WO2007076032A2 - Compositions and methods for producing a composition - Google Patents

Compositions and methods for producing a composition Download PDF

Info

Publication number
WO2007076032A2
WO2007076032A2 PCT/US2006/049074 US2006049074W WO2007076032A2 WO 2007076032 A2 WO2007076032 A2 WO 2007076032A2 US 2006049074 W US2006049074 W US 2006049074W WO 2007076032 A2 WO2007076032 A2 WO 2007076032A2
Authority
WO
WIPO (PCT)
Prior art keywords
ctla4
molecules
composition
molar ratio
average molar
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2006/049074
Other languages
English (en)
French (fr)
Other versions
WO2007076032A3 (en
Inventor
Kirk J. Leister
Eugene J. Schaefer
Ronald Bates
Elizabeth A. Bramhall
David M. Didio
Robert Donaldson
Alan R. Flesher
Helen G. Haggerty
David H. Kirkley
John M. Tabor
Lee K. Tay
Pallaiah Thammana
Ajoy Velayudhan
David E. Smolin
Reb J. Russell
Thomas Vanden Boom
Jeffrey Schrimsher
Joyce Whitehead
Dean Brownell
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bristol Myers Squibb Co
Original Assignee
Bristol Myers Squibb Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=38218674&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2007076032(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to HRP20130975TT priority Critical patent/HRP20130975T1/hr
Priority to CA2634760A priority patent/CA2634760C/en
Priority to HK09101088.2A priority patent/HK1121173B/en
Priority to KR1020087017540A priority patent/KR101398713B1/ko
Priority to PL06848052T priority patent/PL1969007T4/pl
Priority to DK06848052.4T priority patent/DK1969007T3/da
Priority to SI200631696T priority patent/SI1969007T1/sl
Priority to JP2008547621A priority patent/JP5096369B2/ja
Priority to AU2006330922A priority patent/AU2006330922B2/en
Priority to EA200801571A priority patent/EA017765B1/ru
Priority to ES06848052T priority patent/ES2433092T3/es
Priority to EP06848052.4A priority patent/EP1969007B1/en
Priority to KR1020117029336A priority patent/KR101391457B1/ko
Application filed by Bristol Myers Squibb Co filed Critical Bristol Myers Squibb Co
Priority to US12/086,786 priority patent/US10508144B2/en
Priority to BRPI0620178-4A priority patent/BRPI0620178B1/pt
Publication of WO2007076032A2 publication Critical patent/WO2007076032A2/en
Publication of WO2007076032A3 publication Critical patent/WO2007076032A3/en
Priority to IL192098A priority patent/IL192098A/en
Priority to NO20082716A priority patent/NO20082716L/no
Priority to ZA2008/05301A priority patent/ZA200805301B/en
Anticipated expiration legal-status Critical
Priority to AU2010241289A priority patent/AU2010241289B2/en
Priority to IL229904A priority patent/IL229904A0/en
Priority to US16/042,977 priority patent/US10941189B2/en
Priority to US16/044,252 priority patent/US10851150B2/en
Priority to US16/044,217 priority patent/US10808021B2/en
Priority to US17/105,358 priority patent/US12030923B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/195Chemokines, e.g. RANTES
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/14Extraction; Separation; Purification
    • C07K1/16Extraction; Separation; Purification by chromatography
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B01PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
    • B01DSEPARATION
    • B01D15/00Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
    • B01D15/08Selective adsorption, e.g. chromatography
    • B01D15/26Selective adsorption, e.g. chromatography characterised by the separation mechanism
    • B01D15/38Selective adsorption, e.g. chromatography characterised by the separation mechanism involving specific interaction not covered by one or more of groups B01D15/265 and B01D15/30 - B01D15/36, e.g. affinity, ligand exchange or chiral chromatography
    • B01D15/3804Affinity chromatography
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • CTLA4 Cytotoxic T lymphocyte antigen 4
  • CD28 Cytotoxic T lymphocyte antigen 4
  • APCs antigen-presenting cells
  • CTLA4-Ig molecules are fusion proteins of the ligand-binding domain of cytotoxic T lymphocyte antigen 4 (CTLA4) and an immunoglobulin (Ig) heavy chain constant region.
  • CTLA4 cytotoxic T lymphocyte antigen 4
  • Ig immunoglobulin heavy chain constant region.
  • This soluble molecule exerts its physiological effects by binding to B7 antigens (CD80 and CD86) on the surface of various antigen-presenting cells (APC) 3 thus blocking the functional interaction of B7-1 and B7-2 with CD28 on the surface of T-cells. This blockade results in the suppression of T-cell activation, and hence, the suppression of the immune response.
  • CTLA4-Ig molecules can therefore provide a method for inhibiting tissue and/or solid organ transplant rejections, as well as a therapeutic use for diseases or disorders that relate to disregulated immune responses in general, including autoimmunity.
  • CTLA4-Ig molecules can suppress the production of anti-dsDNA antibodies and decrease nephritis in lupus prone mice; can reduce proteinuria and prolong survival in mice with advanced nephriti; and can improve clinical outcomes for psoriasis and rheumatoid arthritis.
  • CTLA4-Ig molecules To improve the therapeutic usefulness of CTLA4-Ig molecules, it is important to determine molecular alterations that can be made to enhance the efficacy of the molecule as an inhibitor of T cell stimulation, for example, by increasing the avidity and potency of the molecule for B7 antigens.
  • An increase in the avidity and potency of CTLA4-Ig molecules may allow for administration of a decreased amount of CTLA4-Ig molecules to a patient to achieve a desired therapeutic effect (i.e., administration of a lower dose).
  • An increase in the avidity and potency of CTLA4-Ig molecules may also decrease the number of doses or the frequency of doses that are administered to a patient to achieve a desired therapeutic effect.
  • the present invention relates to improved compositions and methods for producing CTLA4-Ig compositions.
  • the invention is directed to CTLA4-Ig molecules, improved compositions comprising CTLA4-Ig molecules, and improved methods for producing (including mass-producing) CTLA4-Ig molecules and other recombinant proteins.
  • the invention includes any permutations and/or combinations of any of the elements and characteristics described herein, whether described singly or in certain combinations or permutations.
  • the invention provides for a clonal Chinese Hamster Ovary cell population capable of producing CTLA4-Ig.
  • the invention provides for a clonal Chinese Hamster Ovary cell population capable of producing CTLA4-Ig, each cell comprising 30 or more copies of a CTLA4-Ig expression cassette.
  • the invention also provides for a clonal Chinese Hamster Ovary cell population capable of producing CTLA4-Ig, each cell comprising 30 or more copies of a CTLA4-Ig expression cassette, wherein the 30 or more copies are integrated at a single site in the genome of each cell.
  • the invention provides for a clonal Chinese Hamster Ovary cell population capable of producing CTLA4-Ig, wherein a CTLA4-Ig expression cassette is stable over about 105 passages.
  • the CTLA4-Ig is encoded by an expression cassette comprising a nucleic acid sequence described by Koduri R., et al. (Gene, 2001, 280:87-95) and in U.S. Patent Nos. 6,800,457 and 6,521,419, which are hereby incorporated by reference in their entireties.
  • the CTLA4- Ig is encoded by an expression cassette integrated into a cell genome from the cell population at a specific locus described by Koduri R., et al.
  • the population comprises a sub-population of cells comprising 33 or more copies of the CTLA4-Ig expression cassette, wherein the 33 or more copies are integrated at a single site in the genome of each cell of the subpopulation.
  • the invention provides for a clonal Chinese Hamster Ovary cell population capable of producing CTLA4-Ig, wherein at least 75% of the population of cells has 30 or more copies of a CTLA4-Ig expression cassette, wherein the 30 or more copies are integrated at a single site in the genome of each cell of the 75% of the population.
  • the invention provides for a clonal Chinese Hamster Ovary cell population capable of producing CTLA4- Ig, wherein at least 85% of the population of cells has 30 or more copies of a CTLA4-Ig expression cassette, wherein the 30 or more copies are integrated at a single site in the genome of each cell of the 85% of the population.
  • the invention provides for a clonal Chinese Hamster Ovary cell population capable of producing CTLA4-Ig, wherein at least 95% of the population of cells has 30 or more copies of a CTLA4-Ig expression cassette, wherein the 30 or more copies are integrated at a single site in the genome of each cell of the 95% of the population.
  • the cell population is capable of producing greater than 0.5 or more grams of CTLA4-Ig protein per liter of liquid culture, and wherein the CTLA4-Ig exhibits acceptable carbohydrate characteristics, where the molar ratio of sialic acid to CTLA4-Ig is from about 6 to about 14 at a culture scale of 1 ,000 L or more.
  • the cell population has been adapted to serum-free, chemically defined medium.
  • CTLA4-Ig produced from culture of the cell population has an extinction coefficient of 1.00 ⁇ 0.05 AU mL cm-1 mg-1.
  • the cell population when grown in culture, is capable of producing CTLA4-Ig polypeptides, wherein: (a) about 90% of the CTLA4-Ig polypeptides comprise an amino acid sequence of SEQ ID NO:2 beginning with the methionine at residue 27; (b) about 10% of the CTLA4-Ig polypeptides comprise the amino acid sequence of SEQ ID NO:2 beginning with the alanine at residue number 26; (c) about 4% of the CTLA4-Ig polypeptides comprise the amino acid sequence of SEQ ID NO:2 ending with the lysine at residue number 383, (d) about 96% of the CTLA4-Ig polypeptides comprise the amino acid sequence of SEQ ID NO:2 ending with the glycine at residue number 3
  • the invention provides for a progeny cell of the clonal cell, wherein the progeny cell produces CTLA4-Ig.
  • the progeny cell is obtained from culturing the clonal parental cell over at least 5 generations.
  • the progeny cell is obtained from culturing a cell over at least 10 generations, over at least 20 generations, over at least 40 generations, over at least 50 generations, over at least 75 generations, or over at least 100 generations.
  • the invention provides for a cell line produced from the clonal cell. In one embodiment, the cell line is clonal.
  • the invention provides for a cell line capable of producing: (a) a CTLA4-Ig fusion protein having an amino acid sequence of SEQ ID NO: 10 (methionine at amino acid position 27 and glycine at amino acid position 382; Figures IA and IB); (b) a CTLA4-Ig fusion protein having an amino acid sequence of SEQ ID NO: 7 (methionine at amino acid position 27 and lysine at amino acid position 383; Figures IA and IB); (c) a CTLA4-Ig fusion protein having an amino acid sequence of SEQ ID NO: 9 (alanine at amino acid position 26 and glycine at amino acid position 382; Figures IA and IB); (d) a CTLA4-Ig fusion protein having an amino acid sequence of SEQ ID NO: 6 (alanine at amino acid position 26 and lysine at amino acid position 383; Figures IA and IB); (e) a CTLA4-Ig fusion protein having an amino acid sequence of
  • the cell line is capable of producing CTLA4-Ig fusion proteins, wherein: (a) about 90% of the CTLA4-Ig polypeptides comprise an amino acid sequence of SEQ ID NO:2 beginning with the methionine at residue 27; (b) about 10% of the CTLA4-Ig polypeptides comprise the amino acid sequence of SEQ ID NO:2 beginning with the alanine at residue number 26; (c) about 4% of the CTLA4-Ig polypeptides comprise the amino acid sequence of SEQ ID NO:2 ending with the lysine at residue number 383, (d) about 96% of the CTLA4-Ig polypeptides comprise the amino acid sequence of SEQ ID NO:2 ending with the glycine at residue number 382; and optionally, (e) about less than 1% of the CTLA4-Ig polypeptides comprise the amino acid sequence of SEQ ID NO:2 beginning with the methionine at residue number 25.
  • the CTLA4-Ig fusion proteins which are produced from culturing the cell line, have an extinction coefficient of 1.00 ⁇ 0.05 AU mL cm-1 mg-1.
  • the invention provides for a cell population derived from the clonal cell line.
  • the cell population consists of at least one additional genetic change as compared to the • original clonal cell line and wherein the derived cell population is capable of producing CTLA4-Ig.
  • the cell population consists of at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 10, at least 15, or at least 20 additional genetic changes as compared to the parental cell, and wherein the derived cell population is capable of producing CTLA4-Ig.
  • the genetic change comprises at least one non-conservative mutation in the cellular genome or in the recombinant expression cassette encoding CTLA4-Ig. In another embodiment, the genetic change comprises at least one additional recombinant nucleic acid within the cell. In a further embodiment, the change comprises a mutation of the cellular genome. In another embodiment, the change comprises the addition of a nucleic acid to either the cell genome or as a trans nucleic acid, which encodes an anti-apoptotic polypeptide. In another embodiment, the anti-apoptotic polypeptide relates to glycosylation. In another embodiment, genetic change comprises at least one mutation of the cellular genome or of the recombinant expression cassette encoding CTLA4-Ig.
  • compositions The invention provides for a population of CTLA4-Ig molecules having an average molar ratio of sialic acid groups to CTLA4-Ig dimer or molecule of from about 6 to about 18.
  • the invention provides for a population of CTLA4-Ig molecules having an average molar ratio of sialic acid groups to CTLA4-Ig dimer or molecule of from about 8 to about 18.
  • the invention provides for a population of CTLA4-Ig molecules having an average molar ratio of sialic acid groups to CTLA4-Ig dimer or molecule of from about 1 1 to about 18.
  • the invention provides for a population of CTLA4-Ig molecules having an average molar ratio of sialic acid groups to CTLA4-lg dimer or molecule of from about 12 to about 18.
  • the invention provides for a population of CTLA4-Ig molecules having an average molar ratio of sialic acid groups to CTLA4-Ig dimer or molecule of from about 13 to about 18.
  • the invention provides for a population of CTLA4-Ig molecules having an average molar ratio of sialic acid groups to CTLA4-Ig dimer or molecule of from about 14 to about 18.
  • the invention provides for a population of CTLA4-Ig molecules having an average molar ratio of sialic acid groups to CTLA4-Ig dimer or molecule of from about 15 to about 17.
  • the invention provides for a population of CTLA4-Ig molecules having an average molar ratio of sialic acid groups to CTLA4-Ig dimer or molecule of about 16.
  • the invention provides for a population of CTLA4-Ig molecules, wherein greater than 95% of the molecules are CTLA4-Ig dimers. In one embodiment, greater than 98% of the molecules are CTLA4-Ig dimers. In another embodiment, greater than 99% of the molecules are CTLA4-Ig dimers. In another embodiment, greater than 99.5% of the molecules are CTLA4-Ig dimers.
  • CTLA4-Ig dimers from about 95% to about 99.5% of the molecules are CTLA4-Ig dimers and about 0.5% to about 5% of the molecules are CTLA4-Ig tetramers or high molecular weight species.
  • about 98.6% of the molecules are CTLA4-Ig dimers and about 1.2% of the molecules are CTLA4-Ig tetramers or high molecular weight species and about less than 0.7 % of the molecules are CTLA4-Ig monomers.
  • the invention provides for a population consisting of CTLA4-Ig dimers.
  • the invention provides for a population of CTLA4-Ig molecules, wherein the population is substantially free of CTLA4-Ig monomer.
  • the invention provides for a population of CTLA4-Ig molecules, wherein the population is substantially free of CTLA4-Ig tetramer.
  • the invention provides for a population of CTLA4-Ig monomer molecules substantially free of CTLA4-Ig dimer and tetramer.
  • each monomer of each CTLA4-Ig dimer has at least 3 sialic acid groups.
  • each monomer of each CTLA4-Ig dimer has from at least 3 sialic acid groups to at least 8 sialic acid groups.
  • the • invention provides for a purified population of CTLA4-Ig tetramer molecules, the population being substantially free of CTLA4-Ig dimer, and optionally wherein the population comprises an amount that is greater than about 100 grams.
  • each tetramer molecule comprises two pairs of CTLA4-Ig polypeptides, wherein each polypeptide has an amino acid sequence selected from the group consisting of SEQ ID NOS: 5-10, and wherein each member of the pair of polypeptides is covalently linked to the other member, and wherein the two pairs of polypeptides are non-covalently associated with one another.
  • each tetramer molecule is capable of binding to a CD80 or CD86.
  • each tetramer molecule has at least a 2-fold greater avidity for CD80 or CD86 as compared to a CTLA4-Ig dimer molecule. In another embodiment, each tetramer molecule has at least a 2- fold greater inhibition of T cell proliferation or activation as compared to a CTLA4-Ig dimer molecule.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the composition comprises dominant isoforms visualizable on an isoelectric focusing gel of CTLA4-Ig which have an isoelectric point, pi, less than or equal to 5.1 as determined by isoelectric focusing.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the composition comprises dominant isoforms visualizable on an isoelectric focusing gel of CTLA4-Ig which have an isoelectric point, pi, less than or equal to 5.8 as determined by isoelectric focusing.
  • the pi increases after neuraminidase treatment.
  • the composition comprises dominant iso forms visualizable on an isoelectric focusing gel of CTLA4-Ig which have an isoelectric point, pi, less than or equal to 5.7, 5.6, 5.5, 5.4, 5.3, 5.2, 5.1, 5.0, 4.9, 4.8, 4.7, 4.6, or 4.5 as determined by isoelectric focusing.
  • At least 40% of the CTLA4-Ig molecules exhibit an isoelectric point less than or ' equal to about 5.1 as determined by isoelectric focusing.
  • at least 70% of the CTLA4-Ig molecules exhibit an isoelectric point less than or equal to about 5.1 as determined by isoelectric focusing.
  • at least 90% of the CTLA4-Ig molecules exhibit an isoelectric point less than or equal to about 2.5 as determined by isoelectric focusing.
  • the invention provides for a population of CTLA4-Ig molecules having a pi of from about 2.0 ⁇ 0.2 to about 5.0 ⁇ 0.2.
  • the invention provides for a population of CTLA4-Ig molecules having a pi of from about 4.0 ⁇ 0.2 to about 5.0 ⁇ 0.2.
  • the invention provides for a population of CTLA4-Ig molecules having a pi from about 4.3 ⁇ 0.2 to about 5.0 ⁇ 0.2.
  • the invention provides for a population of CTLA4-Ig molecules having a pi of about 3.3 ⁇ 0.2 to about 4.7 ⁇ 0.2.
  • the invention provides for a method for preparing a composition, the composition comprising a CTLA4-Ig molecule with a pi of from about 2.0 ⁇ 0.2 to about 5.0 ⁇ 0.2, the method comprising: (a) subjecting a mixture of CTLA4-Ig molecules to isoelectric focusing gel electrophoresis, wherein a single band on the gel represents a population of CTLA4-Ig molecules with a particular pi, and (b) isolating the population of CTLA4-Ig molecules having a pi of from about 2.0 ⁇ 0.2 to about 5.0 ⁇ 0.2 so as to prepare the composition.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are characterized by an average molar ratio of GIcNAc per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule of from about 15 to about 35.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4- Ig molecules are characterized by an average molar ratio of GaINAc per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule of from about 1.7 to about 3.6.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are characterized by an average molar ratio of galcatose per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule of from about 8 to about 17.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are characterized by an average molar ratio of fucose per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule of from about 3.5 to about 8.3.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are characterized by an average molar ratio of mannose per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule of from about 7.2 to about 22.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are characterized by an average molar ratio of sialic acid per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule of from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc per mole of CTLA4-Ig dimer or CTLA4-Ig molecule from about 15 to about 35; and (b) an average molar ratio of sialic acid per mole of CTLA4-Ig dimer or CTLA4-Ig molecule from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-lg molecules characterized by: (a) an average molar ratio of GIcNAc per mole of CTLA4-Ig dimer or CTLA4-Ig molecule from about 15 to about 35; (b) an average molar ratio of GaINAc per mole CTLA4-Ig dimer or CTLA4-Ig molecule from about 1.7 to about 3.6; and (c) an average molar ratio of sialic acid per mole of CTLA4-Ig dimer or CTLA4-Ig molecule from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc per mole of CTLA4-Ig dimer or CTLA4-Ig molecule from about 15 to about 35; (b) an average molar ratio of GaINAc per mole CTLA4-Ig dimer or CTLA4-Ig molecule from about 1.7 to about 3.6; (c) an average molar ratio of galcatose per mole CTLA4-Ig dimer or CTLA4-Ig molecule from about 8 to about 17; and (d) an average molar ratio of sialic acid per mole of CTLA4-Ig dimer or CTLA4-Ig molecule from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc per mole of CTLA4-Ig dimer or CTLA4-Ig molecule from about 15 to about 35; (b) an average molar ratio of GaINAc per mole CTLA4-Ig dimer or CTLA4-Ig molecule from about 1.7 to about 3.6; (c) an average molar ratio of galcatose per mole CTLA4-Ig dimer or CTLA4-Ig molecule from about 8 to about 17; (d) an average molar ratio of fucose per mole CTLA4-Ig dimer or CTLA4-Ig molecule from about 3.5 to about 8.3; and (e) an average molar ratio of sialic acid per mole of CTLA4-Ig dimer or CTLA4-Ig molecule from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc per mole of CTLA4-Ig dimer or CTLA4-Ig molecule from about 15 to about 35; (b) an average molar ratio of GaINAc per mole CTLA4-Ig dimer or molecule from about 1.7 to about 3.6; (c) an average molar ratio of galcatose per mole CTLA4-Ig dimer or molecule from about 8 to about 17; (d) an average molar ratio of fucose per mole CTLA4-Ig dimer or molecule from about 3.5 to about 8.3; (e) an average molar ratio of mannose per mole CTLA4-Ig dimer or molecule from about 7.2 to about 22; and (f) an average molar ratio of sialic acid per mole of CTLA4-Ig dimer or CTLA4-Ig molecule from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein composition exhibits an NGNA chromatogram peak of about 9.589+/-0.3 and an NANA chromatogram peak of about 10.543+/-0.3.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA-Ig molecules exhibit a carbohydrate profile as shown in Figure 68.
  • the invention provides for a composition comprising CTLA4- Ig molecules, wherein the CTLA4-Ig molecules exhibit a carbohydrate profile of Domains I — V (e.g., I-IV), wherein Domain I comprises peaks which represent a-sialylated oligosaccharides, Domain II comprises peaks which represent mono-sialylated oligosaccharides, Domain III comprises peaks which represent di-sialylated oligosaccharides, and Domain IV comprises peaks which represent tri-sialylated oligosaccharides. Domain V comprises peaks that represent tetra-sialyated oligosaccharides.
  • Domains I — V e.g., I-IV
  • the difference in retention times of N-linked oligosaccharides between a first peak in Domain I and a main peak in Domain II is from about 22 to about 28 minutes.
  • the invention provides for a composition comprising CTLA4-Ig dimer molecules, wherein at least 0.5 % of the CTLA4-Ig dimer molecules are cysteinylated. In one embodiment, at least 1.0% of the CTLA4-Ig dimer molecules are cysteinylated.
  • the invention provides for a population of CTLA4-Ig molecules, wherein the population exhibits a mass spectrometry profile as shown in Figures 8 and 10.
  • the invention provides for a population of CTLA4-Ig molecules, wherein the population exhibits a capillary electrophoresis profile as shown in Figures 20 and 21.
  • the invention provides for a composition of CTLA4-Ig molecules having an average molar ratio of sialic acid groups to CTLA4-Ig dimer of from about 6 to about 18.
  • the invention provides for a CTLA4-Ig composition obtained by any of the methods described herein.
  • the invention provides for a population of CTLA4-lg molecules, wherein the molecules are glycosylated at an aparagine amino acid residue at position 102 of SEQ ID NO:2, an aparagine amino acid residue at position 134 of SEQ ID NO:2, an aparagine amino acid residue at position 233 of SEQ ID NO:2, a serine amino acid residue at position 155 of SEQ ID NO:2, or a serine amino acid residue at position 165 of SEQ ID NO:2.
  • the invention provides for a population of CTLA4-Ig molecules, wherein the population of molecules is characterized by: (a) an average molar ratio of GIcNAc per mole of CTLA4-Ig dimer or CTLA4-Ig molecule from about 15 to about 35; (b) an average molar ratio of GaINAc per mole CTLA4-Ig dimer or molecule from about 1.7 to about 3.6; (c) an average molar ratio of galcatose per mole CTLA4-Ig dimer or molecule from about 8 to about 17; (d) an average molar ratio of fucose per mole OTLA4-Ig dimer or molecule from about 3.5 to about 8.3; (e) an average molar ratio of mannose per mole CTLA4-Ig dimer or molecule from about 7.2 to about 22; (f) an average molar ratio of sialic acid per mole of CTLA4-Ig dimer or molecule from about 6 to about 12; (a) an
  • compositions The invention provides for a composition comprising an effective amount of the CTLA4-Ig molecules of the invention and a pharmaceutically acceptable carrier.
  • the invention provides for a composition comprising excipients as described in U.S. Application No. 60/752,150, filed December 20, 2005.
  • the composition includes CTLA4-Ig.
  • the composition further comprises a pharmaceutically acceptable diluent, adjuvant or carrier.
  • the composition further comprises maltose, sodium phosphate monobasic monohydrate, sodium chloride, sodium hydroxide, and sterile water.
  • the composition comprises sucrose, poloxamer, sodium phosphate monobasic monohydrate, sodium phosphate dibasic anhydrous, sodium chloride, sodium hydroxide, and sterile water.
  • the invention provides for a lyophilized CTLA4-Ig mixture comprising at least 95% CTLA4-Ig dimer, and not more than 5% CTLA4-Ig tetramer.
  • the mixture comprises at least 98% CTLA4-Ig dimer and no more than 2% CTLA4-Ig high molecular weight species or tetramer.
  • the mixture comprises at least 99% CTLA4-Ig dimer and no more than 1 % CTLA4-Ig high molecular weight species or tetramer.
  • the mixture comprises at least 8.0 moles of sialic acid per mole of CTLA4-Ig dimer or molecule.
  • the mixture comprises from about 15.7 to about 31 moles of GIcNAc per mole of CTLA4-Ig dimer or molecule. In another embodiment, the mixture comprises from about 1.6 to about 3.2 moles of GaINAc per mole of CTLA4-Ig dimer or molecule. In another embodiment, the mixture comprises from about 9.3 to about 15.5 moles of galactose per mole of CTLA4-Ig dimer or molecule. In one embodiment, the mixture comprises from about 3.6 to about 7.9 moles of fucose per mole of CTLA4-Ig dimer or molecule. In one embodiment, the mixture comprises from about 9.7 moles of mannose per mole of CTLA4-Ig dimer or molecule.
  • the invention also provides for a pharmaceutical kit comprising: (a) a container containing a lyophilized CTLA4-Ig mixture of the invention; and (b) instructions for reconstituting the lyophilized CTLA4-Ig mixture into solution for injection.
  • the invention provides for a method for inhibiting T cell proliferation (or activation), the method comprising contacting a T cell with an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for a method for inhibiting an immune response in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for a method for inducing immune tolerance to an antigen in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for a method for treating inflammation in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for a method for treating rheumatoid arthritis comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for a method for treating psoriasis in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for a method for treating lupus in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for a method for treating or preventing an allergy in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for a method for treating or preventing graft vs host disease in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for a method for treating or preventing rejection of a transplanted organ in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for a method for treating multiple sclerosis in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for a method for treating Crohn's Disease in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides a method for treating type I diabetes in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-lg composition of the invention.
  • the invention provides a method for treating inflammatory bowel disease in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides a method for treating oophoritis in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides a method for treating glomerulonephritis in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides a method for treating allergic encephalomyelitis in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides a method for treating myasthenia gravis in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention.
  • the invention provides for the use of a population of CTLA4-Ig molecules having an average molar ratio of sialic acid groups to CTLA4-Ig dimer or molecule of from about 6 to about 1 S in the manufacture of a medicament for the therapeutic and/or prophylactic treatment of an immune disorder.
  • the invention provides for the use of a population of CTLA4-Ig molecules having an average molar ratio of sialic acid groups to CTLA4-Ig dimer or molecule of from about 6 to about 18 in the manufacture of an anti-rheumatoid arthritis agent in a package together with instructions for its use in the treatment of rheumatoid arthritis.
  • the invention provides for a method for inhibiting T cell proliferation (or activation), the method comprising contacting a T cell with an effective amount of a CTLA4-Ig composition of the invention in combination with methotrexate.
  • the invention provides a method for inhibiting an immune response in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention in combination with methotrexate.
  • the invention provides a method for inducing immune tolerance to an antigen in a subject, the method comprising administering to a subject in need thereof an effective amount of a CTLA4-Ig composition of the invention in combination with methotrexate.
  • the invention provides a method for producing a recombinant protein, the method comprising: (a) expanding mammalian cells that secrete a recombinant protein, wherein the expanding is from a seed culture to a liquid culture, wherein the recombinant protein concentration is at least 0.5 grams / L of liquid culture; and (b) isolating the recombinant protein from the liquid culture.
  • the liquid culture can be at least 1,000 L, at least 5,000 L, at least 10,000 L, at least 15,000 L, at least 20,000 L, at least 25,000 L, at least 30,000 L, at least 40,000 L.
  • the expanding of step (a) comprises: (i) culturing the cells in a serum-free, chemically defined medium with at least four passages so as to obtain a cell density of at least about 1.0 x 10 5 viable cells per mL, wherein each seed stage starts at about 2 x 10 5 per ml and goes to 1-2 mil cells per ml; (ii) maintaining the cells in culture for a time sufficient to produce from the culture at least about 0.5 g / L.
  • the protein is a glycoprotein.
  • the protein is a CTLA4-Ig protein.
  • the mammalian cells are progeny of a CHO clonal cell line capable of producing CTLA4-Ig fusion protein, wherein the CHO cells have stably integrated in their genome at least 30 copies of a CTLA4-Ig expression cassette.
  • the time sufficient is a time by which the cells' viability does not fall below 30%. In another embodiment, the time sufficient is a time by which the cells' viability does not fall below 40%. In another embodiment, the time sufficient is a time by which the cells' viability does not fall below 50%. In another embodiment, the time sufficient is a time by which the cells' viability does not fall below 60%. In another embodiment, the time sufficient is a time by which the cells' viability does not fall below 70%, or 80% or 90% or 95%.
  • the at least four passages comprises: (i) growing the cells in a culture volume of at least 50 mL until a cell density of from about 1 million to about 2.5 mill eels per ml is reached, (ii) growing the cells in a culture volume of at least 10 L until a cell density of about 1 million to about 2.5 million eels per ml is reached; (iii) growing the cells in a culture volume of at least 100 L until a cell density of about 1 million to about 2.5 million eels per ml is reached; and (iv) growing the cells in a culture volume of 200 L until a cell density of about 1 million to about 2.5 million eels per ml is reached.
  • galactose is added to the serum-free, chemically defined medium.
  • the maintaining comprises (i) lowering the temperature of the culture from 37 ⁇ 2°C to 34 ⁇ 2°C; and (ii) lowering the temperature of the culture from 34 ⁇ 2°C to 32 ⁇ 2°C.
  • the temperature is kept within the range of 32 ⁇ 2°C for at least 5 days.
  • the temperature is kept within the range of 32 ⁇ 2°C for at least 6 days.
  • the temperature is kept within the range of 32 ⁇ 2°C for at least 7 days.
  • the temperature is kept within the range of 32 ⁇ 2°C for at least 8 days.
  • the temperature is kept within the range of 32 ⁇ 2°C for at least 9 days. In another embodiment, the temperature is kept within the range of 32 ⁇ 2°C for at least 10 days. In another embodiment, the temperature is kept within the range of 32 ⁇ 2°C for at least 11 days. In another embodiment, the temperature is kept within the range of 32 ⁇ 2°C for at least 12 days. In another embodiment, the temperature is kept within the range of 32 ⁇ 2°C for at least 13 days. In another embodiment, the temperature is kept within the range of 32 ⁇ 2°C for at least 14 days. In another embodiment, the temperature is kept within the range of 32 ⁇ 2°C for at least 15 days. In another embodiment, the temperature is kept within the range of 32 ⁇ 2°C for at least 16 days.
  • the temperature is kept within the range of 32 ⁇ 2°C for at least 17 days. In another embodiment, the temperature is kept within the range of 32 ⁇ 2°C for at least 18 days. In another embodiment, the temperature is kept within the range of 32 ⁇ 2°C for up to 18 days. In another embodiment, the temperature is kept within the range of 32 ⁇ 2°C until the cell density of the culture is from about 30 x 10 s to about 79 x 10 s cells per mL of liquid culture.
  • the invention provides for a method for producing a recombinant protein, the method comprising: (a) expanding mammalian cells that secrete a recombinant protein from a seed culture to a liquid culture so that the recombinant protein concentration is at least 0.5 grams / L of liquid culture; and (b) isolating the recombinant protein from the liquid culture, wherein the isolating occurs only when the liquid culture contains greater than or equal to about 6.0 moles of NANA per mole of CTLA4-Ig protein or dimer.
  • the invention provides for a method for producing a recombinant protein, the method comprising: (a) expanding mammalian cells that secrete a recombinant protein from a seed culture to a liquid culture of so that the recombinant protein concentration is at least 0.5 grams / L of liquid culture; and (b) isolating the recombinant protein from the liquid culture, wherein the isolating occurs only when the liquid culture has a cell density of from about 33 x 10 s to about 79 x 10 s cells per mL.
  • the invention provides for a method for producing a recombinant protein, the method comprising: (a) expanding mammalian cells that secrete a recombinant protein from a seed culture to a liquid culture so that the recombinant protein concentration is at least 0.5 grams / L of liquid culture; and (b) isolating the recombinant protein from the liquid culture, wherein the isolating occurs when cell viability in the liquid culture has not fallen below about 20%, or about 30%, or about 38%.
  • the invention provides for a method for producing a recombinant protein, the method comprising: (a) expandingmammalian cells that secrete a recombinant protein from a seed culture to a liquid culture of at least 10,000 L so that the recombinant protein concentration is at least 0.5 grams / L of liquid culture; and (b) isolating the recombinant protein from- the liquid culture, wherein the isolating occurs only when endotoxin is less than or equal to about 76.8 EU per mL. of liquid culture.
  • the invention provides for a method for producing a recombinant protein, the method comprising: (a) expanding mammalian cells that secrete a recombinant protein from a seed culture to a liquid culture of at least 10,000 L so that the recombinant protein concentration is at least 0.5 grams / L of liquid culture; and (b) isolating the recombinant protein from the at least 10,000 L liquid culture, wherein the isolating occurs only when bioburden is less than 1 colony forming unit per mL of liquid culture.
  • the liquid culture of the invention can be of a volume of at least 5,000 L, at least 10,000 L, at least 15,000 L, at least 20,000 L, at least 25,000 L, at least 30,000 L, at least 40,000 L, at least 50,000 L, at least 60,000 L.
  • the invention provides a method for producing a recombinant protein, the method comprising: (a) expanding mammalian cells that secrete a recombinant protein from a seed culture to a liquid culture so that the recombinant protein concentration is at least 0.5 grams / L of liquid culture; and (b) isolating the recombinant protein from the liquid culture, wherein the isolating occurs only if at least two of the following conditions are met: (i) the liquid culture contains greater than or equal to about 6:0 moles of NANA per mole of protein, (ii) the liquid culture has a cell density of from about 33 x 10 5 to about 79 x 10 5 cells per mL,(iii) cell viability in the liquid culture has not fallen below about 20%, or about 38%, or (iv) amount of CTLA4-Ig in the culture is greater than 0.5 g / L.
  • the isolating comprises: (i) obtaining a cell culture supernatent; (ii) subjecting the supernatant to anion exchange chromotagraphy to obtain an eluted protein product; (iii) subjecting the eluted protein product of step (ii) to hydrophobic interaction chromatography so as to obtain an enriched protein product; (iv) subjecting the enriched protein product to affinity chromatography to obtain an eluted and enriched protein product; and (v) subjecting the eluted and enriched protein product of (iv) to anion exchange chromatography.
  • the enriched protein product obtained in step (iii) is characterized in that a percentage of any high molecular weight contaminant is less than 25% by weight.
  • the anion exchange chromatography of step (ii) is earned -out using a wash buffer comprising about 75 mM HEPES, and about 360 ⁇ iM NaCl, and having a pH of about 8.0.
  • the anion exchange chromatography of step (ii) is carried out using an elution buffer comprising about 25 mM HEPES, and about 325 mM NaCl,- and having a pH of about 7.0.
  • the hydrophobic interaction chromatography of step (iii) is carried out using a single wash buffer comprising about 25 mM HEPES, and about 850 mM NaCl, and ' having a pH of about 7.0.
  • the affinity chromatography of step (iv) is carried out using a wash buffer comprising about 25 mM Tris. and about 250 mM NaCl, and having a pH of about 8.0.
  • the affinity chromatography of step (iv) is carried out using an elution buffer comprising about 100 mM Glycine and having a pH of about 3.5.
  • the anion exchange chromatography of step (v) is carried out using a wash buffer comprising about 25 mM HEPES, and from about 120 mM NaCl to about 130 mM NaCl, and having a pH of about 8.0. In another embodiment, the anion exchange chromatography of step (v) is carried out using an elution buffer comprising about 25 mM HEPES, and about 200 mM NaCl, and having a pH of about 8.0. In another embodiment, the anion exchange chromatography of step (ii) is carried out using a column having an anion exchange resin having a primary, secondary, tertiary, or quartenary amine functional group.
  • the resin has a quartenary amine functional group.
  • the hydrophobic interaction chromatography of step (iii) is carried out using a hydrophobic interaction resin having a phenyl, an octyl, a propyl, an alkoxy, a butyl, or an isoamyl functional group.
  • the functional group is a phenyl functional group.
  • the affinity chromatography of step (iv) is carried out using a column containing Protein A.
  • the invention provides for a method for preparing CTLA4-Ig, the method comprising purifying CTLA4-Ig from a liquid cell culture so that the purified CTLA4-Ig (a) has about 38 ng of MCP-I per mg of CTLA4-Ig dimer, and (b.) comprises less than 2.5% of CTLA4-Ig high molecular weight species (e:g;, tetramer) by weight.
  • the invention provides for a method for producing CTLA4-Ig, the method comprising: (a) expanding progeny cells or CHO cells that are capable of producing CTLA4-Ig, wherein the expanding is from a seed culture to a liquid culture of at least 10,000 L 5 wherein the CTLA4-Ig concentration is at least 0.5 grams / L of liquid culture; and (b) isolating CTLA4-Ig from the at least 10,000 L liquid culture, wherein the chromotagraphy is on a column with hydrophobic interaction resin with at least a phenyl functional group, wherein the isolating comprises a step of hydrophobic interaction chromatography carried out using a single wash buffer comprising about 25 mM HEPES, and about 850 mM NaCl, and having a pH of about 7.0.
  • CTLA4-Ig molecules include beta polypeptide molecules.
  • CTLA4 A29YL104E -Ig is a beta polypeptide molecule.
  • the present invention relates to methods for producing (including mass-producing) beta polypeptide compositions or beta polypeptide molecule compositions, and improved compositions.
  • the invention is directed to beta polypeptide molecules, improved compositions comprising beta polypeptide molecules, and improved methods for producing (including mass-producing) beta polypeptide molecules and other recombinant glycoproteins.
  • the invention provides for a method for producing a recombinant glycoprotein, the method comprising: (a) expanding mammalian cells that secrete a recombinant glycoprotein, wherein the expanding is from a seed culture to a liquid culture of at least about 10,000 L, wherein the recombinant protein concentration is at least about 0.5 g/L of liquid culture, wherein the expanding comprises: (i) culturing the cells in a serum-free, chemically defined medium with at least four passages so as to obtain a cell density of at least about 1.0 x 10 viable cells per mL, wherein each seed stage starts at about 2 x 10 s per ml and goes to about 1-2 million cells per ml, wherein the culturing comprises: (1) culturing the cells in a serum- free, chemically- defined inoculum medium for from about 15 days to about 25 days; then (2) culturing the cells in a serum-free,
  • the invention provides for a method for producing a recombinant glycoprotein, the method comprising: (a) expanding mammalian cells that secrete a recombinant glycoprotein, wherein the expanding is from a seed culture to a liquid culture of at least about 10,000 L, wherein the recombinant protein concentration is at least about 0.5 g/L of liquid culture, wherein the expanding comprises: (i) culturing the cells in a serum-free, chemically defined medium with at least four passages so as to obtain a cell density of at least about 1.0 x 10 5 viable cells per mL, wherein each seed stage starts at about 2 x 10 5 per ml and goes to about 1-2 million cells per ml; and (ii) maintaining the cells in culture for a time sufficient to produce the.
  • the recombinant protein from the- culture at least about 0.5 g/L, wherein the • . • maintaining comprises: (1) lowering the temperature of the culture from 37 ⁇ 2°C to 34 ⁇ 2°C; and (2) adding a polyanionic compound to the culture; and (b) isolating the recombinant protein from the at least about 10,000 L liquid culture.
  • the invention provides for a method for producing a recombinant glycoprotein, the method comprising: (a) expanding mammalian cells that secrete a recombinant glycoprotein, wherein the expanding is from a seed culture to a liquid culture of at least about 10,000 L, wherein the recombinant protein concentration is at least about 0.5 g/L of liquid culture; and (b) isolating the recombinant protein from the at least about 10,000 L liquid culture, wherein the isolating comprises: (i) obtaining a soluble fraction of the culture of step (a); (ii) subjecting the soluble fraction to affinity chromotagraphy to obtain an eluted protein product; (iii) subjecting the eluted protein product of step (ii) to anion exchange chromatography so as to obtain an eluted and enriched protein product; and (iv) subjecting the enriched protein product to hydrophobic interaction chromatography to obtain an enriched protein product.
  • the protein comprises a CTLA4-Ig.
  • the protein comprises a beta polypeptide or beta polypeptide molecules.
  • the protein comprises beta polypeptides having SEQ ID NO: 11,- 12, 13, 14, 15, or 16.
  • the at least four passages comprises: (i) growing the cells in a culture volume of at least 50 mL until a cell density of from about 1 million to about 2.5 million cells per ml is reached; (ii) growing the cells in a culture volume of at least 10 L until a cell density of about 1 million to about 2.5 million cells per ml is reached; (iii) growing the cells in a culture volume of at least 100 L until a cell density of about 1 million to about 2.5 million cells per ml is reached; and (iv) growing the cells in a culture volume of 200 L until a cell density of about 1 million to about 2.5 million cells per ml is reached.
  • the isolating comprises: (i) obtaining a soluble fraction of the culture of step (a); (ii) subjecting the soluble fraction to affinity chromotagraphy to obtain an eluted protein product; (iii) subjecting the eluted protein product of step (ii) to anion exchange chromatography so as to obtain an eluted and enriched protein product; and (iv) subjecting the enriched protein product to hydrophobic interaction chromatography to obtain an enriched protein product.
  • the enriched protein product obtained in step (iv) is characterized in that a percentage of any high molecular weight multimer is less than 25% by weight.
  • the anion exchange chromatography of step (iii) is carried out using a wash buffer comprising about 50 raM HEPES, and about 135 mM NaCl, and having a pH of about 7.
  • the anion exchange chromatography of step (iii) is carried out using an elution buffer comprising about 50 mM HEPES, and about 200 mM NaCl, and having a pH of about 7.
  • the hydrophobic interaction chromatography of step (iv) is carried out using a wash buffer comprising about 50 mM HEPES, and about 1.2 M (NH 4 ⁇ SO 4 , and having a pH of about 7.
  • the affinity chromatography of step (ii) is carried out using a wash buffer comprising about 25 mM NaH 2 PO 4 , and about 150 mM NaCl, and having a pH of about 7.5.
  • the affinity chromatography of step (ii) is carried out using an elution buffer comprising about 250 mM Glycine and having a pH of about 3.
  • the anion exchange chromatography of step (iii) is carried out using a column having an anion exchange resin having a primary, secondary, tertiary, or quartenary amine functional group.
  • the resin has a quarternary amine functional group.
  • the hydrophobic interaction chromatography of step (iii) is carried out using a hydrophobic interaction resin having a phenyl, an octyl, a propyl, an alkoxy, a butyl, or an isoamyl functional group.
  • the functional group is a phenyl functional group.
  • the affinity chromatography of step (ii) is carried out using a column containing Protein A.
  • the expanding comprises: (i) culturing the cells in a serum-free, chemically defined medium with at least four passages so as to obtain a cell density of at least about 1.0 x 10 5 viable cells per mL, wherein each seed stage starts at about 2 x 10 s per ml and goes to about 1 -2 million cells per ml; and (ii) maintaining the cells in culture for a time sufficient to produce the recombinant protein from the culture at least about 0.5 g/L.
  • the culturing comprises: (i) culturing the cells in a serum-free, chemically-defined inoculum medium for from about 15 days to about 25 days; then (ii) culturing the cells in a serum-free, chemically-defined basal medium until a cell density of about at least 4 million cells per mL is reached.
  • the maintaining comprises (i) lowering the temperature of the culture from 37 ⁇ 2°C to 34 ⁇ 2°C; and (ii) adding apolyanionic compound to the culture.
  • the polyanionic compound is dextran sulfate and wherein the dextran sulfate is added to the culture at a final concentration- of about 50 mg/ml.
  • the temperature is ' kept within the range of 34 ⁇ 2°C for at least -5 days.
  • the temperature is kept within the range of 34 ⁇ 2°C for at least 6 days.
  • the temperature is kept within the range of 34 ⁇ 2°C for at least 7 days.
  • the temperature is kept within the range of 34 ⁇ 2°C for at least 8 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 9 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 10 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 11 days. Tn another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 12 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 13 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 14 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 15 days.
  • the temperature is kept within the range of 34 ⁇ 2°C for at least 16 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 17 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 18 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 19 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 20 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 21 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 22 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 23 days.
  • the temperature is kept within the range of 34 ⁇ 2°C for at least 24 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 25 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 26 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 27 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for at least 28 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C for up to 28 days. In another embodiment, the temperature is kept within the range of 34 ⁇ 2°C until the cell density of the culture is from about 30 x 10 5 to about 79 x 10 s cells per mL of liquid culture.
  • the time sufficient is a time by which the cells' viability does not fall below 30%. In another embodiment, the time sufficient is a time by which the cells' viability does not fall below 40%. In another embodiment, the time sufficient is a time by which the cells' viability does not fall below 50%. In another embodiment, the time sufficient is a time by which the cells' viability does not fall below 60%. In another embodiment, the time sufficient is a time by which the cells' viability does not fall below 70%, or 80% or 90% or 95%.
  • galactose is added to the serum-free, chemically defined medium.
  • isolating occurs when the liquid culture contains greater than or equal to about 6 moles of sialic acid per mole of protein.
  • isolating occurs when the liquid culture contains from about 5.2 to about 7.6 moles of sialic acid per mole of protein.
  • the isolating occurs when the liquid culture has a cell density of from about 33 x 10 s to about 79 x 10 5 cells per mL.
  • the isolating occurs when cell viability in the liquid culture has not fallen below about 37%.
  • the isolating occurs when endotoxin is less than or equal to about 4.8 EU per mL of liquid culture. In another embodiment, the isolating occurs when bioburden is less than about 1 colony forming unit per mL (cfu/ml) of liquid culture.
  • the isolating occurs if at least two of the following conditions are met: (i) the liquid culture contains greater than or equal to about 6 moles of sialic acid per mole of protein, (ii) the liquid culture has a cell density of from about 33 x 10 5 to about 79 x 10 5 cells per mL, (iii) cell viability in the liquid culture has not fallen below about 37%, or (iv) the amount of glycoprotein in the culture is from about 0.46 g/L to about 0.71 g/L.
  • the mammalian cells are progeny of a Chinese Hamster Ovary clonal cell line that produces any combination of beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises SEQ ID NO: 11, 12, 13, 14, 15, or 16, wherein the Chinese Hamster Ovary cells each have stably integrated in their genome at least 30 copies of an expression cassette comprising SEQ ID NO:3.
  • the liquid culture comprises a cell of or a progeny cell of a cell a production cell line of the invention.
  • the invention provides for a beta polypeptide comprising SEQ ID NO: 11, 12, 13, 14, 15, or 16 obtained by a method provided by the invention.
  • the invention provides for a composition comprising beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises SEQ ID NO: 11, 12, 13, 14, 15, or 16 obtained by a method provided by the invention.
  • the invention provides for a beta polypeptide obtained by a method provided by the invention.
  • the invention provides for a clonal Chinese Hamster Ovary cell comprising a nucleic acid encoding a beta polypeptide or a beta polypeptide molecule.
  • the invention provides for a clonal Chinese Hamster Ovary cell population that produces beta polypeptides or beta polypeptide molecules.
  • the beta polypeptide comprises SEQ ID NO: 11, 12, 13, 14, 15, or 16.
  • the invention provides for a clonal Chinese Hamster Ovary cell comprising a nucleic acid comprising an expression cassette encoding the amino acid sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16.
  • the expression cassette comprises SEQ ID NO:3.
  • the invention provides for a clonal Chinese Hamster Ovary cell population that produces a beta polypeptide or beta polypeptide molecule, wherein the beta polypeptide is expressed from a nucleotide sequence derived from a plasmid having ATCC Accession No. PTA-2104 deposited under the provisions of the Budapest Treaty on June 19, 2000 with the American Type Culture Collection (ATCC), 10801 University Boulevard., Manassas, VA, 20110.
  • ATCC American Type Culture Collection
  • the invention provides for a clonal Chinese Hamster Ovary cell population that produces a beta polypeptide or beta polypeptide molecules, each cell comprising 30 or more copies of a beta polypeptide expression cassette.
  • the invention provides for a clonal Chinese Hamster Ovary cell population that produces a beta polypeptide or beta polypeptide molecules, each cell comprising 30 or more copies of a beta polypeptide expression cassette, wherein the 30 or more copies are integrated at a single site in the genome of each cell.
  • the invention provides for a clonal Chinese Hamster Ovary cell population that produces a beta polypeptide or beta polypeptide molecules, wherein a beta polypeptide expression cassette is stable over about 105 passages.
  • the beta polypeptide is encoded by an expression cassette integrated into a cell genome.
  • the invention provides for a clonal Chinese Hamster Ovary cell population that produces a beta polypeptide, wherein at least 75% of the population of cells has 30 or more copies of a beta polypeptide expression cassette per cell, wherein the 30 or more copies are integrated at a single site in the genome of each cell of the 75% of the population.
  • the invention provides for a clonal Chinese Hamster Ovary cell population that produces a beta polypeptide, wherein at least 85% of the population of cells has 30 or more copies of a beta polypeptide expression cassette per cell, wherein the 30 or more copies are integrated at a single site in the genome of each cell of the 85% of the population.
  • the invention provides ⁇ for a clonal Chinese Hamster Ovary cell population that produces a beta polypeptide, wherein at least 95% of the population of cells has 30 or more copies of a beta polypeptide expression cassette per cell, wherein the 30 or more copies are integrated at a single site in the genome of each cell of the 95% of the population.
  • the expression cassette is derived from a plasmid deposited as ATCC Accession No. PTA-2104.
  • the expression cassette comprises a nucleic acid having the sequence of SEQ ID NO:3.
  • the cell population produces at least about 0.5 grams of the beta polypeptide per liter of liquid culture, and wherein the beta polypeptide has a molar ratio of sialic acid to beta polypeptide dimer or beta polypeptide molecule of from about 5.5 to about 8.5 at a culture scale of 1 ,000 L or more. In another embodiment, the cell population produces at least 5, at least 10 or at least 20 grams of the beta polypeptide per liter of liquid culture. In another embodiment, the beta polypeptide has a molar ratio of sialic acid to beta polypeptide dimer or beta polypeptide molecule of from about 5 to about 10 at a culture scale of 1 ,000 L or more.
  • the cell population has been adapted to a serum- free, chemically defined medium.
  • a beta polypeptide produced from culture of the cell population has an extinction coefficient of 1.0 ⁇ 0.05 AU mL cm “1 mg "1 .
  • the cell population when grown in culture, produces beta polypeptides, wherein: (a) about 90% or about 80% of the beta polypeptides comprise an amino acid sequence of SEQ ID NO:4 beginning with the methionine at residue 27; (b) about 10% or about 20% of the beta polypeptides comprise the amino acid sequence of SEQ ID NO:4 beginning with the alanine at residue number 26; (c) from about 4% to about 8% of the beta polypeptides comprise the amino acid sequence of SEQ ID NO:4 ending with the lysine at residue number 383; (d) from about 92% to about 96% of the beta polypeptides comprise the amino acid sequence of SEQ ID NO:4 ending with the glycine at residue number 382; and optionally, (e) about less than 1% of the beta polypeptides comprise the amino acid sequence of SEQ ID NO:4 beginning with the methionine at residue number 25.
  • the invention provides for a progeny cell of a cell population of the invention, wherein the progeny cell produces a beta polypeptide.
  • the progeny cell is obtained from culturing a cell over at least 5, at least 10, at least 20, at least 40, at least 50, at least 75 generations. In another embodiment, the progeny cell is obtained from culturing a cell for 27 generations.
  • the invention provides for a cell line produced from any cell provided by the invention.
  • the cell line is clonal.
  • the cell line produces: (a) a beta polypeptide having an amino acid sequence of SEQ ID NO:16 (methionine at amino acid position 27 and glycine at amino acid position 382 of SEQ ID NO:4); (b) a beta polypeptide having an amino acid sequence of SEQ ID NO: 13 (methionine at amino acid position 27 and lysine at amino acid position 383 of SEQ ID NO:4); (c) a beta polypeptide having an amino acid sequence of SEQ ID NO: 15 (alanine at amino acid position 26 and glycine at amino acid position 382 of SEQ ID NO:4); (d) a beta polypeptide having an amino acid sequence of SEQ ID NO: 12 (alanine at amino acid position 26 and lysine at amino acid position 383 of SEQ ID NO:4); (e) a beta polypeptide having an amino acid sequence of SEQ ID NO: 16
  • the cell line produces beta polypeptides or beta polypeptide molecules, wherein: (a) about 90% or about 80% of the beta polypeptides comprise an amino acid sequence of SEQ ID NO:4 beginning with the methionine at residue 27; (b) about 10% or about 20% of the beta polypeptides comprise the amino acid sequence of SEQ ID NO:4 beginning with the alanine at residue number 26; (c) from about 4% to about 8% of the beta polypeptides comprise the amino acid sequence of SEQ ID NO:4 ending with the lysine at residue number 383; (d) from about 92% to about 96% of the beta polypeptides comprise the amino acid sequence of SEQ ID NO:4 ending with the glycine at residue number 382; and optionally, (e) about less than 1% of the beta polypeptides comprise the amino acid sequence of SEQ ID NO:2 beginning with the methionine at residue number 25.
  • the beta polypeptides which are produced from culturing the cell line,
  • the invention provides for a cell population derived from a cell of the invention.
  • the cells of the population contain at least one additional genetic change as compared to the cell of the invention from which the population was derived, and wherein the cells produce a beta polypeptide.
  • the cells of the population contain at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, or at least 20 additional genetic change as compared to the cell of the invention from which the population was derived, and wherein the cells produce a beta polypeptide.
  • the genetic change comprises' at least one non-conservative mutation in the cellular genome or in the expression cassette encoding the beta polypeptide.
  • the genetic change comprises at least one additional recombinant nucleic acid within the cell.
  • the genetic change comprises a mutation of the cellular genome.
  • the genetic change comprises addition of a nucleic acid to the cell genome or as a trans nucleic acid, and wherein the nucleic acid encodes an anti-apoptotic polypeptide.
  • the anti-apoptotic polypeptide relates to glycosylation.
  • the genetic change comprises at least one mutation of the cellular genome or of the expression cassette encoding a beta polypeptide.
  • the cell population when grown in culture, produces: (a) a beta polypeptide having an amino acid sequence of SEQ ID NO: 16 (methionine at amino acid position 27 and glycine at amino acid position 382 of SEQ ID NO:4); (b) a beta polypeptide having an amino acid sequence of SEQ ID NO:7 (methionine at amino acid position 27 and lysine at amino acid position 383 of SEQ ID NO:4); (c) a beta polypeptide having an amino acid sequence of' SEQ ID NO: 15 (alanine at amino acid position 26 and glycine at amino acid position 382 of SEQ ID NO:4); (d) a beta polypeptide having an amino acid sequence of SEQ ID NO: 12 (alanine at amino acid position 26 and lysine at amino acid position 383 of SEQ ID NO:4); (e) a beta polypeptide having an amino acid sequence of SEQ ID NO:11 (methionine at amino acid position 25 and lysine at amino acid position 3
  • compositions The invention provides for an isolated population of beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, having an average molar ratio of sialic acid groups to beta polypeptide dimer or beta polypeptide molecule of from about 5 to about 10. In one embodiment, the average molar ratio of sialic acid groups to beta polypeptide dimer or beta polypeptide molecule of from about 5.5 to about 8.5. In one embodiment, average molar ratio of sialic acid groups to beta polypeptide dimer or beta polypeptide molecule of from about 5.2 to about 7.6. The invention provides for an isolated population of beta polypeptides, wherein each polypeptide comprises the sequence of.
  • SEQ ID NO: 1 1, 12, 13, 14, 15, or 16 having an average molar ratio of sialic acid groups to beta polypeptide dimer or beta polypeptide molecule of about 6.
  • the invention provides for an isolated population of beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NOl 1, 12, 13, 14, 15, or 16, and wherein greater than 95% of the polypeptides are formed into dimers. In one greater than 98%, greater than 99%, or greater than 99.5% of the polypeptides are formed into dimers. In another embodiment, from about 95% to about 99.5% of the polypeptides are formed into dimers and about 0.5% to about 5% of the polypeptides are formed into tetramers or high molecular weight species.
  • polypeptides are formed into dimers and about 1.2% of the polypeptides are formed into tetramers or high molecular weight species and about less than 0.7 % of the polypeptides are monomers.
  • about 95% of the polypeptides are formed into dimers and about 4% of the polypeptides are formed into tetramers or high molecular weight species and about 1% of the polypeptides are isolated population of beta polypeptide dimers, wherein each polypeptide monomer comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16.
  • the population is substantially free of beta polypeptide monomer.
  • the population is substantially free of beta polypeptide tetramer.
  • each monomer of each beta polypeptide dimer comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16and has at least 2.5 sialic acid groups.
  • the invention provides for an isolated population of beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, having a potency of from about 70% to about 130% in a B7 binding assay, compared to a CTLA4-Ig standard, wherein the assay comprises measuring surface plasmon resonance.
  • the invention provides for an isolated population of beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, having a potency of from about 50% to about 150% in a human cell IL-2 inhibition assay, compared to a standard.
  • the invention provides for a purified population of beta polypeptide tetramers or high molecular weight species, wherein each polypeptide monomer comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, the population being substantially free of beta polypeptide dimers, and optionally wherein the population comprises an amount that is greater than about 100 grams.
  • each polypeptide monomer comprises the sequence of SEQ ID NO: 11 , 12, 13, 14, 15, or 16, the population being substantially free of beta polypeptide monomer, and optionally wherein the population comprises an amount that is greater than about 100 grams, hi one embodiment, each tetramer molecule comprises two pairs of beta polypeptides, wherein each polypeptide monomer comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein each member of the pair of polypeptides is covalently linked to the other member, and wherein the two pairs of polypeptides are non- covalently associated with one another.
  • each tetramer molecule is capable of binding to a CD80 or CD86.
  • each tetramer molecule has at least a 2-fold greater avidity for CD80 or CD86 as compared to a beta polypeptide dimer, wherein each polypeptide monomer of the dimer comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16.
  • each tetramer molecule has at least a 2-fold greater avidity for CD80 or CD86 as compared to a CTLA4-Ig tetramer molecule comprising the sequence of SEQ ID NO:2.
  • each tetramer molecule has at least a 2-fold greater inhibition of T cell proliferation or activation as compared to a beta polypeptide dimer, wherein each polypeptide monomer of the dimer comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16.
  • each tetramer molecule has at least a 2-fold greater inhibition of T cell proliferation or activation as compared to a CTLA4-Ig tetramer molecule comprising the sequence of SEQ ID NO:2.
  • the invention provides for an isolated composition comprising beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the composition comprises dominant isoforms visualizable on an isoelectric focusing gel which have an isoelectric point, pi, less than or equal to 5.5 as determined by isoelectric focusing.
  • the pi increases after neuraminidase treatment.
  • at least 40% of the beta polypeptides or beta polypeptide molecules exhibit an isoelectric point less than or equal to about 5.3 as determined by isoelectric focusing.
  • At least 70% of the beta polypeptides or beta polypeptide molecules exhibit an isoelectric point less than or equal to about 5.3 as determined by isoelectric focusing. In one embodiment, at least 90% of the beta polypeptides or beta polypeptide molecules exhibit an isoelectric point less than or equal to about 5.3 as determined by isoelectric focusing.
  • the invention provides for an isolated population of beta polypeptides or beta polypeptide molecules having a pi of from about 2.0 ⁇ 0.2 to about 5.2 ⁇ 0.2.
  • the invention provides for an isolated population of beta polypeptides or beta polypeptide molecules having a pi from about 4.5 ⁇ 0.2 to about 5.2 ⁇ 0.2.
  • the invention provides for an isolated population of beta polypeptides or beta polypeptide molecules having a pi of about 4.7 ⁇ 0.2 to about 5.1 + 0.2.
  • the invention provides for a method for preparing a composition, the composition comprising beta polypeptides or beta polypeptide molecules with a pi of from about 2.0 ⁇ 0.2 to about 5.2 ⁇ 0.2, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, the method comprising: (a) subjecting a mixture of beta polypeptides to isoelectric focusing gel electrophoresis, wherein a single band on the gel represents a population of beta polypeptides or beta polypeptide molecules with a particular pi, and (b) isolating the population of beta polypeptides or beta polypeptide molecules having a pi of from about 2.0 ⁇ 0.2 to about 5.2 ⁇ 0.2 so as to prepare the composition.
  • the invention provides for an isolated composition comprising beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises the sequence of SEQ ID NO: 1 1 , 12, 13, 14, 15, or 16, and wherein the polypeptides are characterized by an average molar ratio of GIcNAc per mole of beta polypeptide dimer or beta polypeptide molecule of from about 24 to about 28.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12,
  • polypeptides are characterized by an average molar ratio of GaINAc per mole of beta polypeptide dimer or beta polypeptide molecule of from about 2.7 to about 3.6.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13,
  • polypeptides are characterized by an average molar ratio of galactose per mole of beta polypeptide dimer or beta polypeptide molecule of from about 11 to about 13.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the polypeptides are characterized by an average molar ratio of fucose per mole of beta polypeptide dimer or beta polypeptide molecule of from about 6.4 to about 7.0.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the polypeptides are characterized by an average molar ratio of mannose per mole of beta polypeptide dimer or beta polypeptide molecule of from about 14 to about 16.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14,-15, or 16, and wherein the molecules are characterized by an average molar ratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule of from about 5:5 to about 8.5.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the molecules are characterized by an average molar ratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule of from about 5 to about 10.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the polypeptides are characterized by: (a) an average molar ratio of GIcNAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 24 to about 28; and (b) an average molar ratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule from about 5.5 to about 8.5.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the molecules are characterized by: (a) an average molar ratio of GIcNAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 24 to about 28; (b) an average molar ratio of GaINAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 2.7 to about 3.6; and (c) an average molar ratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule from about 5.5 to about 8.5.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the molecules are characterized by: (a) an average molar ratio of GIcNAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 24 to about 28; (b) an average molar ratio of GaINAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 2.7 to about 3.6; (c) an average molar ratio of galactose per mole of beta polypeptide dimer or beta polypeptide molecule from about 11 to about 13; and (d) an average molar ratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule from about 5.5 to about 8.5.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the polypeptides are characterized by: (a) an average molar ratio of GIcNAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 24 to about 28; (b) an average molar ratio of GaINAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 2.7 to about 3.6; (c) an average molar ratio of galactose per mole of beta polypeptide dimer or beta polypeptide molecule from about 11 to about 13; (d) an average molarratio of fucose per mole of beta polypeptide dimer or beta polypeptide molecule from about 6.4 to about 7.0; and (e) an average molar ' ratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule from . about 5.5 to about 8.5.
  • polypeptides are characterized by: (a) an average molar ratio of GIcNAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 24 to about 28; (b) an average molar ratio of GaINAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 2.7 to about 3.6; (c) an average molar ratio.of galactose per mole of beta polypeptide dimer or beta polypeptide molecule from about 11 to about 13; (d) an average molar ratio of fucose per mole of beta polypeptide dimer or beta polypeptide molecule from about 6.4 to about 7.0; (e) an average molar ratio of mannose per mole of beta polypeptide dimer or beta polypeptide molecule from about 14 to about 16; and (f) an average molar ratio of sialic acid per mole of beta polypeptide dimer or .beta polypeptide molecule from about 5.5 to about 8.5
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the polypeptides are characterized by: (a) an average molar ratio of galactose per mole of beta polypeptide dimer or beta polypeptide molecule from about 8 to about 17; (b) an average molarratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule from about 5.5 to about 8.5; and (c) a carbohydrate profile substantially the same as Figure 8.
  • the invention provides for an isolated composition comprising beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the polypeptides are characterized by: (a) an average molar ratio of galactose per mole of beta polypeptide dimer or beta polypeptide molecule from about 8 to about 17; (b) an average molar ratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule from about 5.5 to about 8.5; (c) a carbohydrate profile substantially the same as Figure 8; and (d) a beta polypeptide tetramer content less than about 5%.
  • the invention provides for an isolated composition comprising beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14,
  • polypeptides are characterized by: (a) an average molar ratio of galactose per mole of beta polypeptide dimer or beta polypeptide molecule from about 11 to about 13; and (b) an average molar ratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule from about 5.5 to about 8.5.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15,-or 16, and wherein the polypeptides are characterized by: (a) an average molar ratio of galactose per mole of beta polypeptide dimer or beta polypeptide molecule from about 11 to about 13; (b) an average molar ratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule from about 5.5 to about 8.5; and (c) a beta polypeptide tetramer content less than about 5%.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each- polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein polypeptides are characterized by: (a) an average molar ratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule from about 5.5 to about 8.5; and (b) a carbohydrate profile substantially the same as Figure 8.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the polypeptides are characterized by: (a) an average molar ratio of galactose per mole of beta polypeptide dimer or beta polypeptide molecule from about 11 to about 13; and (b) a .carbohydrate profile substantially . the same as Figure 8.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein polypeptides are characterized by: (a) an average molar ratio of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule from about 5.5 to about 8.5; and (b) a beta polypeptide tetramer or high molecular weight species content less than about 5%.
  • the invention provides for an isolated composition comprising beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the polypeptides are characterized by: (a) an average molar ratio of galactose per mole of beta polypeptide dimer or beta polypeptide molecule from about 1 1 to about 13; and (b) a beta polypeptide tetramer or high molecular weight species content less than about 5%.
  • the invention provides for an isolated composition comprising beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises the sequence of SEQ ID NO: 1 1, 12, 13, 14, 15, or 16, and wherein the polypeptides exhibit a carbohydrate profile substantially the same as Figure 8.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11 , 12, 13, 14, 15, or 16, and wherein the polypeptides exhibit a carbohydrate profile of Domains I - IV, wherein Domain 1 comprises peaks which represent a-sialylated oligosaccharides, Domain II comprises peaks which represent, mono-sialylated oligosaccharides, Domain III comprises peaks which represent di-sialylated oligosaccharides, and Domain IV comprises peaks which represent tri-sialylated oligosaccharides.
  • the difference in retention times of N-linked oligosaccharides between a first peak in Domain I and a main peak in Domain II is from about 11 to about 13 minutes. In one embodiment, the sum of Domains III and IV comprises from about 25% to about 36% of the total carbohydrate profile.
  • the invention provides for an isolated composition comprising beta polypeptide dimers or beta polypeptide molecules, wherein each polypeptide monomer comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein at least about 0.5 % of the molecules are cysteinylated.
  • the invention provides for an isolated population of beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the population exhibits a mass spectrometry profile as shown in Figure 11.
  • the invention provides for an isolated population of beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, having an average molar ratio of sialic acid groups to beta polypeptide dimer or beta polypeptide molecule of from about 5.5 to about 8.5, wherein the beta polypeptide dimer or beta polypeptide molecules is produced from cells of a production cell line.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, wherein the polypeptides are glycosylated at an asparagine amino acid residue at position 102 of SEQ ID NO:4, an asparagine amino acid residue at position 134 of SEQ ID NO:4, an asparagine amino acid residue at position 233 of SEQ ID NO:4.
  • the invention provides for an isolated composition comprising beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the molecules are characterized by: (a) an average molar ratio of GIcNAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 24 to about 28; (b) an average molar ratio of GaINAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 2.7 to about 3.6; (c) an average molar ratio of galactose per mole of beta polypeptide dimer or beta polypeptide molecule from about 11 to about 13; (d) an average molar ratio of fucose per mole of beta polypeptide dimer or beta polypeptide molecule from about 6.4 to about 7.0; (e) an average molar ratio of mannose per mole of beta polypeptide dimer or beta polypeptide molecule from about 14 to about 16; (f) an average molar ratio of sialic acid
  • the invention provides for an isolated population of beta polypeptides, wherein each polypeptide comprises the sequence of SEQ ID NO: 11 , 12, 13, 14 % 15, or 16, and wherein the population of molecules is characterized by: (a) an average molar ratio of GIcNAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 24 to about 28; (b) an average molar ratio of GaINAc per mole of beta polypeptide dimer or beta polypeptide molecule from about 2.7 to about 3.6; (c) an average molar ratio of galactose per mole of beta polypeptide dimer or beta polypeptide molecule from about 11 to about 13; (d) an average molar ratio of fucose per mole of beta polypeptide dimer or beta polypeptide molecule from about 6.4 to about 7.0; (e) an average molar ratio of mannose per mole of beta polypeptide dimer or beta polypeptide molecule from about 14 to about 16; (f) an average molar ratio
  • the invention provides for a composition comprising an effective amount of the beta polypeptide of the invention and a pharmaceutically acceptable carrier.
  • the invention provides for a composition comprising excipients as described in U.S. Application No. 60/752,150; filed December 20, 2005.
  • the composition includes beta polypeptide molecules.
  • the composition further comprises a pharmaceutically acceptable diluent, adjuvant or carrier.
  • the composition further comprises sucrose, sodium phosphate monobasic monohydrate, sodium chloride, sodium hydroxide, hydrochloric acid, and sterile water.
  • the composition comprises sucrose, poloxamer, sodium phosphate monobasic monohydrate, sodium phosphate dibasic anhydrous, sodium chloride, sodium hydroxide, and sterile water.
  • the composition is lyophilized.
  • the invention provides for a lyophilized composition comprising an effective amount of the beta polypeptides of the invention, sucrose, sodium phosphate monobasic monohydrate, sodium chloride, sodium hydroxide, and hydrochloric acid.
  • each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, comprising at least 95% beta polypeptide dimer, and not more than 5% beta polypeptide tetramer (high molecular weight species).
  • the mixture comprises at least 98% beta polypeptide dimer and no more than 2% beta polypeptide tetramer (high molecular weight species).
  • the mixture comprises at least 99% beta polypeptide dimer and no more than 1 % beta polypeptide tetramer (high molecular weight species).
  • the mixture comprises at least 5 moles of sialic acid per mole of beta polypeptide dimer or beta polypeptide molecule. In one embodiment, the mixture comprises from about 24 to about 28 moles of GIcNAc per mole of beta polypeptide dimer (high molecular weight species). In one embodiment, the mixture comprises from about 2.7 to about 3.6 moles of GaINAc per mole of beta polypeptide dimer or beta polypeptide molecule. In one embodiment, the mixture comprises from about 11 to about 13 moles of galactose per mole of beta polypeptide dimer or beta polypeptide molecule. In one embodiment, the mixture comprises from about 6.4 to about 7.0 moles of fucose per mole of beta polypeptide dimer or beta polypeptide molecule.
  • the mixture comprises from about 14 to about 16 moles of mannose per mole of beta polypeptide dimer or beta polypeptide molecule.
  • the invention also provides for a pharmaceutical kit comprising: (a) a container containing a lyophilized beta polypeptide mixture of the invention and (b) instructions for reconstituting the lyophilized beta polypeptide mixture into solution for injection.
  • Illustrative methods of treatment A method for inhibiting T cell proliferation, activation or both, the method comprising contacting a T cell with an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for inhibiting an immune response in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating an immune disorder in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for inducing immune tolerance to an antigen in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • The.method provides for a method for treating inflammation in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the method provides for a method for treating rheumatoid arthritis comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating psoriasis in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating lupus in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating or preventing an allergy in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating or preventing graft versus host disease in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating or preventing rejection of a transplanted organ in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating or preventing rejection of transplanted tissue in a subject, the method comprising administering to a subject in need thereof an effective amount of the composition a beta polypeptide composition of the invention.
  • the invention provides for a method for treating or preventing rejection of a transplanted cell in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the transplanted cell is a bone marrow cell.
  • the transplanted cell is an islet cell. In another embodiment, the transplanted cell is an insulin- producing pancreatic islet cell.
  • the invention provides for a method for treating multiple sclerosis in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating Crohn's Disease in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating type I diabetes in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating inflammatory bowel disease in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating oophoritis in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating glomerulonephritis in a subject, the method comprising administering to. a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating allergic encephalomyelitis in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for a method for treating myasthenia gravis in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention.
  • the invention provides for the use of a population of beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15, or 16, and wherein the population has an average molar ratio of sialic acid groups to beta polypeptide dimer or beta polypeptide molecule of from about 5 to about 10 in the manufacture of a medicament for the therapeutic and/or prophylactic treatment of an immune disorder.
  • the invention provides for the use of a population of beta polypeptides or beta polypeptide molecules, wherein each polypeptide comprises the sequence of SEQ ID NOl 1, 12, 13, 14, 15, or 16, and wherein the population has an average molar ratio of sialic acid groups to beta polypeptide dimer or beta polypeptide molecule of from about 5 to about 10 in the manufacture of an anti-rheumatoid arthritis agent in a package together with instructions for its use in the treatment of rheumatoid arthritis.
  • the population has an average molar ratio of sialic acid groups to beta polypeptide dimer or beta polypeptide molecule of from about 5.5 to about 8.5.
  • Illustrative combination therapies provides for a method for inhibiting T cell proliferation, activation or both, the method comprising contacting a T cell with an effective amount of a beta polypeptide composition of the invention in combination with methotrexate.
  • the invention provides for a method for inhibiting an immune response in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention in combination with methotrexate.
  • the invention provides for a method for inducing immune tolerance to an antigen in a subject, the method comprising administering to a subject in need thereof an effective amount of a beta polypeptide composition of the invention in combination with methotrexate.
  • FIGS. 1A-1B presents the nucleotide sequence (SEQ ID NO:1) of a portion of an expression cassette for a CTLA4-Ig molecule. Also shown is the amino acid sequence (SEQ ID NO:2) encoded by the nucleic acid.
  • CTLA4-Ig molecules that can be produced from this expression cassette include molecules having the amino acid sequence of residues: (i) 26-383 of SEQ ID NO:2, (ii) 26-382 of SEQ ID NO:2, (iii) 27-383 of SEQ ID NO:2, (iv) 26-382 of SEQ ID NO:2, (v) 25-382 of SEQ ID NO:2, and (vi) 25-383 of SEQ ID NO:2.
  • the expression cassette comprises the following regions: (a) an Oncostatin M signal sequence (nucleotides 11-88 of SEQ ID NO:1; amino acids 1-26 of SEQ ID NO:2); (b) an extracellular domain of human CTLA4 (nucleotides 89-463 of SEQ ID NO:1; amino acids 27-151 of SEQ ID NO:2); (c) a modified portion of the human IgGl constant region (nucleotides 464-1159 of SEQ ID NO:1; amino acids 152-383 of SEQ ID NO:2), including a modified hinge region (nucleotides 464-508 of SEQ ID NO:1; amino acids 152-166 of SEQ ID NO:2), a modified human IgGl C H 2 domain (nucleotides 509-838 of SEQ ID NO:1; amino acids 167-276 of SEQ ID NO:2), and a human IgGl C H 3 domain (nucleotides 839-1159 of SEQ ID NO: 1
  • FIG. 2 presents the nucleic acid (top row) and amino acid (bottom row) sequences corresponding to CTLA4 A29YLI04E -Ig.
  • the amino acid sequence contains an amino acid change from the sequence shown in Fig. 1 , wherein the changes are at position 29 (A to Y) and at position 104 (L to E) compared to that of SEQ ID NO: 2, wherein numbering of amino acid residues begins at Methionine (M) marked by "+1.”
  • M Methionine
  • the nucleotide sequence of CTLA4 ⁇ 29YL104E -Ig is shown in this figure starting from the A at position 79 (i.e., the position marked by the "+1" below the M) through the A at nucleotide position 1149 (SEQ ID NO:3).
  • nucleotide sequence encoding CTLA4 A29YL104E -Ig is from the nucleotide at position 79 to the nucleotide at position 1149, designated SEQ ID NO:3.
  • the full nucleotide sequence shown in Fig. 2 is designated SEQ ID NO:23 and includes the nucleic acid sequence encoding the Oncostatin M signal peptide.
  • FIG. 3 presents the amino acid sequence (SEQ ID NO:4) of CTLA4 A29YLI 04E -Ig molecule including an Oncostatin M prosequence (see bold italics).
  • Polypeptides that can be produced that are CTLA4 A29YLI0 E -Ig molecules include molecules having the amino acid sequence of residues: (i) 26-383 of SEQ ID NO:4, (ii) 26-382 of SEQ ID NO:4, (iii) 27-383 of SEQ ID NO:4, (iv) 26-382 of SEQ ID NO:4, (v) 25-382 of SEQ ID NO:4, and (vi) 25-383 of SEQ ID NO:4.
  • FIG. 4 is a model of a CTLA4 A29YL104E -Ig shown with the N-linked glycosylation sites (N76, N108, and N207), the C120-C120 disulfide bond, and the two amino acid substitutions made in the CTLA-4 domain (L104E and A29Y).
  • FIG. 5 represents the theoretical cDNA-derived amino acid sequence of a CTLA4 A29YL104E -Ig (SEQ ID NO:4). Two amino acid substitutions were made in the CTLA- 4 extracellular domain (L104E and A29Y) to generate CTLA4 A29YL104E -Ig. The sequence identifies the signal peptide (pro-sequence) of oncostatin M along with the N-linked glycosylation sites.
  • FIG. 6 is a graph depicting binding of CTLA4 A29YL104E -Ig samples to goat anti- human IgG Fc antibody. Binding of CTLA4 A29YL104E -Ig samples was detected by measuring the response obtained on this surface, compared to an unmodified sensorchip surface. The various lots represent three different CTLA4 A29YL104E -Ig samples.
  • FIG. 7 is a graph that shows the apparent molecular weights which correspond to multimer. tetramer, and dimer fractions of a CTLA4-Ig HIC cleaning peak as determined by an overlay of two-column SEC with dynamic light scattering detection (DSL) and retention time on SEC.
  • DSL dynamic light scattering detection
  • FIG. 8 A (top) and 8B (bottom) show representative IEF gels of fractions of glycosylated CTLA4-Ig molecules (comprising SEQ ID NO:2 monomers) isolated and purified from HIC cleaning peak.
  • the loading order for the top gel is: lane 1 , pi markers (Amersham); lane 2, CLTA4-Ig dimer standard; lane 3, Protein A eluate; lane 4, Multimer; lane 5, tetramer; lane 6, dimer.
  • the loading order for the bottom gel is: lane 1, pi marker (Amersham); lane 2, lane 2, CLTA4-Ig dimer standard; lane 3, tetramer; lane 4, dissociated tetramer.
  • FIG. 9 shows the predominant carbohydrate structures and relative amounts of carbohydrates observed on a CTLA4-Ig dimer comprising monomers of SEQ ID NO:2.
  • the amino acid residue numbering in the figure is not consistent with SEQ ID N.O:2.
  • the numeration needs to increase by 26, i.e., N 76 is N 102 .
  • FIG. 10 INTENTIONALLY LEFT BLANK
  • FIG. 11 shows a representative IEF gel (pH 4.0 to 6.5) of a CTLA4-Ig dimer . comprising SEQ ID NO:2 monomers. Lanes 1 and 5 show a calibration standard, lane 2, 3, 4 each show 20 ⁇ g/ ⁇ l of CLTA4-Ig dimer.
  • FIG. 12 shows a representative IEF gel (pH 4.0 to 6.5) of a CTLA4 A29YLI04E -Ig dimer comprising SEQ ID NO:4 monomers.
  • Lanes 1.and 8 show a calibration standard, lane 2-7 each show 10 ⁇ g/ ⁇ l of CTLA4 A29YLI04E -Ig dimer.
  • FIG. 13 shows the N-linked carbohydrate profile of a CTLA4-Ig molecule population comprising monomers of SEQ ID NO:2.
  • the carbohydrates were collected from glycopeptides and separated using the LC/MS PGC N-linked Oligosaccharide technique. The chromatograms provide the population profile for each N-link attachment site.
  • FIG. 14A-B shows a UV and TIC trace of an N-linked oligosaccharide profile of a CTLA4-Ig SEQ ID NO:2 monomer from PGC chromatography under acidic elution conditions (0.05% TFA).
  • the trace of FIG. 14A shows negative ion total count (TIC) for PGC chromatograpm under acidic elution conditions (0.05% TFA).
  • the trace of FIG. 14B shows UV trace at 206nm for PGC chromatogram under acidic elutions (0.05% TFA).
  • FIG. 15A-B shows a UV and TIC trace of an N-linked oligosaccharide profile of a CTLA4- ⁇ g SEQ ID NO:2 monomer from PGC chromatography under basic elution conditions (0.4% NH 4 OH).
  • the trace of FIG. 15A shows negative ion total count (TIC) for PGC chromatograpm under basic elution conditions (0.4% NH 4 OH).
  • the trace of FIG. 15B shows UV trace at 206nm for PGC chromatogram under basic elutions (0.4% NH 4 OH).
  • FIG. 16 represents the comparative N-linked oligosaccharide carbohydrate profiles for CTLA4 A29YL104E -Ig molecules comprising SEQ ID ⁇ O:4.
  • oligosaccharide domains Four oligosaccharide domains are observed: Domain I contains non-sialylated species, while Domains II, III, and IV contain mono-sialylated, di-sialylated and tri-sialylated species, respectively. Isolating the oligosaccharides chromatographically and analyzing them by mass spectroscopy determined ' the domains.
  • FIG. 17 shows an HPAEC-PAD profile of N-linked oligosaccharides of CTLA4- Ig molecules comprising SEQ ID NO:2 monomers. Domains are shown in order of increasing sialic acid content for oligosaccharides. Domains I, II, III an TV contain oligosaccharide structures having 0, 1, 2, and 3 sialic acids respectively. Peak labels represent oligosaccharide structures assigned by HPAEC-PAD profiling of peaks collected from PGC profiling. The structural identification of carbohydrate structure is consistent with previous determinations.
  • FIG. 18A-B shows a PGC profile of CTLA4-Ig molecules comprising monomers of SEQ ID NO:2.
  • the profile is obtained from direct injection. of carbohydrate digest mixture . prepared as described in Example 3. Direct injection results in detection of structure P4144 eluting at 130 minutes. The tetra-sialylated structure P4144 is not observed in profiles of oligosaccharides which are isolated prior to injection.
  • FIG. 19 presents a LC/MS deconvoluted positive electrospray spectrum for the T9 fragment of a SEQ ID NO:2 monomer.
  • the spectrum illustrates three major O-linked structures.
  • the spectrum illustrates the base peptide with sugar ladder consistent with the O- linked structure (GaINAc) 1 (Gal) i(Neu Ac) 1 .
  • the bold portion of the spectrum has been enhanced 10-fold with respect to the non-bold portion of the spectrum and illustrates two additional O-linked structures with (GaINAc) 1 (Gal) i(NeuAc) 2 and (GalNAc),(GlcNAc)i(Gal) 2 (NeuAc) 2 .
  • FIG. 20 shows the attachment points and relative populations of O-linked carbohydrate structures of a CTLA4-Ig single chain having a SEQ ID NO:2 monomer sequence.
  • the relative amounts at each site show data generated by two or more orthogonal techniques and are subject to variability.
  • the location of the covalent cysteinylation is also depicted.
  • FIG.21 depicts amap of the intermediate .plasmid piLNrhuCTLA4-Ig.
  • This - plasmid has comprises a sequence that can encode a human CTLA4-Ig molecule (huCTLA4- Ig) (i.e., SEQ ID NO: 1 ) flanked by the restriction enzyme sites HindIII and Xbal.
  • FIG. 22 depicts a map of the plasmid pDl 6LEA29Y.
  • This plasmid comprises a sequence that can encode a human CTLA4 A29YL104E -Ig molecule ⁇ i.e., SEQ ID NO:4).
  • FIG. 23 is a photograph of a Southern blot of DNA extracted from CHO cells expressing the CTLA4-Ig expression cassette derived fromlD5-100Al (for example, clone 17).
  • the lanes for the gel from left to right are: lane M, DNA molecular weight marker; lane N, EcoRI/Xbal digested untransfected CHO DNA (5 mg); lane 1, EcoRI/Xbal digested untransfected CHO DNA (2.5 ⁇ g) + 1 ng pcSDhuCTLA4-Ig; lane 2, EcoRI/Xbal digested untransfected CHO DNA (2.5 ⁇ g) + 0.5 ng pcSDhuCTLA4-Ig; lane 3, EcoRI/Xbal digested untransfected CHO DNA (2.5 ⁇ g) + 0.25 ng pcSDhuCTLA4-Ig; lane 4, EcoRI/Xbal digested untransfected CHO DNA (2.5 ⁇ g) + 0.125 ng
  • FIG. 25 shows a representative chromatogram of NGNA and NANA system suitability standard.
  • the peak at -9.7 min is NGNA, and the peak at -10.7 min is NANA.
  • FIG. 26 shows a representative chromatogram of hydrolyzed CTLA4-Ig molecules comprising SEQ ID NO:2 monomers.
  • the peak at —8.4 min is the solvent peak.
  • the peak at -9.6 min is NGNA.
  • the peak at ⁇ 10.5min is NANA.
  • the peak at -11.3 min is degraded NANA, resulting from the hydrolysis conditions. The area counts of NANA and degraded NANA are combined for calculations of the NANA molar ratio.
  • FIGS. 27 A, 27B, and 27C show the MALDI spectra of CTLA4-Ig cysteinylated peptide.
  • the MALDI spectra were obtained for CTLA4-Ig trypsin/chymotrypsin fragment containing Cys 146 of SEQ ID NO:2.
  • FIG. 27A shows the single chain peptide spectrum • illustrating cysteinylation modification.
  • FIG. 27B shows the spectrum of the single-chain ' peptide following reduction and demonstrates that the modification occurs at Cys 146 .
  • FIG. 27C shows alkylation of the reduced single-chain peptide, which demonstrates that the cysteinylation occurs at Cys 146 .
  • FIG. 28 presents a cloning scheme useful for generating the vector pcSD.
  • pcDNA3 was digested with the restriction enzyme Nael in order to isolate a 3.821 Kb fragment that contains the CMV promoter, an ampicillin resistance gene, and an origin of replication for E. coli.
  • pSV2-dhfr was digested with the restriction enzymes PvuII and BamHIxa order to isolate a 1.93 Kb fragment, which contains the SV40 promoter and the dhfr gene, and was subsequently blunt-ended. To generate pcSD, both fragments were ligated. The map of plasmid pcSD is shown at the bottom of the figure.
  • FIG. 29 presents a cloning scheme useful for generating the expression vector pcSDhuCTLA4-Ig.
  • pcSD was digested with the restriction enzymes EcoRV and Xb ⁇ l.
  • piLN-huCTLA4-Ig was digested with the restriction enzyme Hindlll, blunt-ended, and then digested with the restriction enzyme Xb ⁇ l in order to isolate the 1.2 Kb huCTLA4-Ig fragment.
  • the CTLA4-Ig fragment was ligated to the digested pcSD vector.
  • the map of plasmid pcSDhuCTLA4-Ig is shown at the bottom of the figure.
  • the pcSDhuCTLA4-Ig has the expression cassette comprising the CMV promoter, a sequence that can encode a human CTLA4-Ig molecule (huCTLA4-Ig) (Le., SEQ ID NO:1) and a poly(A) tail sequence from BGH.
  • FIG. 30 shows an electropherogram of system suitability amino monosacchrarides depicted as relative fluorescence units (RFU) versus time (min).
  • FIG. 31 shows an electropherogram of system suitability neutral monosacchrarides depicted as relative fluorescence units (RFU) versus time (min).
  • FIG. 32 represents a tryptic peptide map of CTLA4 A29YLI04E -Ig with peptides labeled.
  • Table 23 corresponds with the labeled peptides.
  • FIG. 33 shows a Northern Hybridization Analysis of the CTLA4 A29YL104E -Ig.
  • Panel A depicts an Ethidium bromide-stained agarose gel wherein Lane M is RNA marker; Lane 1 is total CHO RNA; Lane 2 is total MCB RNA; and Lane 3 is total EPCB RNA.
  • Panel B is the corresponding autoradiogram wherein Lane M is RNA marker; Lane 1 is total CHO RNA; Lane 2 is total MCB RNA; and Lane 3 is total EPCB RNA.
  • FIG. 34A-C depict size exclusion chromatograms, which distinguish CTLA4 ⁇ 29YL104E -Ig dimers from high and low molecular weight species.
  • FIG. 35 shows an SDS-PAGE (Reduced and Non-Reduced) analysis of CTLA4 A29YL104E ⁇ lg stained with Coomassie Blue.
  • Lane 1 is loaded with molecular weight markers; Lanes 2, 7, and 12 are blank; Lanes 3-6 are CTLA4 A29YL104E -Ig samples (reduced); Lanes 8-11 are CTLA4 A29YLI04E -Ig samples (non-reduced).
  • FIG. 36 shows an SDS-PAGE (Reduced and Non-Reduced) analysis of CTLA4 A29YL104E -Ig subjected to silver-staining.
  • Lane 1 is loaded with molecular weight markers; Lanes 2, 7, and 12 are blank; Lanes 3-6 are CTLA4 A29YL104E -Ig samples (reduced); Lanes 8-11 are CTLA4 A29YLI04E -Ig samples (non-reduced).
  • FIG. 37 depicts a peptide map of non-reduced CTLA4 A29YLI 04E -Ig using a combination of trypsin and chymotrypsin digestion.
  • FIG. 38 depicts a peptide map of non-reduced CTLA4 A29YL104E -Ig using a . combination of trypsin and elastase digestion.
  • FIG. 39 is a diagram that depicts patients with anti-CTLA4-Ig or anti-CTLA-4 responses.
  • Antibody response to the whole CTLA4-Ig molecule (CTLA-4 and Ig portion) and the CTLA-4 portion only were determined using Assays A and B, as outlined in the Example 32.
  • FIG. 40 is a schematic demonstrating the distribution of clearance and the volume of central compartment by immunogenicity status.
  • FIG. 41 is a graph demonstrating profiles of mean (SD) CTLA4-Ig serum concentrations over time in monkeys adminstered 10 mg/kg of drug substance produced by a process of the invention.
  • FIG. 42 is a graph of a Size Exclusion Chromatography (SEC) chromatogram of Protein A (MAbSelect) purified from control and disaggregated CTLA4-Ig material.
  • SEC Size Exclusion Chromatography
  • FIG. 43 is a graph of an N-glycan analysis comparing the Disaggregation Processed Material (ii) to Control (i).
  • FIG. 44 is a graph depicting the mean CTLA4-Ig serum concentrations [ ⁇ g/ml] versus time (over 71 days).
  • FIG. 45 shows an electropherogram of neutral monosacchrarides depicted as relative fluorescence units (RFU) versus time (min).
  • FIG. 46 shows an electropherogram of amino monosacchrarides depicted as relative fluorescence units (RFU) versus time (min).
  • FIG. 47 represents the comparative JV-linked oligosaccharide carbohydrate profiles for CTLA4 A29YL104E -Ig molecules comprising SEQ ID NO:4. Four oligosaccharide domains are observed, wherein Domain I contains non-sialylated species, while Domains II, III, and IV contain mono-sialylated, di-sialylated and tri-sialylated species, respectively.
  • FIG. 48 is a graph of a capillary electrophoretic separation of CTLA4-Ig that was mixed 1:1 with CTLA4 A29YLI04E -Ig. The main peak migration times are approximately 0.8 minutes apart.
  • FIG.49 is a chromatogram of hydrolyzed CTLA4 A29YL104E -Ig material, wherein a NANA Peak is observed at 3.4 minutes.
  • FIG. 50 depicts several of the various N-linked carbohydrate structures found in mammalian proteins. All chains share a common core structure containing two GIcNAc and three mannose residues.
  • FIG. 51 is graph depicting CTLA4-Ig exposure (AUC) as a function of sialylation of the glycoprotein (NANA ratio).
  • FIG. 52 is graph depicting CTLA4-Ig exposure (AUC) as a function CTLA4-Ig's carbohydrate profile. A large number of peaks were generated by anion exchange HPLC which were resolved into four or five domains. Domains 1 and 2 are largely asialylated and mono-si alylated structures, while domains 3 and 4 are largely di- and tri-sialylated structures.
  • Fig. 53 represents a tryptic peptide map of CTLA4 A29YL104E -Ig with peptides labeled.
  • Table 56 corresponds with the labeled peptides.
  • FIG. 54 represents the comparative N-linked oligosaccharide carbohydrate profiles for CTLA4-Ig molecules comprising SEQ ID NO:2.
  • Four oligosaccharide domains are observed, wherein Domain I contains non-sialylated species, while Domains II, III, and IV contain mono-sialylated, di-sialylated and tri-sialylated species, respectively.
  • FIG. 55A-D is a graph that represents the oligosaccharide profiles of CTLA4-Ig and Peptides T5, T7, and T14 by HPAEC-PAD.
  • FIG. 56 is a graph depicting the labeled oligosaccharide profile of CTLA4-Ig obtained from PGC (Hypercarb) Column.
  • Fig.57 depicts a graph of pharmacokinetic data showing monkey AUC on the Y axis and percent of N-Iinked glycosylation as shown in Domains I and 11 from a carbohydrate profile on the X axis. See methods of determining the N-linked carbohydrate profile in, for example, Examples 3, 44, 22 and 37. As the percentage of Domains I and II increases (and the percentage of Domains III, IV and V decreases), clearance increases. ' Note that the negative control, the CTLA4-Ig with low sialic acid is cleared very rapidly. Note that the CTLA4-Ig variant, LEA (CTLA4-Ig A29YL104E -Ig) is included in this graph.
  • Fig. 58 A and 58 B depict a trace of a N-linked carbohydrate chromatogram of the N-linked carbohydrates released from CTA4-Ig (as obtained from methods such as those described in Examples 3, 44, 22 and 37).
  • the trace in Fig. 58A is of from an analysis of CTLA4-Ig produced in a culture method without additional galactose added to the culture.
  • the trace in Fig. 58 B did have galactose added to the culture.
  • the percentages of N-linked carbohydrates in each Domain is shown in the inset table.
  • Fig. 59 depicts a trace of a N-linked carbohydrate chromatogram of the N-linked carbohydrates released from CTA4-Ig (as obtained from methods such as those described in Examples 3, 44, 22 and 37). This is from an analysis of CTLA4-Ig produced in a culture method with galactose added to the culture at day 8. This trace of from an analysis of CTLA4-Ig produced in a culture method without additional galactose added to the culture. The percentages of N-linked carbohydrates in each Domain is shown in the inset table.
  • Fig. 60 depicts a trace of a N-linked carbohydrate chromatogram of the N-linked carbohydrates released from CTA4-Ig (as obtained from methods such as those described in Examples 3, 44, 22 and 37). This is from an analysis of CTLA4-Ig produced in a culture method with galactose added to the culture at day 14. This trace of from an analysis of CTLA4-Ig produced in a culture method without additional galactose added to the culture. The percentages of N-linked carbohydrates in each Domain is shown in the inset table. ⁇
  • Fig. 61 A and 61B depicts a trace of a N-linked carbohydrate chromatogram of the N-linked carbohydrates released from CTA4-Ig (as obtained from methods such as those described in Examples 3, 44, 22 and 37).
  • Fig. 61 A is from an analysis of CTLA4-Ig produced in a culture method without galactose added
  • Fig. 61B is from an analysis where galactose was added to the culture at day 14. This trace of from an analysis of CTLA4-Ig produced in a culture method without additional galactose added to the culture.
  • the percentages of N-linked carbohydrates in each Domain is shown in the inset table.
  • Fig. 62 depicts a trace of a N-linked carbohydrate chromatogram of the N-linked carbohydrates released from CTA4-Ig (as obtained from methods such as those described in Examples 3, 44, 22 and 37). This trace was obtained from CTLA4-Ig material that was recovered from the wash step of the QFF column, producing a cut of CTLA4-Ig material with low sialic acid. The relative amount of Domain I and II is increased and Domains III and Iv are decreased, compared to the traces shown in Figures 61, 60 and 59. The percentages of N- linked carbohydrates in each Domain is shown in the inset table.
  • FIG. 63 shows the tryptic peptide map of CTLA4-Ig indicating that T8 elutes at . the end of the solvent front, and T9 elutes at the shoulder of T27.
  • FIG. 64 is a graph that represents the full mass spectrum corresponding to glycopeptide T8 from CTLA4-Ig.
  • FIG. 65 is a graph that represents the full mass spectrum corresponding to glycopeptide T9 from CTLA4 : Ig.
  • FIG. 66 is a graph that represents the MALDI-TOF data for the T9 peptide fragment from CTLA4-Ig.
  • FIG. 67 A-B depicts ion chromatograms and mass spectra of oxidized and native tryptic peptides from CTLA4-Ig.
  • FIG. 68 depicts a typical N-Linked Oligosaccharide Profile (Domains I, II, III, IV and V, and Peaks IA and IB within 5% of Lot averages). Peaks IA, IB and 1C represent the asialo N-linked oligosaccharide structures of GO, Gl and G2. The data for the profile is in the table directly below. See Example 44.
  • FIG. 69 depicts an isoelectric focusing gel of CTLA4-Ig.
  • the bands are characterized by:
  • Fig. 70 depicts a representative isoelectric focusing gel quantitative analysis report of CTLA4-Ig. The quantitation of the gel was performed and the data is as follows:
  • Fig. 71 A depicts Typical 20 ⁇ L Injection of System Suitability Standard on
  • Fig. 71B depicts a 20 ⁇ L Injection of CTLA4-Ig Reference Material on TOSO HAAS 3000 SWXL Column Equipped with a Guard Column.
  • Fig. 72 Example of digitally acquired image of SDS-PAGE Analysis of
  • Fig. 73 depicts an example of quantitative analysis report for Coomassie Blue stained SDS-PAGE.
  • Fig. 74 shows a table setting out the quantitative analysis of the stained SDS-
  • Fig. 75 depicts Example of an enhanced image of SDS-PAGE Analysis of
  • CTLA4-Ig Coomassie Blue Stained Gel for illustrating the migrating positions of the major and expected minor bands relative to the Molecular Weight Markers.
  • Fig. 76 is a depiction of a representative N-Linked Carbohydrate Profile of
  • CTLA4-Ig reference / standard material This is a representative carbohydrate profile of run on the Waters system. Retention times are system dependent.
  • Fig. 77 is a depiction of a representative Stachyose System Suitability
  • Fig. 78 is a trace of a Representative Chromatogram of Hydrolyzed CTLA4-Ig
  • Fig. 79 depicts a ccanned gel image of SDS- PAGE Analysis of
  • Figure 80 depicts a flow diagram of the harvest steps, see Example 28.
  • Figure 81 depicts an electropherogram of system suitability of amino monosaccharides. See Example 16.
  • Figure 82 depicts a graph of pharmacokinetic data showing monkey AUC on the Y axis and percent of N-linked glycosylation as shown in Domains I and II from a carbohydrate profile on the X axis. See methods of determining the N-linked carbohydrate profile in, for example, Examples 3, 44, 22 and 37. As the percentage of Domains I and II increases ⁇ and the percentage of Domains III, IV and V decreases), AUC increases. Note that the negative control, the CTLA4-Ig with low sialic acid is cleared very rapidly. Note that the mutant CTLA4-Ig molecules, CTLA4-Ig A29YLI04E -Ig (designated LEA) is included in this graph.
  • Figure 83 depicts a graph of pharmacokinetic data showing AUC on the Y axis and percent of N-linked glycosylation as shown in Domains III and IV (as determined from an N-linked carbohydrate profile) on the X-axis. As the percentage of Domains III and IV increase, the AUC increases. Note that the negative control, the CTLA4-Ig with low sialic acid is cleared very rapidly. See methods of determining the N-linked carbohydrate profile in, for example, Examples 3, 44, 22 and 37. Note that the mutant CTLA4-Ig molecules, CTLA4-Ig A29YL104E -Ig (designated LEA) is included in this graph.
  • Figure 84 depicts another graph of pharmacokinetic data showing AUC on the
  • Fig. 85 depicts a tryptic Map of CTLA4-Ig standard see Table at end of
  • Example 65 for peak assignments The small peak labeled Tl+A is the Tl tryptic peptide extended by an N-terminal alanine residue.
  • the small peak labeled T31+K is the T31 tryptic peptide extended by a C-terminal lysine residue.
  • Fig. 86 depicts an overlay of 280 nm Data for Tryptic Map of CTLA4-Ig
  • Fig. 87 depicts an expanded View of 215 nm Data for Tryptic Map of
  • CTLA4-Ig molecules can be used to treat a variety of disorders, including disorders relating to aberrant immunoproliferative and immunoreactive phemonena such as autoimmunity and allergy.
  • the invention provides CTLA4-lg compositions that comprise, for example, populations of CTLA4-Ig molecules having particular glycosylation modifications, having particular carbohydrate profiles or characteristics, having particular multimeric structures, and/or having particular avidity strengths.
  • Documents that are hereby incorporated by reference in their entirety that also describe CTLA4-Ig molecules, uses and methods thereof, include U.S. Patent No. 5,434,131; 5,851 ,795; 5,885,796; 5,885,579; and 7,094,874.
  • the invention also provides cell lines that are capable of producing large amounts of CTLA4-Ig molecules via the mass-production and culturing methods provided herein.
  • One particular cell line of the invention is a clonal cell line that can be used to mass-produce CTLA4-Ig molecules such that it has a particular glycosylation and carbohydrate profile.
  • the clonal cell lines of the invention can secrete a population of CTLA4-Ig molecules having a more consistent or more uniform glycosylation .or.carbohydrate profile. .
  • the clonal cell lines of the invention can secrete a greater amount of CTLA4-Ig molecules, in part because the present clonal cell lines are selected to have a high- copy number of CTLA4-Ig expression cassettes integrated into a single site in the genome of the cell.
  • the invention provides for the discovery that the avidity and potency of CTLA4- Ig (SEQ ID NO:2) can be increased by making two amino acid substitutions in the B7 binding region of the CTLA-4 binding domain: (i) alanine at position 29 of SEQ ID NO:2 is substituted by tyrosine (A29Y), and (ii) lysine at position 104 of SEQ ID NO:2 is substituted by glutamate (Ll 04E).
  • the invention provides a subgenus of CTLA4-Ig molecules, called "beta polypeptide molecules,” which comprise beta polypeptides which have B7 binding activity and may comprise the amino acid sequence in SEQ ID NO: 24 (CTLA4 extracellular domain with A29Y and L104E mutations), linked to an immunoglobulin constant region, or portion thereof.
  • clonal refers to a cell population that is expanded from a single cell.
  • the clonal cell line or population is expanded from a single cell that was isolated from a population of cells that were transfected with an expression vector encoding the CTLA4-Ig molecule.
  • the transfected population of cells can be a heterogeneous population.
  • a clonal cell line or population can be considered to be homogeneous in the sense that all of the cells in the population came from a single transfectant.
  • B7-1 refers to CD80; the term “B7-2” refers CD86; and the term “B7” refers to either or both of B7-1 and B7-2 (CD80 and CD86).
  • B7-1-Ig or “B7-lIg” refers to CD80-Ig; the term “B7-2-Ig”or “B7-2Ig” refers CD86-Ig.
  • CTLA4-Ig or “CTLA4-Ig molecule” or “CTLA4Ig molecule” or “CTLA4-Ig protein” or “CTLA4Ig.protein” are used interchangeably, and refer to a protein molecule that comprises at least a CTLA4-Ig polypeptide having a CTLA4 extracellular domain and an immunoglobulin constant region or portion thereof.
  • a CTLA4-Ig polypeptide comprises at least the amino acid sequence of SEQ ID NO: 18.
  • the CTLA4 extracellular domain and the immunoglobulin constant region or portion thereof can be wild-type, or mutant or modified.
  • a mutant CTLA4-Ig polypeptide is a CTLA4-Ig polypeptide comprising a mutant CTLA4 extracellular domain.
  • a mutant CTLA4Ig molecule comprises at least a mutant CTLA4-Ig polypeptide.
  • the CTLA4 extracellular domain and the immunoglobulin constant region or portion thereof can be mammalian, including human or mouse.
  • a mutant CTLA4 extracellular domain can have an amino acid sequence that is at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the CTLA4 extracellular domain shown in Figure 1 or SEQ ID NO:18.
  • a mutant immunoglobulin constant region or portion thereof can have an amino acid sequence that is at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the immunoglobulin (g) constant region as shown in Figure 1.
  • the polypeptide can further comprise additional protein domains.
  • a CTLA4-Ig molecule can refer to a monomer of the CTLA4-Ig polypeptide, and also can refer to mul timer forms of the polypeptide, such as dimers, tetramers, and hexamers, etc. (or other high molecular weight species). CTLA4-Ig molecules are also capable of binding to CD80 and/or CD86.
  • CTLA4- Ig molecules include mutant CTLA4Ig molecules, such as "beta polypeptides molecules," e.g., CTLA4 A29YL104E -Ig.
  • CTLA4-Ig comprises CTLA4-Ig molecules
  • CTLA4 A29YL104E -Ig comprises beta polypeptides molecules (an example of mutant CTLA4-Ig molecules).
  • CTLA4 extracellular domain refers to a protein domain comprising all or a portion of the amino acid sequence shown in SEQ ID NO: 18, that binds to B7-1 (CD80) and/or B7-2 (CD86).
  • a CTLA4 extracellular domain can comprise a polypeptide having an amino acid sequence that is at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to amino acids 27-150 of SEQ ID NO:2, which are the same as amino acids shown SEQ ID NO: 18.
  • the amino acid 151 of SEQ ID NO:2 is a junction amino acid.
  • a polypeptide refers to a mutant CTLA4-Ig polypeptide that (1) comprises the amino acid sequence of SEQ ID NO: 18 wherein the amino acid at position 29 is mutated to tyrosine and the amino acid at position 104 is mutated to glutamate, optionally with various additional mutations, and an immunoglobulin constant region, or a portion thereof; and (2) is capable of binding to CD80 and/or CD86.
  • a beta polypeptide comprises at least the amino acid sequence of the extracellular domain of CTLA4 A29YLI04E -Ig (as shown in SEQ ID NO:24).
  • beta polypeptides include belatacept and SEQ ID NOS: 4 and 11-16.
  • the immunoglobulin constant region or portion thereof can be wild-type, or mutant or modified.
  • the immunoglobulin constant region or portion thereof can be mammalian, including human or mouse.
  • Additional non-limiting examples of beta polypeptides include a beta polypeptide comprising one or more amino acid mutations in the immunoglobulin constant region or portion thereof (for example, substitution of cysteine 120 of SEQ ID NO:4), and a beta polypeptide comprising further mutations at one or more of amino acid position 25, 30, 93, 96, 103 or 105 of SEQ ID NO:18.
  • a beta polypeptide molecule comprises a beta polypeptide.
  • a beta polypeptide molecule can refer to a monomer of the beta polypeptide and smul timer forms of the beta polypeptide, such as dimers,. tetramers and hexamers, etc.
  • belatacept comprises beta polypeptide molecules.
  • Beta polypeptide molecules are further described in U.S. Provisional Application No. 60/849,543 filed on October 5, 2006, which is hereby incorporated by reference in its . entirety.
  • glutamate and “glutamic acid” are used interchangeably.
  • the term "dimer” refers to a CTLA4-Ig protein or CTLA4-Ig molecule composed of two CTLA4-Ig polypeptides or monomers linked or joined together.
  • the linkage between monomers of a dimer can be a non-covalent linkage or interaction, a covalent linkage or interaction, or both.
  • An example of a CTLA4-Ig dimer is shown in Figure 4.
  • a CTLA4-Ig protein or CTLA4-Ig molecule composed of two identical monomers is a homodimer.
  • a CTLA4-Ig homodimer also encompasses a molecule comprising two monomers ' that may differ slightly in sequence.
  • a homodimer encompasses a dimer where the monomers joined together have substantially the same sequence.
  • the monomers comprising a homodimer share considerable structural homology. For example, the differences in sequence may be due to N-termal processing modifications of the monomer.
  • “conservative mutation” refers to a change in a nucleic acid sequence that substitutes one amino acid for another of the same class (e.g., substitution of one nonpolar amino acid for another, such as isoleucine, valine, leucine, or methionine; or substitution of one polar amino acid for another, such as substitution of arginine for lysine, glutamic acid for aspartic acid or glutamine for asparagine).
  • non-conservative mutation refers to a change in a nucleic acid sequence that substitutes one amino acid for another of a different class (e.g., substitution of one basic amino acid, such as lysine, arginine or histidine, with an acidic amino acid, such as aspartic acid or glutamic acid).
  • an amino acid can be biochemically dissimilar from another amino acid based on size, charge, polarity, reactivity or other such ' characteristics of amino acids.
  • isolated refers to a molecule that is taken out of its native environment and is in an environment different from that in which the molecule naturally occurs, or a substance (e.g., a protein) that is partially or completely recovered or separated from other components of its environment such that the substance (e.g., protein) is the predominant species (e.g., protein species) present in the resultant composition, mixture, or collection of components (for example, on a molar basis it is more abundant than any other • individual species in the composition).
  • substance e.g., protein
  • a preparation may consist of more than about 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94 or or 95%, of isolated CTLA4-Ig.
  • isolated does not exclude mixtures of CTLA4-Ig molecules with other CTLA4-Ig molecules from the environment in which the molecule naturally occurs.
  • Isolated does not exclude pharmaceutically acceptable excipients combined with CTLA4-Tg, wherein the CTLA4-Ig has been recovered from its environment ⁇ such as a cell culture, a batch culture, or a bioreactor, etc.
  • isolated refers to carrying out a process or method to obtain an isolated CTLA4-Ig molecule.
  • soluble CTLA4 means a molecule that can circulate in vivo or CTLA4 which is not bound to a cell membrane.
  • the soluble CTLA4 can include CTLA4-Ig which includes the extracellular region of CTLA4, linked to an Ig.
  • the term "soluble fraction of a cell culture” refers to the liquid portion of a cell culture other than, or which is substantially free of, insoluble, particulate or solid components of the cell culture, such as cells, cell membranes and nuclei.
  • the soluble fraction may be, for example, the resulting supernatant following centrifugation of the cell culture, or the resulting filtrate following filtration of the cell culture.
  • expression cassette refers to a nucleic acid having at least a 5' regulatory region (e.g., promoter) operably linked to a nucleotide sequence that encodes a polypeptide, and optionally an untranslated 3' termination region (e.g., stop codon and polyadenylation sequence). Under appropriate conditions, a polypeptide encoded by an expression cassette is produced by the expression cassette.
  • An expression cassette may also have one or more nucleotide sequences that target integration of the expression cassette into a specific site in the genome of a host cell (for example, see Koduri et al., (2001) Gene 280:87- 95).
  • a CTLA4 A29YLI04E -Ig polypeptide expression cassette derived from a plasmid deposited as ATCC Accession No. PTA-2104 is one example of an expression cassette encoding a CTLA4 A29YL104E -Ig.
  • the term “substantially purified” refers to a composition comprising a CTLA4-Ig molecule or a selected population of CTLA4-Ig molecules that is removed from its natural environment (e.g., is isolated) and is at least 90% free, 91% free, 92% free, 93% free, 94% free, 95% free, 96% free, 97% free, 98% free, 99% free, 99.5% free, or 99.9% free from other components, such as cellular material or culture medium, with which it is naturally associated. For example, with respect to a recombinantly produced . • CTLA4-Ig protein molecule, the term “substantially purified” can also refer to.
  • composition comprising a CTLA4-Ig protein molecule that is removed from the production environment such that the protein molecule is at least 90% free, 91% free, 92% free, 93% free, 94% free, 95% free, 96% free, 97% free, 98% free, 99% free, 99.5% free, or 99.9% free from protein molecules which are not polypeptides. of SEQ ID NO: 2 or mutant polypeptides of SEQ ID NO: 2 which are of interest. "Substantially purified” does not exclude mixtures of CTLA4-Ig molecules (such as dimers) with other CTLA4-Ig molecules (such as tetramer). "Substantially purified” does not exclude pharmaceutically acceptable excipients or carriers combined with CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have been taken out of their native environment.
  • a “liquid culture” refers to cells (for example, bacteria, plant, insect, yeast, or animal cells) grown on supports, or growing suspended in a liquid nutrient medium.
  • a “seed culture” refers to a cell culture grown in order to be used to inoculate larger volumes of culture medium.
  • the seed culture can be used to inoculate larger volumes of media in order to expand the number of cells growing in the culture (for example, cells grown in suspension).
  • culturing refers to growing one or more cells in vitro under • defined or controlled conditions.
  • culturing conditions which can be defined include temperature, gas mixture, time; and medium formulation
  • expanding refers to culturing one or more cells in vitro for the purpose of obtaining a larger number of cells in the culture.
  • population refers to a group of two or more molecules (“population of molecules”) or cells (“population of cells”) that are characterized by the presence or absence of one or more measurable or detectable properties.
  • the molecules or cells in the population are characterized by the same or substantially the same properties (for example, the cells of a clonal cell line).
  • the molecules or cells in the population are characterized by at least one property that is the same or substantially the same, where the cells or molecules may also exhibit properties that are not the same (for example, a population of CTLA4-Ig molecules having a substantially similar average sialic content, but having non-similar • mannose content).
  • high molecular weight aggregate is used interchangeably with “high molecular weight species” to refer to a CTLA4-Ig molecule comprising at least three CTLA4-Ig monomers.
  • a high molecular weight aggregate may be a tetramer, a pentamer or a hexamer.
  • Percent (%) yield refers to the actual yield divided by the theoretical yield, and that value multipled by 100.
  • the actual yield can be given as the weight in gram or in mol (for example, a molar yield).
  • the theoretical yield can be given as the ideal or mathematically calculated yield.
  • an “amount of MCP-I” refers to (1) an amount of MCP-I (Monocyte chemotactic protein-1, especially, hamster MCP-I) alone, or (2) an amount of "MCP-I like” protein, wherein "MCP-I like” protein includes MCP-I, together with proteins homologous to MCP-I, fragments of MCP-I, and/or fragments of proteins homologous to MCP-I (for example, in each of the aforementioned instances, as may be cross-reactive with an antibody (e.g.-, polyclonal ELISA) assay for the detection of MCP-I).
  • an antibody e.g.-, polyclonal ELISA
  • MCP-I and/or proteins homologous to MCP-I, fragments of MCP-I, and/or fragments of proteins homologous to MCP-I
  • no lower limit is provided with regard to a range of amounts of MCP-I.
  • glycoslation content refers to an amount of N-linked or O- linked sugar residues covalently attached to a protein molecule, such as a glycoprotein like a CTLA4-Ig molecule.
  • the term “molar ratio of sialic acids to protein” is calculated and given as number of moles of sialic acid molecules per moles of protein (CTLA4-Ig molecules) or dimer.
  • CTL4-Ig molecules CTL4-Ig molecules
  • dimer dimer
  • sialylation refers to the addition of a sialic acid residue to a protein, including a glycoprotein.
  • glycoprotein isoform refers to a molecule characterized by its carbohydrate and sialic acid content as determined by isoelectric focusing (IEF) gel electrophoresis or other suitable methods for distinguishing different proteins in a mixture by their molecular weight, charge, and/or other characteristics.
  • IEF isoelectric focusing
  • each distinct band observed on an IEF gel represents molecules that have a particular isoelectric point (p ⁇ ) and thus the same net overall charge.
  • a glycoprotein isoform can be a distinct band observed on an IEF gel where each band can be a population of molecules that have a particular pi.
  • Immuno tolerance refers to a state of unresponsiveness to a specific antigen or group of antigens to which a person is normally responsive (for example, a state in which a T cell can no longer respond to antigen).
  • Potency refers to a measure of the response as a function of ligand concentration. For example, agonist potency is quantified as the concentration of ligand that produces half the maximal effect (ECso).
  • ECso half the maximal effect
  • a non-limiting pharmacological definition of potency includes components of affinity and efficacy, where, efficacy is the ability of a drug to evoke a response once bound. Potency is related to affinity, but potency and affinity are different measures of drug action.
  • pharmaceutically acceptable carrier refers to a vehicle for a pharmacologically active agent.
  • the carrier facilitates delivery of the active agent to the target site without terminating the function of the agent.
  • suitable forms of the carrier include solutions, creams, gels, gel emulsions, jellies, pastes, lotions, salves, sprays, ointments, powders, solid admixtures, aerosols, emulsions (e.g., water in oil or oil in water), gel aqueous solutions, aqueous solutions, suspensions, liniments, tinctures, and patches suitable for topical administration.
  • composition refers to a composition that. is acceptable for pharmaceutical administration, such as to a human being.
  • a composition can include substances that are impurities at a level not exceeding an acceptable level for pharmaceutical administration (such level including an absence of such impurities), and can include pharmaceutically acceptable excipients, vehicles, carriers and other inactive ingredients, for example, to formulate such composition for ease of administration, in addition to any active agent(s).
  • a pharmaceutically acceptable CTLA4-Ig composition can include MCP-I or DNA, so long as those substances are at a level acceptable for administration to humans.
  • drug substance is the active pharmaceutical ingredient contained in a pharmaceutical composition.
  • drug substance includes an active pharmaceutical ingredient in solution and/or in buffered form.
  • drug product is a pharmaceutical composition containing drug substance formulated for pharmaceutical administration.
  • exemplary drug substances and drug products that may be assayed are as follows.
  • 5, 6, 7, 8, 9, 10 or 18 is, 250 mg lyophilized CTLA4-Ig protein, 500 mg maltose, 17.2 mg monobasic sodium phosphate, and 14.6 mg sodium chloride, pH 7.0-8.0; or
  • composition of lyophilized CTLA4-Ig protein (250mg/vial) drug product Composition of lyophilized CTLA4-Ig protein (250mg/vial) drug product
  • buffered aqueous solution 25 mM sodium phosphate, 1OmM sodium chloride, pH of 7.5.
  • Exemplary drug product for CTLA4Ig molecules comprising SEQ ID NO:s 4, 11, 12, 13, 14, 15, 16, or 24:
  • culture medium and “cell culture medium” and “feed medium” and “fermentation medium” refer to a nutrient solutions used for growing and or maintaining cells, especially mammalian cells.
  • these solutions ordinarily provide at least one component from one or more of the following categories: (1) an energy source, usually in the form of a carbohydrate such as glucose; (2) all essential amino acids, and usually the basic set of twenty amino acids plus cysteine; (3) vitamins and/or other organic compounds required at low concentrations; (4) free fatty acids or lipids, for example linoleic acid; and (5) trace elements, where trace elements are defined as inorganic compounds or naturally occurring elements that are typically required at very low concentrations, usually in the micromolar range.
  • the nutrient solution can be supplemented electively with one or more components from any of the following categories: (1) hormones and other growth factors such as, serum, insulin, transferrin, and epidermal growth factor; (2) salts, for example, magnesium; calcium, and phosphate; (3) buffers, such as HEPES; (4) nucleosides and bases such as, adenosine, thymidine, and hypoxanthine; (5) protein and tissue hydrolysates, for example peptone or peptone mixtures which can be obtained from purified gelatin, plant material, or animal ' byproducts; (6) antibiotics, such as gentamycin; (7) cell protective agents, for example pluronic polyol; and (8) galactose.
  • hormones and other growth factors such as, serum, insulin, transferrin, and epidermal growth factor
  • salts for example, magnesium
  • calcium, and phosphate such as HEPES
  • nucleosides and bases such as, adenosine, thym
  • the term "inoculation” as used herein refers to the addition of cells to culture medium to start the culture.
  • growth phase refers to the period of exponential cell growth (for example, the log phase) where cells are primarily dividing rapidly. During this phase, the rate of increase in the density of viable cells is higher than at any other time point.
  • production phase of the cell culture refers to the period of time during which cell growth is stationary or is maintained at a near constant level. The density of viable cells remains approximately constant over a given period of time. Logarithmic cell growth has terminated and protein production is the primary activity during the production phase. The medium at this time is generally supplemented to support continued protein production and to achieve the desired glycoprotein product.
  • the terms "expression” or “expresses” are used to refer to transcription and translation occurring within a cell.
  • the level of expression of a product gene in a host cell can be determined on the basis of either the amount of corresponding mRNA that is present in the cell or the amount of the protein encoded by the product gene that is produced by the cell, or both.
  • glycosylation refers to the addition of complex oligosaccharide structures to a protein at specific sites within the polypeptide chain. Glycosylation of proteins and the subsequent processing of the added carbohydrates can affect protein folding and structure, protein stability, including protein half life, and functional properties of a protein. Protein glycosylation can be divided into two classes by virtue of the sequence context where the modification occurs, O-linked glycosylation and N-linked glycosylation. O-linked polysaccharides are linked to a hydroxyl group, usually to the hydroxyl group of either a serine or a threonine residue. O-glycans are not added to every serine and threonine residue.
  • O-linked oligosaccharides are usually mono or biantennary, i.e. they comprise one or at most two branches (antennas), and comprise from one to four different kinds of sugar residues, which are added one by one.
  • N-linked polysaccharides are attached to the amide nitrogen of an asparagine. Only asparagines that are part of one of two tripeptide sequences, either asparagine-X-serine or asparagine-X-threonine (where X is any amino acid except, proline), are targets for glycosylation.
  • N-linked oligosaccharides can have from one to four branches referred to as mono-, bi- s tri- tetraantennary.
  • Sialic acid is a common name for a family of unique nine-carbon monosaccharides, which can be linked to other oligosaccharides.
  • Two family members are N-acetyl neuraminic acid, abbreviated as Neu5 Ac or NANA, and N-glycolyl neuraminic acid, abbreviated as Neu5Gc or NGNA.
  • the most common form of sialic acid in humans is NANA.
  • N-acetylneuraminic acid is the primary sialic acid species present in CTLA4-Ig molecules. However, it should be noted that minor but detectable levels of N glycolylneuraminic acid (NGNA) are also present in CTLA4-lg molecules. Furthermore, the method described herein can be used to determine the number of moles of sialic acids for both NANA and NGNA, and therefore levels of both NANA and NGNA are determined and reported for CTLA4-Ig molecules.
  • N- and O-linked oligosaccharides have different number of branches, which provide different number of positions to which sialic acid molecules can be attached. N-linked ologosaccharides can provide up to four attachment positions for sialic acids, while O-linked oligosaccharides can provide two sites for sialic acid attachment.
  • the term “large-scale process” can be used interchangeably with the term “industrial-scale process”.
  • the term “culture vessel” can be used interchangeably with “bioreactor”, “reactor” and “tank”.
  • working solution(s) refers to solutions that are used in a method.
  • working solutions include buffers.
  • reference material refers to a material that is used as a standard in a method.
  • a reference material can be used as a standard to which experimental samples will be compared.
  • temperatures in reference to cell culture refers to the temperature setting on the instrument that regulates the temperature of the bioreactor.
  • the temperature of the liquid culture itself will adopt the temperature set on the instrument regulating the temperature for the bioreactor.
  • the temperature refers to a cell culture that is maintained on a shelf in an incubator, the temperature then refers to the shelf temperature of the incubator.
  • the invention provides for compositions of CTLA4-Ig molecules and compositions of mutant CTLA4-Ig molecules, such as CTLA4 A29YL104E -Ig.
  • the invention provides for compositions with certain characteristics, such as certain amounts of bacterial endotoxin, bioburden, a pi within a certain range (or certain IEF bands within a pi of a certain range), a certain amount of monomer (single chain), dimer or high molecular weight species (such as tetramer), a certain tryptic peptide profile, a certain set of major bands on SDS- PAGE 5 a certain DNA content, an amount of MCP-I not exceeding a certain maximum, an amount of cell protein not exceeding a certain maximum, an amount of Triton X-100 not exceeding a certain maximum, an amount of Protein A not exceeding a certain maximum, a certain profile of N-linked carbohydrates, a certain amino monosaccharide composition (GlcNac, GaINAc), a certain neutral monosacchari
  • the invention provides compositions with any one of the aforementioned characteristics, or more than one of the aforementioned characteristics, up to an including all of the aforementioned characteristics in any and all possible permutations or combinations.
  • the invention includes all the compositions of the invention in isolated or substantially purified form, or not in isolated or substantially purified form.
  • the invention provides for compositions which are pharmaceutical compositions.
  • the invention is directed to a method for obtaining a composition
  • a composition comprising an isolated population of CTLA4-Ig molecules from a liquid culture medium, the medium comprising an initial population of CTLA4-Ig molecules, wherein (1) CTLA4-Ig molecules of the initial population have one or more sialic acid residues, (2) the number of sialic acid residues per CTLA4-Ig molecule varies within the initial population, and (3) the initial population comprises CTLA4-Ig dimer and high molecular weight aggregate
  • the method comprises (a) harvesting the liquid culture medium from a culture of mammalian cells expressing CTLA4-Ig molecules; (b)separating the CTLA4-Ig molecules from cellular components; (c) separating CTLA4-Ig dimers from CTLA4-Ig high molecular weight aggregates; and (d) separating the CTLA4-Ig molecules into two or more fractions, wherein at least one fraction has a greater molar ratio of sialic acid to CTLA4-I
  • the harvesting in step (a) comprises obtaining a soluble fraction of the liquid culture.
  • steps (c) and (d) of the method comprise the use of column chromatography so as to obtain fractions of CTLA4-Ig molecules having different sialic acid contents.
  • the method further comprises use of column chromatography to reduce MCP-I content in the composition.
  • the CTLA4-Ig molecules comprise one or more polypeptides having SEQ ID NO:2, 5, 6, 7, 8, 9, or 10. In other embodiments, the CTLA4-Ig molecules comprise one or more polypeptides having SEQ ID NO:4, 11, 12, 13, 14, 15 or 16.
  • the fraction in (d) having the greater molar ratio of sialic acid to CTLA4-Ig molecules exhibits an average rnolar ratio of sialic acid to CTLA4-Ig molecules from about 8 to about 14.
  • the average molar ratio is from about 8 to about 11, from about 8 to about 10, or from about 8 to about 9.
  • the invention provides for a method for isolating CTLA4-Ig molecules, the method comprising: (i) obtaining a soluble fraction of a liquid culture comprising mammalian cells that produce composition comprising CTLA4-Ig molecules; (ii) subjecting the soluble fraction to anion exchange chromatography to obtain an eluted composition comprising CTLA4-Ig molecules; (iii) subjecting the composition of step (ii) to hydrophobic interaction chromatography so as to obtain an enriched composition comprising CTLA4-Ig molecules; (iv) subjecting the composition of (iii) to affinity chromatography to obtain a further enriched composition comprising CTLA4-Ig molecules; and (v) subjecting the composition of (iv) to anion exchange chromatography.
  • the composition obtained in step (ii) is characterized by: (a) an average of 6.0-10.1 moles of NANA per mole of CTLA4Ig molecule; and (b) less than or equal to 25.7 area percent CTLA4-Ig high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection.
  • the composition obtained in step (iii) is characterized by: (a) an average of 6.8-1 1.4 moles of NANA per mole of CTLA4Ig molecule; and (b) less than or equal- to 2.5 area percent of CTLA4-Ig high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection.
  • the composition obtained in step (iv) is characterized by: (a) an average of 8.0-11.0 moles of NANA per mole of CTLA4-Ig molecule; and (b) less than or equal to 2.5 area percent of CTLA4-Ig high molecular weight species.
  • the composition obtained in step (v) is characterized by: (a) an average of 8.0-11.9 moles of NANA per mole of CTLA4-Ig molecule; and (b) less than or equal to 2.0 area percent being CTLA4-Ig high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection (SPD).
  • SPD spectrophotometric detection
  • an example of SPD can be at A 280 nm.
  • the present invention also provides a method for isolating a composition of
  • •CTLA4-Ig molecules comprising: (i) obtaining a soluble fraction of a liquid culture comprising mammalian cells that produce CTLA4-Ig molecules, and, in any order, (ii) subjecting the soluble fraction to anion exchange chromatography so as to obtain an enriched and eluted composition comprising CTLA4-Ig molecules; (iii) subjecting the soluble fraction to hydrophobic interaction chromatography so as to obtain an enriched and eluted • composition comprising CTLA4-Ig molecules; (iv) subjecting the soluble fraction to affinity chromatography so as to obtain an enriched and eluted composition comprising CTLA4-Ig molecules; and (v) subjecting the soluble fraction to anion exchange chromatography so as to obtain an eriched and eluted composition comprising CTLA4-Ig molecules.
  • the present invention provides a method for isolating a composition comprising CTLA4-Ig molecules, the method comprising: (i) obtaining a soluble fraction of a liquid culture comprising mammalian cells that produce CTLA4-lg molecules; (ii) subjecting the soluble fraction to anion exchange chromatography to obtain an eluted composition comprising CTLA4-Ig molecules; (iii) subjecting the protein product of step (ii) to hydrophobic interaction chromatography so as to obtain an enriched composition comprising CTLA4-Ig molecules; (iv) subjecting the protein product of (iii) to affinity chromatography to obtain a further enriched composition comprising CTLA4-Ig molecules; and (v) subjecting the protein product of (iv) to anion exchange chromatography, so as to isolate a composition comprising CTLA4-Ig molecules.
  • the composition comprising CTLA4-Ig molecules obtained in step (ii) of the method is characterized by: (a) an average molar ratio of NANA to CTLA4Ig molecules of from 6.0 to 10.1, and (b) less than or equal to 2.5 area percent CTLA4-Ig high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection.
  • the composition comprising CTLA4-Ig molecules obtained in step (iii) of the method is characterized in that in that (a) CTLA4-Ig high molecular weight species is less than about 2.5 area % as determined by size exclusion chromatography and spectrophotometric detection, (b) cellular protein is less than about 95 ng/ml, and (c) MCP-I is less than about 5 ppm.
  • the composition comprising CTLA4-Ig molecules obtained in step (iii) of the method is characterized by: (a) an average molar ratio of NANA to CTLA4-Ig molecules of from 6.8 to 11.4, and (b) less than or equal to 2.5 area percent CTLA4-Ig high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection.
  • the composition comprising CTLA4-Ig molecules obtained in step (iv) of the method is characterized by: (a) an average molar ratio of NANA to CTLA4-Ig molecules of from 8.0 to 1 1.0, and (b) less than or equal to 2.5 area percent CTLA4-Ig high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection.
  • the composition obtained in step (iii) of the invention is characterized in that CTLA4-Ig high molecular weight species is less than 2.5% area percent as determined by size exclusion chromatography and spectrophotometric detection.
  • the protein composition comprising CTLA4-Ig molecules in step (v) of the method is characterized by: (a) an average molar ratio of NANA to CTLA4-Ig molecules of from 8.0 to 1 1.9, and (b) less than or equal to 2.0 area percent CTLA4-Ig high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection.
  • the invention also provides, in another aspect, a method for isolating a composition of CTLA4-Ig molecules, comprising: (i) obtaining a soluble fraction of a liquid culture comprising mammalian cells that produce CTLA4-Ig molecules, and, in any order, (ii) subjecting the soluble fraction to anion exchange chromatography so as to obtain an enriched and eluted composition comprising CTLA4-Ig molecules; (iii) subjecting the soluble fraction to hydrophobic interaction chromatography so as to obtain an enriched and eluted composition comprising CTLA4-Ig molecules; (iv) subjecting the soluble fraction to affinity chromatography so as to obtain an enriched and eluted composition comprising CTLA4-Ig molecules; and (v) subjecting the soluble fraction to anion exchange chromatography so as to obtain an enriched and eluted composition comprising CTLA4-Ig molecules, wherein the composition obtained in step (iii) is characterized in that the percentage of
  • the invention provides a method for isolating a composition of CTLA4-Ig molecules, the method comprising: (i) obtaining a soluble fraction of a liquid culture comprising mammalian cells that produce CTLA4-Ig molecules, and, in any order, (ii) subjecting the soluble fraction to anion exchange chromatography so as to obtain an enriched and eluted composition comprising CTLA4-Ig molecules; (iii) subjecting the soluble fraction to hydrophobic interaction chromatography so as to obtain an enriched and eluted composition comprising CTLA4-Ig molecules; (iv) subjecting the soluble fraction to affinity chromatography so as to obtain an enriched and eluted composition comprising CTLA4-Ig molecules; and (v) subjecting the soluble fraction to anion exchange chromatography so as to obtain an enriched and eluted composition comprising CTLA4-Ig molecules, wherein the composition obtained in step (iii) is characterized in that the percentage of
  • the anion exchange chromatography of step (ii) of the method is carried out using a wash buffer comprising about 75 mM HEPES, and about 360 mM NaCl, and having a pH of about 8.0.
  • the anion exchange chromatography of step (ii) of the invention is carried out using an elution buffer comprising ' about 25 mM HEPES, and about 850 mM NaCl, and having a pH of about 7.0.
  • the hydrophobic interaction chromatography of step (iii) of the method is carried out using a single wash buffer comprising about 25 mM HEPES, and about 850 mM NaCl, and having a pH of about 7.0.
  • the affinity chromatography of step (iv) of the method is carried out using a wash buffer comprising about 25 mM Tris, and about 250 mM NaCl, and having a pH of about 8.0.
  • the affinity chromatography of step (iv) of the method is carried out using an elution buffer comprising about 100 mM glycine and having a pH of about 3.5.
  • the anion exchange chromatography of step (v) of the method is carried out using a wash buffer comprising about 25 mM HEPES, and from about 120 mM NaCl to about 130 mM NaCl, and having a pH of about 8.0.
  • the anion exchange chromatography of-step (v) of the method is carried out using an elution buffer, comprising about 25 mM HEPES, and about 200 mM NaCl, and having a pH of about 8.0.
  • the anion exchange chromatography of step (ii) of the method is carried out using a column having an anion ex change- resin comprising a primary, secondary, .tertiary, or quarternary amine functional group.
  • the resin comprises a quarternary amine functional group.
  • the hydrophobic interaction chromatography of step (iii) of the method is carried out using a hydrophobic interaction resin comprising a phenyl, an octyl, a propyl, an alkoxy, a butyl, or an isoamyl functional group.
  • the functional group comprises a phenyl functional group.
  • the affinity chromatography of step (iv) of the method is carried out using an affinity chromatography resin comprising Protein A.
  • the invention provides a method for preparing a composition comprising CTLA4-Ig molecules, comprising purifying CTLA4-Ig molecules from a liquid cell culture, wherein the purified CTLA4-Ig composition comprises (a) a pharmaceutically acceptable amount of MCP-I per mg of CTLA4-Ig molecules, and (b) less than 2.5 area % of CTLA4-Ig high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection.
  • the pharmaceutically acceptable amount of MCP-I comprises from about 40 to about 0.5 ng/mg of CTLA4-Ig molecules.
  • the pharmaceutically acceptable amount of MCP-I comprises from about 35 to about 0.5 ng/mg of CTLA4-Ig molecules. In an additional embodiment, the pharmaceutically acceptable amount of MCP-I comprises from about 10 to about 0.5 ng/mg of CTLA4-Ig molecules.
  • the affinity chromatography of step (iv) of the method is carried out using a. column comprising a resin capable of reducing MCP-I in the eluted protein product.
  • the hydrophobic interaction chromatography of step (iii) of the method is carried out using a hydrophobic interaction resin, wherein the resin is capable of (a) separating CTLA4-Ig dimers from CTLA4-Ig high molecular weight species; (b) increasing sialic acid content of the eluted CTLA4-Ig molecules; or (c) both (a) and (b).
  • the anion exchange chromatography of step (ii) or step (iv), or both is carried out using an anion .exchange resin, wherein the resin is capable of (a) decreasing the CTLA4-Ig high molecular weight aggregate content of the eluted composition; (b) increasing the sialic content of the eluted composition; or (c) both (a) and (b). [00213] .
  • the invention provides a method for isolating a composition .
  • the method comprising: (i) obtaining a soluble fraction of a liquid culture comprising mammalian cells that produce CTLA4-Ig molecules, and in any order; (ii) subjecting the soluble fraction to affinity chromatography so as to obtain an eluted composition comprising CTLA4-Ig molecules; (iii) subjecting the soluble fraction to anion exchange chromatography so as to obtain an eluted and enriched composition comprising CTLA4-Ig molecules; and (iv) subjecting the soluble fraction to hydrophobic interaction chromatography so as to obtain an eluted and enriched composition comprising CTLA4-Ig molecules.
  • the affinity chromatography step is performed first.
  • the affinity chromatography of step (ii) of the method is carried out using a resin comprising Protein A.
  • the affinity chromatography of step (ii) is carried out using an elution buffer comprising guanidine.
  • the affinity chromatography of step (ii) is carried out using an elution buffer comprising urea.
  • the affinity chromatography of step (ii) results in an increase in CTLA4-Ig dimers in the eluted composition comprising CTLA4-Ig molecules.
  • the invention provides a method for isolating composition comprising CTLA4-Ig molecules from liquid harvested from a mammalian cell culture, wherein the cells produce CTLA4-Ig molecules, the method comprising: (i) obtaining a soluble fraction of the harvested liquid; (ii) subjecting the soluble fraction to affinity chromatography to obtain an eluted composition comprising CTLA4-Ig molecules; (iii) subjecting the composition of step (ii) to anion exchange chromatography so as to obtain an eluted and enriched composition comprising CTLA4-Ig molecules; and (iv) subjecting the composition from step (iii) to hydrophobic interaction chromatography to obtain a further enriched composition comprising CTLA4-Ig molecules.
  • the composition obtained in step (iv) of the method is characterized in that the percentage of high molecular weight species is less than about 2.5 area % as determined by size exclusion chromatography and spectrophotometric detection, and the percentage of cellular protein is less than about 95 ng/ml, and the percentage of MCP-I is less than about 5 ppm.
  • the anion exchange chromatography of step (iii) is carried out using a wash buffer comprising about 50 mM HEPES, and about 135 mM NaCl, and having a pH of about 7.
  • the anion exchange chromatography of step (iii) is carried out using an elution buffer comprising about 50 mM HEPES, and about 200 mM NaCl, and having a pH of about 7.
  • the hydrophobic interaction chromatography of step (iii) is carried out using a hydrophobic interaction resin comprising a phenyl, an octyl, a propyl, an alkoxy, a butyl, or an isoamyl functional group.
  • the hydrophobic interaction chromatography of step (iv) is carried out using a wash buffer comprising about 50 mM HEPES, and about 1.2 M (NFLj) 2 SO 4 , and having a pH of about 7.
  • the affinity chromatography of step (ii) is carried out using a wash buffer comprising about 25 mM NaHaPO 4 , and about 150 mM NaCl, and. having a pH of about 7.5.
  • the affinity chromatography of step (ii) is carried out using an elution buffer-comprising about 250 mM glycine and having a pH of about 3.
  • the anion exchange chromatography of step (iii). is carried out using a column having an anion exchange resin comprising a primary, secondary, tertiary, or quartemary amine functional group. In a specific embodiment, the resin comprises a quartemary amine functional group.
  • the hydrophobic interaction chromatography of step (iii) is carried out using a hydrophobic interaction resin comprising a phenyl, an octyl, a propyl, an alkoxy, a butyl, or an isoamyl functional group.
  • the functional group comprises a phenyl functional group.
  • the affinity chromatography of step (ii) is carried out using a resin comprising Protein A.
  • the invention provides for a composition comprising CTLA4-lg molecules obtained by any of the methods of the invention.
  • the composition comprises one or more polypeptides having SEQ ID NO:2, 5, 6, 7, 8, 9 or 10.
  • the composition comprises one or more polypeptides having SEQ ID NO:4, 11, 12; 13;.14, 15 or 16.
  • the invention provides for a • CTLA4-Ig expression plasmid having the nucleic acid sequence of SEQ ID NO: 17.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig protein of from about 5.5 to about 18.
  • the invention provides for a substantially. purified . composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 5.5 to about 9.5.
  • the invention provides for a substantially purified composition comprising
  • CTLA4-Ig molecules wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 5 to about 10.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 6 to about 18.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 8 to about 18. . .
  • the invention provides for a substantially purified composition comprising
  • CTLA4-Ig molecules wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 8 to about 12.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 8 to about 11.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 7 to about 12.
  • the invention provides for a substantially purified composition comprising
  • CTLA4-Ig molecules wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 7 to about 11.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 11 to about 18.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 12 to about 18.
  • the invention provides for a substantially purified composition comprising
  • CTLA4-Ig molecules wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 13 to about 18.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules; wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 14 to about 18.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 15 to about 17.
  • the invention provides for a substantially purified composition comprising
  • CTLA4-Ig molecules wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of about 16.
  • the invention provides, for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of about 10.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules; wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of about 6.
  • the sialic acid is N-acetyl neuraminic acid (NANA).
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of NANA to CTLA4-Ig molecules of from about 8 to about 12.
  • the invention provides for a substantially purified " composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of N-glycolyl neuraminic acid (NGNA) to CTLA4-Ig molecules of less than or equal to about 1.5.
  • NGNA N-glycolyl neuraminic acid
  • the invention provides for a substantially purified composition comprising
  • CTLA4-Ig molecules wherein the CTLA4-Ig molecules have an average molar ratio of NGNA to CTLA4-Ig molecules of from about 0.5 to about 1.5.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of NGNA to CTLA4-Ig molecules of from about 1.0 to about 1.5.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4- ⁇ g molecules of from about 6 to about 18.
  • the invention provides for a substantially purified composition comprising
  • CTLA4-Ig molecules wherein the CTLA4-Ig molecules are characterized by an average molar ratio of sialic acid per mole of CTLA4-Ig molecules of from about 6 to about 12.
  • the invention provides for a substantially purified composition comprising
  • CTLA4-Ig molecules wherein each polypeptide of the molecule comprises the sequence of SEQ ID NO:11, 12, 13, 14, 15 or 16, and wherein the CTLA4-Ig molecules are characterized by an average molar ratio of sialic acid per mole of CTLA4-Ig molecules of from about 5.5 to about 9.5. In one embodiment, the molar ratio of sialic acid per mole of CTLA4-Ig molecules is determined by acid hydrolysis and HPLC. In one embodiment, the CTLA4-Ig molecules comprise one or more polypeptides having SEQ ID NO:2, 5, 6, 7, 8, 9 or 10. 100225J . In one embodiment, the CTLA4 ⁇ Ig molecules comprise one or more polypeptides having SEQ ID NO:4, 11, 12, 13, 14, 15 or 16.
  • the invention provides for a substantially purified composition comprising CTLA4-Ig molecules, wherein greater than or equal to 95% of the CTLA4-Ig molecules are OTLA4-Ig dimers. In one embodiment, greater than or equal to 98% of the CTLA4-Ig molecules are CTLA4-Ig dimers. In one embodiment, greater than or equal to 99% of the CTLA4-Ig molecules are CTLA4-Ig dimers.
  • CTLA4-Ig dimers greater than or equal to 99.5% of the CTLA4-Ig molecules are CTLA4-Ig dimers. In one embodiment, from about 95% to about 99.5% of the CTLA4-Ig molecules are CTLA4-Ig dimers and about 0.5 area percent to about 5 area percent of the molecules are CTLA4-Ig high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection.
  • the molecules are CTLA4-Ig dimers and about 1.2 area percent of the molecules are CTLA4-Ig high molecular weight species and about less than 0.7 area percent of the molecules are CTLA4-Ig monomers as determined by size exclusion chromatography and spectrophotometric detection. In one embodiment, about less then about 0.3% of the . molecules are multimers comprising five or more CTLA4-Ig monomers.
  • the invention provides for a composition consisting essentially of CTLA4-Ig dimers.
  • the invention provides for a composition consisting essentially of CTLA4-Ig molecules, wherein the population is substantially free of CTLA4-Ig monomers.
  • the invention provides for a composition consisting essentially of CTLA4-Ig molecules, wherein the population is substantially free of CTLA4-Ig high molecular weight species.
  • the invention provides for a composition consisting essentially of CTLA4-Ig monomers substantially free of CTLA4-Ig dimers and high molecular weight species.
  • each monomer of each CTLA4-Ig dimer has at least 3 sialic acid groups.
  • each monomer of each CTLA4-Ig dimer has at least 2.5 sialic acid groups.
  • each monomer of each CTLA4-Ig dimer has from at least 3 sialic acid groups to at least 8 sialic acid groups.
  • each monomer of each CTLA4-Ig dimer has from at least
  • each dimer comprises two CTLA4-Ig polypeptides, wherein each polypeptide has an amino acid sequence selected from the group consisting of SEQ ID NOS:5 ⁇ 16.
  • the composition comprises one or more polypeptides having SEQ ID NO:2, 5, 6, 7, 8, 9 or 10.
  • the composition comprises one or more polypeptides having SEQ ID NO:4, 11, 12, 13, .14, 15 or-l 6.
  • the invention provides for an isolated-composition comprising CTLA4-Ig tetramers, which is substantially free of CTLA4-Ig dimers. The invention .
  • each tetramer comprises two pairs of CTLA4-Ig polypeptides, wherein each polypeptide has an amino acid sequence selected from the group consisting of SEQ ID NQS:5-10. In one embodiment, each tetramer comprises two pairs of CTLA4-Ig polypeptides, wherein each polypeptide has an amino acid sequence selected from the group consisting of SEQ ID NOS : 11 - 16. In one embodiment, each tetramer is capable of binding to a CD80 or CD86.
  • the invention provides for a pharmaceutically acceptable composition comprising CTLA4-Ig molecules, wherein the composition is substantially free of MCP-I .
  • the invention provides for a pharmaceutically acceptable composition comprising CTLA4-Ig molecules, wherein the composition comprises no more than about 25 ppm MCP-I . In one embodiment, the composition comprises no more than 10 ppm MCP-I. In one embodiment, the composition comprises from about 0.2 ng/ml MCP-I to about 10 ng / ml of MCP-I .
  • the invention provides for a pharmaceutically acceptable composition comprising CTLA4-Ig molecules, wherein the composition comprises (a) from about 0.2 ng/ml MCP-I to about 10 ng / ml of MCP-I and (b) no more than 25 ng/ml of CHO protein or no more than 10 ng/ml of CHO protein. In one embodiment, the composition comprises no more than about 20 pg/ml of DNA.
  • the invention provides for an isolated composition comprising CTLA4-Ig molecules, wherein, when administered to a subject at an intravenous dose of about 10 mg/kg, the CTLA4-Ig molecules are capable of exhibiting: an area under the curve (AUC) of about 44400 ⁇ g.h/ml; a volume of distribution of about 0.09 L/kg; a peak concentration (Cmax) of about 292 ⁇ g/ml; and a clearance rate of about 0.23 ml/h/kg.
  • AUC area under the curve
  • Cmax peak concentration
  • the invention • provides for an isolated composition comprising CTLA4-Ig molecules, wherein the composition comprises dominant isoforms of CTLA4-Ig molecules visualizable on an isoelectric focusing gel which have an isoelectric point, pi, less than or equal to 5.1 ⁇ 0.2 as determined by isoelectric focusing.
  • the average pi of the composition increases after neuraminidase treatment.
  • at least 40% of the CTLA4-Ig molecules exhibit an isoelectric point less than or equal to about 5.1 ⁇ 0.2 as determined by isoelectric focusing.
  • at least 70% of the CTLA4-Ig molecules exhibit an isoelectric point less than or equal to about 5.1 ⁇ 0.2 as determined by isoelectric focusing.
  • CTLA4-Ig molecules exhibit an isoelectric point less than or equal to about 5.1 ⁇ 0.2 as determined by isoelectric focusing.
  • the invention provides for an isolated composition comprising CTLA4- ⁇ g molecules having a pi of from about 3.0 ⁇ 0.2 to about 5.0 ⁇ 0.2.
  • the invention provides for an isolated composition comprising CTLA4-Ig molecules having a pi from about 4.3 ⁇ 0.2 to about 5.0 ⁇ 0.2.
  • the invention provides for an isolated composition comprising CTLA4-Ig molecules having a pi of about 3.3 ⁇ 0.2 to about 4.7 ⁇ 0.2.
  • the composition is substantially purified.
  • the invention provides for a method for preparing a composition, the composition comprising a CTLA4-Ig molecule with a pi of from about 3.0 ⁇ 0.2 to about 5.0 ⁇ 0.2, the method comprising: (a) subjecting a mixture of CTLA4-Ig molecules to isoelectric focusing gel electrophoresis, wherein a single band on the gel represents a population of CTLA4-Ig molecules with a particular pi, and (b) isolating the population of CTLA4-Ig molecules having a pi of from about 3.0 ⁇ 0.2 to about 5.0 ⁇ 0.2 so • as to prepare the composition.
  • the invention provides for an isolated composition comprising CTLA4-Ig molecules, wherein the composition comprises dominant isoforms visualizable on an isoelectric focusing gel which have an isoelectric point, pi, less than or equal to 5.5 ⁇ 0.2 as determined by isoelectric focusing.
  • the average pi ⁇ of the composition increases after neuraminidase treatment.
  • at least 40% of the CTLA4-Ig molecules exhibit an isoelectric point less than or equal to about 5.3 ⁇ 0.2 as determined by isoelectric focusing.
  • at least 70% of the CTLA4-Ig molecules exhibit an isoelectric point less than or equal to about 5.3 ⁇ 0.2 as determined by isoelectric focusing.
  • CTLA4-lg molecules exhibit an isoelectric point less than or equal to about 5.3 ⁇ 0.2 as determined by isoelectric focusing.
  • the invention provides for an isolated composition comprising CTLA4-Ig molecules having a pi of from about 3.0 ⁇ 0.2 to about 5.2 ⁇ 0.2.
  • the invention provides for an isolated composition comprising CTLA4-Ig molecules having a pi from about 4.5 ⁇ 0.2 to about 5.2 ⁇ 0.2.
  • the invention provides for an isolated composition comprising CTLA4-Ig molecules having a pi of about 4.7 ⁇ 0.2 to about 5.1 ⁇ 0.2.
  • the composition is substantially purified. [00231] .
  • the invention provides for a method for preparing, a composition, the- ⁇ composition comprising CTLA4-Ig molecules with a pi of from about 2.0 + 0.2 to about 5.2 ⁇ 0.2, the method comprising: (a) subjecting a mixture of CTLA4-Ig molecules to isoelectric focusing gel electrophoresis, wherein a single band on the gel represents a population- of • CTLA4-Ig molecules with a particular pi, and (b) isolating the population of CTLA4-Ig molecules having a pi of from about ' 3.0 ⁇ 0.2 to about 5.2 ⁇ 0.2 so as to prepare the composition.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are characterized by an average molar ratio of GIcN Ac to CTLA4-Ig molecules of from about 17 to about 28.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are characterized by an average molar ratio of GIcNAc to CTLA4-Ig molecules of from about 17 to about 25.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the GTLA4- ⁇ Ig molecules are characterized by an average molar ratio of GIcNAc to CTLA4-Ig molecules of from about- 15 to about 35.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein each polypeptide of the molecule comprises the sequence of SEQ ID NO:11, 12, 13, 14, 15 or 16, and wherein the CTLA4-Ig molecules are characterized by an average molar ratio of GIcNAc to CTLA4-Ig molecules of from about 24 to about 28.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are characterized by an average molar ratio of GaINAc to CTLA4-Ig molecules of from about 1.7 to about 3.6.
  • the invention provides for a composition comprising CTLA4- Ig molecules, wherein each polypeptide of the molecule comprises the sequence of SEQ ID NO: 11, 12, 13, 14, 15 or 16, and wherein the CTLA4-Ig molecules are characterized by an average molar ratio of GaINAc to CTLA4-Ig molecules of from about 2.7 to about 3.6.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are characterized by an average molar ratio of galactose to CTLA4-Ig molecules of from about 8 to about 17.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein each polypeptide of the molecule comprises the sequence of SEQ ID NO:11, 12, 13, 14, 15 or 16, and wherein the CTLA4-Ig molecules are characterized by an average molar ratio of galactose to CTLA4-Ig molecules of from about 11 to about 13.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-lg molecules -are characterized by an average molar ratio of fucose to CTLA4-Ig molecules of from about 3.5 to about 8.3.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein each polypeptide of the molecule comprises the sequence of SEQ ID NO:11, 12, 13, 14, 15 or 16, and wherein the CTLA4-Ig molecules are characterized by an average molar ratio of fucose to CTLA4-Ig molecules of from about 6.4 to about 7.0.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are characterized by an average molar ratio of mannose to CTLA4-Ig molecules of from about 7.7 to about 22.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein each polypeptide of the molecule comprises the sequence of SEQ ID NO:11, 12, 13, 14, 15 or 16, and wherein the CTLA4-Ig molecules are characterized by an average molar ratio of mannose to CTLA4-Ig molecules of from about 14 to about 16.
  • the molar ratio of GIcNAc to CTLA4-Ig molecules is determined by capillary electrophoresis. In one embodiment, the molar ratio of GaINAc to CTLA4-Ig molecules is determined by capillary electrophoresis. In one embodiment, the molar ratio of galactose to CTLA4-Ig molecules is determined by capillary electrophoresis.
  • the molar ratio of fucose to CTLA4-Ig molecules is determined by capillary electrophoresis. In one embodiment, the molar ratio of mannose to CTLA4-Ig molecules is determined by capillary electrophoresis. In one embodiment, the CTLA4-Ig molecules are obtained by enzymatic attachment of one or more carbohydrates to the molecule.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the molecules comprise carbohydrate residues attached to the molecules enzymatically in vitro.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from about 15 to about 35; and (b) an average molar ratio of sialic acid to CTLA4-Ig molecules from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from about 15 to about 35; (b) an average molar ratio of GaINAc to CTLA4-Ig molecules from about 1.7 to about 3.6; and (c) an average molar ratio of sialic acid to CTLA4-Ig molecules from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from about 15 to about 35; (b) an average molar ratio of GaINAc to CTLA4-tg molecules from about 1.7 to about 3.6; (c) an average molar ratio of galactose to - CTLA4-Ig molecules from about 8 to about 17; and (d) an average molar ratio of sialic acid to CTLA4-Ig molecules from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from- about 15 to about 35; (b) an average molar ratio of GaINAc to CTLA4-Ig molecules from about 1.7 to about 3.6; (c) an average molar ratio of galactose to CTLA4-Ig molecules from about 8 to about 17; (d) an average molar ratio of fucose to CTLA4-Ig molecules from about 3.5 to about 8.3; and (e) an average molar ratio of sialic acid to CTLA4-lg molecules from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from about 15 to about 35; (b) an average molar ratio of GaINAc to CTLA4-Ig molecules from about 1.7 to about 3.6; (c) an average molar ratio of galactose to CTLA4-Ig molecules from about 8 to about 17; (d) an average molar ratio of fucose to CTLA4-Ig molecules from about 3.5 to about 8.3; (e) an average molar ratio of mannose to CTLA4-Ig molecules from about 7.2 to about 22; and (f) an average molar ratio of sialic acid to CTLA4-Ig molecules from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from about 24 to about 28; and (b) an average molar ratio of- sialic acid to CTLA4-Ig molecules from about 5.5 to about 9.5.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from about 24 to about 28; (b) an average molar ratio of GaINAc to CTLA4-Ig molecules from about 2.7 to about 3.6; and (c) an average molar ratio of sialic acid to CTLA4-Ig molecules from about 5.5 to about 9.5.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from about 24 to about 28; (b) an average molar ratio of GaINAc to CTLA4-Ig molecules from about 2.7 to about 3.6; (c) an average molar ratio of galactose to CTLA4-Ig molecules from about 11 to about 13; and (d) an average molar ratio of sialic acid to CTLA4-Ig molecules from about 5.5 to about 9.5.
  • the invention provides for a composition comprising CTLA4-ig molecules characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from about 24 to about 28; (b) an average molar ratio of GaINAc to CTLA4-Ig molecules from about 2.7 to about 3.6; (c) an average molar ratio of galactose to CTLA4-Ig molecules from about 11 to about 13; (d) an average molar ratio of fucose to CTLA4-Ig molecules from about 6.4 to about 7.0; and (e) an average molar ratio of sialic acid to CTLA4-Ig molecules from about 5.5 to about 9.5.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from about 24 to about 28; (b) an average molar ratio, of GaINAc to CTLA4-Ig molecules from about 2.7 to about 3.6; (c) an average molar ratio of galactose to CTLA4-Ig molecules from about 11 to about 13; (d) an average molar ratio of fucose to CTLA4-Ig molecules from about 6.4 to about 7.0; (e) an average molar ratio of mannose to CTLA4-Ig protein from about 14 to about 16; and (f) an average molar ratio of sialic acid to CTLA4-Ig protein from about 5.5 to about 9.5.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are glycosylated at an asparagine amino acid residue at position 102 of SEQ ID NO:2 or 4, an asparagine amino acid residue at position 134 of SEQ ID NO:2 or 4, an asparagine amino acid residue at position 233 of SEQ ID NO:2 or 4, a serine amino acid residue at position 155 of SEQ ID NO:2 or 4, or a serine amino acid residue at position 165 of SEQ ID NO:2 or 4.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are glycosylated, and wherein at least about 2 % of total mass of glycosylation is O-linked glycosylation.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the composition exhibits an NGNA chromatogram peak of about 9.6 ⁇ 0.3 and an NANA chromatogram peak of about 10.5 ⁇ 0.3.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules exhibit a carbohydrate profile substantially the same as Figure 68.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA-Ig molecules exhibit a carbohydrate profile as shown in Figure 68.
  • the invention provides for a composition consisting essentially of CTLA4-Ig molecules, wherein the CTLA4-Ig molecules exhibit a carbohydrate profile of Domains I - IV, wherein Domain I comprises peaks which represent a-sialylated oligosaccharides, Domain II comprises peaks which represent mono-sialylated oligosaccharides, Domain III comprises peaks which represent di-sialylated oligosaccharides, Domain IV comprises peaks which represent tri-sialylated oligosaccharides, and Domain V comprises peaks which represent tetra-sialyated oligosaccharides, and wherein the profile is a chromatogram of oligosaccharides released from CTLA4-Ig.
  • the difference in retention times of N-linked oligosaccharides between a first peak in Domain I and a main peak in Domain II is from about 10 to about 12 minutes. In one embodiment, the difference in retention times of N-linked oligosaccharides between a first peak in Domain I and a main peak in Domain II is from about 11 to about 13 minutes.
  • - glycosylation of Domains III and IV comprises about 25% to about 36% of N-linked- glycosylation as measured by HPAEC. In one embodiment, glycosylation of Domain I comprises about 24.5% to about 35.2% of N-linked glycosylation as measured by HPAEC. In one embodiment, glycosylation of Domain II comprises about 26.3% to about 34.1% of N- linked glycosylation as measured by HPAEC. In one embodiment, glycosylation of Domain
  • glycosylation III comprises about 21.9% to about 31.5% of N-linked glycosylation as measured by HPAEC.
  • glycosylation of Domain IV and Domain V comprises about 7.9% to about 18.6% of N-linked glycosylation as measured by HPAEC.
  • Domain II exhibits an area percentage of at least about 33;
  • Domain III exhibits an area percentage of at least about 24;
  • Domain IV exhibits an area percentage of at least about 9.4,
  • Domain V exhibits an area percentage of at least about 67; or wherein the area is measured from a chromatogram of oligosaccharides released from CTLA4-Ig.
  • Domain IV exhibits at least about 6 peaks
  • Domain V exhibits at least about 6 peaks, and wherein the peaks are exhibited on a chromatogram.
  • Domain III and IV exhibit an area percentage of about
  • Domain I exhibits an area percentage of about 24.5% to about 35.2% as measured by HPAEC.
  • Domain II exhibits ' an area percentage of about 26.3% to about 34.1% as measured by HPAEC.
  • Domain III exhibits an area percentage of about 21.9% to about 31.5% as measured by HPAEC.
  • Domain IV exhibits an area percentage of about 7.9% to about 18.6% as measured by HPAEC.
  • the invention provides for a composition comprising CTLA4-Ig polypeptides, wherein: (a) about 80 % of the polypeptides have biantennary N-linked glycosylation; (b) about 14 % of the polypeptides have triantennary N-linked glycosylation; and (c) about 6 % of the polypeptides have tetraantennary N-linked glycosylation.
  • the N- linked glycosylation is idetermined by high pH anion exchange chromatography ⁇ with pulsed amperometric detection (HPEAC-P AD).
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of galactose to- CTLA4-Ig molecules of from about 8 to about 17; and (b) an average molar ratio of NANA to CTLA4-ig molecules of from about 6 to about 12.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by:
  • CTLA4-Ig high molecular weight species area percent of less than about 3% as determined by size exclusion chromatography and spectrophotometric detection.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by:
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of galactose to CTL A4-Ig. molecules offrom - about 8 to about 17; (b) an average molar ratio of NANA to CTLA4-lg molecules offrom about 6 to about 12; (c) a CTLA4-Ig high molecular weight aggregate content less than about 3 area percent as determined by size exclusion chromatography and spectrophotometric detection; and (d) a carbohydrate profile substantially the same as that of Figure 68.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar- ratio of galactose to CTLA4-Ig molecules offrom about 8 to about 17; (b) an average molar ratio of NANA to CTLA4-Ig molecules offrom about 6 to about 12; (c) a CTLA4-Ig high molecular weight aggregate content less than about 3 area percent as . determined by size exclusion chromatography and spectrophotometric detection; and (d) a glycosylation content in Domains III, IV and V of at least about 29.8% to about 50.1% of N : linked glycosylation as determined by HPAEC.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of galactose to CTLA4-Ig molecules of from about 8 to about 17; (b) an average molar ratio of NANA to CTLA4-Ig molecules offrom about 6 to about 12; and (c) a CTLA4-Ig high molecular weight species, of les.s than about 3 area percent as determined by size exclusion chromatography and spectrophotometric detection.
  • the molecules- are further characterized by an average molar ratio of NANA to CTLA4-Ig molecules from about 8-to about 12.
  • the molecules are further characterized by: (a) about 80 % biantennary N-linked glycosylation; (b) about 14 % triantennary N-linked glycosylation; and (c) about 6 % tetraantennary N-linked glycosylation.
  • the molecules further comprise any combination of one or more of: (a) the amino acid sequence of SEQ ID NO: 10 (methionine at amino acid position 27 and glycine at amino acid position 382 of SEQ ID NO:2); (b) the amino acid sequence of SEQ ID NQ:7 (methionine at amino acid position 27 and lysine at amino acid position 383 of SEQ ID NO:2); (c) the amino acid sequence of SEQ ID NO:9 (alanine at amino acid position 26 and glycine at amino acid position 382 of SEQ ID NO:2); and (d) the amino acid sequence of SEQ ID NO:6 (alanine at amino acid position 26. and lysine at amino acid position 383 of SEQ ID NO:2).
  • (a) about 90% of the molecules comprise the amino acid sequence of SEQ ID NO:2 beginning with the methionine at residue 27; (b) about 10% of the molecules comprise the amino acid sequence of SEQ ID NO:2 beginning with the alanine at residue number 26; (c) about 4% of the molecules comprise the amino acid sequence of SEQ ID NO:2 ending with the lysine at residue number 383; and (d) about 96% of the molecules comprise the amino acid sequence of SEQ ID NO:2 ending with the glycine at residue number 382.
  • the invention provides for a composition comprising CTLA4-Ig polypeptides, wherein: (a) about 80 % of the polypeptides have biantennary N-linked glycosylation; (b) about 14 % of the polypeptides have triantennary N-linked glycosylation; (c) about 6 % of the polypeptides have tetraantennary N-linked glycosylation; and(d) an average molar ratio of NGNA to CTLA4-Ig molecules of less than or equal to 1.5.
  • the invention provides for a composition comprising CTLA4-Ig polypeptides, wherein: (a) about 80 % of the polypeptides have biantennary N- linked glycosylation; (b) about 14 % of the polypeptides have triantennary N-linked glycosylation; (c) about 6 % of the polypeptides have tetraantennary N-linked glycosylation; and(d) an average molar ratio of GIcNAc to CTLA4-Ig molecules of from about 15 to about 35.
  • the invention provides for a composition comprising CTLA4-Ig polypeptides, wherein: (a) about 80 % of the polypeptides have biantennary N-linked glycosylation; (b) about 14 % of the polypeptides have triantennary N-linked glycosylation; (c) about 6 % of the polypeptides have tetraantennary N-linked glycosylation; and(d) an average molar ratio of GalNAc to CTLA4-Ig molecules of from about 1.7 to about 3.6.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of galactose to CTLA4-Ig molecules of from about 11 to about 13; and (b) an average molar ratio of sialic to CTLA4-Ig molecules of from about 5.5 to about 9.5.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of galactose to CTLA4-Ig molecules of from about 11 to about 13; (b) an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 5.5 to about 9.5; and (c) a CTLA4-Ig high molecular weight species of less than about 5 area percent as determined by size exclusion chromatography and spectrophotometric detection.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of galactose to CTLA4-Ig molecules of from about 11 to about 13;
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of galactose to CTLA4-Ig molecules of from about 11 to about 13; (b) an average molar ratio of sialic acid to CTLA4-Ig molecules of from 5.5 to about 9.5; (c) a CTLA4-Ig high molecular weight species content less than about 5 area percent as determined by size exclusion chromatography and spectrophotometric detection; and (d) a glycosylation content in Domains III, IV and V of at least about 29.8% to about 50.1% of N- linked glycosylation as determined by HPAEC.
  • the invention provides for a composition comprising CTLA4-Ig molecules characterized by: (a) an average molar ratio of galactose to CTLA4-Ig molecules of from about 1 1 to about 13; (b) an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 5.5 to about 9.5; and (c) a CTLA4-Ig high molecular weight species content less than about 5 area percent as determined by size exclusion chromatography and spectrophotometric detection.
  • the molecules are further characterized by: (a) about 80 % biantennary N-linked glycosylation; (b) about 14 % triantennary N-linked glycosylation; and (c) about 6 % tetraantennary N-linked glycosylation.
  • the molecules further comprise any combination of one or more of: (a) the amino acid sequence of SEQ ID NO: 16 (methionine at amino acid position 27 and glycine at amino acid position 382 of SEQ ID NO:4); (b) the amino acid sequence of SEQ ID NO: 13 (methionine at amino acid position 27 and lysine at amino acid position 383 of SEQ ID NO:4); (c) the amino acid sequence of SEQ ID NO:15 (alanine at amino acid position 26 and glycine at amino acid position 382 of SEQ ID NO:4); and (d) the amino acid sequence of SEQ ID NO: 12 (alanine at amino acid position 26 and lysine at amino acid position 383 of SEQ ID NO:4).
  • (a) about 90% of the molecules comprise the amino acid sequence of SEQ ID NO:4 beginning with the methionine at residue 27; (b) about 10% of the molecules comprise the amino acid sequence of SEQ ID NO:4 beginning with the alanine at residue number 26; (c) about 4% of the molecules comprise the amino acid sequence of SEQ ID NO:4 ending with the lysine at residue number 383; and (d) about 96% of the molecules comprise the amino acid sequence of SEQ ID NO:4 ending with the glycine at residue number 382.
  • the invention provides for a composition comprising CTLA4-Ig polypeptides, wherein:(a) about 80 % of the polypeptides have biantennary N-linked glycosylation; (b) about 14 % of the polypeptides have triantennary N-linked glycosylation; (c) about 6 % of the polypeptides have tetraantennary N-linked glycosylation; and(d) an average molar ratio of GIcNAc per mole of CTLA4-Ig protein of from about 24 to about 28.
  • the invention provides for a composition comprising CTLA4-Ig polypeptides, wherein:(a) about 80 % of the polypeptides have biantennary N-linked glycosylation; (b) about 14 % of the polypeptides have triantennary N-linked glycosylation; (c) about 6 % of the polypeptides have tetraantennary N-linked glycosylation; and(d) an average molar ratio of GaINAc to CTLA4-Ig molecules of from about 2.7 to about 3.6.
  • the composition is a substantially purified composition.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein less than or equal to about 2.5 % of the CTLA4-Ig molecules are oxidized.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein less than or equal to about 2.0 % of the CTLA4-Ig molecules are deamidated.
  • the invention provides for a composition comprising CTLA4-Ig dimer molecules, wherein at least 0.5 % of the CTLA4-Ig dimer molecules are cysteinylated. In one embodiment, at least 1.0% of the CTLA4-Ig dimer molecules are cysteinylated.
  • the invention provides for a population of CTLA4-Ig molecules, wherein the population exhibits a mass spectrometry profile substantially the same as Figure 64, 65 or 67.
  • the invention provides for a population of CTLA4-Ig molecules, wherein the population exhibits a capillary electrophoresis profile substantially the same as Figure 48.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the composition is characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from about 15 to about 35; (b) an average molar ratio of GaINAc to CTLA4-Ig molecules from about 1.7 to about 3.6; (c) an average molar ratio of galcatose to CTLA4-Ig molecules from about 8 to about 17; (d) an average molar ratio of fucose to CTLA4-Ig molecules from about 3.5 to about 8.3; (e) an average molar ratio of mannose to CTLA4-Ig molecules from about 7.2 to about 22; (f) an average molar ratio of sialic acid to CTLA4-Ig molecules from about 6 to about 12; (g) a pi as determined from visualization on an isoelectric focusing gel in a range from about 2.4 ⁇ 0.2 to about 5.0 ⁇ 0.2; (h) MCP-I
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the population of molecules is characterized by: (a) an average molar ratio of GIcNAc to CTLA4-Ig molecules from about 15 to about 35; (b) an average molar ratio of GaINAc to CTLA4-Ig molecules from about 1.7 to about 3.6; (c) an average molar ratio of galcatose to CTLA4-Ig molecules from about 8 to about 17; (d) an average molar ratio of fucose to CTLA4-Ig molecules from about 3.5 to about 8.3; (e) an average molar ratio of mannose to CTLA4-Ig molecules from about 7.2 to about 22; (f) an average molar ratio of sialic acid to CTLA4-Ig molecules from about 6 to about 12; (g) a pi as determined from visualization on an isoelectric focusing gel in a range from about 3.4 ⁇ 0.2 to about 5.0 ⁇ 0.2; (h) MCP-I of less
  • the invention provides for an isolated composition comprising CTLA4-Ig molecules having an incidence of immunogenicity of less than or equal to 7.4%. In one embodiment, the incidence of immunogenicity is from about 2.1% to about 7.4%. In one embodiment, the incidence of immunogenicity is less than or equal to 3.7%. In one embodiment, the incidence of immunogenicity is less than or equal to 3.0%. In one embodiment, the incidence of immunogenicity is from about 2.8% to about 3.0%.
  • the invention provides for an isolated composition comprising CTLA4-Ig molecules, wherein, following administration of the composition to humans, production of antibodies that bind to the CTLA4-Ig molecules occurs at an incidence in the humans of less than or equal to 7.4%. In one embodiment, the incidence is from about 2.1% to about 7.4%.
  • the incidence is less than or equal to 3.7%. In one embodiment, the incidence is less than or equal to 3.0%. In one embodiment, the incidence is from about 2.8% to about 3.0%.
  • the invention provides for an isolated composition comprising CTLA4-Ig molecules, wherein, following administration of the composition to humans, production of antibodies that bind to the CTLA4 portions of the CTLA4-Ig molecules occurs in the humans at an incidence of less than or equal to 4.9%. In one embodiment, the incidence is from about 0.5% to about 4.9%. In one embodiment, the incidence is less than or equal to 1.2%. In one embodiment, the incidence is less than or equal to 1.0%. In one embodiment, the incidence is from about 0.9% to about 1.0%. In one embodiment, the incidence is measured in an enzyme-lined immunosorbent assay (ELISA). In one embodiment, wherein the incidence is measured in an an electrochemoluminescence assay (ECL).
  • ELISA enzyme-lined immunosorbent assay
  • ECL electrochemoluminescence assay
  • the invention provides for an isolated composition comprising CTLA4-Ig molecules, wherein, following administration of the composition to humans, production of antibodies that neutralize the CTLA4-Ig molecules occurs at an incidence of less than or equal to 75% of the humans having antibodies that bind to the CTLA4 portion of the CTLA4- Ig molecule.
  • the incidence is 40-75%.
  • the incidence isless than or equal to 40%.
  • the incidence is measured in a cell-based luciferase reporter assay.
  • the invention provides for a method for producing CTLA4-Ig protein, the method comprising: (a) expanding mammalian cells that produce CTLA4-Ig protein, wherein the expanding is from a seed culture to a liquid culture of at least 10,000 L until the CTLA4-Ig protein is produced at a yield of at least about 0.5 grams of CTLA4-Ig protein per liter of liquid culture, as determined by assessing an aliquot of the liquid culture; and (b) isolating the CTLA4-Ig protein from the at least 10,000 L liquid culture, wherein the isolating occurs when the liquid culture exhibits greater than or equal to about 6.0 moles of NANA per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule, as determined by assessing an aliquot of the liquid culture.
  • the method also provides for a method for producing CTLA4-Ig protein, the method comprising: (a) expanding mammalian cells that produce CTLA4-Ig protein, wherein the expanding is from a seed culture to a liquid culture of at least 10,000 L until the CTLA4- Ig protein is produced at a yield of at least about 0.5 grams of CTLA4-Ig protein per liter of liquid culture, as determined by assessing an aliquot of the liquid culture; and (b) isolating the CTLA4-Ig protein from the at least 10,000 L liquid culture, wherein the isolating occurs when the liquid culture exhibits from about 5.2 to about 7.6 moles of sialic acid per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule, as determined by assessing an aliquot of the liquid culture.
  • the method also provides for a method for producing CTLA4-Ig protein, the method comprising: (a) expanding mammalian cells that produce CTLA4-Ig protein, wherein the expanding is from a seed culture to a liquid culture of at least 10,000 L until the CTLA4-Ig protein is produced at a yield of at least about 0.5 grams of CTLA4-Ig protein per liter of liquid culture, as determined by assessing an aliquot of the liquid culture; and (b) isolating the CTLA4-Ig protein from the at least 10,000 L liquid culture, wherein the isolating occurs when the liquid culture has a cell density of from about 33 x 105 viable cells per mL of liquid culture to about 79 x 105 cells per mL of liquid culture.
  • the invention also provides a method for producing CTLA4-Ig protein, the method comprising: (a) expanding mammalian cells that produce CTLA4-Ig protein, wherein the expanding is from a seed culture to a liquid culture of at least 10,000 L until the CTLA4-Ig protein is produced at a yield of at least about 0.5 grams of CTLA4-Ig protein per liter of liquid culture, as determined by assessing an aliquot of the liquid culture; and (b) isolating the CTLA4-Ig protein from the at least 10,000 L liquid culture, wherein the isolating occurs when cell viability in the liquid culture is not less than about 38%.
  • the invention also provides for a method for producing CTLA4-Ig protein, the method comprising: (a) expanding mammalian cells that produce CTLA4-Ig protein, wherein the expanding is from a seed culture to a liquid culture of at least 10,000 L until the CTLA4-Ig protein is produced at a yield of at least about 0.5 grams of CTLA4-Ig protein per liter of liquid culture, as determined by assessing an aliquot of the liquid culture; and (b) isolating the CTLA4-Ig protein from the at least 10,000 L liquid culture, wherein the isolating occurs when cell viability in the liquid culture is not less than about 37%.
  • the method also provides for a method for producing CTLA4-Ig protein, the method comprising: (a) expanding mammalian cells that produce CTLA4-Ig protein, wherein the expanding is from a seed culture to a liquid culture of at least 10,000 L until the CTLA4-Ig protein is produced at a yield of at least about 0.5 grams of CTLA4-Ig protein per liter of liquid culture, as determined by assessing an aliquot of the liquid culture; and (b) isolating the CTLA4-Ig protein from the at least 10,000 L liquid culture, wherein the isolating occurs when endotoxin is less than or equal to about 76.8 EU per mL of liquid culture, as determined by assessing an aliquot of the liquid culture.
  • the method also provides for a method for producing CTLA4-Ig protein, the method comprising: (a) expanding mammalian cells that produce CTLA4-Ig protein, wherein the expanding is from a seed culture to a liquid culture of at least 10,000 L until the CTLA4-Ig protein is produced at a yield of at least about 0.5 grams of CTLA4-Ig protein per liter of liquid culture, as determined by assessing an aliquot of the liquid culture; and (b) isolating the CTLA4-Ig protein from the at least 10,000 L liquid culture, wherein the isolating occurs when endotoxin is less than or equal to about 4.8 EU per mL of liquid culture, as determined by assessing an aliquot of the liquid culture.
  • the invention also provides for a method for producing CTLA4- Ig protein, the method comprising: (a) expanding mammalian cells that produce CTLA4-Ig protein, wherein the expanding is from a seed culture to a liquid culture of at least 10,000 L until the CTLA4-Ig protein is produced at a yield of at least about 0.5 grams of CTLA4-Ig protein per liter of liquid culture, as determined by assessing an aliquot of the liquid culture; and (b) isolating the CTLA4-Ig protein from the at least 10,000 L liquid culture, wherein the isolating occurs only when bioburden is less than 1 colony forming unit per mL of liquid culture, as determined by assessing an aliquot of the liquid culture.
  • the invention also provides for a method for producing CTLA4-Ig protein, the method comprising: (a) expanding mammalian cells that produce CTLA4-Ig protein, wherein the expanding is from a seed culture to a liquid culture of at least 10,000 L until the CTLA4-Ig protein is produced at a yield of at least about 0.5 grams of CTLA4-Ig protein per liter of liquid culture, as determined by assessing an aliquot of the liquid culture; and (b) isolating the CTLA4-Ig protein from the at least 10,000 L liquid culture, wherein the isolating occurs when at least two of the following conditions are met: (i) the liquid culture contains greater than or equal to about 6.0 moles of NANA per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule; (ii) the liquid culture has a cell density of from about 33 x 105 viable cells per mL of liquid culture to about 79 x 105 viable cells per mL of liquid culture; (iii) the cell
  • the invention also provides for a method for producing CTLA4-Ig protein, the method comprising: (a) expanding mammalian cells that produce CTLA4-Ig protein, wherein the expanding is from a seed culture to a liquid culture of at least 10,000 L until the CTLA4-Ig protein is produced at a yield of at least about 0.5 grams of CTLA4-Ig protein per liter of liquid culture, as determined by assessing an aliquot of the liquid culture; and (b) isolating the CTLA4-Ig protein from the at least 10,000 L liquid culture, wherein the isolating occurs when at least two of the following conditions are met: (i) the liquid culture contains from about 5.2 to about 7.6 moles of sialic acid per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule; (ii) the cell viability in the liquid culture is not less than about 37%; or (iii) the yield of CTLA4-Ig protein is greater than about 0.5 grams of CTLA4-Ig protein per
  • SEQ ID NO:1 [CTLA4-Ig nucleotide sequence, See Fig. 1]
  • SEQ ID NO:2 [CTLA4-Ig amino acid sequence, See Fig. ⁇ ]
  • SEQ ID NO:3 [CTLA4 A29YLI04E -Ig nucleotide sequence comprises nucleotides 79 to 1149 of the nucleic acid sequence shown in Fig. 2]
  • SEQ ID NO: 23 is the full nucleotide sequence shown in Fig. 2. This nucleotide sequence includes the coding sequence for the prosequence.
  • SEQ ID NO:4 [CTLA4 A29YL104E -Ig amino acid sequence, Fig. 3, without the pro-sequence]
  • SEQ ID NO:5 [amino acids 25-383 of SEQ ID NO:2]
  • MAMHVAQP A WLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYM MGNELTFLDDSICF GTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGT QIYVIDPEPCPDSDQEPKSSDKTHTSPPSP APELLGGSSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK
  • SEQ ID NO:6 [amino acids 26-383 of SEQ ID NO:2]
  • AMHVAQP A WLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMM GNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQI YVIDPEPCPDSDQEPKSSDKTHTSPPSP APELLGGSSVFLFPPKPKDTLMISRTPEVTCV WDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALP AP IEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
  • SEQ ID NO:8 [amino acids 25-382 of SEQ ID NO:2]
  • MAMHVAQP AWLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYM MGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGT QIYVIDPEPCPDSDQEPKSSDKTHTSPPSP APELLGGSSVFLFPPKPKDTLMISRTPEVT
  • AMHVAQP A VVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMM GNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQI YVIDPEPCPDSDQEPKSSDKTHTSPPSP APELLGGSSVFLFPPKPKDTLMISRTPEVTCV
  • SEQ ID NO: 10 [amino acids 27-382 of SEQ ID NO:2]
  • MAMHVAQP A WLASSRGIASF.V.CEYASP.GKYTEVRVTVLRQADSQVTEVCAATYM MGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYEGIGNGT QIYVIDPEPCPDSDQEPKSSDKTHTSPPSP APELLGGSSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL - NGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK
  • SEQ ID NO: 12 [amino acids 26-383 of SEQ ID NO:4]
  • AMHVAQP AVVLASSRGIASFVCEYASPGKYTEVRVTVLRQADSQVTEVCAATYMM GNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYEGIGNGTQI YVIDPEPCPDSDQEPKSSDKTHTSPPSP APELLGGSSVFLFPPKPKDTLMISRTPEVTCV
  • SEQ ID NO:14 [amino acids 25-382 of SEQ ID NO:4] MAMHVAQPAWLASSRGIASFVCEYASPGKYTEVRVTVLRQADSQVTEVCAATYM MGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYEGIGNGT QIYVIDPEPCPDSDQEPKSSDKTHTSPPSP APELLGGSSVFLFPPKPKDTLMISRTPEVT
  • SEQ ID NO: 15 [amino acids 26-382 of SEQ ID NO:4]
  • SEQ ID NO:16 [amino acids 27-382 of SEQ ID NO:4]
  • SEQ ID NO: 18 [CTLA4 extracellular domain sequence]
  • the invention provides cell lines having an expression cassette that comprises SEQ ID NO:1 (FIG. IA).
  • an expression cassette when expressed in mammalian cells, including CHO cells, can result in the production of N- and C- terminal variants, such that the proteins produced from the expression cassette can have the amino acid sequence of residues: (i) 26-383 of SEQ ID NO:2, (ii) 26-382 of SEQ ID NO:2; (iii) 27-383 of SEQ ID NO:2, or (iv) 27-382 of SEQ ID NO:2, or optionally (v) 25-382 of . SEQ ID NO:2, or (vi) 25-383 of SEQ ID NO:2 (FIG. 1 A).
  • SEQ ID NO:2 monomers can dimerize, such that dimer combinations can include, for example: (i) and (i); (i) and (ii); (i) and (iii); (i) and (iv); (i) and (v); (i) and (vi); (ii) and (ii); (ii) and (iii); (ii) and (iv); (ii) and (v); (ii) and (vi); (iii) and (iii); (iii) and (iv); (iii) and (v); (iii) and (vi); (iv) and (iv); (iv) and (v); (iv) and (vi); (v) and (v); (iv) and (vi); (v) and (v); (iv) and (vi); (v) and (v); (v) and (vi); (v) and (v); (v) and (vi); (v) and (v); (v) and (vi); (v) and
  • These different dimer combinations can also associate with each other to form tetramer CTLA4-Ig molecules.
  • These monomers, dimers, teramers, and other multimers can be referred to herein as "SEQ ID NO:2 proteins" or proteins "having a SEQ ID NO:2 sequence.” While the cell lines can produce these variants immediately upon translation, the variants can more typically be a product of post-translational actions in the cells. The cell line also secretes CTLA4-Ig molecules. Abatacept refers to SEQ ID NO:2 proteins.
  • CTLA4-Ig molecules can include, for example, CTLA4-Ig proteins in monomer, dimer, trimer, tetramer, pentamer, hexamer, or other multimeric forms.
  • CTLA4-Ig molecules can comprise a protein fusion with at least an extracellular domain of CTLA4 and an immunoglobulin constant region.
  • CTLA4-Ig molecules can have wild-type or mutant sequences, for example, with respect to the CTLA4 extracellular domain and immunoglobulin constant region sequences.
  • CTLA4-Ig monomers, alone, or in dimer, tetramer or other multimer form, can be glycosylated.
  • the invention provides populations of CTLA4-Ig molecules that have at least a certain percentage of dimer or other multimer molecules.
  • the invention provides CTLA4-Tg molecule populations that are greater than 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% CTLA4-Ig dimers.
  • the invention provides a CTLA4-Ig molecule population that comprises from about 95% to about 99.5% CTLA4-Ig dimer and from about 0.5% to about 5% of CTLA4-Ig tetramer.
  • the CTLA4-Ig molecule population comprises about 98 % CTLA4-Ig dimer, about 1.5% CTLA4-Ig tetramer and about 0.5% CTLA4-Ig monomer.
  • the invention provides a population of CTLA4-Ig molecules • wherein the population is substantially free of CTLA4-Ig monomer molecules.
  • Substantially free of CTLA4-Ig monomer molecules can refer to a population of CTLA4-Ig molecules that have less than 1%, 0.5%, or 0.1% of monomers.
  • the invention provides a population of CTLA4-Ig molecules wherein the population is substantially free of CTLA4-Ig multimers that are larger than dimers, such as tetramers, hexamers, etc. (e.g., high molecular weight species).
  • Substantially free of CTLA4-Ig multimer molecules larger than dimers can refer to a population of CTLA4-Ig molecules that have less than 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, or 0.1% of CTLA4-Ig multimers (e.g., high molecular weight species) larger than dimeric form.
  • a CTLA4-Ig monomer molecule can have, for example, the amino acid sequence of: (i) 26-383 of SEQ ID NO:2, (ii) 26-382 of SEQ ID NO:2 (iii) 27-383 of SEQ ID NO:2, or (iv) 27-382 of SEQ ID NO:2, or optionally (v) 25-382 of SEQ ID NO:2, or (vi) 25-383 of SEQ ID NO:2.
  • SEQ ID NO:1 When an expression cassette comprising the nucleic acid sequence of SEQ ID NO:1 is expressed in CHO cells, the predominant monomer form expressed has the N- terminus amino acid residue of methionine (residue 27 of SEQ ID NO:2), which corresponds to the N-terminus amino acid residue of wild-type human CTLA4.
  • SEQ ID NO:1 also includes the coding sequence for an Oncostatin M Signal Sequence (nucleotides 11-88 of SEQ ID NO:1), the expressed protein from SEQ ID NO:1 contains an Oncostatin M Signal Sequence.
  • the signal sequence is cleaved from the expressed protein during the process of protein export from the cytoplasm, or secretion out of the cell.
  • cleavage can result in N-terminal variants, such as cleavage between amino acid residues 25 and 26 of SEQ ID NO. 2 (resulting in an N-terminus of residue 26, i.e., the "Ala variant"), or between amino acid residues 24 and 25 of SEQ ID NO. 2 (resulting in an N-terminus of residue 25, i.e., the "Met- Ala variant”), as opposed to cleavage between amino acid residues 26 and 27" of SEQ ID NO. 2 (resulting in an N-terminus of residue 27).
  • the Met- Ala variant can be present in a mixture of CTLA4-Ig molecules at about 1%
  • the Ala variant can be present in a mixture of CTLA4-Ig molecules at about 8-10%.
  • the expressed protein from SEQ ID NO:1 can have C-terminus variants due to incomplete processing.
  • the predominant C-terminus is the glycine at residue 382 of SEQ ID NO:2.
  • a mixture of CTLA4-Ig molecules ⁇ monomers having lysine at the C-terminus can be present, for example, at about 4-5%.
  • a CTLA4-Ig molecule has the amino acid sequence of SEQ ID NO: 5 as follows (which is the same as amino acids 25-383 of SEQ ID NO:2):
  • MAMHVAQP A WLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYM
  • a CTLA4-Ig molecule has the amino acid sequence of SEQ ID NO: 6 as follows (which is the same as amino acids 26-383 of SEQ ID NO:2):
  • AMHVAQP AWLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMM GNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQI YVIDPEPCPDSDQEPKSSDKTHTSPPSP APELLGGSSVFLFPPKPKDTLMISRTPEVTCV
  • a CTLA4-Ig molecule has the' amino acid sequence of SEQ ID NO: 7 as follows (which is the same as amino acids 27-383 of SEQ ID NO:2):
  • a CTLA4-Ig molecule has the amino acid sequence of SEQ ID NO: 8 as follows (which is the same as amino acids 25-382 of SEQ ID NO:2):
  • MAMHVAQP A WLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYM
  • a CTLA4-Ig molecule has the amino acid sequence of SEQ ID NO: 9 as follows (which is the same as amino acids 26-382 of SEQ ID NO:2):
  • a CTLA4- ⁇ g molecule has the amino acid sequence of SEQ • ID..NO: .10 as follows (which is the same as amino acids 27-382 of SEQ ID NO:2):
  • a CTLA4-Ig monomer molecule can comprise an extracellular domain of human CTLA4.
  • the extracellular domain can comprise the nucleotide sequence of nucleotides 89-463 of SEQ ID NO:1 that code for amino acids 27-151 of SEQ ID NO:2.
  • the extracellular domain can comprise mutant sequences of human CTLA4.
  • the extracellular domain can comprise nucleotide changes to nucleotides 89-463 of SEQ ID NO:1 such that conservative amino acid changes are made.
  • the extracellular domain can comprise a nucleotide sequence that is at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to nucleotides 89-463 of SEQ ID NO:l.
  • a CTLA4-Ig monomer molecule can comprise a constant region of a human immunoglobulin.
  • This constant region can be a portion of a constant region; this constant region can have a wild-type or mutant sequence.
  • the constant region can be from human IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD or IgE.
  • the constant region can be from a light chain or a heavy chain of an immunoglobulin. Where the constant region is from an IgG, IgD, or IgA molecule, the constant region can comprise one or more of the following constant region domains: C L , CHl , hinge, CH2, or CH3.
  • the constant region can comprise one or more of the following constant region domains: CL, C H I, C H 2, C H 3, or C H 4.
  • the constant region can comprise on or more constant region domains from IgG, IgD, IgA, IgM or IgE.
  • CTLA4-Ig dimers are comprised of two monomers, wherein each monomer can have the same or different amino acid sequence, and where the sequence can be the amino acid sequence of: (i) 26-383 of SEQ ID NO:2, (ii) 26-382 of SEQ ID NO:2, (iii) 27-383 of SEQ ID NO:2, (iv) 27-382 of SEQ ID NO:2, (v) 25-382 of SEQ ID NO:2, and (vi) 25-383 of SEQ ID NO:2.
  • Such CTLA4-Ig monomers can dimerize through the extracellular domain of the human CTLA4 sequence via a cysteine amino acid residue at position 146 of SEQ ID NO:2.
  • a CTLA4-Ig molecule can multimerize through the interaction of IgM or IgA constant region domains with a J chain protein.
  • IgM and IgA are usually produced as multimers in association with an additional polypeptide chain, the J chain.
  • pentameric IgM the monomers are crosslinked by disulfide bonds to each other in the CH3 domain and to the J chain through the CH4 domain.
  • IgM can also form hexamers that lack a J chain where multimerization is achieved through disulfide bonds to each.
  • dimeric IgA the monomers have disulfide bonds to the J chain via their CH3 domain and not each other.
  • the invention provides CTLA4-Ig multimers, including dimers, pentamers, and hexamers, wherein the Ig portion comprises an IgM constant region or portion thereof or an IgA constant region or portion thereof.
  • CTLA4-Ig multimers based on IgM or IgA can include the J chain.
  • a CTLA4-Ig monomer molecule (CTLA4 GenBank Accession No. 113253) comprises a modified human IgGl hinge region (nucleotides 464-508 of SEQ ID NO:1; amino acids 152-166 of SEQ ID NO:2) wherein the serines at amino acid residues 156, 162, and 165 of SEQ ID NO:2 have been engineered from cysteines present in the wild-type sequence.
  • a CTLA4-lg monomer molecule comprises a modified human IgGl CH2 region and a wild-type CH3 region (the modified human IgGl C H 2 domain having nucleotides 509-838 of SEQ ID NO:1 and amino acids 167-276 of SEQ ID NO:2; the human IgGl C H 3 domain having nucleotides 839-1159 of SEQ ID NO:1 and amino acids 277-383 of SEQ ID NO:2).
  • a CTLA4-Ig molecule population comprises monomers having a sequence shown in any one or more of Figures 7, 8, or 9 of the U.S. patent application published as Publication No. US 2002/0182211 Al, and in U.S. patent applications published as Publication Nos. US20030083246 and US20040022787, each of which is hereby incorporated by reference in its entirety.
  • a CTLA4-Ig tetramer molecule comprises two pairs or two dimers of CTLA4-Ig polypeptides, wherein each polypeptide has one of the following amino acid sequences: (i) 26-383 of SEQ ID NO:2, (ii) 26-382 of SEQ ID NO:2, (iii) 27-383 of SEQ ID NO:2, (iv) 27-382 of SEQ ID NO:2, (v) 25-382 of SEQ ID NO:2, and (vi) 25-383 of SEQ ID NO:2.
  • Each member of the pair of polypeptides or dimer is covalently linked to the other member, and the two pairs of polypeptides are non-covalently associated with one another thereby forming a tetramer.
  • tetramer molecules are capable of binding to CD80 or CD86.
  • such tetramer molecules can bind to CD80 or CD86 with an avidity that is at least 2-fold greater than the binding avidity of a CTLA4-Ig dimer (whose monomers have one of the above amino acid sequences) to CD80 or CD86.
  • such tetramer molecules can bind to CD80 or CD86 with an avidity that is at least 2-fold greater than the binding affinity or avidity of wild-type CTLA4 to CD80 or CD86.
  • Such greater avidity can contribute to higher efficacy in treating immune disorders and other diseases as described below, as well as in inhibiting tissue and/or solid organ transplant rejections.
  • greater or improved avidity can produce the result of higher potency of a drug.
  • a therapeutic composition comprising CTLA4-Ig tetramer would have a higher avidity and therefore higher potency than the same amount of a therapeutic composition having CTLA4-Ig monomer.
  • such tetramer molecules can have at least a 2-fold greater inhibition on T cell proliferation as compared to a CTLA4-Ig dimer (whose monomers have one of the above amino acid sequences).
  • such tetramer molecules can have at least a 2-fold greater inhibition on T cell proliferation as compared to a wild-type CTLA4 molecule.
  • CTLA4 A29YL104E -Ig are modified forms of CTLA4-Ig (FIG. 1 A; SEQ ID NOS : 1 - 2).
  • the modification consists of point mutations that result in two amino acid substitutions (L104E and A29Y) as shown in FIG. 2 (corresponding to amino acid positions 55 and 130 in FIG. 3; SEQ ID NO: 4).
  • CTLA4 A29YL104E -Ig (for example, SEQ ID NOS:5-10) bind CD80 (B7-1) with approximately 2-fold increased avidity, and binds CD86 (B7-2) with approximately 4-fold increased avidity.
  • CTLA4 A29YL104E -Ig are approximately 10-fold more effective than CTLA4-Ig at inhibiting T cell proliferation, cytokine production, and CD28-dependent killing of target cells by natural killer cells.
  • CTLA4 A29YLI04E -Ig cause modest inhibition of B7-1 mediated T cell proliferation but are markedly more potent than CTLA4-Ig at blocking B7-2 mediated T cell proliferation.
  • the increased potency is comparable, whether blocking B7-2 alone or blocking both B7-1 and B7-2, suggesting that the enhanced immunomodulatory activity of CTLA4 A29YU04E -Ig can most likely be attributed to the enhanced potency for blocking B7-2.
  • CTLA4 A29YU04E -Ig is a genetically engineered fusion protein, which consists of the functional binding domain of modified human CTLA-4 and the Fc domain of human immunoglobulin of the IgGl class (FIG. 3 A-B). Two amino acid substitutions were made in the B7 binding region of the CTLA-4 domain (L104E and A29Y) to generate a CTLA4 A29YLI04E -Ig molecule.
  • a CTLA4 A29YLI04E -Ig dimer is comprised of two glycosylated CTLA4 A29YL104E -Ig chains. It exists as a covalent dimer linked through an inter-chain disulfide bond.
  • a molecular model of a CTLA4 A29YL104E -Ig molecule is shown in FTG. 4.
  • a CTLA4 A29YL104E -Ig molecule has an average mass of approximately 91,800 Da as determined by matrix-assisted laser desorption-ionization-time-of-flight (MALD I-TOF) mass spectrometry.
  • MALD I-TOF matrix-assisted laser desorption-ionization-time-of-flight
  • the invention provides cell lines having an expression cassette that comprises SEQ ID NO:3.
  • an expression cassette when expressed in mammalian cells, for example CHO cells, can result in the production of N- and C- terminal variants, such that the polypeptides produced from the expression cassette can have the amino acid sequence of residues: (i) 26-383 of SEQ ID NO:4, (ii) 26-382 of SEQ ID NO:4; (iii) 27- 383 of SEQ ID NO:4, or (iv) 27-382 of SEQ ID NO:4, or optionally (v) 25-382 of SEQ ID NO:4, or (vi) 25-383 of SEQ ID NO:4.
  • SEQ ID NO:4 monomers or monomers "having a SEQ ID NO:4 sequence.”
  • dimer combinations can include, for example: (i) and (i); (i) and (ii); (i) and (iii); (i) and (iv); (i) and (v); (i) and (vi); (ii) and (ii); (ii) and (iii); (ii) and (iv); (ii) and (v); (ii) and (vi); (iii) and (iii); (iii) and (iv); (iii) and (v); (iii) and (v); (iii) and (vi); (iv) and (iv); (iv) and (v); (iv) and (vi); (v) and (v); (v) and (v); (v) and (vi); (v) and (v); (v); (v); (v); (v); (v); (v); (v); (v); (v); (v); (v); (v); (v); (v); (v); (v); (v); (vi);
  • dimer combinations can also associate with each other to form tetramer CTLA4 A29YL104E -Ig molecules.
  • These monomers, dimers, teramers, and other multimers can be referred to herein as "SEQ ID NO:4 polypeptides" or polypeptides "having a SEQ ID NO:4 sequence.” While the cell lines can produce these variants immediately upon translation, the variants can more typically be a product of post-translational actions in the cells. Dimers can be covalently joined together, non-covalently joined together, or both.
  • the invention provides for compositions that consist essentially of dimers that are covalently bound together.
  • the invention provides for compositions where at least 50% of the CTLA4-Ig dimers are made up of monomers joined covalently.
  • the invention also provides for compositions where at least 60%, 70%, 80%, 85%, 90%, 95%; 96%, 97%, 98%, 99% or 100% of the CTLA4-Ig dimers are made up of monomers joined covalently.
  • the invention also provides for compositions of CTLA4-Ig molecules, wherin the molecules are predominantly in dimer form, and the dimers are predominantly formed by covalent linkages.
  • the invention provides for a composition wherein the majority of the CTAL4-Ig dimers are joined covalently. It is possible that some fraction of the CTLA4-Ig dimers in the composition are joined non-covalently.
  • CTLA4 A29YL104E -Ig molecules can include, for example, CTLA4 A29YL104E -Ig in monomer, dimer, trimer, tetramer, pentamer, hexamer, or other multimeric forms.
  • CTLA4 A29YL104E -Ig molecules can comprise a protein fusion with at least an extracellular domain of modified CTLA4 (SEQ ID NO: 18) and an immunoglobulin constant region.
  • CTLA4 A29YL104E -Ig molecules can have mutant sequences, for example, with respect to the modified CTLA4 extracellular domain and immunoglobulin constant region sequences.
  • CTLA4 A29YL104E -Ig monomers, alone, or in dimer, tetramer or other multimer form, can be glycosylated.
  • the invention provides populations of CTLA4 A29YL104E -Ig molecules that have at least a certain percentage of dimer or other multimer molecules.
  • the invention provides CTLA4 A29YL104E -Ig molecule populations that are greater than 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% of CTLA4 A29YLI04E -Ig dimers.
  • the invention provides a CTLA4 ⁇ 29YL104E -Ig molecule population that comprises from about 95% to about 99.5% of CTLA4 A29YLI04E -Ig dimer and from about 0.5% to about 5% of CTLA4 A29YL104E -Ig tetramer.
  • the invention provides a CTLA4 A29YLI04E -Ig molecule population that comprises from about 95% to about 99.5% of CTLA4 A29YLI 04E -Ig dimer, from about 0.5% to about 2.5% of CTLA4 A29YLI04E -Ig monomer, and from about 0.5% to about 5% of CTLA4 A29YLI04E -Ig tetramer.
  • the CTLA4 A29YL104E -Ig molecule population comprises about 96% of CTLA4 A29YL104E -Ig dimer, about 2.5% of CTLA4 A29YL104E -Ig tetramer, and about 0.5% of CTLA4 A29YLI04E -Ig monomer.
  • the invention provides a population of CTLA4 A29YL104E -Ig molecules wherein the population is substantially free of CTLA4 A29YL!04E -Ig monomers.
  • Substantially free of CTLA4 A29YL104E -Ig monomers can refer to a population of CTLA4 A29YL104E -Ig molecules that have less than 1%, 0.5%, or 0.1% of monomers.
  • the invention provides a population of CTLA4 A29YL104E -Ig molecules wherein the population is substantially free of CTLA4 A29YL104E -Ig multimers that are larger than dimers, such as tetramers, hexamers, etc.
  • Substantially free of CTLA4 A29YL104E -Ig multimers larger than dimers can refer to a population of CTLA4 A29YL104E -Ig molecules that have less than 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, or 0.1% of CTLA4 A29YLI04E -Ig multimers larger than dimers.
  • a CTLA4 A29YLI04E -Ig monomer can have, for example, the amino acid sequence of: (i) 26-383 of SEQ ID NO:4, (ii) 26-382 of SEQ ID NO:4 (iii) 27-383 of SEQ ID NO:4, or (iv) 27-382 of SEQ ID NO:4, or optionally (v) 25-382 of SEQ ID NO:4, or (vi) 25-383 of SEQ ID NO:4.
  • SEQ ID NO:23 When an expression cassette comprising the nucleic acid sequence of SEQ ID NO:3 or 23 is expressed in CHO cells, the predominant monomer form expressed has the N- terminus amino acid residue of methionine (residue 27 of SEQ ID NO:4), which corresponds to the N-terminus amino acid residue of human CTLA4.
  • SEQ ID NO:23 also includes the coding sequence for an Oncostatin M Signal Sequence (nucleotides 11-88 of SEQ ID NO:23), the expressed protein from SEQ ID NO:23 contains an Oncostatin M Signal Sequence.
  • the signal sequence is cleaved from the expressed protein during the process of protein export from the cytoplasm, or secretion out of the cell. But cleavage can result in N- terminal variants, such as cleavage between amino acid residues 25 and 26 of SEQ ID NO:4 (resulting in an N-terminus of residue 26, i.e., the "Ala variant"), or between amino acid residues 24 and 25 SEQ ID NO:4 (resulting in an N-terminus of residue 25, i.e., the "Met-Ala variant"), as opposed to cleavage between amino acid residues 26 and 27 SEQ ID NO:4 (resulting in an N-terminus beginning with the Met residue at amino acid position 27).
  • N- terminal variants such as cleavage between amino acid residues 25 and 26 of SEQ ID NO:4 (resulting in an N-terminus of residue 26, i.e., the "Ala variant"), or between amino acid residues 24 and 25 SEQ ID NO:4 (resulting in an N-terminus of residue 25, i
  • the Met-Ala variant can be present in a mixture of CTLA4 A29YLI04E -Ig molecules at about 1%
  • the Ala variant can be present in a mixture of CTLA4 ⁇ 29YLI04E -Ig molecules at about 10-20%.
  • the expressed protein from a nucleic acid comprising SEQ ID NO:3 can have C-terminus variants due to incomplete processing.
  • the predominant C-terminus is the glycine at residue 382 of SEQ ID NO:4.
  • monomers having lysine at the C-terminus can be present, for example, at about 4-8%
  • a CTLA4 A29YL104E -Ig molecule comprises the amino acid sequence of SEQ ID NO: 11 as follows (which is the same as amino acids 25-383 of SEQ ID NO:4):
  • a CTLA4 A29YLI04E -Ig molecule comprises the amino acid sequence of SEQ ID NO: 12 as follows (which is the same as amino acids 26-383 of SEQ ID NO:4):
  • AMHV AQP A VVLASSRGIASFVCEYASPGKYTEVRVTVLRQADSQVTEVCAATYMM GNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYEGIGNGTQI YVIDPEPCPDSDQEPKSSDKTHTSPPSP APELLGGSSVFLFPPKPKDTLMISRTPEVTCV
  • a CTLA4 A29YL104E -Ig molecule comprises the amino acid sequence of SEQ ID NO: 13 as follows (which is the same as amino acids 27-383 of SEQ ID NO:4):
  • a CTLA4 A29YL104E -Ig molecule comprises the amino acid sequence of SEQ ID NO: 14 as follows (which is the same as amino acids 25-382 of SEQ ID NO:4):
  • MAMHVAQP A WLASSRGIASFVCEYASPGKYTEVRVTVLRQADSQVTEVCAATYM MGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYEGIGNGT QIYVIDPEPCPDSDQEPKSSDKTHTSPPSP APELLGGSSVFLFPPKPKDTLMISRTPEVT
  • a CTLA4 A29YL104E -Ig molecule has the amino acid sequence of SEQ ID NO: 15 as follows (which is the same as amino acids 26-382 of SEQ ID NO:4):
  • AMHVAQP A WLASSRGIASFVCEYASPGKYTEVRVTVLRQADSQVTEVCAATYMM GNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYEGIGNGTQI YVIDPEPCPDSDQEPKSSDKTHTSPPSP APELLGGSSVFLFPPKPKDTLMISRTPEVTCV
  • a CTLA4 A29YL104E -Ig molecule has the amino acid sequence of SEQ ID NO: 16 as follows (which is the same as amino acids 27-382 of SEQ ID NO:4): [SEQ ID NO: 16]
  • a CTLA4 A29YL104E -Ig monomer comprises an extracellular domain of human CTLA4, wherein two amino acid substitutions were made in the CTLA-4 domain (L104E and A29Y) (FIG. 5).
  • the extracellular domain can comprise the nucleotide sequence of nucleotides 89-463 of SEQ ID NO:23 that code for amino acids 27-151 of SEQ ID NO:4.
  • the extracellular domain can comprise mutant sequences of human CTLA4 (such as single, double, and triple site mutants in amino acids 27-151 of SEQ ID NO:4).
  • the extracellular domain can comprise nucleotide changes to nucleotides 89-463 of SEQ ID NO:23 such that conservative amino acid changes are made. In a further embodiment, the extracellular domain can comprise nucleotide changes to nucleotides 89-463 of SEQ ID NO:23 such that non-conservative amino acid changes are made. In another embodiment, the extracellular domain can comprise a nucleotide sequence that is at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to nucleotides 89-463 of SEQ ID NO:23.
  • a CTLA4 A29YLI04E -Ig monomer can comprise a constant region of a human immunoglobulin.
  • This constant region can be a portion of a constant region.
  • This constant region also can have a wild-type or mutant sequence.
  • the constant region can be from human IgGi, IgG 2 , IgG 3 , IgG4, IgM, IgAi, IgA 2 , IgD or IgE.
  • the constant region can be from a light chain or a heavy chain of an immunoglobulin. Where the constant region is from an IgG, IgD, or IgA molecule, the constant region can comprise one or more of the following constant region domains: CL, C H I, hinge, C H 2, or C H 3.
  • the constant region can comprise one or more of the following constant region domains: C L , C H I, C H 2, CH3, or C H 4.
  • the constant region can comprise on or more constant region domains from IgG. IgD, IgA, IgM or IgE.
  • CTLA4 A29YL104E -Ig dimers are comprised of two monomers, wherein each monomer can have the same or different amino acid sequence, and where the sequence can be the amino acid sequence of: (i) 26-383 of SEQ ID NO:4, (ii) 26-382 of SEQ ID NO:4, (iii) 27-383 of SEQ ID NO:4, (iv) 27-382 of SEQ ID NO:4, (v) 25-382 of SEQ ID NO:4, and (vi) 25-383 of SEQ ID NO:4.
  • Such CTLA4 A29YU04E -Ig monomers can dimerize through the extracellular domain of the human CTLA4 sequence via a cysteine amino acid residue at position 146 of SEQ ID NO:4 (or cysteine amino acid residue at position 120 of FIG. 5).
  • a CTLA4 A29YL104E -Ig molecule can multimerize through the interaction of IgM or IgA constant region domains with a J chain protein.
  • IgM and IgA are usually produced as multimers in association with an additional polypeptide chain, the J chain.
  • pentameric IgM the monomers are crosslinked by disulfide bonds to each other in the C H 3 domain and to the J chain through the C H 4 domain.
  • IgM can also form hexamers that lack a J chain where multimerization is achieved through disulfide bonds to each.
  • dimeric IgA the monomers have disulfide bonds to the J chain via their C H 3 domain and not each other.
  • the invention provides CTLA4 A29YLI04E -Ig multimers, including dimers, pentamers, and hexamers, wherein the Ig portion comprises an IgM constant region or portion thereof or an IgA constant region or portion thereof.
  • CTLA4 A29YLI04E -Ig multimers based on IgM or IgA can include the J chain.
  • a CTLA4 A29YU04E -Ig monomer comprises a modified human IgGl hinge region (nucleotides 464-508 of SEQ ID NO:23; amino acids 152-166 of SEQ ID NO:4) wherein the serine residues at positions 156, 162, and 165 of SEQ ID NO:4 have been engineered from cysteine residues present in the wild-type sequence.
  • a CTLA4 A29YL104E -Ig monomer comprises a modified human IgGl CH2 region and a wild-type CH3 region (the modified human IgGl C H 2 domain having nucleotides 509-838 of SEQ ID NO:1 and amino acids 167-276 of SEQ ID NO:2; the human IgGl C H 3 domain having nucleotides 839-1159 of SEQ ID NO:1 and amino acids 277-383 of SEQ ID NO:2).
  • a CTLA4 A29YL104E -Ig molecule population comprises monomers having a sequence shown U.S. Patent Application Publication Nos. U.S. 2002/0039577, U.S. 2003/0007968, U.S. 2004/0022787, U.S. 2005/0019859 and U.S. 2005/0084933, and U.S. Patent No. 7,094,874, each of which is hereby incorporated by reference in its entirety.
  • a CTLA4 A29YL104E -Ig tetramer comprises two pairs or two dimers of CTLA4 A29YLI04E -Ig molecules, wherein each polypeptide has one of the following amino acid sequences: (i) 26-383 of SEQ ID NO:4, (ii) 26-382 of SEQ ID NO:4, (iii) 27-383 of SEQ ID NO:4, (iv) 27-382 of SEQ ID NO:4, (v) 25-382 of SEQ ID NO:4, and (vi) 25-383 of SEQ ID NO:4.
  • Each member of the pair of polypeptides or dimer is covalently linked to the other member, and the two pairs of polypeptides are non-covalently associated with one another thereby forming a tetramer.
  • tetramer molecules are capable of binding to CD80 or CD86.
  • such tetramer molecules can bind to CD80 or CD86 with an avidity that is at least 2-fold greater than the binding avidity of a CTLA4 A29YL104E -Ig dimer (whose monomers have one of the above amino acid sequences) to CD80 or CD86.
  • Such greater avidity can contribute to higher efficacy in treating immune disorders and other diseases as described below, as well as in inhibiting tissue and/or solid organ transplant rejections.
  • greater or improved avidity can produce the result of higher potency of a drug.
  • a therapeutic composition comprising CTLA4 A29YL104E -Ig tetramer would have a higher avidity and therefore higher potency than the same amount of a therapeutic composition having CTLA4 A29YL104E -Ig monomer.
  • such tetramer molecules can have at least a 2-fold greater inhibition on T cell proliferation as compared to a CTLA4 A29YLI04E -Ig dimer (whose monomers have one of the above amino acid sequences).
  • such tetramer molecules can have at least a 2-fold greater inhibition on T cell proliferation as compared to a CTLA4-Ig tetramer molecule.
  • T cell proliferation can be measured using standard assays known in the art.
  • one of the most common ways to assess T cell proliferation is to stimulate T cells via antigen or agonistic antibodies to TCR and to measure, for example, the incorporation of tritiated thymidine ( 3 H-TdR) in proliferating T cells or the amount of cytokines released by proliferating T cells into culture.
  • the inhibitory effect of CTLA4-Ig or CTLA4 A29YLI04E -Ig molecules upon T cell activation or proliferation can thereby be measured.
  • the affinity of a CTLA4-Ig molecule is the strength of binding of the molecule to a single ligand, including CD80, CD86, or CD80Ig or CD86Ig fusion proteins.
  • the affinity of CTLA4-Ig or CTLA4 A29YLl04E -Ig to .ligands can be measured, for example, by using binding interaction analysis (BIA) based on surface plasmon technique. Aside from measuring binding strength, it permits real time determination of binding kinetics, such as association and dissociation' rate constants.
  • a sensor chip consisting of a glass slide coated with a thin metal film, to.
  • CTLA4-Ig CTLA4 A29YLI04E -Ig
  • ligands one of the interactants, Ie, CTLA4-Ig, CTLA4 A29YLI04E -Ig, or one of the ligands.
  • a solution containing the other interactant is allowed to flow over its surface.
  • a continuous light beam is directed against the other side of the surface, and its reflection angle is measured.
  • the resonance angle of the light beam changes (as it depends on the refractive index of the medium close to the reactive side of the sensor, which in turn is directly correlated to the concentration of dissolved material in the medium). It is subsequently analyzed with the aid of a computer.
  • CTLA4-Ig binding experiments can be performed by surface plasmon resonance (SPR) on a BIAcore instrument (BIAcore AG, Uppsala, Sweden).
  • SPR surface plasmon resonance
  • CTLA4-Ig can be covalently coupled by primary amine groups to a carboxymethylated dextran matrix on a BIAcore sensor chip, thereby immobilizing CTLA4-Ig to the sensor chip.
  • an anti-constant region antibody can be used to. immobilize CTLA4-Ig indirectly to the sensor surface via the Ig fragment.
  • ligands are added to the chip to measure CTLA4-Ig binding to the ligands.
  • Affinity measurements can be performed, for example, as described in van der Merwe, P.
  • CTLA4 ⁇ 29YLI04E -Ig binding experiments can be performed using surface plasmon resonance (SPR) technology as described above (FIG. 6; see EXAMPLE 21).
  • the avidity of CTLA4-Ig or CTLA4 A29YL104E -Ig molecules can also be measured.
  • Avidity can be defines as the sum total of the strength of of binding of two molecules or cells to one another at multimple sites. Avidity is distinct from affininty, which is the strength of binding one site on a molecule to its ligand.
  • affininty which is the strength of binding one site on a molecule to its ligand.
  • higer avidity of CTLA4-Ig or CTLA4 A29YL104E -Ig molecules can lead to increased potency of inhibiton by CTLA4-Ig or CTLA4 A29YL104E -Ig molecules on T-cell proliferation and activation.
  • Avidity can be measured, for example, by two categories of solid phase assays: a) competitive inhibition assays, and b) elution assays. In both of them the ligand is attached to a solid support. In the competitive inhibition assay, CTLA4-Ig or CTLA4 A29YL104E -Ig molecules are then added in solution at a fixed concentration, together with free ligand in different concentrations, and the amount of ligand, which inhibits solid phase binding by 50%, is determined. The less ligand needed, the stronger the avidity. In elution assays, the ligand is added in solution. After obtaining a state of equilibrium, a chaotrope or denaturant agent (e.g.
  • isothiocyanate, urea, or dieth-ylamine is added in different concentrations to disrupt CTLA4- Ig/ligand interactions or CTLA4 A29YL104E -Ig /ligand interactions.
  • the amount of CTLA4-Ig or CTLA4 A29YL104E -Ig resisting elution is determined thereafter with an ELISA. The higher the avidity, the more chaotropic agent is needed to elute a certain amount of CTLA4-Ig or CTLA4 A29YU04E -lg.
  • the relative avidity of a heterogeneous mixture of CTLA4-Ig molecules or CTLA4 A29YLI04E -Ig can be expressed as the avidity index (AI); equal to the concentration of eluting agent needed to elute 50% of the bound CTLA4-Ig or CTLA4 A29YL104E -Ig molecules.
  • AI avidity index
  • Refined analysis of data can be performed by determining percentages of eluted CTLA4-Ig or CTLA4 A29YL104E -Ig at different concentrations of the eluting agent.
  • a Phenyl Sepharose 4 Fast Flow column chromatography, Hydrophobic Interaction Chromatography (HIC), process can be used to reduce the amount of CTLA4-Ig high molecular weight species eluted in a HIC purification step (see Example 15). Therefore, the cleaning peak from the HIC column is enriched in CTLA4-Ig HMW species.
  • preparative single or tandem column SEC HPLC can be employed to purify dimer, tetramer and multimer subpopulations from HIC cleaning peak material.
  • the purified components are CTLA4-Ig dimer, tetramer, and hexamer.
  • Characterization of high molecular weight components of CTLA4-Ig present in the HIC cleaning peak can be done by static and dynamic light scattering techniques.
  • Samples taken at the hydrophobic interaction chromatography (HIC) process step chase revealed the presence of dimer, tetramer, and multimers at various sampling points.
  • Hexamer species can be detected only in samples corresponding to the "start of the cleaning peak” and “cleaning peak maximum OD”. Decamer species were detected in the "cleaning peak maximum OD" only.
  • Molar mass and hydrodynamic radius formation can be determined by fractionation via size exclusion chromatography (SEC) employing MultiAngle light scattering (MALS) coupled with quasi elastic light scatter (QELS) detection.
  • SEC size exclusion chromatography
  • MALS MultiAngle light scattering
  • QELS quasi elastic light scatter
  • the biospecific binding activity of purified components from the HIC cleaning peak is comparable to the binding activity of determined by the BIAcore based immobilized B7.-lIg binding assay.
  • sialic acid molar ratio for components isolated from HIC cleaning peak are in the range of 4.9 to 7.6 whereas the sialic acid molar ratio of CTLA4-Ig molecules or dimer (not in the HIC cleaning peak) is in the range of 8- 10.
  • the choice of cell culture conditions can influence the formation of single chain ⁇ i.e., monomer) and high molecular weight species (i.e, dimers, tetramers, etc.) of a recombinant protein product.
  • Growth conditions also including but not limited to media composition, are factors that can affect the formation of single chain, and the level of cysteinylation. This is likely the result of presence of agents that lead to disulfide bond reduction.
  • the supplementation of cysteine directly or cysteine containing media to cells secreting CTLA4-Ig or CTLA4 A29YL104E -Ig can result in a rapid formation of single chain and high molecular weight species. The rate is proportional to amount of cysteine added.
  • the supplementation of iodoacetamide, a compound that reacts with free sulfhydryls blocks the formation of high molecular weight species of CTLA4-Ig or CTLA4 A29YLI04E -Ig that are dependent upon disulfide bonds.
  • the iodoacetamide sensitive and non-sensitive high molecular weight pathway highlight two major and distinctly different mechanisms by which high molecular weight species can form in CTLA4-Ig.
  • the supplementation of high salt concentrations (0.5M) to CTLA4-Ig solutions results in a sustained, rapid rate of high molecular weight formation.
  • EDTA 5 ConAcidSol II, and yeastolates modestly increase single chain formation (see Example 5).
  • the invention provides methods for generating high molecular weight CTLA4-Ig populations, wherein mixtures containing predominantly monomers or dimers of CTLA4-Ig are supplemented with high salt such that the mixture has a salt concentration greater than about 0.3, 0.4, 0.45, 0.5, or 0.6M.
  • such methods generate a mixture comprising a CTLA4-Ig population that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% CTLA4-Ig tetramer molecules.
  • the invention provides a population of CTLA4-Ig single chain species containing a modification on Cys 146 such that it is cysteinylated (see Example 4). Cysteinlyation is a posttranslational modification wherein a cysteine within a polypeptide chain is modified by the attachment of another cysteine via a disulfide bond. Cysteinylation of proteins have been implicated in modifying protein bioactivity including immunogenicity and antigenicity of MHC Class-I restricted viral determinants.
  • the invention provides a composition that comprises at least 1, 5, 10, 15, 20, 25, 50, 75, 90,or 95% of cysteinylated single chain CTLA4-Ig molecules.
  • a CTLA4-Ig population has no more than about 1 % CTLA4-Ig monomer molecules, or in another embodiement, less than 0.6% CTLA4-Ig monomer.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of sialic acid to CTLA4-Ig molecules of from about 5 to about 18.
  • the average molar ratio of sialic acid to CTLA4-Ig molecules is between from about X to about Y, inclusive of X and Y, where X is about 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, ⁇ or 17, and Y is about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 or 18.
  • the average molar ratio of sialic acid to CTLA4-Ig molecules is between from about X to about Y, inclusive of X and Y, where X is about 4.0, 4.5, 5.0, 5.5 or 6.0, and Y is about 8.0, 8.5, 9.0, 9.5, or 10.0. In other embodiments the average molar ratio of sialic acid to CTLA4-Ig molecules is between from about X to about Y, inclusive of X and Y, where X is about 6.0, 6.5, 7.0, 7.5, 8.0, 8.5 or 9.0 and Y is about 11.0, 11.5, 12.0, 12.5 or 13.0.
  • the average molar ratio of sialic acid to CTLA4-Ig molecules is from about 6 to about 14, from about 7 to about 13, from about 8 to about 12, or from about 9 to about 11. In other embodiments the average molar ratio of sialic acid to CTLA4-Ig molecules is from about 5 to about 9, from about 5.5 to about 9.5, from about 6 to about 9, from about 6 to about 10, or from about 7 to about 10. In other embodiments the average molar ratio of sialic acid to CTLA4-Ig molecules is greater than or equal to 5, or greater than or equal to 8. In certain embodiments, the sialic acid is N- acetyl neuraminic acid (NANA).
  • NANA N- acetyl neuraminic acid
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of N-glycolyl neuraminic acid (NGNA) to CTLA4-Ig molecules of less than or equal to 2.5, less than or equal to 2.0, less than or equal to 1.5, less than or equal to 1.0, or less than or equal to 0.5.
  • NGNA N-glycolyl neuraminic acid
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are greater than or equal to 93.0 area percent, greater than or equal to 93.5 area percent, greater than or equal to 94.0 area percent, greater than or equal to 94.5 area percent, greater than or equal to 95.0 area percent, greater than or equal to 95.5 area percent, greater than or equal to 96.0 area percent, greater than or equal to 96.5 area percent, or greater than or equal to 97.0 area percent CTLA4-Ig dimers as determined by size exclusion chromatography and spectrophotometric detection.
  • the composition comprises CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are greater than or equal to 95.0 area percent CTLA4-Ig dimers, and less than or equal to 4.0 area percent high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection. In some embodiments, the composition comprises CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are greater than or equal to 95.0 area percent CTLA4-Ig dimers, and less than or equal to 5.0 area percent high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are of less than or equal to 2.0 area percent, less than or equal to 1.5 area percent, less than or equal to 1.0 area percent; or less than or equal to 0.5 area percent area percent CTLA4-Ig monomers (i.e., single chain) as determined by size exclusion chromatography and spectrophotometric detection.
  • the present invention provides a composition comprising CTLA4-Ig molecules, ' wherein the CTLA4-Ig molecules are of less than or equal to 5.0 area percent, less than or equal to 4.5 area percent, less than or equal to 4.0 area percent, less than or equal to 3.5 area percent, less than or equal to 3.0 area percent, less than or equal to 2.5 area percent, less than or equal to 2.0 area percent, less than or equal to 1.5 area percent, less than or equal to 1.0 area percent, or less than or equal to 0.5 area percent CTLA4-Ig high molecular weight species (e.g., tetramer) as determined by size exclusion chromatography and . . ⁇ spectrophotometric detection.
  • CTLA4-Ig high molecular weight species e.g., tetramer
  • the CTLA4-Ig molecules are of less than or equal tolO area percent, less than or equal to 9 area percent, less than or equal to 8 area percent, less than or equal to 7 area percent, less than or equal to 6 area percent CTLA4-Ig high molecular weight species as determined by size exclusion chromatography and spectrophotometric detection.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the composition comprises an amount of MCP-I or MCP-1-like material less than or equal to 50 ppm, less than or equal to 40 ppm, less than or equal to 38 ppm, less than or equal to 30 ppm less than or equal to 20 ppm, less than or equal to 10 ppm, 5 ppm, less than or equal to 4 ppm, less than or equal to less than or equal to 3 ppm, less than or equal to 2 ppm or less than or equal to 1 ppm.
  • MCP-I or MCP-1-like material less than or equal to 50 ppm, less than or equal to 40 ppm, less than or equal to 38 ppm, less than or equal to 30 ppm less than or equal to 20 ppm, less than or equal to 10 ppm, 5 ppm, less than or equal to 4 ppm, less than or equal to less than or equal to 3 ppm, less than or equal to 2
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the composition comprises MCP-I or MCP-1-like material at less than or equal to 50 ng/mg CTLA4-Ig molecules, less than or equal to 40 ng/mg CTLA4- Ig molecules, less than or equal to 38 ng/mg CTLA4-Ig molecules, less than or equal to 30 ng/mg CTLA4-Ig molecules, less than or equal to 20 ng/mg CTLA4-Ig molecules, less than or equal to 10 ng/mg CTLA4-Ig molecules, less than or equal to 5 ng/mg, less than or equal t ⁇ 4 ng/mg CTLA4-Tg molecules, less than or equal to 3 ng/mg CTLA4-Ig molecules, less than or equal to 2 ng/mg CTLA4-Ig molecules or less than or equal to 1 ng/mg CTLA4-Ig molecules.
  • the present invention provides a composition comprising CTLA4-I
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of galactose to CTLA4-Ig molecules of from about 6 to about 19.
  • the average molar ratio of sialic acid to CTLA4-Ig molecules is from about X to about Y, where X is about 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 or 18, and Y is about 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18 or 19.
  • the average molar ratio of galactose to CTLA4-Ig molecules is between from about X to Y, inclusive of X and Y, where X is about 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9;0, 9.5, or 10.0 and Y is about 12.0, 12.5, 13.0, 13.5, 14:0, 14.5, 15,0, 15.5, or 16.0.
  • the average molar ratio of galactose to CTLA4-Ig molecules is between from about X " to about Y, inclusive of X and Y, wherein X is about 6.0, 6.5, 7.0, 7.5 or 8.0 and Y is about 15.0, 15.5, 16.0, 16.5, 17.0, 17.5, 18.0, 18.5, or 19.0. In other embodiments the average molar ratio of galactose to CTLA4-Ig molecules is from about from about 7 to about 15, from about 8 to about 14, from about 9 to about 13, from about 10 to about 12.
  • the average molar ratio of galactose to CTLA4-Ig molecules is from about 7 to about 18, from about 8 to about 17, from about 9 to about 17, from about 9 to about 16, or from about 10 to about 15. In other embodiments the average molar ratio of galactose to CTLA4-Ig molecules is greater than or equal to 8.
  • ⁇ e present invention provides a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of fucose to CTLA4-Ig molecules of from about 0.5 to about 12.
  • the average molar ratio of sialic acid to CTLA4-Ig molecules is between from about X to about Y, inclusive of X and Y, where X is about 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5 or 4.5, and Y is about 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10.0 or 10.5.
  • the average molar ratio of fucose to CTLA4-Ig molecules is between from about X to Y, inclusive of X and Y, where X is about 2.9 5 3.1, 3.3, 3.5, 3.7, 3.9, or 4.1 and Y is about 7.9, 8.1, 8.3, 8.5, 8.7, 8.9, or 9.1.
  • the average molar ratio of fucose to CTLA4-Ig molecules is between from about X to Y, inclusive of X and Y, wherein X is about 1.0, 1.5, 1.7, 1.9, 2.1, 2.3, or 2.5, and Y is about 8.7, 8.9, 9.1, 9.3, 9.6, 9.9, 10.1, 10.3 or 10.5.
  • the average molar ratio of fucose to CTLA4-Ig molecules is from about from about 3.3 to about 8.5, from about 3.5 to about 8.3, from about 3.7 to about 8.1, from about 3.9 to about 7.9. In other embodiments the average molar ratio of fucose to CTLA4-Ig molecules is from about 1.5 to about 9.5, from about 1.7 to about 9.3, from about 1.9 to about 9.1, or from about 2.1 to about 8.9. In other embodiments the average molar ratio of fucose to CTLA4-Ig molecules is greater than or equal to 1.7.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of mannose to CTLA4-Ig molecules of from about 5 to about 25.
  • the average molar ratio of sialic acid to CTLA4-Ig molecules is between from about X to about Y 5 inclusive of X and Y, where X is about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or 21, and Y is about 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24.
  • the average molar ratio of mannose to CTLA4-Ig molecules is between from about X to Y, inclusive of X and Y 5 where X is about 6.5, 7.0, 7.5, 7.7, 7.9, 8.1, 8.3, 8.5, 9.0, 9.5, 10.0, 10.5, 11.0, 11.5 or 12.0 and Y is about 17.0, 17.5, 18.0, 18.5, 19.0, 19.5, 20.0, 20.5, 21.0, 21.5, 22.0, 22.5, 23, 23.5 or 24.0.
  • the average molar ratio of mannose to CTLA4-Ig molecules is between from about X to Y, inclusive of X and Y, where X is about 8, 8.5, 9.0, 9.5 10.0 or 11.0 and Y is about 17.0, 17.5, 18.0, 18.5, 19.0, 19.5 or 20.0. Jn other embodiments the average molar ratio of mannose to CTLA4-Ig molecules is from about from about 6 to about 23, from about 7 to about 22, from about 7.7 to about 22, from about 8 to about 21, from about 9 to about 20, from about 10 to about 19, from about 11 to about 19, and from about 11 to about 17.
  • the average molar ratio of mannose to CTLA4-Ig molecules is from about 8 to about 19, from about 9 to about 18, from about 10 to about 17, or from about 11 to about 16. In other embodiments the average molar ratio of mannose to CTLA4-Ig molecules is greater than or equal to 7.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are of less than or equal to 5.0 area percent, less than or equal to 4.5 area percent, less than or equal to 4.0 area percent, less than or equal to 3.5 area • percent, less than or equal to 3.0 area percent, less than or equal to 2.5 area percent, less than or equal to 2.0 area percent, less than or equal to 1.5 area percent, less than or equal to 1.0 area percent, or less than or equal to 0.5 area percent oxidized species.
  • the present invention provides a.composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules are less than or equal to 5.0 area percent, less than or equal to 4.5 area percent, less than or equal to 4.0 area percent, less than or equal to 3.5 area percent, less than or equal to 3.0 area percent, less than or equal to 2.5 area percent, less than or equal to 2.0 area percent, less than or equal to 1.5 area percent, less than or equal to 1.0 area percent, or less than or equal to 0.5 area percent deamidated species.
  • the composition comprises CTLA4- Ig molecules, wherein the CTLA4-Ig molecules are less than or equal to 3.5 area percent oxidized species and less than or equal to 2.5 area percent deamidated species.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the composition comprises bacterial endotoxins LAL at less than or equal to 0.7 EU/mg CTLA4-Ig molecules, less than or equal to 0.6 EU/mg CTLA4-Ig molecules, less than or equal to 0.5 EU/mg CTLA4-Ig molecules, less than or equal to 0.42 EU/mg CTLA4- Ig molecules, less than or equal to 0.4 EU/mg CTLA4-Ig molecules, less than or equal to 0.35 EU/mg CTLA4-Ig molecules, less than or equal to 0.3 EU/mg CTLA4-Ig molecules, less than or equal to 0.25 EU/mg CTLA4-Ig molecules, less than or equal to 0.20 EU/mg CTLA4- Ig molecules, less than or equal to 0.15 EU/mg CTLA4-Ig molecules, or less than or equal to 0.05 EU/mg CTLA4-Ig molecules.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the composition comprises bioburden at less than or equal to 2 CFU/10mL, less than or equal to 1.5 CFU/lOmL, less than or equal to 1 CFU/10mL, or less than or equal to 0.5 CFU/lOmL.
  • the present invention provides a composition comprising CTLA4-lg molecules, wherein the composition comprises DNA at less than or equal to 25 pg/mg CTLA4-Ig molecules, less than or equal to 20 pg/mg CTLA4-Ig molecules, less than or equal to 15 pg/mg CTLA4-Ig molecules, less than or equal to 10 pg/mg CTLA4-Ig molecules, less than or equal to 5.0 pg/mg CTLA4-Ig molecules, less than or equal to 4.0 pg/mg CTLA4-Ig molecules, less than or equal to 3.5 pg/mg CTLA4-Ig molecules, less than or equal to 3.0 pg/mg CTLA4-Ig molecules, less than or equal to 2.5 pg/mg CTLA4-Ig molecules, less than or equal to 1.5 pg/mg CTLA4-Ig molecules, less than or equal to 1.0 pg/mg CTLA4-Ig molecules, or
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the composition comprises cellular protein (e.g., CHO protein or CHOP) at less than or equal to 200 ng/mg CTLA4-Ig molecules, less than or equal to 150 ng/mg CTLA4-Ig molecules, less than or equal to 125 ng/mg CTLA4-Ig molecules, less than or equal to- 100 ng/mg CTLA4-Ig molecules, less than or equal to 90 ng/mg CTLA4-Ig molecules, less than or equal to 80 ng/mg CTLA4-Ig molecules, 70 ng/mg CTLA4-Ig molecules, less than or equal to 60 ng/mg CTLA4-Ig molecules, less than or equal to 50 ng/mg CTLA4-Ig molecules, less than or equal to 40 ng/mg CTLA4-Ig molecules, less than or equal to 30 ng/mg CTLA4-Ig molecules, less than or equal to
  • ng/mg CTLA4-Ig molecules less than or equal to 20 ng/mg CTLA4-Ig molecules, less than or equal to 15 ng/mg CTLA4-Ig molecules, less than or equal to 10 ng/mg CTLA4-Ig molecules, or less than or equal to 5 ng/mg CTLA4-Ig molecules.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the composition comprises cellular protein at less than or equal to 200 ppm, less than or equal to 150 ppm, less than or equal to 125 ppm, less than or equal to 100 ppm, less than or equal to 90 ppm, less than or equal to 80 ppm, 70 ppm, less than or equal to 60 ppm, less than or equal to 50 ppm, ess than or equal to 40 ppm, less than or equal to 30 ppm, less than or equal to 25 ppm, less than or equal to 20 ppm, less than or equal to 15 ppm, less than or equal to 10 ppm, or less than or equal to 5 ppm.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the composition comprises Triton-X (e.g., Triton X-100) at less than or equal to 4.0 ng/mg CTLA4-Ig molecules, less than or equal to 3.5 ng/mg CTLA4-Ig molecules, less than or equal to 3.0 ng/mg CTLA4-Ig molecules, less than or equal to 2.5 ng/mg CTLA4-Ig molecules, less than or equal to 2.0 ng/mg CTLA4-Ig molecules, less than or equal to 1.5 ng/mg CTLA4-Ig molecules, less than or equal to 1.0 ng/mg CTLA4-Ig molecules, or less than or equal to 0.5 ng/mg CTLA4-Ig molecules.
  • Triton-X e.g., Triton X-100
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the composition comprises Triton-X at less than or equal to 4.0 ppm, less than or equal to 3.5 ppm, less than or equal to 3.0 ppm, less than or equal to 2.5 ppm, less than or equal to 2.0 ppm, less than or equal to 1.5 ppm, less than or equal to 1.0 ppm, or less than or equal to 0.5 ppm.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the composition comprises Protein A at less than or equal to 8.0 ng/mg CTLA4-Ig molecules, less than or equal to 7.5 ng/mg CTLA4-Ig molecules, less than or equal to 7.0 ng/mg CTLA4-Ig molecules, less than or equal to 6.5 ng/mg CTLA4-Ig molecules, less than or equal to 6.0 ng/mg CTLA4-Ig molecules, less than or equal to 5.5 ng/mg CTLA4-Ig molecules, less than or equal to 5.0 ng/mg CTLA4-Ig molecules, less than or equal to 4.5 ng/mg CTLA4-Ig molecules, less than or equal to 4.0 ng/mg CTLA4-Ig molecules, less than or equal to 3.5 ng/mg CTLA4-Ig molecules, less than or equal to 3.0 ng/mg CTLA4-Ig molecules, less than or equal to
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the composition comprises Protein A at less than or equal to 8.0 ppm, less than or equal to 7.5 ppm, less than or equal to 7.0 ppm, less than or equal to 6.5 ppm, less than or equal to 6.0 ppm, less than or equal to 5.5 ppm, less than or equal to 5.0 ppm, less than or equal to 4.5 ppm, less than or equal to 4.0 ppm, less than or equal to 3.5 ppm, less than or equal to 3.0 ppm, less than or equal to 2.5 ppm, less than or equal to 2.0 ppm, less than or equal to 1.5 ppm, less than or equal to 1.0 ppm, or less than or equal to 0.5 ppm.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of GIcNAc to CTLA4-Ig molecules of from about 10 to about 40.
  • the average molar ratio of GIcNAc to CTLA4-Ig molecules is between from about X to about Y 5 inclusive of X and Y, where X is any whole number between 10 and 39 and Y is any whole number between 11 and 40.
  • the average molar ratio of GIcNAc to CTLA4-Ig molecules is between from about X to Y, inclusive of X and Y, where X is about 12, 14, 14, 15, 16 or 17, and Y is about 32, 33, 34, 35, 36 or 37. In other embodiments the average molar ratio of GIcNAc to CTLA4-Ig molecules is from about 12 to about 35, from about 13 to about 35, from about 14 to about 35, from about 15 to about 35.
  • the present invention provides a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig molecules have an average molar ratio of GaINAc to CTLA4-Ig molecules of from about 0.5 to about 7.0.
  • the average molar ratio of GaINAc to CTLA4-Ig molecules is between from about X to about Y, inclusive ofX and Y, where X is 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, or 2.0, and Y is 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, .46, 4.7, 4.8, 4.9, 5.0, 6.0, 7.0 or 8.0.
  • the average molar ratio of GaINAc to CTLA4-lg molecules is between from about X to Y, inclusive of X and Y, where X is about 0.6, 0.7, 0.8, 0.9, or 1.0, and Y is about 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1 or 4.2.
  • the average molar ratio of GaINAc to CTLA4-Ig molecules is from about 0.7 to about 4.1, from about 0.8 to about 4.0, from about 0.9 to about 3.9, or about 1.0 to about 3.8, or about 1.1 to about 3.7.
  • the average molar ratio of GaINAc to CTLA4-Ig molecules is from about 1.6 to about 3.7, from about 1.7 to about 3.6, from about 1.8 to about 3.5, or about 1.9 to about 3.4.
  • the invention provides for a composition comprising CTLA4-Ig molecules, wherein the CTLA4-Ig composition exhibits bands in pi ranges as determined on an isoelectric focusing gel (IEF gel) as follows: from about 10 to about 22 bands in the pi range of from about 4.3 to about 5.6; cumulative bands intensity of from about 90% to about 110% in a pi range from about 4.3 to about 5.3 and about 3 major bands in a pi range from about 4.5 to about 5.2.
  • IEF gel isoelectric focusing gel
  • the bands in the range of from about 4.3 to about 5.6 is from about 5 to about 30, from about 6 to about 29, from about 7 to about 28, from about 8 to about 27, from about 9 to about 26, from about 10 to about 25, from about 11 to about 24, from about 12 to about 23, from about 13 to about 22, from about 14 to about 21, from about 15 to about 20, from about 16 to about 19, from about 17 to about 20, from about 18 to about 19.
  • glycosylation can refer to the addition of complex oligosaccharide structures to a protein at specific sites within the polypeptide chain. Glycosylation of proteins and the subsequent processing of the added carbohydrates can affect protein folding and structure, protein stability, including protein half life, and functional properties of a protein. Protein glycosylation can be divided into two classes by virtue of the sequence context where the modification occurs, O-linked glycosylation and N- linked glycosylation.
  • O-linked polysaccharides are linked to a hydroxyl group, usually to the hydroxyl group of either a serine or a threonine residue.
  • O-glycans are not added to every serine and threonine residue.
  • O-linked oligosaccharides are usually mono or biantennary, i.e. they comprise one or at most two branches (antennas), and comprise from one to four different kinds of sugar residues, which are added one by one.
  • N-linked polysaccharides are attached to the amide nitrogen of an asparagine. Only asparagines that are part of one of two tripeptide sequences, either asparagine-X-serine or asparagine-X-threonine (where X is any amino acid except proline), are targets for glycosylation. N-Hnked oligosaccharides can have from one to four branches referred to as mono-, bi-, tri- tetraantennary. The structures of and sugar residues found in N- and O-linked oligosaccharides are different.
  • sialic acid is a common name for a family of unique nine-carbon monosaccharides, which can be linked to other oligosaccharides.
  • Two family members are N-acetyl neuraminic acid, abbreviated as Neu5 Ac or NANA, and N- glycolyl neuraminic acid, abbreviated as Neu5Gc or NGNA.
  • NANA N-acetylneuraminic acid
  • NGNA N-glycolylneuraminic acid
  • the method described herein can be used to determine the number of moles of sialic acids for both NANA and NGNA, and therefore levels of both NANA and NGNA are determined and reported for CTLA4-Ig molecules.
  • N- and 0-linked oligosaccharides have different number of branches, which provide different number of positions to which sialic acid molecules can be attached.
  • N-linked ologosaccharides can provide up to four attachment positions for sialic acids, while O-linked oligosaccharides can provide two sites for sialic acid attachment.
  • Glycosylated proteins are of great interest as diagnostic and therapeutic agents.
  • Many eukaryotic transmembrane proteins destined for the cell surface and secreted proteins are post-translationally modified to incorporate N-linked and O-linked carbohydrate groups.
  • N-linked oligosaccharides are attached to asparagine residues when they are part of the peptide motif Asn-X-Ser/Thr, where X can be any amino acid except proline.
  • O-linked oligosaccharides are attached to serine or threonine residues.
  • N-linked and O-linked oligosaccharides as well as the sugar residues found in each can be different.
  • One type of sugar that is commonly found on both is N-acetylneuraminic acid (NANA; hereafter referred to as sialic acid).
  • NANA N-acetylneuraminic acid
  • sialic acid is the terminal residue of both N-linked and O- linked oligosaccharides.
  • the glycoprotein because of its negative charge, can exhibit acidic properties.
  • glycosylation can have a profound impact on the circulating half-life and bioactivity of glycoprotein therapeutics by processes which involve receptor mediated endocytosis and clearance.
  • Receptor-mediated systems are thought to play a major role in clearing serum glycoproteins by recognizing the various sugar components of the oligosaccharide.
  • a glycoprotein's terminal sialic acid group can affect absorption, half-life, and serum clearance.
  • glycoprotein production strategies which maintain the terminal sialic acid component of the glycosylated protein, can better increase the protein's bioavailability and serum half- life.
  • Several production process parameters have been investigated pertaining to recombinant glycoprotein synthesis, especially the effect of media composition and temperature shifts in various production strategies.
  • CTLA4-Ig dimers composed of monomers having the amino acid sequence of residues (i) 26-383 of SEQ ID NO:2, (ii) 26-382 of SEQ ID NO:2, (iii) 27-383 of SEQ ID . NO:2, (iv) 27-382 of SEQ ID NO:2 5 (v) 25-382 of SEQ ID NO:2, or (vi) 25-383 of SEQ ID NO:2, can have a predicted theoretical MW of about 78,000 to about 79,000 Daltons. However, the MW for such dimers obtained by MALDI-TOF is approximately 91,000 Daltons.
  • This difference in MW of approximately 13,000-rl4,000 Daltons is due at least in part to glycosylation, which in one embodiment, accounts for approximately 15% of the mass of this particular CTLA4-Ig monomer molecule.
  • the above specified monomers have three N-linked glycosylation sites that have been confirmed by peptide mapping to occur at asparagines at residues 102, 134, and 233 of SEQ ID NO:2.
  • Carbohydrate molecules that are linked through asparagine can be cleaved selectively using the enzyme Peptide-N Glycosidase F (PNGase F).
  • the predominant glycan attached to these two sites is HexNAc-Hex-NeuAc.
  • FIG. 9 presents an overall view of the N-linked and O-linked carbohydrate structures on CTLA4-Ig molecules comprised of monomers having a sequence from SEQ ID NO:2 (Le, a monomer having one of the following sequences: (i) 26-383 of SEQ ID NO:2, (ii) 26-382 of SEQ ID NO:2, (iii) 27-383 of SEQ ID NO:2, (iv) 27-382 of SEQ ID NO:2), (v) 25-382 of SEQ ID NO:2, or (vi) 25-383 of SEQ ID NO:2 wherein in one embodiment such molecules with the shown carbohydrate characteristics are produced by the cell-line of the invention or progeny thereof according to the method of production described in Examples 14-15 and also shown in FIG.
  • CTLA4 A29YU04E - ⁇ g dimers composed of monomers having the amino acid sequence of residues (i) 26-383 of SEQ ID NO:4, (ii) 26-382 of SEQ ID NO:4, (iii) 27-383 of SEQ ID NO:4, (iv) 27-382 of SEQ ID NO:4, (v) 25-382 of SEQ ID NO:4, or (vi) 25-383 of SEQ ID NO:4, can have a predicted theoretical MW of about 78,000 to about 79,000 Daltons.
  • the MW for such dimers obtained by MALDI-TOF is approximately 91,500 Daltons. This difference in MW of approximately 12,000-13,000 Daltons is due at least in part to glycosylation.
  • the above specified monomers have three N-linked glycosylation sites that have been confirmed by peptide mapping to occur at asparagines at residues 102, 134, and 233 of SEQ ID NO:4 (N76, Nl 08, and N207 of FIG. 4).
  • Carbohydrate molecules that are linked through asparagine can be cleaved selectively using the enzyme Peptide-N Glycosidase F (PNGase F).
  • the predominant glycan attached to these sites is HexNAc-Hex-NeuAc.
  • CTLA4-Ig or CTLA4 A29YLI04E -Ig molecules are glycoproteins that can be produced by the culture methods of the invention.
  • CTLA4-Ig glycoproteins are modified with oligosaccharides that represent approximately 15% (w/w) of the molecule. These oligosaccharides can play an important role in the pharmacokinetic (PK) parameters of a CTLA4-Ig or CTLA4 A29YLI04E -Ig glycoprotein.
  • PK pharmacokinetic
  • different oligosaccharide profiles can influence the stability and degradation of proteins. For example, O-linked oligosaccharides may enhance the stability of CTLA4 A29YL104 ⁇ -Ig molecules by preventing autolysis in the hinge region of the immunoglobulin constant region.
  • the oligosaccharide distribution on a.population of CTLA4-Ig or CTLA4 ⁇ ⁇ 9YL104E -Ig molecules can be heterogeneous in nature due to the complexity of cell culture and processes.
  • the heterogeneity can be present due to glycosylation sites being completely occupied to unoccupied, and the fact that any specific site can be populated with many different oligosaccharide structures, which can further display variation in the pattern of sialic acid modification.
  • the primary sialic acid moiety on CTLA4-Ig or CTLA4 A29YL104E -Ig molecules is N-acetyl neuraminic acid (NeuAc, NANA), and the secondary sialic acid moiety is N-glycolyl neuraminic acid (NGNA).
  • NGNA N-glycolyl neuraminic acid
  • the charged nature of sialic acid and the complex sialic acid-containing structures can result in multiple isoforms of CTLA4-Ig or CTLA4 A29YLI04E -Ig, respectively, where such isoforms can be evident in an isoelectric focusing (IEF) profile.
  • IEF isoelectric focusing
  • the invention provides a population of CTLA4-Ig molecules that have a dominant CTLA4-Ig isoform having an isoelectric point (pi) that is less than or equal to 5.1 or 5.0, which can be determined for example by IEF.
  • a population of CTLA4 A29YU04E -Ig .molecules is provided that has dominant cTLA4 A29YL104E - Ig isoforms having an isoelectric point (pi) that is less than or equal to 5.5, which can be determined for example by IEF (FIG. 12).
  • the invention provides a population of CTLA4-Ig molecules that have a pi of from about 4.2 to about 5.7, from about 4.25 to about 5.5, from about 4.3 to about 5.3, or from about 4.5 to about 5.2.
  • the invention provides a population of CTLA4-Ig molecules that have a pi of from about 4.45 to about 5.30.
  • the invention provides a population of CTLA4-Ig molecules that have a pi of from about 4.3 to about 5.1.
  • the invention provides a population of CTLA4-Ig molecules that have a pi of from about 4.45 to about 5.0.
  • the invention provides a population of CTLA4-Ig molecules where at least 40%, 50%, 60%, 70%, 80%, 90%, or 95% of the molecules in the population exhibit an isoelectric point less than or equal to about 5.7, 5.6, 5.5, 5.4, 5.3, 5.2, 5.1, 5.0, 4.9, 4.8, 4.7, 4.6, 4.5, 4.4.
  • the invention provides a method for preparing a population of CTLA4-Ig molecules having a pi of from about 4.45 to about 5.30, or from about 4.45 to about 5.1, or from about 4.45 to about 5.0, wherein the methods involves subjecting a population of CTLA4-Ig molecules to IEF gel electrophoresis, wherein a single band on the gel represents a sub-population of CTLA4-Ig molecules having a particular pi, and isolating the sub-population of CTLA4-Ig molecules having the particular pi by excising the band from the gel and subsequent purification of the proteins from the excised gel band.
  • the invention provides a population of CTLA4 A29YLI04E - Ig molecules that have a pi of from about 4.5 to about 5.2. In other embodiments, the invention provides a population of CTLA4 A29YLI04E -Ig molecules that have a pi of from about 4.7 to about 5.1. In another embodiment, the invention provides a population of CTLA4 A29YLI04E -Ig molecules that have a pi of from about 2.0 to about 5.2.
  • the invention provides a population of CTLA4 A29YL104E -Ig molecules where at least 40%, 50%, 60%, 70%, 80%, 90%, or 95% of the molecules in the population exhibit an isoelectric point less than or equal to about 5.5, 5.4, 5.3, 5.2, 5.1, 5.0, 4.9, 4.8, 4.7, 4.6, 4.5, 4.4. 4.3, 4.2, 4.1, 4.0, 3.9, 3.8, 3.7, 3.6, 3.5, 3.4, 3.3, 3.2, 3.1, or 3.0 as determined by IEF (these values can have a Standard Deviation of ⁇ 0.2).
  • the invention provides a method for preparing a population of CTLA4 A29YLI04E -Ig molecules having a pi of from about 4.5 to about 5.2; from about 4.7 to about 5.1; from about 2.0 to about 5.2, wherein the method involves subjecting a population of CTLA4 A29YL104E -Ig molecules to IEF gel electrophoresis, wherein a single band on the gel represents a sub-population of CTLA4 A29YLI04E -Ig molecules having a particular pi, and isolating the sub-population of CTLA4 A29YL104E -Ig molecules'having the particular pi by excising the band from the gel and subsequent purification of the proteins from the excised gel band.
  • the invention provides populations of CTLA4-Ig molecules having an average molar ratio of moles sialic acid groups to moles CTLA4-Ig moleculesof from: about 6 to about 32, about 8 to about 32, about 11 to about 30, about 12 to about 20, about 13 to about 19, about 14 to about 18, about 15 to about 17, about 6 to about 16, about 8 to about 16, about 8 to about 14, about 8 to about 12.
  • a maximum allowable CHO host cell protein of ⁇ 25 ppm to ⁇ 10 ng/mg characterizes the composition of CTLA4-Ig molecules.
  • the composition of CTLA4-Ig molecues is characterized by host cell DNA at a level of ⁇ 2.5 pg/mg to ⁇ 1.0 pg/mg.
  • the composition of CTLA4-Ig molecues is characterized by Triton X-100 at a level of ⁇ 1.0 ng/mg or ⁇ 1.0 ppm.
  • the concentration of Triton X-100 can be determined by extraction of the Triton X-100 using Waters OASIS-HLB solid-phase extraction followed by washing with water to remove residual protein. The bound Triton X-100 is removed by elution with acetonitrile. The acetonitrile eluate is analyzed by reversed-phase chromatography using a SAS Hypersil 5 ⁇ m column and a mobile phase consisting of acetonitrile: water (80:20). Detection is by UV absorbance at 225 nm.
  • the composition of CTLA4-Ig molecules is characterized by ⁇ 2.5 area % oxidation and ⁇ 2.0 area % deamidation.
  • the composition of CTLA4-Ig molecules is characterized by ⁇ 3.0 area % oxidation and ⁇ 2.5 area % deamidation.
  • the tryptic peptide mapping method was used for quantitation of oxidation and deamidation.
  • the percent oxidation data was determined by the use of an RP-HPLC tryptic mapping assay that quantitates the area percent oxidation of Met85 in the CTLA4-Ig protein to methionine sulfoxide.
  • Percent oxidation in the method is obtained by measuring UV peak areas in the RP-HPLC tryptic map for the T6 tryptic peptide, comprised of residues 84-93 containing Met85, and the corresponding oxidized tryptic peptide, T6ox, containing Met(O)85.
  • AT6ox peak area for ⁇ T6ox tryptic peptide, Met(O)85(84-93).
  • the percent deamidation data acquired by using a RP-HPLC tryptic mapping assay that quantitates the area percent oxidation and deamidation, • is obtained by measuring UV peak areas in the RP-HPLC tryptic map for the T26 tryptic peptide, comprised of residues 281-302_containing Asn294, and the corresponding deamidated tryptic peptide, T26deaml, containing isoAsp294.
  • AT26deam2 peak area for T26deam2, Asp299(281-302).
  • AT26deam3 peak area for T26deam3, Asp294(281 -302).
  • AT26deam4 peak area for T26deam4, Asu294(281-302).
  • the composition of CTLA4-Ig molecules is characterized by N-Acetyl glucosamine (GIcNAc) of from 15 to 35 Moles:Mole CTLA4-Ig Protein, or N- Acetylgalactosamine (GaINAc) of from 1.7 to 3.6 Moles:Mole CTLA4-Tg Protein.
  • GIcNAc N-Acetyl glucosamine
  • GaINAc N- Acetylgalactosamine
  • the amino monosaccharides are quantitated by capillary electrophoresis (CE) following release from the protein by acid hydrolysis.
  • the released amino monosaccharides are re-acetylated, and fluorescently labeled with aminopyrene trisulfonic acid (APTS) to facilitate their detection and quantitation.
  • APTS aminopyrene trisulfonic acid
  • N-Acetylmannosamine is added to a sample and amino monosaccharide standards to serve as an internal standard.
  • the peak areas of the amino monosaccharides in the samples are normalized using the internal standard and quantified by comparing with their respective normalized amino monosaccharides peak areas in the standard.
  • the molar ratio of each monosaccharide relative to the CTLA4-Ig molecule is then calculated.
  • the composition of CTLA4-Ig molecues is characterized by the following N-linked oligosaccharide profile specifications:
  • composition of CTLA4-Ig molecules is characterized by neutral monosaccharide where the composition has ratios of about:
  • the monosaccharide molar ratio range for a CTLA4 A29YL104E -Ig composition is as follows: mannose from about 10 - 20 moles/mole protein; fucose from about 4.2 -7.0 moles/mole protein; and galactose from about 9.2 —17 moles/mole protein.
  • the CTLA4 A29YL104B -Ig composition is characterized by a NANA molar ratio of from about 5.0 - 10.0. mole of NANA/mole protein.
  • the CTLA4 A29YLI04E -Ig composition is characterized by a NGNA molar ratio of ⁇ 1.5 mole NGNA/mole protein.
  • the % deviation of molar ratio for sialic acids is ⁇ 15% or ⁇ 20% or ⁇ 30%.
  • a population of CTLA4-Ig molecules can comprise CTLA4- Ig monomers that each have at least 3 sialic acid groups. In another embodiment a population of CTLA4-Ig molecules comprises CTLA4-Ig monomers that each have from 3 to 8 sialic acid groups.
  • the invention provides a population of CTLA4-Ig molecules where at least 40%, 50%, 60%, 70%, 80%, 90%, or 95% of the molecules in the population exhibit an isoelectric point less than or equal to about 5.7, 5.6, 5.5, 5.4, 5.3, 5.2, 5.1, 5.0, 4.9, 4.8, 4.7, 4.6,-4.5, 4.4: 4.3, 4.2, 4.1, 4.0, 3.9, 3.8, 3.7, 3.6, 3.5, 3.4, 3.3, 3.2, 3.1, or 3.0.
  • the invention provides populations of CTLA4-Ig molecules having an average molar ratio of moles NANA to moles CTLA4-Ig molecules or dimer of from: about 6 to about 16, about 6 to about 14, about 6 to about 12, about 8 to about 12, about 8 to about 14, about 8 to about 16.
  • the invention provides populations of CTLA4-Ig molecules having an average molar ratio of moles NGNA to moles CTLA4-Ig molecules or dimer of less than or equal to about 2, 1.8, 1.6, 1.5, 1.4, 1.0, 0.8, or 0.5
  • the invention provides populations of CTLA4 A29YL104E -Ig molecules having an average molar ratio of moles sialic acid groups to moles CTLA4 A29YL104E -Ig molecules or dimer of from about 5.5 to about 8.5. In another embodiment, the invention provides populations of CTLA4 A29YL104E -Ig molecules having an average molar ratio of moles sialic acid groups to moles CTLA4 A29YLI04E -Ig molecules or dimer of from about 5 to about 10.
  • a population of CTLA4 A29YL104E -Ig molecules can comprise CTLA4 A29YL104E -Ig monomers that each have at least 2.5 sialic acid groups.
  • a population of CTLA4 A29YL104E -Ig molecules comprises CTLA4 A29YL104E -Ig monomers that each have from 2.5 to 5 sialic acid groups.
  • the invention provides populations of CTLA4-Ig molecules that are distinguished by the population's average molar ratio of moles amino monosaccharides and/or neutral monosaccharides and/or sialic acids to moles CTLA4-Ig molecules or dimer.
  • the invention provides populations of CTLA4 A29YL104E -Ig molecules that are distinguished by the population's average molar ratio of moles amino monosaccharides and/or neutral monosaccharides and/or sialic acids to moles CTLA4 A29YL104E -Ig moleculesor dimer.
  • Amino monosaccharides include N-acetyl galactosamine (GaINAc) and N-acetyl glucosamine (GIcNAc).
  • Neutral monosaccharides include mannose, fucose, and galactose.
  • Sialic acids include N-acetyl neuraminic acid (NANA) and N-glycolyl neuramininc acid (NGNA).
  • the invention provides a population of CTLA4-Ig molecules that are characterized by an average molar ratio of moles GIcNAc per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule that is from about 10 to about 40, from about 15 to about 35, from about 15 to about 25, or from about 15 to about 20.
  • the invention provides a population of CTLA4-Ig molecules where at least 40%, 50%, 60%, 70%, 80%, 90%, or 95% of the molecules in the population are characterized by an average molar ratio of moles GIcNAc per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule that is less than or equal to about 40, 38, 35, 30, 25, 20, 18, or 15.
  • the invention provides a population of CTLA4-Ig molecules that are characterized by an average molar ratio of moles GaINAc per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule that is from about 1.5 to about 8.5, from about 1.7 to about 3.0, from about 1.7 to about 4.0, from about 1.7 to about 5.0, from about 1.7 to about 6.0, from about 1.7 to about 7.0, from about 1.7 to about 8.0, or from about 1.7 to about 8.3.
  • the invention provides a population of CTLA4-Ig molecules where at least 40%, 50%, 60%, 70%, 80%, 90%, or 95% of the molecules in the population are characterized by an average molar ratio of moles GaINAc per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule that is less than or equal to about 8.5, 8, 7.5, 7, 6.5, 6, 5.5, 5, 4.5, 4.0, 3.8, 3.6, 3.5, 3.0, 2.5, 2.0, 1.7, or 1.5.
  • the invention provides a population of CTLA4-Ig molecules that are characterized by an' average molar ratio of moles galactose per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule that is from about 7.5 to about 20.0, from about 8.0 to about 19.0, from about 8 to about 18.0, from about 8.0 to about 17.0, from about 8.5 to about 17.0, or from about 9.0 to- about 17.0;
  • the invention provides a population of CTLA4-Ig molecules where at least 40%, 50%, 60%, 70%, 80%, 90%, or 95% of the molecules in the population characterized by an average molar ratio of moles galactose per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule that is less than or equal to about 20.0, 19.0, 18.0, 17.O 3 16.0, 15.0, 14.0, 13.0, 12.0, 11.0, 10.0, 9.0, 8.5, 8.0
  • the invention provides a population of CTLA4-Ig molecules that are characterized by an average molar ratio of moles fucose per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule that is from about 3 to about 8.5, from about 3.5 to about 8.5, from about 3.5 to about 8.3, from about 3.5 to about 8.0, from about 3.5 to about 7.5, or from about 3.5 to about 7.0.
  • the invention provides a population of CTLA4-Ig molecules where at least 40%, 50%, 60%, 70%, 80%, 90%, or 95% of the molecules in the population characterized by an average molar ratio of moles fucose per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule that is less than or equal to about 8.5, 8.3, 8.0, 7.5, 7.0, 6.5, 6.0, 5.5, 5.0, 4.5, 4.0, 3.5, 3.2, or 3.0.
  • the invention provides a population of CTLA4-Ig molecules that are characterized by an average molar ratio of moles mannose per mole of CTLA4-Ig dimer or to CTLA4-Ig molecule that is from about 7 to about 23, from about 7.5 to about 23, from about 7.7 to about 23, from about 7.7 to about 22.5, from about 7.7 to about 22, from about 7.7 to about 20, from about 7.7 to about 18, from about 7.7 to about 16, from about 8.0 to about 16.0, from about 9.0 to about 17.0, from about 10 to about 19.0, or from about 11 to about 19.0.
  • the invention provides a population of CTLA4-Ig molecules where at least 40%, 50%, 60%, 70%, 80%, 90%, or 95% of the molecules in the population characterized by an average molar ratio of moles mannose per mole of CTLA4-Ig molecules or dimer or to CTLA4-Ig molecule that is less than or equal to about 23, 22.5, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9.5, 9, 8.5, 8, 7.7, 7.5, 7.3, or 7.
  • the invention provides a glycosylated CTLA4-Ig population that exhibits increased PK values, such as increased exposure as measured by area under the curve (AUC), such as resulting from or as' demonstrated by decreased clearance from the serum while retaining bioactivity.
  • the invention provides a glycosylated CTLA4 A29YLI04E -Ig population that exhibits increased pharmacokinetic (PK) values as demonstrated by decreased clearance from the serum while retaining bioactivity.
  • the invention provides analogs of soluble CTLA4-Ig molecules, which have additional glycosylation sites.
  • the invention provides analogs of soluble CTLA4 A29YL104E -Ig molecules, which have additional glycosylation sites. Additional glycosylation sites provide attachment points for additional carbohydrate structures that can be sialylated. Increased sialic content can be lead to increased PK values, and/or increased glycoprotein stability. Higher sialic acid content is beneficial. In vitro post-purification methods that use enzymes to add more sialic acids can be performed to produce further embodiments of the CTLA4- ⁇ g or CTLA4 A29YL104E -Ig molecules of the invention.
  • the embodiments of the invention include any one range disclosed herein in combination with any one-or more ranges disclosed herein.
  • the embodiments of the invention include any one characteristic or property of CTLA4-Ig disclosed herein in combination with any one or more characteristics or properties of CTLA4-Ig disclosed herein.
  • CTLA4-Ig or CTLA4 A29YL104E -Ig molecule populations on the basis of various sugar profiles, including but not limited to a population's average molar ratio of moles amino monosaccharides and/or neutral monosaccharides and/or sialic acids per mole CTLA4-Ig or CTLA4 A29YL104E -Ig molecules or dimer.
  • a glycoprotein that is secreted from cultured cells can be isolated from the culture medium or supernatant.
  • the glycoprotein produced by the cells is collected, recovered, isolated, and/or purified, or substantially purified, as desired, at the end of the total cell culture period using isolation and purification methods as known and practiced in the art or as described herein.
  • a glycoprotein of the invention which is expressed by the cell but not secreted by the cell, can still be recovered from the cells, e.g., via making cell lysates and isolating the glycoprotein, and/or using methods that are known and'practiced in the art, and as further described below.
  • the glycoprotein p/oduced by the cell culture processes of this invention comprises complex carbohydrates that can be analyzed by various techniques of carbohydrate analysis. For example, techniques such as lectin blotting, well-known in the art, reveal proportions of terminal mannose, or other sugars such as galactose. Termination of mono-, bi-, tri-, or tetra-antennary oligosaccharide by sialic acids can be confirmed by release of sugars from the protein using anhydrous hydrazine or enzymatic methods and fractionation of oligosaccharides by ion-exchange chromatography, size exclusion chromatography, or other methods that are known in the- art.
  • glycosidic linkages There are two main types of glycosidic linkages found in glycoprotiens, N- and O- linked.
  • N-glycosylations are created by a covalent link of the glycan to the amide nitrogen of an asparagine residue.
  • O-glycosidic linkages are created by the covalent linkage of the hydroxyl group of serine, threonine, hydroxylysine or hydroxyproline to the glycan.
  • the carbohydrate moieties of glycoproteins are involved in numerous molecular recognition phenomena, including host-pathogen interactions, clearance from serum and targeting of different tissues.
  • carbohydrate moieties can at least affect binding between CTLA4-Ig molecules and CD80 or CD86, or between CTLA4 A29YL104E -Ig molecules and CD80 or CD86.
  • Carbohydrate structures typically occur on the expressed protein as N-linked or O- linked carbohydrates.
  • the N-linked and O-linked carbohydrates differ primarily in their core structures.
  • N-linked glycosylation refers to the attachment of the carbohydrate moiety via GIcNAc to an asparagine residue in the peptide chain.
  • the N-linked carbohydrates all contain a common Manl-6(Manl-3)Manpl-4Glc- NAc ⁇ l-4GlcNAc ⁇ -R core structure, where R in this core structure represents an asparagine residue.
  • the peptide sequence of the protein produced will contain an asparagine-X-serine, asparagine-X- threonine, and asparagine-X-cysteine, wherein X is any amino acid except proline.
  • O-linked carbohydrates are characterized by a common core structure, which contains GaINAc attached to the hydroxyl group of a threonine or serine.
  • N-linked and O-linked carbohydrates the most important are the complex N- and O-linked carbohydrates.
  • Such complex carbohydrates contain several antennary structures.
  • the mono-, bi-, tri, -", and tetra-, antennary structures are important for the addition of terminal sialic acids.
  • Such outer chain structures provide for additional sites-for the specific sugars and linkages that comprise the carbohydrates of the protein products.
  • Therapeutic glycoproteins are often produced using recombinant DNA cell culture techniques. Protein glycosylation distributions in cell culture can be affected by variations in pH, cell density, nutrient concentrations ⁇ and metabolite concentrations. The sensitivity of glycan distributions to environmental effects makes it necessary to carefully monitor the glycan distribution during product development and production in order to ensure that a reproducible product is manufactured.
  • a variety of techniques are available to evaluate carbohydrate structural distributions. These include gel-filtration, chromatographic and electrophoretic separation techniques coupled with a wide range of detection techniques. If sample amounts are limited, the glycoproteins are often derivatized with fluorescence reagents such as 2- aminobenzoic acid and 2-aminopyridine in order to improve detection. However, derivatization and purification of the derivatives can be time consuming. When sample size is not an issue, direct evaluation of carbohydrate structural distributions is possible.
  • a particular glycoprotein can display heterogeneity of carbohydrates. Heterogeneity can be seen at several levels: glycosylation sites can vary from completely occupied to unoccupied, and any specific site can be populated with many different oligosaccharide structures, wherein each structure can be modified by sialic acid molecules, such as NANA or NGNA.
  • the carbohydrate content of the protein of the present invention can be analyzed by methods known in the art, including methods described in the.Examples herein. Several methods are known in the art for glycosylation analysis and are useful in the context of the present invention. These methods provide information regarding the identity and the composition of the oligosaccharide attached to the produced peptide.
  • Methods for carbohydrate analysis useful in connection with the present invention include, but are not limited to, lectin chromatography; high performance anion-exchange chromatography combined with pulsed amperometric detection (HPAEC-PAD), which uses high pH anion exchange chromatography to separate oligosaccharides based on charge; NMR; Mass spectrometry; HPLC; porous graphitized carbon (GPC) chromatography.
  • HPAEC-PAD pulsed amperometric detection
  • HPLC porous graphitized carbon
  • Methods for releasing oligosaccharides are known. These methods include 1) enzymatic methods, which are commonly performed using peptide-N-glycosidase F/endo- ⁇ - galactosidase; 2) ⁇ -elimination methods, using a harsh alkaline environment to release mainly O-linked structures; and 3) chemical methods using anhydrous hydrazine to release both N- and O-linked oligosaccharides.
  • Methods for analysis can comprise the following steps: 1. Dialysis of the sample against deionized water to remove all buffer salts, followed by lyophilization. 2. Release of intact oligosaccharide chains with anhydrous hydrazine. 3.
  • the presence of neutral and amino sugars can be determined by using high performance anion-exchange chromatography combined with pulsed amperometric detection (HPAEC-PAD Carbohydrate System; Dionex Corp.). For instance, sugars can be released by hydrolysis in 20% (v/v) trifluoroacetic acid at 100 0 C for 6 hours. Hydrolysates are then dried by lyophilization or with a Speed-Vac (Savant Instruments). Residues are then dissolved in 1% sodium acetate trihydrate solution and analyzed on an HPLC-AS6 column (as described by Anumula et al., 1991, Anal. Biochem.. 195:269-280).
  • immunoblot carbohydrate analysis can be performed.
  • protein-bound carbohydrates are detected using a commercial glycan detection system (Boehringer), which is based on the oxidative immunoblot procedure described by Haselbeck et al. (1993, Glvcoconiugate J., 7:63).
  • the staining protocol recommended by the manufacturer is followed except that the protein is transferred to a polyvinylidene difluoride membrane instead of a nitrocellulose membrane and the blocking buffers contain 5% bovine serum albumin in 10 mM Tris buffer, pH 7.4, with 0.9% sodium chloride.
  • Detection is carried out with anti-digoxigenin antibodies linked with an alkaline phosphate conjugate (Boehringer), 1 :1000 dilution in Tris buffered saline using the phosphatase substrates, A- nitroblue tetrazolium chloride, 0.03% (w/v) and 5-bromo-4 chloro-3-indoyl-phosphate 0.03% (w/v) in 100 mM Tris buffer, pH 9.5, containing 100 mM sodium chloride and 50 mM magnesium chloride.
  • the protein bands containing carbohydrate are usually visualized in about 10 to 15 minutes.
  • Carbohydrates associated with protein can also be cleaved by digestion with peptide-N-glycosidase F. According to this procedure the residue is suspended in 14 ⁇ L of a buffer containing 0.18% SDS, 18 mM beta-mercaptoethanol, 90 mM phosphate, 3.6 mM EDTA, at pH 8.6, and heated at 100°C for 3 minutes. After cooling to room temperature, the reaction mixture is divided into two approximately equal parts. One part, which is not treated further, serves as a control. The other part is adjusted to about 1% NP -40 detergent followed by the addition of 0.2 units of peptide-N-glycosidase F (Boehringer). Both parts are warmed at 37°C for 2 hours and then analyzed by SDS-polyacrylamide gel electrophoresis.
  • the invention provides CTLA4-Ig populations characterized by particular oligosaccharide profiles. Oligosaccharide profiling is typically done by chromatographic separation of oligosaccharides followed by detection and relative quantitation. An alternative to chromatographic profiling is the direct analysis of oligosaccharides by ESI infusion after online desalting.
  • Oligosaccharide profiling by PGC can be been used to characterize the N-linked oligosaccharides from CTLA4-Ig molecules.
  • N-linked glycosylation sites per chain i.e., per monomer
  • the monomer has a sequence from SEQ ID NO:2, for example: (i) 26-383 of SEQ ID NO:2, (ii) 26-382 of SEQ ID NO:2, (iii) 27-383 of SEQ ID NO:2, (iv) 27-382 of SEQ ID NO:2, (v) 25-382 of SEQ ID NO:2, or (vi) 25-383 of SEQ ID NO:2).
  • the variations in glycosylation by site are analyzed by isolating peptide fragments containing N-linked glycans from a tryptic digest of the protein.
  • the N-linked glycosylation sites on the protein are located at Asn 102 , Asn 134 and Asn 233 , contained in tryptic fragments 5, 7, and 14, respectively.
  • Enzymatic release of N-linked oligosaccharides from the isolated peptide fragments, followed by PGC profiling of the released oligosaccharides results in the profiles shown in FIG. 13. It is clear from the profile of the glycans released from Asn 233 (Tryptic fragment 14, T14) that the oligosaccharide population is enriched in the asialo structures (structures have no sialic acids).
  • Oligosaccharide profiles from the glycans attached at Asn 102 and Asn 134 (T5 and T7) contain the bulk of the sialylated structures
  • FIGS. 14 and 15 show the TIC and UV chromatograms of a typical PGC profiles generated by acetonitrile gradients containing acidic and basic additives. In most cases, the mass spectra from a single chromatographic peak contain mass peaks for a single oligosaccharide. Thirty oligosaccharide structural classes are identified from the TFA containing elution profile. Only sixteen oligosaccharide structural classes are identified from the NH 4 OH containing elution profile.
  • each structural class there are variant structures containing substitution of N-glycolylneuraminic acid (NGNA) in place of N-acetylneuraminic acid (NANA) as well as differing degrees of sialic acid acetylation.
  • NGNA N-glycolylneuraminic acid
  • NANA N-acetylneuraminic acid
  • the major structural classes within each of the four domains are P2100, P2111, P2122, and P3133. This is consistent with the integration values obtained from the UV trace at 206 ran. Further structural verification can be obtained from the positive ion mass spectrogram.
  • Positive ion mode ionization promotes in source fragmentation of oligosaccharides, mainly at the glycosidic bonds. Because there is good separation of oligosaccharides, as determined by the negative, ion mass spectra, the fragmented spectra from the positive ion mode mimic the positive ion MS/MS spectra. Domain III (di-sialylated structures) contains a significant amount of the O-acetylated structure P2122-Ac. Positive ion m/s data .supports O-acetylation of one of the sialic acids on the structure.
  • O-acetylation site of sialic acid residues are at the C-7 and C-9 positions (Shi WX, Chammas R., Varki A., J. Biol. Chem..271 (1996) 15130-15188).
  • O-acetyl esters at C-7 spontaneously migrate to C-9.
  • the most likely O-acetlylation site is therefore C-9.
  • the analytical techniques can comprise cleavage and isolation of N-linked oligosaccharides by column chromatography, which in a non-limiting embodiment uses a Hypercarb column. Glycans subjected to Hypercarb chromatography are isolated and can be analyzed by HPAEC-PAD which analysis determines the types of carbohydrates that modify a particular glycoprotein. Analytical characterization of the N-linked oligosaccharides can also be achieved by Liquid Chromatography/Mass Spectrometry (LC/MS ) using a Porous Graphitized Carbon (PGC). Carbohydrate analysis can also include trypsin, Asp-N, and Trypsin/Chymotrypsin peptide mapping to determine the peptides, which comprise carbohydrate structures.
  • LC/MS Liquid Chromatography/Mass Spectrometry
  • PPC Porous Graphitized Carbon
  • N-linked oligosaccharide structures can be analyzed using a series of orthogonal mass spectrometry and HPAEC-PAD techniques (see Examples). These techniques include several endopeptidase cleavages followed by LC/MS/MS analysis. With respect to CTLA4-Ig monomers having a sequence from SEQ ID NO:2, the three major sites of N- linked glycosylation were characterized using LC/MS and LC/MS/MS electrospray ionization and the major structures at each N-link site were determined. These data are summarized in FIG. 9. There are at least three major attachment points for N-linked oligosaccharides at Asn 102 , Asn 134 , and Asn 233 .
  • N-linked oligosaccharide structures ofCTLA4-Ig determined by LC/MS of the glycopeptides, LC/MS of the oligosaccharides, and HPAEC-PAD: The N-linked carbohydrates are associated with a consensus sequence motif of Asn - X - Ser/Thr.
  • This sequence appears three times on CTLA4-Ig monomer chains having one of the following sequences: (i) 26-383 of SEQ ID NO:2, (ii) 26-382 of SEQ ID NO:2, (iii) 27-383 of SEQ ID NO:2, (iv>27-382 of SEQ ID NO:2, (v) 25-382 of SEQ ID NO:2, and (vi) 25-383 of SEQ ID NO:2.
  • the consensus sequence motif appears in SEQ ID NO:2 at: Asn 102 Leu 103 Thr 104 ; Asn 134 GIy 135 Thr 136 ; and Asn 233 Ser 234 Thr 235 .
  • N-linked carbohydrate sites per dimer molecule that is formed of any one or two of the following monomer sequences: (i) 26-383 of SEQ TD NO:2, (ii) 26-382 of SEQ ID NO:2, (iii) 27-383 of SEQ ID NO:2, (iv) 27-382 of SEQ ID NO:2, (v) 25-382 of SEQ ID NO:2, and (vi) 25-383 of SEQ ID NO:2.
  • N-linked carbohydrates can be of three general varieties: high-mannose, hybrid and/or complex.
  • a LC/MS technique for the glycopeptide analysis was developed. Trypsin endoproteolytic cleavage of monomers (having one of the sequences (i) 26-383 of SEQ ID NO:2, (ii) 26-382 of SEQ ID NO:2, (iii) 27-383 of SEQ ID NO:2, (iv) 27-382 of SEQ ID NO:2, (v) 25-382 of SEQ ID NO:2, and (vi) 25-383 of SEQ ID NO:2) result in three peptides that contain N-linked glycosylation. All three N-linked sites are populated with carbohydrate structures.
  • Tryptic fragment T5 corresponding to amino acids 65-109 of SEQ ID NO:2 contains a glycosylation on Asn 102 .
  • Tryptic fragment T7 corresponding to amino acids 120- 154 of SEQ ID NO:2 contains a glycosylation on Asn 134 .
  • Tryptic fragment T14 corresponding to amino acids 229-237 of SEQ ID NO:2 contains a glycosylation on Asn 233 .
  • a chromatogram (FIG. 13 panel A) for the Asn 102 (T5) carbohydrates illustrates a series of mono- and di-sialo structures at the site.
  • a chromatogram (FIG. 13 panel B) for Asn 134 (T7) illustrates two main di-sialo structures with a population of mono-sialo structures.
  • a chromatogram (FIG. 13 panel C) for Asn 233 (T14) illustrates little sialylation.
  • Asn 134 (T7 peptide) contains primarily bi- antennary structures. This site contains much less heterogeneity than the Asn 102 site. The Asn 233 (T14 peptide) site contains little sialylation.
  • HPAEC-PAD was also employed to support the two orthogonal LC/MS findings.
  • Table 1 The maior N-linked structures and selected minor complex structures observed using
  • Table 2 The area percentages for each domain observed by the HPAEC-PAD
  • Table 3 The area percentages for each domain expressed as weighted average on Table 2 data set.
  • N-linked oligosaccharide structures ofCTLA4 A29YU04E -Ig molecules determined by LC/MS of the glycopeptides, LC/MSofthe oligosaccharides, and HPAEC-PAD The N- linked carbohydrates are associated with a consensus sequence motif of Asn - X - Ser/Thr.
  • This sequence appears three times on CTLA4 ⁇ 29YL104E -Ig monomer chains having one of the following sequences: (i) 26-383 of SEQ ID NO:4, (ii) 26-382 of SEQ ID NO:4, (iii) 27-383 of SEQ ID NO:4, (iv) 27-382 of SEQ ID NO:4, (v) 25-382 of SEQ ID NO:4, and (vi) 25-383 of SEQ ID NO:4.
  • the consensus sequence motif appears in SEQ ID NO:4 at: Asn 102 Leu 103 Thr 104 ; Asn 134 GIy 135 Thr 136 ; and Asn 233 Ser 234 Thr 235 .
  • N-linked carbohydrate sites per dimer molecule that is formed of any one or two of the following monomer sequences: (i) 26-383 of SEQ ID NO:4, (ii) 26-382 of SEQ ID NO:4, (iii) 27-383 of SEQ ID NO:4, (iv) 27-382 of SEQ ID NO:4, (v) 25-382 of SEQ ID NO:4, and (vi) 25-383 of SEQ ID NO:4.
  • N-linked carbohydrates can be of three general varieties: high-mannose, hybrid and/or complex.
  • a LC/MS technique for the glycopeptide analysis was developed. Trypsin endoproteolytic cleavage of monomers (having one of the sequences (i) 26-383 of SEQ ID NO:4, (ii) 26-382 of SEQ ID NO:4, (iii) 27-383 of SEQ ID NO:4, (iv) 27-382 of SEQ ID NO:4, (v) 25-382 of SEQ ID NO:4, and (vi) 25-383 of SEQ ID NO:4) result in three peptides that contain N-linked glycosylation (See Table 25 in EXAMPLE 22). All three N-linked sites are populated with carbohydrate structures.
  • Tryptic fragment T5 corresponding to amino acids 65-109 of SEQ ID NO:4 contains a glycosylation on Asn 102 .
  • Tryptic fragment. T7 . corresponding to amino acids 120-154 of SEQ ID NO:4 contains a glycosylation on Asn 134 .
  • Tryptic fragment T14 corresponding to amino acids 229-237 of SEQ ID NO:4 contains a glycosylation on Asn 233 (See Table 25 in EXAMPLE 22).
  • the characteristics or a carbohydrate prot ⁇ le that can be analyzed and compared between glycosylated molecules, or populations or compositions comprising glycosylated molecules include peak area percent, domain area percent, valley-to-valley distance, or peak-to-peak distance.
  • LC/MS porous graphitic carbon (PGC) chromatography is a method for profiling N-linked oligosaccharides can provide several advantages over the High pH Anion Exchange Chromatography (HPAEC). Some of these advantages include: Direct profiling from digest mixtures which minimizes sample lossand degradation; direct MS interface provides a method for rapid characterization and analysis of oligosaccharides; increased resolution v through PGC chromatography permits both the inter-domain comparisons as well as more subtle intra-domain analysis.
  • HPAEC High pH Anion Exchange Chromatography
  • the LC/MS PGC method allows for rapid profiling and characterization of oligosaccharides in terms of gl yean type, and determining the extent of sialylati ⁇ n and branching on the non-reducing end of the carbohydrates. Then negative ion mode MS spectra produce data that is simple to interpret, with minimal oligosaccharide fragmentation, while positive mode ionization allows for structural class verification.
  • the method described here can be applied to whole digest mixtures of glycoproteins, as well as to previously isolated oligosaccharide samples without the need for derivatization.
  • the chromatographic mobile phases used allow for collection of peaks from the profiles and concentration to dryness, without further manipulation for more detailed characterization.
  • the method used to characterize CTLA4-Ig N-linked oligosaccharides.
  • oligosaccharides Using the LC/MS PGC method, thirty-one distinct classes of oligosaccharides can be identified on CTLA4-Ig molecules comprised of monomers having sequences from SEQ ID NO:2, e.g., SEQ ID NO: 5, 6, 7, 8, 9, or 10.
  • High pH anion exchange chromatography has been used extensively to profile oligosaccharides released from glycoproteins without the need for derivitization.
  • HPAEC High pH anion exchange chromatography
  • the high resolution of HPAEC and the fact that the separation is influenced by the type of sugar residue present, type of linkage and the size of the glycan are reasons for the widespread use of the technique.
  • the dominating factor in separation is charge, highly charged oligosaccharides eluting later than less charged glycans.
  • Chromatographic profiles are often divided into domains defined by the number of charged species, typically sialic acid residues, on the glycans (FIG. 17).
  • HPAEC-PAD profiling of oligosaccharide distributions is the variability inherent to the detection mode. Electrochemical cell aging and electrode surface fouling result in profile variability. It has also been reported that oligosaccharide structures and the degree of sialylation can cause variability among detection cells when using HPAEC with pulsed amperometric detection (HPAEC-PAD). This variability can affect quantitative and relatively quantitative results used to evaluate the effect of process changes or determine batch to batch consistency.
  • MS mass spectrometry
  • the porous graphitized carbon (PGC) chromatographic profiling method for ! enzymatically released N-linked oligosaccharides uses both ultraviolet (UV) and mass spectroscopic (MS) detection to profile and characterize N-linked oligosaccharides, either directly from enzymatic digest mixtures or from isolated oligosaccharides.
  • This method can be used to profile and characterize oligosaccharide released from CTLA4-Ig glycoproteins.
  • the LC/MS PGC method can evaluate the consistency of the oligosaccharide distributions resulting from the production process, as well as any changes in the oligosaccharide distributions resulting from process modifications.
  • N-- linked oligosaccharides of CTLA4-Ig molecules enzymatically released N-linked oligosaccharides can be readily separated by the PGC column in order of increasing sialylation and increasing size.
  • the range of structures present and the relative amounts of each class of structure are determined through a combination of MS and UV analysis (Example 3).
  • optimization of mass spectral conditions can be useful. Optimization can include a set of surface mapping experiments in order to evaluate the effects of solvent composition and MS ionization parameters on oligosaccharide detection.
  • Solvent composition parameters for evaluation comprise percentage acetonitrile (by volume) and eluent additives (trifluoroacetic acid and ammonium hydroxide).
  • MS ionization parameters evaluated for evaluation include the desolvation temperature, capillary voltage and cone voltage settings for the electrospray source.
  • the ionization parameters can play a significant role in signal response.
  • the model resulting from the surface mapping determination was used to set ionization parameters during the chromatographic determination. Higher values for both desolvation temperature and cone voltage result in greater response.
  • the capillary voltage optimum varies depending on the eluent additive, the TFA containing solvent system having a slightly higher optimal capillary voltage. The factor with the largest effect is the volume percentage of acetonitrile, higher acetonitrile content resulting in higher responses.
  • Porous graphitized carbon has been used for solid phase extraction desalting of oligosaccharides.
  • PGC has also been known as an effective chromatographic media for oligosaccharide separation under both acidic and basic elution conditions. Chromatography conditions for both acidic and basic profiling of enzymatically released oligosaccharides from CTLA4-Ig molecules having monomer sequences from SEQ ID NO:2 are developed. Each condition is compatible with both UV and MS detection. As was observed in the infusion experiments, the acidic elution conditions result in higher MS sensitivity than the basic conditions.
  • the MS response for neutral oligosaccharides eluted under acidic conditions, detected as TFA adducts, are five to nine times the intensity of the corresponding peak eluted under basic conditions.
  • the difference in signal response is less dramatic for the acidic oligosaccharides, averaging three times the signal response for monosialylated glycans and equal signal response for di-sialylated glycans.
  • the increased number of peaks in the TFA eluted chromatogram (FIGS. 14 A-B) compared to the NH 4 OH eluted chromatogram (FIG. 15A-B) is a result of separation of anomeric forms of oligosaccharides.
  • a particular profiling system consists of a Luna CIS column coupled through two dual-position six port valves to the Hypercarb 5 ⁇ M column (100 x 4.6 mm).
  • the Hypercarb column is coupled to a UV detector (Waters 2996 PDA) in series with a Q-ToF Micro (Micromass) with a standard ESI probe.
  • prepurified CTLA4-Ig samples can be profiled using the Hypercarb column alone, or digest mixtures can be profiled by direct injection of the digest mixture onto the Luna Cl 8 in series with the Hypercarb column.
  • profiles are obtained from the N-linked oligosaccharides released from 10 to 20 nmoles of protein.
  • the invention provides a population of CTLA4-Ig molecules that have a chromatogram according to any one or more of the chromatograms having representative peaks.
  • Representative oligosaccharide profile chromatograms for CTLA4-Ig molecules having monomers with sequences from SEQ ID NO:2 are shown in FIG. 13, FIGS. 14A-B, FIGS. 15A-B (PGC), FIG. 17 (HPAEC/PAD), and FIGS:18A-B.
  • the surface mapping performed on infusion samples indicates that the volume percentage of acetonitrile has a significant effect on the ionization efficiency of eluting oligosaccharides.
  • the dependence of signal intensity on acetonitrile content in- the mobile phase makes relative quantitation of oligosaccharides by MS dependent on the retention time of the eluting peak. Variations in column condition can effect elution times on PGC columns. For this reason, it would be difficult to obtain consistent relative quantitation from the ion chromatogram elution profile.
  • the UV trace at 206 nm should not be affected by the solvent composition to the same extent as the ion trace.
  • CTLA4-Ig molecules can contain O- linked carbohydrates.
  • the O-linked oligosaccharide structures can be analyzed using a series of orthogonal mass spectrometry techniques. These techniques include several endopeptidase cleavages followed by LC/MS/MS analysis.
  • CTLA4-Ig molecules formed of monomers having a sequence from SEQ ID NO: 5, 6, 7, 8, 9, or 10.
  • the two major sites of O-linked glycosylation were characterized using exact mass electrospray ionization and the major structures at each O-link site were determined.
  • FIG. 9. Data are consistent with there being three major O-linked structures: (GaINAc) i (Gal)j (NeuAc)i; (GaINAc)] (Gal)i (NeuAc) 2 ; (GalNAc)i (GlcNac)i (GaI) 2 (NeUAc) 2 . Each structure is observed in differing amounts on each site.
  • the O-linked oligosaccharides contribute a substantial amount of sialic acid to CTLA4-Ig.
  • the primary site of occurrence for O-linked oligosaccharides is Ser 165 , which is occupied in about 95% of the time.
  • the orthogonal data presented herein provides an overview of the predominant carbohydrate structures present on such CTLA4-Ig molecules and is summarized in FIG. 9.
  • the O-linked carbohydrates have, far greater.heterogeneity of structure than are present in N-linked carbohydrates.
  • orthogonal techniques were developed for use in the structural characterization of the. O-linked oligosaccharides: LC/MS intact analysis and LC/MS glycopeptide analysis.
  • Table 4 presents LC/MS/MS b' and y' ' ions for the T9 peptide with and without the O-linked ladder of (GaINAc)) (Gal)i (NeuAc)i.
  • the b' ion series are identical for all spectra until b7 where the spectrum then differs by the.O-linked carbohydrate structure listed above each series.
  • the y' ion series are identical for all spectra until y 19 where the spectrum then differs by the O-linked carbohydrate structure listed above each series.
  • Table 4 LC/MS/MS b' and v" ions for the T9 peptide.
  • the O-linked carbohydrate structures at Ser 165 represent a heterogeneous population of three major species.
  • the T9 glycopeptide is observed in the deconvoluted spectrum.
  • the spectrum illustrates three major O-linked structures.
  • the spectrum illustrates the base peptide with a sugar ladder consistent with the O-linked structure (GalNAc)i (Gal)i (NeuAc)].
  • Mass spectrometry was used to assess the relative abundance of each O-linked species.
  • the (GalNAc)i (Gal)i (NeuAc)i glycan is observed in a 10:1 ratio with the (GaINAc) i (Gal), (NeuAc) 2 glycan and in a 30:1 ratio with the (GaINAc) i (GIcNAc) j (GaI) 2 (NeUAc) 2 glycan.
  • the invention provides a population comprising CTLA4-Ig molecules that have a 10:1 ratio of (GalNAc) ⁇ (Gal)i (NeuAc) ⁇ glycan to (GaINAc) i (Gal)i (NeuAc) 2 glycan.
  • the invention provides a population comprising CTLA4-Ig molecules that have a 30:1 ratio of (GaIN Ac) i (Gal)i (NeUAc) 1 glycan to (GaINAc) 1 (GIcNAc) , (GaI) 2 (NeuAc) 2 glycan.
  • the (GaINAc) i (Gal), (NeuAc) 2 glycan is observed in a ratio of 20:1 with the (HeXNAc) 2 (GaI) 2 (NeuAc) 2 glycan.
  • the invention provides a population comprising CTLA4-Ig molecules that have a 20:1 ratio of the (GalNAc)i (Gal)i (NeuAc) 2 glycan to (HexNAc) 2 (GaI) 2 (NeuAc) 2 glycan.
  • the invention provides a population of CTLA4-Ig molecules that comprise all of the said ratios in this paragraph.
  • a negative ion electrospray spectrum confirms these three predominant structures; the relative abundance of each is shown in FIG. 9.
  • a second O-link site is observed at Ser 155 or Ser 156 .
  • This site is referred to as Ser 155/I56 .
  • the D8 peptide containing Ser l 55/156 was generated from an AspN digestion and corresponds to amino acids 150-156 of SEQ ID NO:2.
  • the peptide is separated and detected by LC/MS.
  • the spectrum (not shown herein) for the D8 O-linked glycopeptide shows a base peak of 190.2 amu that is in agreement with the theoretical mass of 790.8 amu.
  • the spectrum illustrates the peptide ion and a series of ions which are consistent with the structure, (GalNAc)i (Gal)i (NeuAc)i.
  • the peptide is predominantly non-glycosylated; the glycosylated (GaINAc) 1 (Gal)i (NeuAc)i species constitutes approximately 22% peak area.
  • GaINAc glycosylated glycosylated glycosylated
  • the O-linked oligosaccharide structures of the CTLA4-Ig single chain were characterized using a series of orthogonal mass spectrometry techniques.
  • Another assay was developed to confirm the O-linked carbohydrates and look for less prevalent structures.
  • This technique utilized trypsin and chymotrypsin co- digestion to produce a peptide confirmed by MS/MS to be THTSPPSP APELL (amino acids 159-171- of SEQ ID NO:2).
  • This peptide allowed for the identification ofone monosialylated, two di-sialylated and one tri-sialylated O-linked species.
  • a definitive structure has not been elucidated for the tri-sialylated species, however two possibilities are proposed: a peptide containing a core 2 structure with 3 sialic acids or two core 1 structures present on two different amino acid residues.
  • CTLA4-Ig dimers and' CTLA4-Ig single chain were treated with PNGase F to remove the N-linked oligosaccharides.
  • the molecule was then detected by the mass spectrometer and the corresponding ions were deconvoluted into the spectrum.
  • the predominant glycan composition is (HexNAc)2(Hex)2(NeuAc)2, while the reference is predominantly (HexNAc)l(Hex)l(NeuAc)l.
  • the glycosylation compositions are in agreement with those observed during the LC/MS peptide analysis.
  • sialic acid content Can be a signature characteristic of glycoprotein.
  • Sialic acid content of a glycoprotein of the present invention can be assessed by conventional methods. For example, sialic acid can be separately determined by a direct colorimetric method (Yao et al., 1989, Anal. Biochem., 179:332-335), using at least triplicate samples.
  • Another method of sialic acid determination involves the use of thiobarbaturic acid (TBA), as described by Warren et al., 1959, J. Biol. Chem., 234:1971 -1975.
  • TSA thiobarbaturic acid
  • Yet another method involves high performance chromatography, such as described by H. K. Ogawa et al., 1993, J. Chromatography, 612:145-149.
  • a method to determine the amount of N-Acetyl Neuraminic Acid (NANA) and N-Glycolyl Neuraminic Acid (NGNA) is through acid hydrolysis treatment of the glycoprotein of interest (for example, see Example 3).
  • NANA and NGNA are cleaved from the protein by acid hydrolysis.
  • the glycoprotein is substantially purifed by methods suitable for its purification.
  • the released NANA and NGNA are separated by HPLC on a Rezex Monosaccharide RHM column and detected by UV absorbance (206 ran).
  • NANA and NGNA are quantitated based on the response factors of concurrently run NANA and NGNA standards. The results can be reported as molar ratios (MR) of NANA and NGNA respectively, to protein.
  • MR molar ratios
  • the purpose of the acid hydrolysis method of measuring sialic acid content is to measure the amount of total sialic acid (NANA and NGNA) to protein in CTLA4-Ig or CTLA4 A29YLI04E -Ig samples (molar ratios). It is important to note, however, that these sialic acid molar ratios include both bound and free NANA and NGNA. Molar ratio results are obtained based on the peak area comparison of NANA and NGNA from hydrolyzed CTLA4- Ig or CTLA4 A29YL104E -Ig samples versus non-hydrolyzed NANA and NGNA standards. Hydrolyzed standards of NANA and NGNA can also be used.
  • molar ratios were obtained for CTLA4-Ig molecules having SEQ ID NO:2 amino acid sequences.
  • the peak of interest in chromatograms of NANA and NGNA standards appears as a single peak.
  • the resulting chromatograms show NANA as a major peak followed closely by a small shoulder peak ( ⁇ 10% of the major peak area; referred to as "degraded NANA"); the same concentration of NANA standards with-and without hydrolysis resulted in very close peak areas, including the degradant.
  • NGNA degradant el ⁇ ted between NANA and NANA degradant so that UV did not detect it.
  • NGNA content is roughly 5% of NANA content and, as a result, co-elution of the NGNA degradant causes less than 0.5% change of the NANA peak area, which is within the variability range of the NANA peak area.
  • the method cannot include the area of degraded NGNA in the NGNA result; therefore the NGNA result can be low by ⁇ 10%, also within the variability of the method.
  • NGNA is thought to be more immunogenic than NANA, there is a clinical preference for a recombinant thereapeutic that contains a low NGNA molar ratio.
  • the preponderance of sialic acid in a population of CTLA4- Ig molecules is NANA and not NGNA, wherein in this population the molar ratio of moles sialic acid per mole CTLA4-Ig molecules or dimer is from about 5 to about 18.
  • the preponderance of sialic acid in a population of CTLA4 A29YL104E -Ig molecules is NANA and not NGNA, wherein in this population the molar ratio of moles sialic acid per mole CTLA4 ⁇ 29YL104E -Ig molecules or dimer is from about 5.5 to about 8.5.
  • the invention provides for a nucleic acid encoding a CTLA4-Ig molecule, which is an expression cassette in one embodiment.
  • the invention also provides for a nucleic acid encoding a CTLA4 A29YL104E -Ig molecule.
  • the nucleic acid encoding CTLA4-Ig molecule is contained within an expression cassette.
  • the nucleic acid encoding the CTLA4-Ig molecule is contained within an expression cassette derived from a plasmid having the nucleotide sequence of SEQ ID NO: 17.
  • the nucleic .acid. encoding the CTLA4 A29YLI04E -Ig molecule is contained within an expression cassette.
  • the nucleic acid encoding the CTLA4 A2S>YL104E -Ig molecule is contained within an expression cassette derived from a plasmid deposited as ATCC Accession No. PTA-2104.
  • the nucleic acids of the invention can be a cDNA, cDNA-like, DNA or RNA nucleic acid molecule of interest in an expressible format, such as an expression cassette, which can be expressed from the natural promoter or a derivative thereof or an entirely heterologous promoter.
  • the nucleic acid of interest can encode an anti-sense RNA.
  • the nucleic acid of interest can encode a protein (for example a glycoprotein, such as CTLA4-Ig or CTLA4 A29YL104E -Ig glycoprotein), and may or may not include introns.
  • the nucleic acid encoding a peptide having CTLA4 activity can be obtained from T cell genomic DNA or from mRNA present in activated T lymphocytes.
  • the nucleic acid encoding a CTLA4 A29YL104E -Ig also can be obtained from T cell genomic DNA or from mRNA present in activated T lymphocytes.
  • the gene encoding a protein of interest for example CTLA4 or CTLA4 A29YL104E -Ig, can be cloned from either a genomic library or a cDNA according to standard protocols that one skilled in the art practices.
  • a cDNA for example encoding CTLA4 or CTLA4 A29YL104E -Ig, can be obtained by isolating total mRNA from a suitable cell line. Using methods known in the art, double stranded cDNAs can be prepared from the total mRNA and subsequently can be inserted into a suitable bacteriophage vector or plasmid. Genes can also be cloned using PCR techniques well established in the art. In one embodiment, a gene that encodes CTLA4 or CTLA4 A29YLI04E -Ig can be cloned via PCR in accordance with the nucleotide sequence information provided by this invention.
  • a DNA vector containing a CTLA4 or CTLA4 A29YL104E -Ig cDNA can act as a template in PCR reactions wherein oligonucleotide primers designed to amplify a region of interest can be used as to obtain an isolated DNA fragment encompassing that region.
  • the region of interest targeted in CTLA4 cDNA can be the extracellular domain of CTLA4, including the extracellular domain of human CTLA4.
  • the region of interest targeted in a CTLA4 A29YLI04E -Ig cDNA can be the extracellular domain of CTLA4 with amino acid changes at amino acid positions 55 and 130 of SEQ ID NO:2, (for example, see SEQ ID NO: 18) including the extracellular domain of human CTLA4 harboring the amino acid changes described above.
  • the chimeric gene fusion in one embodiment (for example a gene encoding a CTLA4-immunoglobulin (CTLA4-Ig) fusion protein or CTLA4 A29YL104E -Ig fusion protein) includes a nucleotide sequence, which encodes a signal sequence whereby upon transcription and translation of the chimeric gene, directs the newly synthesized fusion protein for secretion.
  • CTLA4 signal sequence e.g., the human CTLA4 signal sequence described in Harper, K., et al. (1991, J. Immunol. 147,1037-1044
  • a native CTLA4 signal sequence e.g., the human CTLA4 signal sequence described in Harper, K., et al. (1991, J. Immunol. 147,1037-1044
  • a heterologous signal sequence can be used to direct CTLA4-Ig or CTLA4 A29YL104E -Ig secretion (for example, the oncostatin-M signal sequence (Malik N., et al., 1989, MoI Cell Biol 9(7), 2847-2853) or an immunoglobulin signal sequence).
  • CTLA4-Ig or CTLA4 A29YL104E -Ig secretion for example, the oncostatin-M signal sequence (Malik N., et al., 1989, MoI Cell Biol 9(7), 2847-2853) or an immunoglobulin signal sequence).
  • the nucleotide sequence corresponding to the signal sequence can be inserted into the chimeric gene fusion by standard recombinant DNA techniques, such as by performing an in-frame ligation of the signal sequence at the 5 1 end of a nucleic acid sequence encoding CTLA4.
  • the deposited plasmid is also referred to as pD16 LEA29Y and pD16 L104EA29Y.
  • CTLA4 A29YL104E -Ig s are further described in U.S. Patent No. 7,094,874 and co-pending U.S. Patent Application Nos. 09/579,927, 60/287,576, and 60/214,065, and in International Patent Publication No. WO 01/923337 A2, all of which are incorporated by reference in this application in their entireties.
  • An expression vector of the invention can be used to transfect cells, either eukaryotic (for example, yeast, mammalian, or insect cells) or prokaryotic in order to produce proteins (for example, fusion proteins such as CTLA4-Ig, CTLA4 A29YLI 04 ⁇ Ig molecules, and the like) encoded by nucleotide sequences of the vector.
  • eukaryotic for example, yeast, mammalian, or insect cells
  • proteins for example, fusion proteins such as CTLA4-Ig, CTLA4 A29YLI 04 ⁇ Ig molecules, and the like
  • fusion proteins such as CTLA4-Ig, CTLA4 A29YLI 04 ⁇ Ig molecules, and the like
  • coli expression vectors are designed to add a number of amino acid residues, usually to the N-terminus of the expressed recombinant protein.
  • Said fusion vectors can serve three functions: 1) to increase the solubility of the desired recombinant protein; 2) to increase expression of the recombinant protein of interest; and 3) to aid in recombinant protein purification by acting as a ligand in affinity purification.
  • fusion expression vectors include, but are not limited to: a) pGEX (Amrad Corp., Melbourne, Australia) which fuse glutathione S-tranferase to desired protein; b) pcDNATM3.1/V5-His A B & C (Invitrogen Corp, Carlsbad, CA) which fuse 6x-His to the recombinant proteins of interest; and c) pMAL (New England Biolabs, Beverly, Mass.) which fuse maltose E binding protein to the target recombinant protein.
  • pGEX Amrad Corp., Melbourne, Australia
  • pcDNATM3.1/V5-His A B & C Invitrogen Corp, Carlsbad, CA
  • pMAL New England Biolabs, Beverly, Mass.
  • the cells suitable for culruring according to the processes and methods of the present invention can harbor introduced expression vectors (constructs), such as plasmids and the like.
  • the expression vector constructs can be introduced via transfection, lipofection, transformation, injection, electroporation, or infection.
  • the expression vectors can contain coding sequences, or portions thereof, encoding the proteins for expression and production in the culruring process.
  • Such expression vectors can include the required components for the transcription and translation of the inserted coding sequence.
  • Expression vectors containing sequences encoding the produced proteins and polypeptides, as well as the appropriate transcriptional and translational control elements, can be generated using methods well known to and practiced by those skilled in the art.
  • a selectable marker can be used in a recombinant expression vector (for example, a plasmid), wherein the vector is stably integrated into the genome of the cell, to confer resistance to the cells harboring the vector. This allows for their selection in an appropriate selection medium.
  • a number of selection systems can be used, including but not limited to, the hypoxanthine-guanine phosphoribosyltransferase (HGPRT), the Herpes Simplex Virus thymidine kinase (HSV TK), (Wigler et al., 1977, Cell, 11 :223), (Szybalska and Szybalski, 1992, Proc. Natl. Acad. Sci. USA.
  • HGPRT hypoxanthine-guanine phosphoribosyltransferase
  • HSV TK Herpes Simplex Virus thymidine kinase
  • AP-RT adenine phosphoribosyltransferase
  • marker genes which can be contained within an expression vector, can also be used as the basis of selection for anti-metabolite resistance: gpt, which confers resistance to mycophenolic acid (Mulligan and Berg, 1981, Proc. Natl. Acad. Sci. USA, 78:2072); dhfr, which confers resistance to methotrexate (Wigler et al., 1980, Proc. Natl. Acad. Sci. USA, 77:3-57; and O'Hare et al., 1981, Proc. Natl. Acad>. Sci. USA.
  • the expression levels of an expressed protein molecule can be increased via amplification of the expression vector (for a review, see Bebbington and Hentschel, "The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning", Vol. 3, Academic Press, New York, 1987).
  • An increase in the level of an inhibitor present in the culture medium of a host cell will increase the number of copies of the marker gene when a marker in the expression vector system expressing a protein of interest is amplif ⁇ able. Since the amplified region is associated with the protein-encoding gene, protein production will concomitantly increase (Crouse et al., 1983, MoI. Cell. Biol.. 3:257).
  • Vectors that harbor the nucleic acid sequences that encode for the selectable markers glutamine synthase (GS) or dihydrofolate reductase (DHFR) can be amplified in the presence of the drugs methionine sulphoximine or methotrexate, respectively.
  • An advantage of such vectors is the availability of cell lines, for example the murine myeloma cell line, NSO and the Chinese Hamster Ovary, CHO, cell line DG44, which are glutamine synthase negative and" dihydrofolate reductase negative, respectively.
  • a nucleic acid sequence encoding a soluble CTLA4 or CTLA4 A29YL1 ° -Ig fusion protein molecule can be inserted into an expression vector designed for expressing foreign sequences in a eukaryotic host.
  • the regulatory components of the vector can vary according to the eukaryotic host chosen for use.
  • Vectors used to express soluble CTLA4 or CTLA4 A29YL104E -Ig in eukaryotic host cells can include enhancer sequences for optimization of protein expression.
  • Mammalian cells such as BHK cells, VERO cells, CHO cells and the like
  • an expression vector for example, one that contains a gene encoding the CTLA4-Ig fusion protein or the CTLA4 A29YLI04E -Ig fusion protein
  • the invention encompasses expression vectors containing a nucleic acid sequence that encodes a CTLA4-Ig or CTLA4 A29YLI04E -Ig fusion protein and encompasses host cells into which such expression vectors can be introduced via methods known in the art.
  • an expression vector of the invention can include nucleotide sequences that encode a CTLA4-Ig or CTLA4 A29YLI04E -Ig fusion protein linked to at least one regulatory sequence in a manner that allows expression of the nucleotide sequence in a host cell.
  • regulatory sequences are well known and can be selected to direct the expression of a protein of interest in an appropriate host cell as described in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990).
  • Regulatory sequences can comprise the following: enhancers, promoters, polyadenylation signals, and other expression control elements. Practitioners in the art understand that designing an expression vector can depend on factors, such as the choice of host cell to be transfected and/or the type and/or amount of desired protein to be expressed.
  • Cloning and expression plasmids are constructed as described in Examples 11.
  • an isolated DNA fragment from plasmid pSV2dhfr- is ligated to the pcDNA3 vector backbone generating the expression vector pcSD.
  • Vector pcSD is comprised of the following features: a cytomegalovirus (CMV) promoter followed by a multiple cloning site (MCS); a bovine growth hormone (BGH) polyadenylation signal and transcriptional termination sequence; a mouse dhfr cDNA sequence for selection and amplification; an ampicillin resistance gene; and a pUC origin of replication for selection and maintenance in Escherichia coli.
  • CMV cytomegalovirus
  • MCS multiple cloning site
  • BGH bovine growth hormone
  • Vector piLN is constructed containing cDNAs encoding portions of the amino acid sequence corresponding to a fragment of the extracellular domain of the human CTLA4 receptor Example 11, where the cDNA encoding a first amino acid sequence is joined to DNA encoding a second amino acid sequence, which corresponds to an IgC region that permits the expression of the CTLA4 receptor gene by altering the solubility of the expressed CTLA4 protein (see FIG. 1 and brief description for FIG. 1 for residues corresponding to CTLA4 extracellular portion and IgGl constant region).
  • an oncostatin M signal peptide sequence can be fused to the amino acid sequence corresponding to the extracellular domain of CTLA4 which subsequently is fused to a second amino acid sequence corresponding to an Ig domain (for example, the human IgC ⁇ i domain) as previously- described in FIG. 1.
  • the oncostatin M signal sequence allows for soluble forms of the CTLA4 gene (for example CTLA4-Ig) protein product to be generated.
  • a pcSD expression vector containing a gene encoding the CTLA4- immunoglobulin fusion protein methods known in the art (for example, restriction site sub- cloning) can be used.
  • the starting material for one embodiment of the invention can be a digested and excised DNA fragment from the cloning vector piLN described in Example 11.
  • the excised DNA fragment from said vector contains the amino acid sequence of the oncostatin M signal sequence and CTL4Ig fusion protein wherein said DNA fragment is ligated to the digested pcSD vector.
  • the oncostatin M-CTLA4-Ig DNA fragment can be inserted between the CMV promoter and a cassette containing the BGH polyadenylation signal and transcriptional termination sequence. This would place a CTLA4- Ig gene product under the control of the CMV promoter in the plasmid designated pcSDhuCTLA4-Ig (FIG. 21; SEQ ID NO: 17).
  • Vector pD16LEA29Y (FIG. 22) comprises the following features: the neomycin resistance gene from pcDNA3 was replaced with the murine dihydrofolate reductase (DHFR) gene under control of the enhancerless (weakened) SV40 promoter; the gene encoding a CTLA4 A29YLI04E -Ig is expressed from the CMV promoter, and the poly adenylation signal is from the bovine growth hormone gene; the expression cassette for the gene of interest is flanked by transcription termination sequences, i.e., 5' to the promoter and 3' to the poly A site; the vectors contain two distinct restriction site polylinkers, one 3' to the promoter for cloning the gene of interest, and one 5' to the promoter for vector linearization prior to transfection; the vector
  • the vector is constructed containing cDNAs encoding portions of the amino acid sequence corresponding to a fragment of the extracellular domain of the human CTLA4 receptor (SEQ ID NO:2), wherein the amino acid Ala at position 55 is replaced by the amino acid Tyr and the amino acid Leu at position 130 is replaced by the amino acid GIu (FIG. 3). These amino acid changes are depicted in the CTLA4 A29YLI04E -Ig amino acid sequence having SEQ ID NO: 4.
  • the cDNA encoding a first amino acid sequence (for example, the sequence that encodes a CTLA4 A29YL104E -Ig) is joined to DNA encoding a second amino acid sequence, which corresponds to an IgC region that permits the expression of the CTLA4 A29YLI04E -Ig receptor gene by altering the solubility of the expressed CTLA4 A29YL104E - Ig protein (see FIG. 3 and the brief description for FIG. 3 for residues corresponding to the modified CTLA4 extracellular portion and IgGl constant region) having SEQ ID NO: 3.
  • an oncostatin M signal peptide sequence can be fused to the amino acid sequence corresponding to the extracellular domain of CTLA4 which subsequently is fused- to a second amino acid sequence corresponding to an Ig domain (for . example, the human IgC ⁇ ⁇ domain) as previously described in FIG. 3.
  • the oncostatin M signal sequence allows for soluble forms of the CTLA4 gene (for example a CTLA4 A29YLI04E - Ig) protein product to be generated.
  • Vectors that contain DNA encoding a protein of interest can be transformed into suitable host cells (for example bacterial cells) in order to produce large quantities of cloned DNA.
  • suitable host cells for example bacterial cells
  • suitable host cells for example bacterial cells
  • bacterial cells for transformation include the bacterial cell line E. coli strains DH5 ⁇ or MCl 061 /p3 (Invitrogen Corp., San Diego, Calif.), which can be transformed using standard procedures practiced in the art, and colonies can then be screened for the appropriate plasmid expression.
  • Expression vectors for eukaryotic cells such as mammalian cells, can include promoters and control sequences compatible with mammalian cells.
  • these regulatory elements can be, for example, a CMV promoter found in the pcSD or pD16LEA29Y vector, or the avian sarcoma virus (ASV) located in the piLN vector.
  • ASV avian sarcoma virus
  • Other commonly used early and late promoters include, but are not limited to, those from Simian Virus 40 (SV 40) (Fiers, et al., 1973, Nature 273:113), or other viral promoters such as those derived from bovine papilloma, polyoma, and Adenovirus 2 virus.
  • the regulatable promoter, hMTII (Karin, et al., 1982, Nature 299:797-802) can also be used, in addition to others known in the art.
  • baculovirus vectors available include the pVL series (Lucklow, V. A., and Summers, M. D., 1989, Virology 170:31-39) and the pAc series (Smith et al., 1983, MoI. Cell Biol. 3:2156-2165).
  • enhancer regions are also important in optimizing expression. Origins of replication can be employed, if needed, from viral sources, for example if utilizing a prokaryotic host for introduction of plasmid DNA.
  • chromosome integration is a common mechanism for DNA replication in eukaryotic organisms.
  • mammalian host cells such as CHO cells
  • desired protein for example, fusion proteins, glycoproteins, and the like
  • other eukaryotic organisms also may be used as hosts.
  • Laboratory strains of the budding yeast Saccharomyces cerevisiae also known as Baker's yeast or Brewer's yeast
  • yeast strains such as the fission yeast Schizosaccharomyces pombe.
  • Yeast vectors harboring DNA encoding a protein of interest can utilize the 2 ⁇ origin of replication of Broach, Meth. Enz. 101 :307 (1983), or other origins of replications compatible with yeast (for example, Stinchcomb et al., 1979, Nature 282:39; Tschempe et al., 1980, Gene 10:157; and Clarke et al., ' 1983, Meth. Enz. 101 :300).
  • a regulatory element contained within yeast vectors can be a promoter for the synthesis of glycolytic enzymes (Hess et al., 1968, J. Adv. Enzyme Reg. 7:149; Holland et al., 1978, Biochemistry 17:4900).
  • yeast vectors suitable for recombinant protein expression in yeast (for example, in S.
  • cerevisiae include pMFa (Kurjan and Herskowitz, (1982) Cell 30:933- 943), pJRY88 (Schultz et al., 1987, Gene 54:113-123), pYepSecl (Baldari, et al., 1987, Embo J. 6:229-234), pYES2 (Invitrogen Corporation, San Diego, Calif.), as well as those belonging to the pRS family of yeast vectors.
  • Clones for example bacterial clones,- which contain DNA encoding a protein of interest (for example, fusion constructs, glycoproteins, and the like), obtained as described above may then transfected into suitable host cells, such as mammalian cells, for expression of the desired product.
  • suitable host cells such as mammalian cells
  • Transfection techniques are carried out using standard techniques established in the art appropriate to said host cells, wherein the transfection technique depends on the host cell used.
  • mammalian cell transfection can be accomplished using lipofection, protoplast fusion, DEAE-dextran mediated transfection, CaPO 4 co-precipitation, electroporation, direct microinjection, as well as other methods known in the art which can comprise: scraping, direct uptake, osmotic or sucrose shock, lysozyme fusion or erythrocyte fusion, indirect microinjection such as via erythrocyte- mediated techniques, and/or by subjecting host cells to electric currents.
  • the above-mentioned list of transfection methods is not considered to be exhaustive.
  • cell lines stably expressing the protein of interest are used.
  • a mammalian cell line (such as a-CH ⁇ cell line) is transfected (for example by electroporation) with an expression vector (for. example, ⁇ cSDhuCTLA4-Ig, pD16LEA29Y, and the like) containing a DNA sequence encoding a glycoprotein of interest.
  • the glycoprotein of interest can be a CTLA4-Ig protein, including the CTLA ⁇ Ig protein(s) having an amino acid sequence contained in SEQ ID NO:2, encoded by a portion of the nucleotide sequence in SEQ ID NO:1.
  • the glycoprotein of interest can be a CTLA4 A29YL104E -Ig, including the CTLA4 A29YL104E -Ig having an amino acid sequence contained in SEQ ID NO:4, encoded by a portion of the nucleotide sequence in SEQ ID NO:23.
  • a recombinant protein such as CTLA4-Ig or CTLA4 A29YL104E -Ig
  • eukaryotic host cells such as mammalian cells (for example, CHO, BHK, VERO, or NSO cells), insect cells (for example, using a baculovirus vector), or yeast cells.
  • mammalian cells for example, CHO, BHK, VERO, or NSO cells
  • insect cells for example, using a baculovirus vector
  • yeast cells yeast cells.
  • suitable host cells such as those described earlier, in the context of this invention.
  • ⁇ eukaryotic, rather than prokaryotic, expression of a recombinant fusion protein, is employed.
  • eukaryotic recombinant proteins such as human CTLA4-Ig or CTLA4 A29YL104E -Ig
  • eukaryotic cells such as CHO cells
  • eukaryotic cells such as CHO cells
  • a vector harboring DNA encoding a protein of interest for example fusion constructs, glycoproteins, and the like such as CTLA4-Ig or CTLA4 A29YL104E -Ig
  • a transfection method known in the art but not integrated into the cell's genome.
  • Mammalian cells such as COS cells
  • vectors such as pCDM8 to transiently express a desired protein (Gluzman, Y., 1981, CeU 23:175-182; Seed, B., 1987, Nature 329:840).
  • a small fraction of cells can integrate DNA into their genomes and successful integration can depend on the expression vector and transfection method utilized.
  • a vector harboring DNA encoding a protein of interest for example fusion constructs, glycoproteins, and the like such as CTLA4-Ig or CTLA4 A29YL104E - Ig
  • eukaryotic cells such as mammalian cells
  • a gene that encodes a selectable marker for example, resistance to antibiotics
  • a selectable marker for example, resistance to antibiotics
  • Selectable markers used by one skilled in the art can be those that confer resistance to drugs, such as G418 and hygromycin.
  • the gene encoding a selectable marker can be introduced into a host cell on a separate plasmid or can be introduced on the same plasmid as the gene of interest.
  • Cells containing the gene of interest can be identified by drug selection wherein cells that have incorporated the selectable marker gene will survive in the presence of said drug, while cells that have not incorporated the selectable marker gene die.
  • Surviving cells can then be screened for the production of the desired protein (for example, a" CTLA4-Ig protein or CTLA4 A29YLI 04 ⁇ -Ig).
  • CHO cells deficient in expression of the dihydrofolate reductase (dhfr) gene can survive only with the addition of nucleosides.
  • dhfr dihydrofolate reductase
  • cells are then capable of producing the necessary nucleosides.
  • dhfr as the selectable marker, one skilled in the art understands that in the presence of the anti-metabolite, methotrexate, gene amplification of dhfr as well as the transfected gene of interest (for example, CTLA4-Ig or CTLA4 A29YL104E -Ig) readily occurs.
  • mammalian cells such as CHO dhfr- cells
  • an expression vector such as pcSDhuCTLA4- Ig (Examples 11-13) or pD16LEA29Y
  • a desired protein product such as CTLA4-Ig or beta p CTLA4 A29YLI04E -Ig olypeptide, respectively.
  • the dhfr- negative cell line DG44 (Invitrogen Corp. Carlsbad, CA) can be employed for stable transfection.
  • transfection can occur via electroporation.
  • transfected mammalian cells for example dhfr- negative CHO cells
  • non-selective medium containing serum for 1-2 days post-transfection.
  • Cells then are treated with trypsin and re-plated in serum-containing medium, in the presence of a selective pressure (for example, a drug such as methotrexate).
  • a selective pressure for example, a drug such as methotrexate.
  • Cells are cultured in selective serum-containing medium for 2-3 weeks, with frequent changes of selective medium in order to eliminate debris and dead cells, until distinct colonies can be visualized.
  • the method described above was carried out for transfecting dhfr- negative CHO cells (for example DG44 cells) in order to establish a stable cell line expressing a recombinant protein of interest (for example, a-CTLA4-Ig protein) (see for example, Examples 12-13).
  • a stable cell line expressing a CTLA4 A29YU04E -Ig was established (see EXAMPLE 23).
  • a stable CHO line of the invention stably expresses CTLA4-Ig protein molecules as CTLA4-Ig monomers having the sequence (i) 26-383 of SEQ ID NO:2, (ii) 26-382 of SEQ ID NO:2, (iii) 27-383 of SEQ ID NO:2, (iv) 27-382 of SEQ ID NO:2, (v) 25-382 of SEQ ID NO:2, and (vi) 25-383 of SEQ ID NO:2.
  • This cell line can secrete a population of CTLA4-Ig molecules that can exist as multimeric forms (such as dimers, tetramers, and the like), wherein the multimeric form can have different monomer sequences of SEQ ID NO:2.
  • the expression cassette integrated into this cell line comprises SEQ ID NO:1, and is contained within pcSDhuCTLA4-Ig.-
  • the invention also provides a stable CHO line, which stably expresses a CTLA4 A29YLI04E -Ig.
  • the cell line expresses CTLA4 A29YL104E -Ig monomers having the sequence (i) 26-383 of SEQ ID NO:4, (ii) 26-382 of SEQ ID NO:4, (iii) 27-383 of SEQ ID NO:4, (iv) 27-382 of SEQ ID NO:4, (v) 25-382 of SEQ ID NO:4, and (vi) 25-383 of SEQ ID NO:4.
  • the cell line can secrete a population of CTLA4 A29YL104E -Ig molecules that can exist as multimeric forms (such as dimers, tetramers, and the like), wherein the multimeric form can have different monomer sequences of SEQ ID NO:4.
  • the expression cassette integrated into this cell line comprises SEQ ID NO:3, and is contained within pD16LEA29Y.
  • Cells identified as being producers of a des ' ired protein are isolated from cell culture and subsequently amplified under production-equivalent conditions wherein culture medium can contain ' serum.
  • Subcloning methods known in the art such as, but not limited to, soft-agar cloning, can be employed.
  • the stable recombinant cell clones obtained can then be further multiplied under serum- and animal product-free conditions.
  • a stable cell clone expressing the desired protein product is achieved via obtaining a recombinant cell clone from a cell culture that is obtained after culturing a recombinant-original cell clone in serum- containing medium and re-adapting the cells to serum- and animal product- free medium.
  • the cell clones expressing CTLA4-Ig can be continued to be cultured in serum- and animal product- free medium through at least 50 generations.
  • the cell clones can be continued to be cultured as described above through at least 75 generations.
  • cell clones can also be continued to be cultured in serum- and animal product- free medium through at least 100 generations.
  • the cell clones expressing a CTLA4 A29YL104E -Ig can be continued to be cultured in serum- and animal product- free medium through at least 27 generations. In another embodiment, the cell clones can continue to be cultured as described above through at least 75 generations. Additionally, cell clones can be cultured in serum- and animal product- free medium through at least 100 generations.
  • the invention provides a cell line that produces CTLA4-Ig molecules comprising SEQ ID NO:2 monomers, wherein the cell line is stable for over 100 generations, and wherein cell line stability comprises: (1) doubling time at generation 100 is less than about 24.5 ⁇ 2.6 hours; (2) cell viability at generation 100 is greater than 95%, (3) production titer for CTLA4-Ig in 5-L bioreactors is greater than 1.69 mg/mL at generation 100; (4) sialic acid molar ratio to protein is about 9.3 to about 11.0 at generation 105..
  • the stable recombinant cell clone of this invention is present in isolated form wherein isolation can occur according to methods practiced in the art (for example, soft-agar cloning or limited dilution cloning or the like).
  • the stable recombinant cell clone is derived from a recombinant mammalian cell (for example, a CHO cell) that contains DNA sequences encoding a recombinant protein of interest (for example, fusion constructs, glycoproteins, and the like, such as CTLA4-Ig or CTLA4 A29YLI04E -Ig), which can grow in suspension or adherently.
  • a recombinant protein expressed by the cell line of this invention can be a therapeutic glycoprotein, such as CTLA4-Ig or CTLA4 A29YL104E -Ig.
  • a therapeutic glycoprotein such as CTLA4-Ig or CTLA4 A29YL104E -Ig.
  • stable recombinant cell clones derived from eukaryotic cells such as mammalian CHO cells, DG44 cells, or dhfr- negative CHO cells
  • a DNA sequence encoding a recombinant glycoprotein such as CTLA4-Ig or CTLA4 A29YLI04 ⁇ -Ig, and which are capable of stably expressing the recombinant glycoprotein over several generations is useful.
  • a population of mammalian host cells stably expressing a protein of interest is obtained under serum- and animal product-free conditions via amplifying the stably transfected cells.
  • a recombinant cell clone can then be characterized in that it is stable in serum-free and animal product- free culturing medium through at least 105 generations, for example.
  • the clonal population of cells produces CTLA4-Ig molecules.
  • Some of the specific characteristics of this population of CTLA4-Ig molecules are listed below in Table 6.
  • a population of CTLA4-Ig molecules can at least includes CTLA4-Ig dimer molecules that comprise two monomer molecules that each can' have one of the following sequences: (i) 26-383 of SEQ ID NO:2 5 (ii) 26-382 of SEQ ID NO:2, (iii) 27-383 of SEQ ID NO:2, (iv) 27-382 of SEQ ID NO:2, (v) 25-382 of SEQ ID NO:2, and (vi) 25-383 of SEQ ID NO:2.
  • the population of CTLA4-Ig molecules can include predominantly homodimers or heterodimers.
  • the population can include both homodimers and heterodimers.
  • the invention provides for a population of CTLA4-Ig molecules having the characteristics shown in Table 6 or a pharmaceutical equivalent thereof.
  • a pharmaceutical equivalent is where a population of molecules has a safety and efficacy profile equivalent to the original population (standard population) for treating a patient, as would be understood by a governmental agency, such as the FDA.
  • the CTLA4-Ig population of this invention can have the characteristics shown in Table 6.
  • the population of CTLA4-Ig molecules of the invention can have the characteristics shown in Table 6 or equivalents thereof singly or in any combination or permutaion thereof.
  • the clone of interest can also be characterized according to the recombinant product expressed and its biochemical characteristics (for example, CTLA4-Ig having a particular extinction coefficient value).
  • An extinction coefficient value also referred to as an absorptivity value (a s )
  • the absorptivity value (a s ) of CTLA4-Ig was determined to be 1.01 mL mg " cm " using the method of Mach, et al (Analytical Biochemistry, Vol. 200, pp. 74-80, 1992) as detailed below.
  • Equation 1 was used to determine the molar absorptivity ( ⁇ ).
  • Equation 1 [(Number of disulfide bonds x 134) + (Number of Tryptophan residues x 5,540) + (Number of Tyrosine residues x 1,480)]
  • CTLA4-Ig has 9 disulfide bonds, 8 tryptophan residues and 32 tyrosine residues to give a molar absorptivity ( ⁇ ) of 92,886 M “ cm " as shown in Equation 2.
  • the absorptivity constant (a s ) was calculated by dividing the molar absorptivity ( ⁇ ) by the molecular weight where the molecular weight was determined by MALDI-TOF as shown in Equation 3:
  • the invention provides a cell line that produces CTLA4-Ig molecules that have an absorptivity value or extinction coefficient of about 1.00 ⁇ 0.05 mL mg "1 cm “1 .
  • the recombinant clone of interest can also be characterized according to the number of sites a DNA sequence that encodes a protein of interest (for example, fusion constructs, glycoproteins, and the like, such as CTLA4-Ig) is integrated into the host cell genome.
  • a DNA sequence that encodes a protein of interest for example, fusion constructs, glycoproteins, and the like, such as CTLA4-Ig
  • CTLA4-Ig fusion constructs, glycoproteins, and the like, such as CTLA4-Ig
  • the invention provides CHO cell populations capable of producing CTLA4-Ig molecules, wherein each cell of the population comprises at least 30 copies of a nucleic acid that codes for a CTLA4-Ig protein, wherein the 30 or more copies are integrated in tandem at a single site in the genome of the cell, and wherein the population of cells are clonal.
  • the CHO cell populations capable of producing CTLA4-Ig molecules comprise a population wherein at least 75%, 80%, 85%, 90%, 95%, or 99% of the cells in the populations comprises at least 30 copies of a nucleic acid that codes for a CTLA4-Ig protein.
  • the invention provides a cell line that when cultured in conditions according to FIG. 10 or Example 14, produces CTLA4-Ig molecules comprised of SEQ ID NO:2 in an amount that is least 1.0, 1.3, 1.6, 1.8, 2.0, or 2.5 grams of CTLA4-Ig molecules per liter cell culture at the production stage.
  • a mammalian cell line for example a dhfr negative CHO cell line
  • a desired protein for example a CTLA4-Ig protein
  • This population of molecules can have, for example, one or more or all of the following characteristics listed in TABLE 6.
  • the percent of CTLA4-Ig dimer, percent of HMW species (for example CTLA4-Ig multimers such as a tetramer), and percent of LMW species (for example CTLA4-Ig monomer) are with respect to a population of CTLA4-Ig molecules.
  • the moles of sugars and the moles of sialic acid described in Table 6 are with respect to mole of CTLA4-Ig molecules or dimer.
  • the percent of B7 binding found in Table 6 is in reference to CTLA4-Ig binding experiments performed by surface plasmon resonance (SPR) on a BIAcore instrument described earlier wherein the percentage is a comparison to B7 binding to a CTLA4-Ig control.
  • SPR surface plasmon resonance
  • a mammalian cell line (such as, a dhfr negative CHO cell line) generates a population of CTLA4-Ig molecules displaying characteristic attributes numbers 1-5 from Table 6.
  • a mammalian cell line generates a population of CTLA4-Ig molecules having characteristic attributes numbers 1-10 from Table 6.
  • a mammalian cell line generates a population of CTLA4-Ig molecules displaying characteristic attributes numbers 1-15 from Table 6.
  • the amount of free sulfhydryl- groups on CTLA4-Ig is about ⁇ 0.20 free thiols per molecule.
  • the population of molecules can have further characteristics.
  • this population of molecules can have, for example, one or more or all of the following characteristics: a pH range from about 7.0 — 8.0; ability to inhibit human cell IL-2 activity by 50 - 150%; Monocyte Chemotactic Protein (MCP-I) present in the final purified product at ⁇ 5 ng/mg CTLA4-Ig.
  • MCP-I Monocyte Chemotactic Protein
  • CTLA4-Ig dimer or CTLA4-Ig molecules concentration of DNA present in the final purified product at ⁇ 2.5 pg/mg CTLA4-Ig dimer; CHO host cell protein present in the final purified product at ⁇ 50 ng/mg CTLA4-Ig dimer; concentration of Triton X-IOO in the final purified product at ⁇ 1.0 ppm; amount of Protein A at ⁇ 5 ng/mg CTLA4-Ig dimer; amount of bacterial endotoxins in the final purified product at ⁇ 0.3 EU/mg CTLA4-Ig dimer; amount of Bioburden in the final purified product at ⁇ 3.0 CFU/10ml.
  • Monocyte Chemotactic Protein is present in the final purified product at ⁇ 3 ng/mg CTLA4-Ig dimer or CTLA4-Ig molecules; the concentration of DNA present in the final purified product at ⁇ 1.0 pg/mg CTLA4-Ig dimer; CHO host cell protein present in the final purified product at ⁇ 10 ng/mg CTLA4-Ig dimer; amount of Protein 1 A at ⁇ lng/mg CTLA4-Ig dimer; amount of bacterial endotoxins in the final purified product at ⁇ 0.15 EU/mg CTLA4-Ig dimer; and amount of Bioburden in the final purified product at ⁇ 1.0 CFU/lOml; a pH range from about 7.2 — 7.8.
  • Monocyte Chemotactic Protein is present in the final purified product at ⁇ 1 ng/mg CTLA4-Ig dimer or CTLA4-Ig molecules.
  • CTLA4-Ig molecules inhibit human cell IL-2 activity by 60 — 140%.
  • the clonal population of cells produces CTLA4 A29YL104E -Ig molecules.
  • Some of the specific characteristics of this population of CTLA4 A29YL104E -Ig molecules are listed in Table 7.
  • a population of CTLA4 A29YL104E -Ig molecules can at least includes CTLA4 A29YLI04E -Ig dimer molecules that comprise two monomer molecules that each can have one of the following sequences: (i) 26-383 of SEQ ID NO:4, (ii) 26-382 of SEQ ID NO:4, (iii) 27-383 of SEQ ID NO:4, (iv) 27-382 of SEQ ID NO:4, (v) 25-382 of SEQ ID NO:4, and (vi) 25-383 of SEQ ID NO:4.
  • the population of CTLA4 A29YL104E -Ig molecules can include predominantly homodimers or heterodimers, or any mixture thereof.
  • the invention provides for a population of CTLA4 ⁇ 29YLI04E -Ig molecules having the characteristics shown in Table 7 or a pharmaceutical equivalent thereof.
  • a pharmaceutical equivalent is where a population of molecules has a safety and efficacy profile equivalent to the original population (standard population) for treating a patient, as would be understood by a governmental agency, such as the FDA.
  • the CTLA4 A29YU04E -Ig population of this invention can have the characteristics shown in Table 7.
  • the population of CTLA4 A29YLI04E -Ig molecules of the invention can have the characteristics shown in Table 7 or equivalents thereof singly or in any combination or permutation thereof.
  • the invention provides CHO cell populations capable of producing CTLA4 A29YL104E -Ig molecules, wherein each cell of the population comprises at least 30 copies of a nucleic acid that codes for a CTLA4 A29YL104E -Ig protein, wherein the 30 or more copies are integrated in tandem at a single site in the genome of the cell, and wherein the population of cells are clonal.
  • the CHO cell populations capable of producing CTLA4 A29YLI04E -Ig molecules comprise a population wherein at least 75%, 80%, 85%, 90%, 95%, or 99% of the cells in the populations comprises at least 30 copies of a nucleic acid that codes for a CTLA4 A29YL104E -Ig.
  • the invention provides a cell line that when cultured in conditions according to FIG. 24 or Examples 19-20, produces CTLA4 A29YLI04E -Ig molecules comprised of SEQ ID NO:4 in an amount that is least 22, 22.5, 23, 27.5, or 28 grams of CTLA4 A29Y ⁇ 104E -Ig molecules per liter cell culture at the production stage.
  • a mammalian cell line for example a dhfr negative CHO cell line
  • a desired protein for example a CTLA4 ⁇ 29YL104E -Ig
  • This population of molecules can have, for example, one or more or all of the following characteristics listed in TABLE 7.
  • the percent of CTLA4 A29YL104E -Ig dimer, percent of HMW species (for example CTLA4 9YL104E -Ig multimers such as a tetramer), and percent of LMW species (for example CTLA4 A29YL104E -Ig monomer) are with respect to a population of CTLA4 A29YLI04E -Ig molecules.
  • the moles of sugars and the moles of sialic acid described in Table 7 are with respect to mole of CTLA4 A29YU04E -Ig molecules or dimer.
  • a mammalian cell line (such as, a dhfr negative CHO cell line) generates a population of CTLA4 A29YLI04E -Ig molecules displaying characteristic attributes numbers 1-5 from Table 7.
  • a mammalian cell line generates a population of CTLA4 A29YL104E -Ig molecules having characteristic attributes numbers 1-10 from Table 7.
  • a mammalian cell line generates a population of CTLA4 A29YL104E -Ig molecules displaying characteristic attributes numbers 1-13 from Table 7.
  • the population of molecules can have further characteristics.
  • the desired protein for example a CTLA4 ⁇ 29YL104E -Ig
  • a population of transfected mammalian cells for example a dhfr negative CHO cell
  • this population of molecules can have, for example, one or more or all of the following characteristics: Monocyte Chemotactic Protein (MCP-I) present in the final purified product at ⁇ 5 ng/mg CTLA4 A29YL104E -Ig dimer; concentration of DNA present in the final purified product at ⁇ 2.5 pg/mg CTLA4 A29YL104E -Ig dimer; and CHO host cell protein present in the final purified product. at ⁇ 50 ng/mg CTL-A4- 2 - 9YL104 - E -Ig dimer. .
  • MCP-I Monocyte Chemotactic Protein
  • mammalian cells are cultured to produce a desired protein, including a glycoprotein, as conventionally known by one skilled in the art.
  • the mammalian cells expressing a glycoprotein of interest should express or be manipulated to express the appropriate enzymes such that under satisfactory conditions, post-translational modifications most pertinent to glycosylation occur in vivo.
  • the enzymes include those necessary for the addition and completion of N- and O-linked carbohydrates, such as those described in Hubbard and Ivatt, Ann. Rev. Biochem., 50:555-583(1981) for N-lmked oligosaccharides.
  • the enzymes optionally include oligosaccharyltransferase, alpha- glucosidase I, alpha-glucosidase II, ER alpha(l,2)mannosidase, Golgi alpha-mannodase I, N- acetylyglucosaminyltransferase I, Golgi alpha-mannodase II, N- acetylyglucosaminyltransferase II, alpha(l,6)fucosyltransferase, beta (l,4)galactosyltransferase, and an appropriate sialyltransferase.
  • a delay in apoptosis can have an effect of increasing cell viability during a cell culturing processes.
  • a decrease in apoptosis, and in turn, an increase in the lifetime of a particular cell can increase protein production from a cell culture.
  • Apoptotic events can be inhibited in a cell by introducing into a cell (such as a mammalian cell, an insect cell, or a yeast cell) one or more anti-apoptotic proteins, which inhibit apoptosis in cells at precise points along the apoptotic pathway.
  • Another method to inhibit apoptosis is to inhibit release of pr ⁇ -a ' poptotic molecules from the mitochondria in the cell.
  • Variants of pro- apoptotic proteins known in the art can be used as an inhibitor of apoptosis in a cell.
  • Such a variant protein can be introduced into a cell in order to delay programmed cell death. Inhibition of apoptosis of a cell, in turn, prolongs the time during which a particular cell produces protein, resulting in an overall increase in the production of a desired protein by a particular cell.
  • caspase inhibitors such as X-linked inhibitor of arxyptosis (XIAP) or variants therof
  • anti-apoptotic genes for example, Bcl-2 and Bcl-x L or variants thereof
  • mammalian cells such as, CHO cells, VERO cells, BHK cells, and the like
  • mammalian cells which produce a recombinant protein, can be transfected with a vector containing an anti-apoptotic gene (such as bcl-2).
  • recombinant mammalian cells can be transfected with a plasmid that contains a gene encoding for a caspase inhibitor, or a gene that encodes a variant of a pro-apoptotic molecule as described above, a gene that encodes a protein that is known to an individual skilled in the art to possess anti-apoptotic activity, or any combination thereof.
  • the overall product quality (for example enhanced glycosylation) of a desired recombinant protein can be enhanced.
  • mammalian cells for example CHO cells, VERO cells, BHK cells, and the like
  • nucleic acids encoding one or more enzymes that are involved in glycosylation (such as ⁇ 2,3- sialyltransferase, ⁇ l,4-galactosyltransferase, and the like) of proteins (Weikert et al., 1999, Nature Biotechnol 17:1116-21).
  • a plasmid that encodes ⁇ l,4- galactosyl transferase can be introduced into mammalian cells expressing a protein of interest.
  • a plasmid that encodes ⁇ 2,3-sialyltransferase can be introduced into mammalian cells expressing a protein of interest.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Toxicology (AREA)
  • Cell Biology (AREA)
  • Epidemiology (AREA)
  • Rheumatology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Dermatology (AREA)
  • Transplantation (AREA)
  • Pain & Pain Management (AREA)
  • Analytical Chemistry (AREA)
  • Urology & Nephrology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2006/049074 2005-12-20 2006-12-19 Compositions and methods for producing a composition Ceased WO2007076032A2 (en)

Priority Applications (24)

Application Number Priority Date Filing Date Title
EP06848052.4A EP1969007B1 (en) 2005-12-20 2006-12-19 Compositions and methods for producing a composition
US12/086,786 US10508144B2 (en) 2005-12-20 2006-12-19 Carbohydrate content of CTLA4 molecules
HK09101088.2A HK1121173B (en) 2005-12-20 2006-12-19 Compositions and methods for producing a composition
KR1020087017540A KR101398713B1 (ko) 2005-12-20 2006-12-19 조성물 및 조성물의 제조 방법
PL06848052T PL1969007T4 (pl) 2005-12-20 2006-12-19 Kompozycje i sposoby wytwarzania kompozycji
DK06848052.4T DK1969007T3 (da) 2005-12-20 2006-12-19 Sammensætninger og fremgangsmåder til fremstilling af en sammensætning
SI200631696T SI1969007T1 (sl) 2005-12-20 2006-12-19 Sestavki in postopki za izdelavo sestavka
JP2008547621A JP5096369B2 (ja) 2005-12-20 2006-12-19 組成物および組成物の製造方法
AU2006330922A AU2006330922B2 (en) 2005-12-20 2006-12-19 Compositions and methods for producing a composition
EA200801571A EA017765B1 (ru) 2005-12-20 2006-12-19 КОМПОЗИЦИЯ, СОДЕРЖАЩАЯ СИАЛИРОВАННЫЕ МОЛЕКУЛЫ CTLA4-Ig, И ЕЕ ПРИМЕНЕНИЕ
ES06848052T ES2433092T3 (es) 2005-12-20 2006-12-19 Composiciones y procedimientos de producción de una composición
CA2634760A CA2634760C (en) 2005-12-20 2006-12-19 Compositions and methods for producing a composition
KR1020117029336A KR101391457B1 (ko) 2005-12-20 2006-12-19 조성물 및 조성물의 제조 방법
HRP20130975TT HRP20130975T1 (hr) 2005-12-20 2006-12-19 Pripravci i postupci proizvodnje pripravaka
BRPI0620178-4A BRPI0620178B1 (pt) 2005-12-20 2006-12-19 Composições compreendendo moléculas de ctla4-ig
IL192098A IL192098A (en) 2005-12-20 2008-06-12 Preparations and Methods for Manufacturing Preparations
NO20082716A NO20082716L (no) 2005-12-20 2008-06-13 Sammensetninger og fremgangsmater for fremstilling av en sammensetning
ZA2008/05301A ZA200805301B (en) 2005-12-20 2008-06-18 Compositions and methods for producing a composition
AU2010241289A AU2010241289B2 (en) 2005-12-20 2010-11-08 Compositions And Methods For Producing A Composition
IL229904A IL229904A0 (en) 2005-12-20 2013-12-10 Preparations and methods for producing a compound
US16/042,977 US10941189B2 (en) 2005-12-20 2018-07-23 Carbohydrate content of CTLA4 molecules
US16/044,217 US10808021B2 (en) 2005-12-20 2018-07-24 Compositions and methods for producing a composition
US16/044,252 US10851150B2 (en) 2005-12-20 2018-07-24 Carbohydrate content of CTLA4 molecules
US17/105,358 US12030923B2 (en) 2005-12-20 2020-11-25 Compositions and methods for producing a composition

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US75226705P 2005-12-20 2005-12-20
US75215005P 2005-12-20 2005-12-20
US60/752,267 2005-12-20
US60/752,150 2005-12-20
US84954306P 2006-10-05 2006-10-05
US60/849,543 2006-10-05

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US12/086,786 A-371-Of-International US10508144B2 (en) 2005-12-20 2006-12-19 Carbohydrate content of CTLA4 molecules
US16/042,977 Division US10941189B2 (en) 2005-12-20 2018-07-23 Carbohydrate content of CTLA4 molecules

Publications (2)

Publication Number Publication Date
WO2007076032A2 true WO2007076032A2 (en) 2007-07-05
WO2007076032A3 WO2007076032A3 (en) 2008-04-03

Family

ID=38218674

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2006/049074 Ceased WO2007076032A2 (en) 2005-12-20 2006-12-19 Compositions and methods for producing a composition

Country Status (24)

Country Link
US (4) US10508144B2 (enExample)
EP (2) EP2253644B1 (enExample)
JP (2) JP5096369B2 (enExample)
KR (2) KR101391457B1 (enExample)
CN (1) CN106589132B (enExample)
AU (2) AU2006330922B2 (enExample)
BR (2) BRPI0620178B1 (enExample)
CA (2) CA2634760C (enExample)
CY (1) CY1114887T1 (enExample)
DK (2) DK1969007T3 (enExample)
EA (1) EA017765B1 (enExample)
ES (2) ES2439641T3 (enExample)
HR (1) HRP20130975T1 (enExample)
IL (2) IL192098A (enExample)
MX (1) MX336807B (enExample)
NO (1) NO20082716L (enExample)
NZ (1) NZ597215A (enExample)
PE (1) PE20080556A1 (enExample)
PL (2) PL2253644T3 (enExample)
PT (2) PT1969007E (enExample)
SI (2) SI1969007T1 (enExample)
TW (2) TWI423986B (enExample)
WO (1) WO2007076032A2 (enExample)
ZA (1) ZA200805301B (enExample)

Cited By (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7915222B2 (en) 2008-05-05 2011-03-29 Bristol-Myers Squibb Company Method of preventing the development of rheumatoid arthritis in subjects with undifferentiated arthritis
CN101995476A (zh) * 2009-08-10 2011-03-30 中国医学科学院北京协和医院 临床化学检验用液体质控血清
WO2011069056A2 (en) 2009-12-04 2011-06-09 Momenta Pharmaceuticals, Inc. Antennary fucosylation in glycoproteins from cho cells
US20110182921A1 (en) * 2007-01-30 2011-07-28 Epivax, Inc. Regulatory t cell epitopes, compositions and uses thereof
WO2011098526A1 (en) 2010-02-12 2011-08-18 Dsm Ip Assets B.V. Single unit antibody purification
US20120121574A1 (en) * 2010-11-15 2012-05-17 Luciano Polonelli Antimicrobial, antiviral, anticancer and immunomodulatory peptides and uses therefore
WO2013130604A1 (en) * 2012-02-27 2013-09-06 Biogen Idec Ma Inc. High-throughput method for sialic acid quantitation
WO2014004780A1 (en) * 2012-06-29 2014-01-03 Bristol-Myers Squibb Company Methods for reducing glycoprotein aggregation
WO2014149067A1 (en) * 2013-03-15 2014-09-25 Momenta Pharmaceuticals, Inc. Methods related to ctla4-fc fusion proteins
CN104902974A (zh) * 2012-07-06 2015-09-09 三维矩阵有限公司 肽溶液的灌装加工法
US9157078B2 (en) 2011-03-30 2015-10-13 Fujifilm Corporation Cell-adhesive protein
EP2486048B1 (en) 2009-10-06 2016-11-23 Bristol-Myers Squibb Company Methods of production of glycoproteins in mammalian cell cultures using glucocorticoids
US10464996B2 (en) 2013-05-13 2019-11-05 Momenta Pharmaceuticals, Inc. Methods for the treatment of neurodegeneration
US10508144B2 (en) 2005-12-20 2019-12-17 Bristol-Myers Squibb Company Carbohydrate content of CTLA4 molecules
US10576123B2 (en) 2008-10-06 2020-03-03 3-D Matrix, Ltd. Tissue occluding agent comprising an IEIKIEIKIEIKI peptide
US10654893B2 (en) 2014-03-10 2020-05-19 3-D Matrix, Ltd. Self-assembling peptide compositions
US10711057B2 (en) 2014-10-15 2020-07-14 Alexion Pharmaceuticals, Inc. Methods of shifting an isoelectric profile of a protein product and uses thereof
US10814038B2 (en) 2016-01-06 2020-10-27 3-D Matrix, Ltd. Combination compositions
US10851150B2 (en) 2005-12-20 2020-12-01 Bristol-Myers Squibb Company Carbohydrate content of CTLA4 molecules
WO2020251862A1 (en) * 2019-06-14 2020-12-17 Agilent Technologies, Inc. Methods and kits to improve the fluorescent signal of dmb-labeled sialic acids
WO2021019295A1 (en) * 2019-07-26 2021-02-04 Jan Remmereit Sialic acid for use in the treatment of psoriasis
US11090398B2 (en) 2014-03-10 2021-08-17 3-D Matrix, Ltd. Sterilization and filtration of peptide compositions
WO2022036275A3 (en) * 2020-08-14 2022-05-12 Bristol-Myers Squibb Company Manufacturing process for protein
WO2022036232A3 (en) * 2020-08-14 2022-06-09 Bristol-Myers Squibb Company Method of making protein
WO2022159432A1 (en) * 2021-01-20 2022-07-28 Regeneron Pharmaceuticals, Inc. Methods of improving protein titer in cell culture
WO2022208550A1 (en) * 2021-03-31 2022-10-06 Dr. Reddy's Laboratories Limited Cell culture process for fusion protein composition
US11661456B2 (en) 2013-10-16 2023-05-30 Momenta Pharmaceuticals, Inc. Sialylated glycoproteins
WO2023115027A3 (en) * 2021-12-16 2023-08-31 Bristol-Myers Squibb Company Detergent for viral inactivation
EP4269578B1 (en) 2008-03-06 2024-06-05 Halozyme, Inc. Soluble hyaluronidase composition
EP4408857A4 (en) * 2021-09-28 2025-11-05 Kashiv Biosciences Llc IMPROVED PROCESS FOR PURIFICATION OF FUSION PROTEIN
US12559542B2 (en) 2012-07-26 2026-02-24 Momenta Pharmaceuticals, Inc. Glycoproteins with anti-inflammatory properties

Families Citing this family (47)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9309316B2 (en) 2005-12-20 2016-04-12 Bristol-Myers Squibb Company Stable subcutaneous protein formulations and uses thereof
EP2545073B1 (en) 2010-03-12 2015-09-30 AbbVie Biotherapeutics Inc. Ctla4 proteins and their uses
US8679767B2 (en) * 2011-05-12 2014-03-25 Genentech, Inc. Multiple reaction monitoring LC-MS/MS method to detect therapeutic antibodies in animal samples using framework signature peptides
WO2013162951A1 (en) * 2012-04-22 2013-10-31 Perfinity Biosciences, Inc. Automated protein digestion, recovery and analysis
GB201403775D0 (en) 2014-03-04 2014-04-16 Kymab Ltd Antibodies, uses & methods
SG11201608848XA (en) 2014-04-25 2016-11-29 Bristol Myers Squibb Co Use of ctla4 compound for achieving drug-free remission in subjects with early ra
US9139653B1 (en) 2015-04-30 2015-09-22 Kymab Limited Anti-human OX40L antibodies and methods of treatment
US9512229B2 (en) * 2015-03-03 2016-12-06 Kymab Limited Synergistic combinations of OX40L antibodies for the treatment of GVHD
RS61943B1 (sr) 2015-04-17 2021-07-30 Alpine Immune Sciences Inc Imunomodulatorni proteini sa prilagodljivim afinitetima
IL256175B2 (en) 2015-06-10 2024-10-01 Univ Texas Using exosomes to treat the disease
TWI579030B (zh) * 2015-12-15 2017-04-21 Cg生物技術有限公司 分離細胞之容器、系統及方法
JP7461741B2 (ja) 2016-06-20 2024-04-04 カイマブ・リミテッド 抗pd-l1およびil-2サイトカイン
EP3491013A1 (en) 2016-07-28 2019-06-05 Alpine Immune Sciences, Inc. Cd155 variant immunomodulatory proteins and uses thereof
US11584932B2 (en) 2016-11-01 2023-02-21 The Research Foundation For The State University Of New York 5-halouracil-modified microRNAs and their use in the treatment of cancer
US11779604B2 (en) 2016-11-03 2023-10-10 Kymab Limited Antibodies, combinations comprising antibodies, biomarkers, uses and methods
US10613081B2 (en) * 2016-11-27 2020-04-07 Alireza Palangi Quality control system and kit for automated ELISA devices
WO2018229802A1 (en) * 2017-06-16 2018-12-20 Ge Healthcare Bio-Sciences Ab Method for predicting outcome of and modelling of a process in a bioreactor
CN109385401A (zh) * 2017-08-10 2019-02-26 北京泰德制药股份有限公司 一种表达重组蛋白的cho细胞的培养方法
ES2936149T3 (es) * 2017-09-21 2023-03-14 Codiak Biosciences Inc Producción de vesículas extracelulares en suspensión unicelular utilizando medios de cultivo de células químicamente definidos
WO2019074983A1 (en) 2017-10-10 2019-04-18 Alpine Immune Sciences, Inc. CTLA-4 VARIANT IMMUNOMODULATORY PROTEINS AND USES THEREOF
JP7282760B2 (ja) 2017-10-18 2023-05-29 アルパイン イミューン サイエンシズ インコーポレイテッド バリアントicosリガンド免疫調節タンパク質ならびに関連する組成物および方法
JP7432506B2 (ja) 2017-10-30 2024-02-16 武田薬品工業株式会社 脂質エンベロープウイルスを不活化するための環境適合性の界面活性剤
WO2019136179A1 (en) 2018-01-03 2019-07-11 Alpine Immune Sciences, Inc. Multi-domain immunomodulatory proteins and methods of use thereof
JP7102734B2 (ja) 2018-01-09 2022-07-20 東洋製罐グループホールディングス株式会社 細胞培養方法及び装置
HUE058711T2 (hu) 2018-04-20 2022-09-28 Janssen Biotech Inc Kromatográfiás oszlopos minõség-ellenõrzés anti-IL12/IL23 ellenanyag-készítmények elõállítására szolgáló gyártási eljárásokban
CA3106384A1 (en) * 2018-11-02 2020-05-07 Beijing Vdjbio Co., Ltd. Modified ctla4 and methods of use thereof
US11965900B2 (en) * 2018-11-09 2024-04-23 Wyatt Technology, Llc Indicating a status of an analytical instrument on a screen of the analytical instrument
CN110554107B (zh) * 2019-08-14 2022-06-10 上海应用技术大学 一种高效液相色谱-质谱联用分析食用油中甘油三酯成分的方法
CN114981659A (zh) 2019-11-21 2022-08-30 百时美施贵宝公司 无标记n-聚糖定量方法
CN111398308B (zh) * 2020-03-27 2023-01-17 上海健康医学院 一种片剂、胶囊铝塑泡罩包装质量自动检测方法及系统
JP7415771B2 (ja) 2020-04-24 2024-01-17 株式会社島津製作所 分析支援装置、分析支援方法および分析支援プログラム
JP7314859B2 (ja) 2020-04-30 2023-07-26 株式会社島津製作所 分析支援装置、分析支援方法および分析支援プログラム
AU2021262609A1 (en) 2020-05-01 2022-12-22 Kashiv Biosciences, Llc An improved process of purification of protein
WO2021226551A1 (en) 2020-05-08 2021-11-11 Alpine Immune Sciences, Inc. April and baff inhibitory immunomodulatory proteins and methods of use thereof
JP7415783B2 (ja) * 2020-05-12 2024-01-17 株式会社島津製作所 分析支援装置、分析支援方法および分析支援プログラム
CN112198302B (zh) * 2020-10-25 2022-12-16 中铁二局第一工程有限公司 一种细集料含泥量快速检测方法及测量工具
CA3113278C (en) * 2021-03-25 2025-08-12 Lumex Instruments Canada (0890278 B.C. Ltd.) Device for electrophoretic analysis of multicomponent liquid samples
CN113241192B (zh) * 2021-05-18 2023-06-20 武汉大学中南医院 一种证据合成方法和计算机设备
JP7600875B2 (ja) * 2021-06-01 2024-12-17 株式会社島津製作所 試料分析装置、試料分析方法、医薬分析装置および医薬分析方法
EP4408879A4 (en) * 2021-09-28 2025-08-27 Kashiv Biosciences Llc IMPROVED PROCESS FOR PURIFYING FUSION PROTEIN
WO2023053030A1 (en) * 2021-09-28 2023-04-06 Kashiv Biosciences, Llc An improved process for purification of protein
JP2025016812A (ja) * 2021-12-16 2025-02-05 レグセル株式会社 免疫系の異常に関連する疾患、障害または症状を処置するための医薬組成物
CA3242953A1 (en) * 2021-12-17 2025-04-29 Kashiv Biosciences, Llc IMPROVED METHOD FOR SEPARATION OF LOW MOLECULAR WEIGHT PROTEINS
JP2025509749A (ja) * 2022-03-18 2025-04-11 ブリストル-マイヤーズ スクイブ カンパニー ポリペプチドの単離方法
CN116467264B (zh) * 2023-04-14 2025-11-28 阿里健康科技(中国)有限公司 Rf2文件的生成方法、装置、设备和存储介质
US12461955B2 (en) * 2023-09-08 2025-11-04 Salesforce, Inc. Integration flow generation using large language models
CN117044627B (zh) * 2023-10-11 2023-12-15 中国科学院昆明植物研究所 一种高山植物塔黄的组培快繁及离体保存方法

Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5434131A (en) 1991-06-27 1995-07-18 Bristol Myers Squibb Co. Chimeric CTLA4 receptor and methods for its use
US5721121A (en) 1995-06-06 1998-02-24 Genentech, Inc. Mammalian cell culture process for producing a tumor necrosis factor receptor immunoglobulin chimeric protein
US5773253A (en) 1993-01-22 1998-06-30 Bristol-Myers Squibb Company MYPPPY variants of CTL A4 and uses thereof
US5844095A (en) 1991-06-27 1998-12-01 Bristol-Myers Squibb Company CTLA4 Ig fusion proteins
US5851795A (en) 1991-06-27 1998-12-22 Bristol-Myers Squibb Company Soluble CTLA4 molecules and uses thereof
US6090914A (en) 1991-06-27 2000-07-18 Bristol-Myers Squibb Company CTLA4/CD28Ig hybrid fusion proteins and uses thereof
WO2001092337A2 (en) 2000-05-26 2001-12-06 Bristol-Myers Squibb Company Soluble ctla4 mutant molecules and uses thereof
US20020039577A1 (en) 2000-06-09 2002-04-04 Townsend Robert M. Methods for regulating a lymphocyte-mediated immune response by blocking costimulatory signals and blocking LFA-1 mediated adhesion in lymphocytes
US20020182211A1 (en) 2000-05-26 2002-12-05 Peach Robert J. Soluble CTLA4 mutant molecules and uses thereof
US20030007968A1 (en) 2001-01-26 2003-01-09 Larsen Christian P. Methods of inducing organ transplant tolerance and correcting hemoglobinopathies
US6521419B1 (en) 1998-09-22 2003-02-18 Kanakaraju Koduri Expression vectors containing hot spot for increased recombinant protein expression in transfected cells
US20030083246A1 (en) 2000-07-03 2003-05-01 Robert Cohen Methods for treating rheumatic diseases using a soluble CTLA4 molecule
US20040022787A1 (en) 2000-07-03 2004-02-05 Robert Cohen Methods for treating an autoimmune disease using a soluble CTLA4 molecule and a DMARD or NSAID
US6800457B2 (en) 1998-09-22 2004-10-05 Bristol-Myers Squibb Company Expression vectors containing hot spot for increased recombinant protein expression in transfected cells
US20050019859A1 (en) 2002-12-23 2005-01-27 Schilling Bernhard M. Mammalian ceII culture processes for protein production
US20050084933A1 (en) 2002-12-23 2005-04-21 Schilling Bernhard M. Product quality enhancement in mammalian cell culture processes for protein production

Family Cites Families (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4460694A (en) * 1981-03-26 1984-07-17 University Of Miami Bovine glycoproteins and use in diagnosing infectious mononucleosis
US4929700A (en) * 1987-04-16 1990-05-29 Cetus Corporation Production of purified, biologically active, bacterially produced recombinant human CSF-1
US5856298A (en) 1989-10-13 1999-01-05 Amgen Inc. Erythropoietin isoforms
WO1993010260A1 (en) * 1991-11-21 1993-05-27 The Board Of Trustees Of The Leland Stanford Junior University Controlling degradation of glycoprotein oligosaccharides by extracellular glycosisases
US5456909A (en) 1992-08-07 1995-10-10 T Cell Sciences, Inc. Glycoform fractions of recombinant soluble complement receptor 1 (sCR1) having extended half-lives in vivo
US6084067A (en) 1993-07-26 2000-07-04 Dana-Farber Cancer Institute CTLA4/CD28 ligands and uses therefor
WO1995007703A1 (en) * 1993-09-15 1995-03-23 Alpha Therapeutic Corp. Alpha1-acid glycoprotein purification process and product
US5451660A (en) * 1993-12-13 1995-09-19 Genentech, Inc. Method for purifying polypeptides
US5429746A (en) * 1994-02-22 1995-07-04 Smith Kline Beecham Corporation Antibody purification
EP0784482A2 (en) 1994-06-07 1997-07-23 The Regents Of The University Of Minnesota Methods for inhibiting antigen specific t cell responses
US5705364A (en) * 1995-06-06 1998-01-06 Genentech, Inc. Mammalian cell culture process
US6656466B1 (en) * 1995-06-06 2003-12-02 Genetech, Inc. Human tumor necrosis factor—immunoglobulin(TNFR1-IgG1) chimera composition
CA2226575C (en) 1995-07-27 2011-10-18 Genentech, Inc. Stabile isotonic lyophilized protein formulation
NZ335207A (en) 1996-11-15 2000-09-29 Genentech Inc Process to isolate recombinant human neurotrophin using hydrophobic chromatography resin
ES2337091T3 (es) 1996-11-27 2010-04-20 Genentech, Inc. Purificacion por afinidad de polipeptido en una matriz de proteina.
ZA98533B (en) 1997-01-31 1999-07-22 Bristol Myers Squibb Co Soluble CTLA4 mutant molecules and uses thereof.
US20030124614A1 (en) 1997-08-29 2003-07-03 Brighams And Womens Hospital Inc. Novel T-cell membrane protein (TIRC7), peptides and antibodies derived therefrom and uses thereof
ATE309350T1 (de) 1997-12-03 2005-11-15 Roche Diagnostics Gmbh Verfahren zur herstellung von polypeptiden mit geeigneter glykosilierung
US6528286B1 (en) 1998-05-29 2003-03-04 Genentech, Inc. Mammalian cell culture process for producing glycoproteins
EP1084136B1 (en) 1998-06-01 2004-08-25 Genentech, Inc. Separation of antibody monomers from its multimers by use of ion-exchange chromatography
US6358703B1 (en) * 1998-12-10 2002-03-19 Bayer Corporation Expression system for factor VIII
ATE348173T1 (de) 1999-04-26 2007-01-15 Genentech Inc Zellenzuchtverfahren für glycoproteine
US6992081B2 (en) 2000-03-23 2006-01-31 Elan Pharmaceuticals, Inc. Compounds to treat Alzheimer's disease
ES2343023T3 (es) * 2000-03-27 2010-07-21 Genetics Institute, Llc Procedimientos para purificar proteinas altamente anionicas.
US6586398B1 (en) 2000-04-07 2003-07-01 Amgen, Inc. Chemically modified novel erythropoietin stimulating protein compositions and methods
AU2001272978A1 (en) 2000-06-23 2002-01-08 Maxygen, Inc. Novel co-stimulatory molecules
US7183376B2 (en) * 2000-06-23 2007-02-27 Maxygen, Inc. Variant B7 co-stimulatory molecules
US6358265B1 (en) 2000-07-18 2002-03-19 Specialized Health Products, Inc. Single-step disposable safety lancet apparatus and methods
PL204899B1 (pl) 2001-05-23 2010-02-26 Bristol Myers Squibb Co Zastosowanie rozpuszczalnej zmutowanej cząsteczki CTLA4
ATE363541T1 (de) * 2002-03-26 2007-06-15 Lek Tovarna Farmacevtskih Verfahren für die herstellung eines gewünschten profils von erythropoietin glyko-isoformen
WO2003083066A2 (en) 2002-03-27 2003-10-09 Immunex Corporation Methods for increasing polypeptide production
US20040259150A1 (en) 2002-04-09 2004-12-23 Kyowa Hakko Kogyo Co., Ltd. Method of enhancing of binding activity of antibody composition to Fcgamma receptor IIIa
AU2003243152A1 (en) 2002-04-19 2003-11-03 Bristol-Myers Squibb Company Methods for treating an autoimmune disease using a soluble ctla4 molecule and a dmard or nsaid
DK1501369T3 (en) 2002-04-26 2015-09-28 Genentech Inc Non-affinity purification of proteins
AU2002345524A1 (en) 2002-06-19 2004-01-06 Eos Eczacibasi Ozgun Kimyasal Urunler Sanyi Ve Ticaret A.S. A process for the production of substituted phenyl ethers
WO2004008100A2 (en) 2002-07-15 2004-01-22 Immunex Corporation Methods and media for controlling sialylation of proteins produced by mammalian cells
US6924124B1 (en) 2002-08-23 2005-08-02 Immunex Corporation Feeding strategies for cell culture
AU2004229335C1 (en) 2003-04-04 2010-06-17 Genentech, Inc. High concentration antibody and protein formulations
US7118222B2 (en) * 2003-05-12 2006-10-10 Seiko Epson Corporation Optical device and protector
DE602004029252D1 (de) 2003-06-13 2010-11-04 Biogen Idec Inc Aglycosyl-anti-cd154 (cd40-ligand) antikörper und deren verwendungen
NZ545314A (en) 2003-08-04 2009-03-31 Bristol Myers Squibb Co Methods for treating cardiovascular disease using a soluble CTLA4 molecule
DE602004026343D1 (de) * 2003-10-24 2010-05-12 Amgen Inc Verfahren zur aufreinigung von proteinen in einer durchflussfraktion aus der chromatographie mit hydrophoben wechselwirkungen
BRPI0417916A (pt) 2003-12-31 2007-04-10 Merck Patent Gmbh proteìna de fusão de fc-eritropoietina com farmacocinética melhorada
US7253167B2 (en) 2004-06-30 2007-08-07 Bristol-Myers Squibb Company Tricyclic-heteroaryl compounds useful as kinase inhibitors
JO3000B1 (ar) 2004-10-20 2016-09-05 Genentech Inc مركبات أجسام مضادة .
PL2253644T3 (pl) 2005-12-20 2014-04-30 Bristol Myers Squibb Co Kompozycje i sposoby wytwarzania kompozycji
AR058568A1 (es) 2005-12-20 2008-02-13 Bristol Myers Squibb Co Metodos para producir una composicion con moleculas ctla4-ig a partir de un medio de cultivo
CA2634547C (en) 2005-12-20 2016-10-11 Bristol-Myers Squibb Company Stable ctla4 formulation for subcutaneous administration
US8513393B2 (en) 2006-08-28 2013-08-20 Ares Trading S.A. Process for the purification of Fc-containing proteins
BRPI0716139A2 (pt) 2006-08-28 2013-09-17 Ares Trading Sa processo para purificaÇço de proteÍnas de fusço fc

Patent Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5434131A (en) 1991-06-27 1995-07-18 Bristol Myers Squibb Co. Chimeric CTLA4 receptor and methods for its use
US5844095A (en) 1991-06-27 1998-12-01 Bristol-Myers Squibb Company CTLA4 Ig fusion proteins
US5851795A (en) 1991-06-27 1998-12-22 Bristol-Myers Squibb Company Soluble CTLA4 molecules and uses thereof
US5885579A (en) 1991-06-27 1999-03-23 Briston-Myers Squibb Company CTLA4 receptor and uses thereof
US5885796A (en) 1991-06-27 1999-03-23 Bristol-Myers Squibb Company CTLA4 receptor and uses thereof
US6090914A (en) 1991-06-27 2000-07-18 Bristol-Myers Squibb Company CTLA4/CD28Ig hybrid fusion proteins and uses thereof
US5773253A (en) 1993-01-22 1998-06-30 Bristol-Myers Squibb Company MYPPPY variants of CTL A4 and uses thereof
US5721121A (en) 1995-06-06 1998-02-24 Genentech, Inc. Mammalian cell culture process for producing a tumor necrosis factor receptor immunoglobulin chimeric protein
US6521419B1 (en) 1998-09-22 2003-02-18 Kanakaraju Koduri Expression vectors containing hot spot for increased recombinant protein expression in transfected cells
US6800457B2 (en) 1998-09-22 2004-10-05 Bristol-Myers Squibb Company Expression vectors containing hot spot for increased recombinant protein expression in transfected cells
US20020182211A1 (en) 2000-05-26 2002-12-05 Peach Robert J. Soluble CTLA4 mutant molecules and uses thereof
WO2001092337A2 (en) 2000-05-26 2001-12-06 Bristol-Myers Squibb Company Soluble ctla4 mutant molecules and uses thereof
US7094874B2 (en) 2000-05-26 2006-08-22 Bristol-Myers Squibb Co. Soluble CTLA4 mutant molecules
US20020039577A1 (en) 2000-06-09 2002-04-04 Townsend Robert M. Methods for regulating a lymphocyte-mediated immune response by blocking costimulatory signals and blocking LFA-1 mediated adhesion in lymphocytes
US20030083246A1 (en) 2000-07-03 2003-05-01 Robert Cohen Methods for treating rheumatic diseases using a soluble CTLA4 molecule
US20040022787A1 (en) 2000-07-03 2004-02-05 Robert Cohen Methods for treating an autoimmune disease using a soluble CTLA4 molecule and a DMARD or NSAID
US20030007968A1 (en) 2001-01-26 2003-01-09 Larsen Christian P. Methods of inducing organ transplant tolerance and correcting hemoglobinopathies
US20050019859A1 (en) 2002-12-23 2005-01-27 Schilling Bernhard M. Mammalian ceII culture processes for protein production
US20050084933A1 (en) 2002-12-23 2005-04-21 Schilling Bernhard M. Product quality enhancement in mammalian cell culture processes for protein production

Non-Patent Citations (72)

* Cited by examiner, † Cited by third party
Title
ANDERSON, ANN. REV. BIOCHEM., vol. 62, 1993, pages 191 - 21
ANUMULA ET AL., ANAL. BIOCHEM., vol. 195, 1991, pages 269 - 280
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1993, JOHN WILEY & SONS
BALDARI ET AL., EMBO J., vol. 6, 1987, pages 229 - 234
BEBBINGTON; HENTSCHEL: "The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning", vol. 3, 1987, ACADEMIC PRESS
BROACH, METH. ENZ., vol. 101, 1983, pages 307
CELL, vol. 33, 1983, pages 405
CHASIN ET AL., SOM. CELL MOLEC. GENET, vol. 12, 1986, pages 555 - 556
CHEE ET AL., BIOTECHNOL. BIOENG., vol. 89, 2005, pages 164 - 177
CHURMS SC, J. CHROMATOGR. A., vol. 500, 1990, pages 555 - 583
CLARKE ET AL., METH. ENZ., vol. 101, 1983, pages 300
CLEVELAND ET AL., J. IMMUNOL. METHODS, vol. 56, 1983, pages 221 - 234
CLINICAL PHARMACY, vol. 12, pages 488 - 505
CNIZ AND PATTERSON,: "Tissue Cultures", 1973, ACADEMIC PRESS
COLBERRE-GARAPIN ET AL., J. MOL. BIOL., vol. 150, 1981, pages 1
CROUSE ET AL., MOL. CELL. BIOL., vol. 3, 1983, pages 257
DRACOPOLI ET AL.: "Current Protocols in Human Genetics", 1994, JOHN WILEY & SONS, article "Chapters 12 and 13,"
F. M. AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1989, JOHN WILEY & SONS
FIERS ET AL., NATURE, vol. 273, 1973, pages 113
FIGUEROA, B. ET AL., BIOTECHNOL BIOENG., vol. 73, 2001, pages 211 - 222
FREIREICH, E. J. ET AL.: "Quantitative Comparison of Toxicity of Anticancer Agents in Mouse, Rat, Hamster, Dog, Monkey and Man", CANCER CHEMOTHER, REP., vol. 50, no. 4, May 1966 (1966-05-01), pages 219 - 244
GLUZMAN, Y., CELL, vol. 23, 1981, pages 175 - 182
GOEDDEL: "Gene Expression Technology: Methods in Enzymology", vol. 185, 1990, ACADEMIC PRESS
GRAHAM ET AL., J. GEN. VIROL, vol. 36, 1977, pages 59
GRAHAM ET AL., J. GEN. VIROL., vol. 36, 1977, pages 59 - 72
H. K. OGAWA ET AL., J. CHROMATOGRAPHY, vol. 612, 1993, pages 145 - 149
HARPER, K. ET AL., J. IMMUNOL., vol. 147, 1991, pages 1037 - 1044
HESS ET AL., J. ADV. ENZYME REG., vol. 7, 1968, pages 149
HOLLAND, BIOCHEMISTRY, vol. 17, 1978, pages 4900
HUBBARD; IVATT, ANN. REV. BIOCHEM., vol. 50, 1981, pages 555 - 583
ITOH S. ET AL., J. CHROMATOGR. A., vol. 968, no. 1 -2, 2002, pages 89 - 100
J. SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR PRESS
KARIN ET AL., NATURE, vol. 299, 1982, pages 797 - 802
KIM, N. ET AL., J BIOTECHNOL., vol. 95, 2002, pages 237 - 248
KODURI ET AL., GENE, vol. 280, 2001, pages 87 - 95
KODURI R. ET AL., GENE, vol. 280, 2001, pages 87 - 95
KOLKEKAR ET AL., BIOCHEMISTRY, vol. 36, 1997, pages 10901 - 10909
KRIEGLER: "Gene Transfer and Expression, A Laboratory Manual", 1990, STOCKTON PRESS
KURJAN; HERSKOWITZ, CELL, vol. 30, 1982, pages 933 - 943
LOWY ET AL., CELL, vol. 22, 1980, pages 817
LUCKLOW, V. A.; SUMMERS, M. D., VIROLOGY, vol. 170, 1989, pages 31 - 39
MACH ET AL., ANALYTICAL BIOCHEMISTRY, vol. 200, 1992, pages 74 - 80
MALIK N. ET AL., MOL CELL BIOL, vol. 9, no. 7, 1989, pages 2847 - 2853
MASTRANGELO, A. ET AL., BIOTECHNOL BIOENG, vol. 67, 2000, pages 544 - 564
MATHER, ANNALS NY ACAD. SCI., vol. 383, 1982, pages 44 - 68
MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251
MAY, TIB TECH, vol. 11, no. 5, 1993, pages 155 - 215
MERWE, P. ET AL., J. EXP. MED., vol. 185, no. 3, 1997, pages 393 - 404
MULLIGAN, SCIENCE, vol. 260, 1993, pages 926 - 932
MULLIGAN; BERG, PROC. NATL. ACAD. SCI. USA, vol. 78, 1981, pages 2072
O'HARE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 78, 1981, pages 1527
R. J. PEACH ET AL., J EXP MED, vol. 180, 1994, pages 2049 - 2058
RICKWOOD, D. AND HAMES, B. D.,: "Animal Cell Culture: A Practical Approach 2nd Ed.", 1992, OXFORD UNIVERSITY PRESS
SANTERRE ET AL., GENE, vol. 30, 1984, pages 147
SAUERWALD, T. ET AL., BIOTECHNOL BIOENG., vol. 77, 2002, pages 704 - 716
SAUERWALD, T. ET AL., BIOTECHNOL BIOENG., vol. 81, 2003, pages 329 - 340
SCHULTZ ET AL., GENE, vol. 54, 1987, pages 113 - 123
SEED, B., NATURE, vol. 329, 1987, pages 840
SHI WX; CHAMMAS R.; VARKI A., J. BIOL. CHEM., vol. 271, 1996, pages 15130 - 15188
SMITH ET AL., MOL. CELL BIOL., vol. 3, 1983, pages 2156 - 2165
SOMATIC CELL AND MOLECULAR GENETICS, vol. 12, 1986, pages 555
STINCHCOMB ET AL., NATURE, vol. 282, 1979, pages 39
SZYBALSKA; SZYBALSKI, PROC. NATL. ACAD. SCI. USA, vol. 48, 1992, pages 202
TOLSTOSHEV, ANN. REV. PHARMACOL. TOXICOL., vol. 32, 1993, pages 573 - 596
TSCHEMPE ET AL., GENE, vol. 10, 1980, pages 157
URLAUB; CHASIN, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216
WARREN ET AL., J. BIOL. CHEM., vol. 234, 1959, pages 1971 - 1975
WEIKERT ET AL., NATURE BIOTECHNOL, vol. 17, 1999, pages 1116 - 21
WIGLER ET AL., CELL, vol. 11, 1977, pages 223
WIGLER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 357
WU; WU, BIOTHERAPY, vol. 3, 1991, pages 87 - 95
YAO ET AL., ANAL. BIOCHEM., vol. 179, 1989, pages 332 - 335

Cited By (71)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10808021B2 (en) 2005-12-20 2020-10-20 Bristol-Myers Squibb Company Compositions and methods for producing a composition
US10508144B2 (en) 2005-12-20 2019-12-17 Bristol-Myers Squibb Company Carbohydrate content of CTLA4 molecules
US10851150B2 (en) 2005-12-20 2020-12-01 Bristol-Myers Squibb Company Carbohydrate content of CTLA4 molecules
US10941189B2 (en) 2005-12-20 2021-03-09 Bristol-Myers Squibb Company Carbohydrate content of CTLA4 molecules
US12030923B2 (en) 2005-12-20 2024-07-09 Bristol-Myers Squibb Company Compositions and methods for producing a composition
US10925942B2 (en) 2007-01-30 2021-02-23 Epivax, Inc. Regulatory T cell epitopes, compositions and uses thereof
US11045530B2 (en) 2007-01-30 2021-06-29 Epivax, Inc. Regulatory T cell epitopes, compositions and uses thereof
US11045528B2 (en) 2007-01-30 2021-06-29 Epivax, Inc. Regulatory T cell epitopes, compositions and uses thereof
US11045532B2 (en) 2007-01-30 2021-06-29 Epivax, Inc. Regulatory T cell epitopes, compositions and uses thereof
US11045531B2 (en) 2007-01-30 2021-06-29 Epivax Inc. Regulatory T cell epitopes, compositions and uses thereof
US11045529B2 (en) 2007-01-30 2021-06-29 Epivax, Inc. Regulatory T cell epitopes, compositions and uses thereof
US10925941B2 (en) 2007-01-30 2021-02-23 Epivax, Inc. Regulatory T cell epitopes, compositions and uses thereof
US10925940B2 (en) 2007-01-30 2021-02-23 Epivax, Inc. Regulatory T cell epitopes, compositions and uses thereof
US10980867B2 (en) 2007-01-30 2021-04-20 Epivax Inc. Regulatory T cell epitopes, compositions and uses thereof
US20110182921A1 (en) * 2007-01-30 2011-07-28 Epivax, Inc. Regulatory t cell epitopes, compositions and uses thereof
US10213496B2 (en) 2007-01-30 2019-02-26 Epivax, Inc. Regulatory T cell epitopes, compositions and uses thereof
US10751397B2 (en) 2007-01-30 2020-08-25 Epivax, Inc. Regulatory T cell epitopes, compositions and uses thereof
US10925939B2 (en) 2007-01-30 2021-02-23 Epivax, Inc. Regulatory T cell epitopes, compositions and uses thereof
EP4269578B1 (en) 2008-03-06 2024-06-05 Halozyme, Inc. Soluble hyaluronidase composition
US7915222B2 (en) 2008-05-05 2011-03-29 Bristol-Myers Squibb Company Method of preventing the development of rheumatoid arthritis in subjects with undifferentiated arthritis
US9012408B2 (en) 2008-05-05 2015-04-21 Bristol-Myers Squibb Company Method of preventing the development of rheumatoid arthritis in subjects with undifferentiated arthritis
US11801281B2 (en) 2008-10-06 2023-10-31 3-D Matrix, Ltd. Tissue occluding agent comprising an ieikieikieiki peptide
US10576123B2 (en) 2008-10-06 2020-03-03 3-D Matrix, Ltd. Tissue occluding agent comprising an IEIKIEIKIEIKI peptide
US10596225B2 (en) 2008-10-06 2020-03-24 3-D Matrix, Ltd. Tissue occluding agent comprising an IEIKIEIKIEIKI peptide
CN101995476A (zh) * 2009-08-10 2011-03-30 中国医学科学院北京协和医院 临床化学检验用液体质控血清
EP2486048B1 (en) 2009-10-06 2016-11-23 Bristol-Myers Squibb Company Methods of production of glycoproteins in mammalian cell cultures using glucocorticoids
WO2011069056A2 (en) 2009-12-04 2011-06-09 Momenta Pharmaceuticals, Inc. Antennary fucosylation in glycoproteins from cho cells
CN102762585B (zh) * 2010-02-12 2016-01-20 DPx控股有限公司 单一单元抗体纯化
AU2011214361C1 (en) * 2010-02-12 2016-01-14 Dpx Holdings B.V. Single unit antibody purification
WO2011098526A1 (en) 2010-02-12 2011-08-18 Dsm Ip Assets B.V. Single unit antibody purification
CN102762585A (zh) * 2010-02-12 2012-10-31 帝斯曼知识产权资产管理有限公司 单一单元抗体纯化
AU2011214361B2 (en) * 2010-02-12 2014-12-04 Dpx Holdings B.V. Single unit antibody purification
US20120121574A1 (en) * 2010-11-15 2012-05-17 Luciano Polonelli Antimicrobial, antiviral, anticancer and immunomodulatory peptides and uses therefore
US9157078B2 (en) 2011-03-30 2015-10-13 Fujifilm Corporation Cell-adhesive protein
WO2013130604A1 (en) * 2012-02-27 2013-09-06 Biogen Idec Ma Inc. High-throughput method for sialic acid quantitation
US9926365B2 (en) 2012-06-29 2018-03-27 Bristol-Myers Squibb Company Methods for reducing glycoprotein aggregation
EP3613763A1 (en) * 2012-06-29 2020-02-26 Bristol-Myers Squibb Company Methods for reducing glycoprotein aggregation
JP2015522024A (ja) * 2012-06-29 2015-08-03 ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company 糖タンパク質の凝集を低下させるための方法
WO2014004780A1 (en) * 2012-06-29 2014-01-03 Bristol-Myers Squibb Company Methods for reducing glycoprotein aggregation
US10793307B2 (en) 2012-07-06 2020-10-06 3-D Matrix, Ltd. Fill-finish process for peptide solutions
AU2013286676B2 (en) * 2012-07-06 2016-12-15 3-D Matrix, Ltd. Fill-finish process for peptide solutions
EP2869903A4 (en) * 2012-07-06 2016-05-11 3 D Matrix Ltd FILLING PROCESS FOR PEPTIDE SOLUTIONS
EP3466964A1 (en) * 2012-07-06 2019-04-10 3-D Matrix Ltd. Fill-finish process for peptide solutions
US12006085B2 (en) 2012-07-06 2024-06-11 3-D Matrix, Ltd. Fill-finish process for peptide solutions
CN104902974A (zh) * 2012-07-06 2015-09-09 三维矩阵有限公司 肽溶液的灌装加工法
US12559542B2 (en) 2012-07-26 2026-02-24 Momenta Pharmaceuticals, Inc. Glycoproteins with anti-inflammatory properties
US10450361B2 (en) 2013-03-15 2019-10-22 Momenta Pharmaceuticals, Inc. Methods related to CTLA4-Fc fusion proteins
WO2014149067A1 (en) * 2013-03-15 2014-09-25 Momenta Pharmaceuticals, Inc. Methods related to ctla4-fc fusion proteins
US11352415B2 (en) 2013-05-13 2022-06-07 Momenta Pharmaceuticals, Inc. Methods for the treatment of neurodegeneration
US10464996B2 (en) 2013-05-13 2019-11-05 Momenta Pharmaceuticals, Inc. Methods for the treatment of neurodegeneration
US12297256B2 (en) 2013-05-13 2025-05-13 Momenta Pharmaceuticals, Inc. Methods for the treatment of neurodegeneration
US11661456B2 (en) 2013-10-16 2023-05-30 Momenta Pharmaceuticals, Inc. Sialylated glycoproteins
US10654893B2 (en) 2014-03-10 2020-05-19 3-D Matrix, Ltd. Self-assembling peptide compositions
US12115264B2 (en) 2014-03-10 2024-10-15 3-D Matrix, Ltd. Sterilization and filtration of peptide compositions
US11090398B2 (en) 2014-03-10 2021-08-17 3-D Matrix, Ltd. Sterilization and filtration of peptide compositions
US10711057B2 (en) 2014-10-15 2020-07-14 Alexion Pharmaceuticals, Inc. Methods of shifting an isoelectric profile of a protein product and uses thereof
US12018070B2 (en) 2014-10-15 2024-06-25 Alexion Pharmaceuticals, Inc. Methods of shifting an isoelectric profile of a protein product and uses thereof
US10814038B2 (en) 2016-01-06 2020-10-27 3-D Matrix, Ltd. Combination compositions
US20220242896A1 (en) * 2019-06-14 2022-08-04 Agilent Technologies, Inc. Methods and kits to improve the fluorescent signal of dmb-labeled sialic acids
US12534492B2 (en) 2019-06-14 2026-01-27 Agilent Technologies, Inc. Methods and kits to improve the fluorescent signal of DMB-labeled sialic acids
WO2020251862A1 (en) * 2019-06-14 2020-12-17 Agilent Technologies, Inc. Methods and kits to improve the fluorescent signal of dmb-labeled sialic acids
WO2021019295A1 (en) * 2019-07-26 2021-02-04 Jan Remmereit Sialic acid for use in the treatment of psoriasis
CN114450026A (zh) * 2019-07-26 2022-05-06 生命科学股份有限公司 用于治疗银屑病用途的唾液酸
WO2022036232A3 (en) * 2020-08-14 2022-06-09 Bristol-Myers Squibb Company Method of making protein
WO2022036275A3 (en) * 2020-08-14 2022-05-12 Bristol-Myers Squibb Company Manufacturing process for protein
WO2022159432A1 (en) * 2021-01-20 2022-07-28 Regeneron Pharmaceuticals, Inc. Methods of improving protein titer in cell culture
US12031151B2 (en) 2021-01-20 2024-07-09 Regeneron Pharmaceuticals, Inc. Methods of improving protein titer in cell culture
CN116761880A (zh) * 2021-01-20 2023-09-15 瑞泽恩制药公司 改进细胞培养物中的蛋白质滴度的方法
WO2022208550A1 (en) * 2021-03-31 2022-10-06 Dr. Reddy's Laboratories Limited Cell culture process for fusion protein composition
EP4408857A4 (en) * 2021-09-28 2025-11-05 Kashiv Biosciences Llc IMPROVED PROCESS FOR PURIFICATION OF FUSION PROTEIN
WO2023115027A3 (en) * 2021-12-16 2023-08-31 Bristol-Myers Squibb Company Detergent for viral inactivation

Also Published As

Publication number Publication date
CY1114887T1 (el) 2016-12-14
PL1969007T4 (pl) 2014-04-30
EP2253644A1 (en) 2010-11-24
HRP20130975T1 (hr) 2013-11-22
US12030923B2 (en) 2024-07-09
JP5097194B2 (ja) 2012-12-12
EA017765B1 (ru) 2013-03-29
IL192098A (en) 2014-01-30
DK2253644T3 (da) 2014-01-13
EA200801571A1 (ru) 2010-02-26
KR20080090428A (ko) 2008-10-08
AU2006330922B2 (en) 2012-07-26
TWI423986B (zh) 2014-01-21
KR101398713B1 (ko) 2014-06-12
BRPI0620178A2 (pt) 2010-06-29
CA2634760C (en) 2014-09-09
AU2006330922A1 (en) 2007-07-05
BRPI0622251A2 (pt) 2011-07-19
PL2253644T3 (pl) 2014-04-30
MX336807B (es) 2016-02-02
KR101391457B1 (ko) 2014-05-19
BRPI0620178B1 (pt) 2022-08-23
NO20082716L (no) 2008-09-19
EP1969007B1 (en) 2013-08-28
IL192098A0 (en) 2008-12-29
EP2253644B1 (en) 2013-10-16
DK1969007T3 (da) 2013-11-25
TWI398520B (zh) 2013-06-11
AU2010241289A1 (en) 2010-12-02
US20210246188A1 (en) 2021-08-12
CA2836123C (en) 2017-09-12
SI2253644T1 (sl) 2014-03-31
PL1969007T3 (pl) 2014-01-31
PT1969007E (pt) 2013-12-10
PT2253644E (pt) 2014-01-23
CA2634760A1 (en) 2007-07-05
US20190092835A1 (en) 2019-03-28
TW200745334A (en) 2007-12-16
AU2010241289B2 (en) 2012-09-13
ES2439641T3 (es) 2014-01-24
JP2010116402A (ja) 2010-05-27
CA2836123A1 (en) 2007-07-05
US10808021B2 (en) 2020-10-20
US10508144B2 (en) 2019-12-17
NZ597215A (en) 2012-11-30
SI1969007T1 (sl) 2014-03-31
EP1969007A2 (en) 2008-09-17
US20190062399A1 (en) 2019-02-28
IL229904A0 (en) 2014-01-30
US10941189B2 (en) 2021-03-09
CN106589132A (zh) 2017-04-26
KR20120010275A (ko) 2012-02-02
JP2009520503A (ja) 2009-05-28
US20090252749A1 (en) 2009-10-08
TW201313742A (zh) 2013-04-01
ES2433092T3 (es) 2013-12-09
PE20080556A1 (es) 2008-06-13
CN106589132B (zh) 2022-03-29
ZA200805301B (en) 2012-11-28
JP5096369B2 (ja) 2012-12-12
HK1121173A1 (en) 2009-04-17
WO2007076032A3 (en) 2008-04-03

Similar Documents

Publication Publication Date Title
US12030923B2 (en) Compositions and methods for producing a composition
US10851150B2 (en) Carbohydrate content of CTLA4 molecules
US20130259861A1 (en) Treatment of autoimmune disorders
CN101448852A (zh) 组合物和用于生产组合物的方法
HK1121173B (en) Compositions and methods for producing a composition
US20230417762A1 (en) Sialylated glycoproteins
HK1178549A (en) Control of protein glycosylation and compositions and methods relating thereto
HK1129684A (en) Glycosylated antibodies

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200680053116.5

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application
DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
WWE Wipo information: entry into national phase

Ref document number: 12008501349

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 5159/DELNP/2008

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2634760

Country of ref document: CA

Ref document number: MX/a/2008/008130

Country of ref document: MX

Ref document number: 2008547621

Country of ref document: JP

Ref document number: 08063977

Country of ref document: CO

Ref document number: 08063977A

Country of ref document: CO

Ref document number: 2006848052

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2006330922

Country of ref document: AU

Ref document number: 569872

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 10822

Country of ref document: GE

Ref document number: 1020087017540

Country of ref document: KR

Ref document number: 200801571

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 2006330922

Country of ref document: AU

Date of ref document: 20061219

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 12086786

Country of ref document: US

ENP Entry into the national phase

Ref document number: PI0620178

Country of ref document: BR

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 1020117029336

Country of ref document: KR