenics, Inc. Bispecific molecules having immunoreactivity with PD-1 and CTLA-4, and methods of use thereof
US11840571B2 (en) 2015-12-14 2023-12-12 Macrogenics, Inc. Methods of using bispecific molecules having immunoreactivity with PD-1 and CTLA-4
WO2017149143A1 (en) 2016-03-04 2017-09-08 Agency For Science, Technology And Research Anti-lag-3 antibodies
WO2017194265A1 (en) 2016-05-10 2017-11-16 Agency For Science, Technology And Research Anti-CTLA-4 Antibodies
WO2017214092A1 (en) 2016-06-07 2017-12-14 Macrogenics, Inc. Combination therapy
US11942149B2 (en) 2017-02-24 2024-03-26 Macrogenics, Inc. Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof
EP4389226A2 (en) 2017-02-24 2024-06-26 MacroGenics, Inc. Bispecific binding molecules that are capable of binding cd137 and tumor antigens, and uses thereof
US11459394B2 (en) 2017-02-24 2022-10-04 Macrogenics, Inc. Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof
US11667724B2 (en) 2017-07-07 2023-06-06 Astellas Pharma Inc. Anti-human CEACAM5 antibody Fab fragment
US11795226B2 (en) 2017-12-12 2023-10-24 Macrogenics, Inc. Bispecific CD16-binding molecules and their use in the treatment of disease
EP3752196A1 (en) 2018-02-15 2020-12-23 MacroGenics, Inc. Variant cd3-binding domains and their use in combination therapies for the treatment of disease
US11685781B2 (en) 2018-02-15 2023-06-27 Macrogenics, Inc. Variant CD3-binding domains and their use in combination therapies for the treatment of disease
US12065503B2 (en) 2018-10-10 2024-08-20 Astellas Pharma Inc. Pharmaceutical composition containing tagged site-antihuman antibody fab fragment complex
US12221479B2 (en) 2018-12-19 2025-02-11 Bayer Aktiengesellschaft Pharmaceutical combination of anti CEACAM6 and TIM3 antibodies
JP7554781B2 (ja) 2019-06-04 2024-09-20 普米斯生物技術(珠海)有限公司 抗ceacam5モノクローナル抗体およびその調製方法およびその使用
JP2022536114A (ja) * 2019-06-04 2022-08-12 普米斯生物技術(珠海)有限公司 抗ceacam5モノクローナル抗体およびその調製方法およびその使用
CN110327074A (zh) * 2019-08-02 2019-10-15 无锡海斯凯尔医学技术有限公司 肝脏评价方法、装置、设备及计算机可读存储介质
WO2021023987A1 (en) 2019-08-05 2021-02-11 Autolus Limited Chimeric cytokine receptor
WO2022048883A1 (en) * 2020-09-04 2022-03-10 Merck Patent Gmbh Anti-ceacam5 antibodies and conjugates and uses thereof
WO2023073352A1 (en) 2021-10-25 2023-05-04 Autolus Limited Chimeric cytokine receptor
WO2024194630A1 (en) 2023-03-20 2024-09-26 Autolus Limited A chimeric cytokine receptor, which comprises a truncated il2rbeta and il2rgamma
WO2024243217A1 (en) * 2023-05-25 2024-11-28 BioLegend, Inc. Ceacam6 binding antibodies and antigen-binding fragments thereof
WO2024250924A1 (en) * 2023-06-05 2024-12-12 Nona Biosciences (Suzhou) Co., Ltd. Anti-ceacam5/6 dual-binding antibodies
CN118005796A (zh) * 2024-01-19 2024-05-10 南京鼓楼医院 一种靶向癌胚抗原的单域抗体、构建方法及其应用

Also Published As

Publication number Publication date
EP3009455A1 (en) 2016-04-20
US8945554B2 (en) 2015-02-03
US8771690B2 (en) 2014-07-08
US9371393B2 (en) 2016-06-21
US20150343087A1 (en) 2015-12-03
US20110064653A1 (en) 2011-03-17
US20150111279A1 (en) 2015-04-23
US8470994B2 (en) 2013-06-25
EP2478110A4 (en) 2013-11-27
CA2774260A1 (en) 2011-03-24
US8603479B1 (en) 2013-12-10
EP2478110B1 (en) 2016-01-06
US20130034492A1 (en) 2013-02-07
CA2774260C (en) 2018-10-09
US9139657B2 (en) 2015-09-22
US20140308278A1 (en) 2014-10-16
US20140079629A1 (en) 2014-03-20
US20130344071A1 (en) 2013-12-26
US8287865B2 (en) 2012-10-16
EP2478110A1 (en) 2012-07-25
CN102482701A (zh) 2012-05-30
CN102482701B (zh) 2015-05-13
IN2012DN01663A (https=) 2015-06-05

Similar Documents

Publication Publication Date Title
US9139657B2 (en) Class I anti-CEA antibodies and uses thereof
US10377829B2 (en) Isolated nucleic acid encoding an anti-IGF-1R antibody
EP2506881B1 (en) Combining radioimmunotherapy and antibody-drug conjugates for improved cancer therapy
US9272057B2 (en) Combining radioimmunotherapy and antibody-drug conjugates for improved cancer therapy
JP5786204B2 (ja) インスリン様増殖因子i型受容体(igf−1r)を標的とする新規クラスの単一特異性ヒト化抗体および二重特異性ヒト化抗体

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201080039267.1

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10817617

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 1663/DELNP/2012

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2774260

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2010817617

Country of ref document: EP