WO2007063308A2 - Noncompetitive domain antibody formats that bind interleukin 1 receptor type 1 - Google Patents

Noncompetitive domain antibody formats that bind interleukin 1 receptor type 1 Download PDF

Info

Publication number
WO2007063308A2
WO2007063308A2 PCT/GB2006/004471 GB2006004471W WO2007063308A2 WO 2007063308 A2 WO2007063308 A2 WO 2007063308A2 GB 2006004471 W GB2006004471 W GB 2006004471W WO 2007063308 A2 WO2007063308 A2 WO 2007063308A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
dom4
tar2h
dom7r
dab
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2006/004471
Other languages
English (en)
French (fr)
Other versions
WO2007063308A3 (en
Inventor
Philip D. Drew
Rudolf M.T. De Wildt
Ian M. Tomlinson
Amrik Basran
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Domantis Ltd
Original Assignee
Domantis Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA002632866A priority Critical patent/CA2632866A1/en
Priority to JP2008542829A priority patent/JP2009519011A/ja
Priority to AU2006321364A priority patent/AU2006321364B2/en
Priority to EA200801170A priority patent/EA200801170A1/ru
Priority to BRPI0619225A priority patent/BRPI0619225A2/pt
Priority to EP06820376A priority patent/EP1957536A2/en
Application filed by Domantis Ltd filed Critical Domantis Ltd
Priority to US12/085,920 priority patent/US20090155283A1/en
Publication of WO2007063308A2 publication Critical patent/WO2007063308A2/en
Publication of WO2007063308A3 publication Critical patent/WO2007063308A3/en
Priority to NO20082215A priority patent/NO20082215L/no
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®

Definitions

  • Interleukin 1 is an important mediator of the immune response that has biological effects on several types of cells. Interleukin 1 binds to two receptors Interleukin 1 Receptor type 1 (IL-IRl, CD121a, p80), which transduces signal into cells upon binding IL-I, and Interleukin 1 Receptor type 2 (IL-IRl, CDwI 2 Ib), which does not transduce signals upon binding IL-I and acts as an endogenous regulator of IL-I.
  • Another endogenous protein that regulates the interaction of IL-I with IL-IRl is Interleukin 1 receptor antagonist (IL-lra). IL-lra binds IL-IRl, but does not activate IL- 1 R 1 to transduce signals .
  • IL-IRl Signals transduced through IL-IRl upon binding IL-I (e.g., IL-l ⁇ or IL-I ⁇ ) induce a wide spectrum of biological activities that can be pathogenic. For example, signals transduced through IL-IRl upon binding of IL-I can lead to local or systemic inflammation, the elaboration of additional inflammatory mediators (e.g., IL-6, 11-8, TNF), fever, activate immune cells (e.g., lymphocytes, neutrophils), anorexia, hypotension, leucopenia, and thrombocytopenia.
  • additional inflammatory mediators e.g., IL-6, 11-8, TNF
  • immune cells e.g., lymphocytes, neutrophils
  • hypotension e.g., leucopenia, and thrombocytopenia.
  • IL-IRl Signals transduced through IL-IRl upon binding of IL-I also have effects on non-immune cells, such as stimulating chondrocytes to release collagenase and other enzymes that degrade cartilage, and stimulating the differentiation of osteoclast progenitor cells into mature osteoclasts which leads to resorption of bone.
  • non-immune cells such as stimulating chondrocytes to release collagenase and other enzymes that degrade cartilage, and stimulating the differentiation of osteoclast progenitor cells into mature osteoclasts which leads to resorption of bone.
  • IL-IRl Interleukin 1 Receptor Type 1
  • Amgen anti-IL-lRl antibody AMG 108
  • the invention relates to domain antibody (dAb) monomers that bind IL-IRl and inhibit binding of IL-I (e.g., IL- l ⁇ and/or IL- l ⁇ ) to the receptor but do not inhibit binding of IL-lra to IL-IRl, and to ligands comprising such dAb monomers.
  • dAb domain antibody
  • Such ligands and dAb monomers are useful as therapeutic agents for treating inflammation, disease or other conditions mediated in whole or in part by biological functions induced by binding of IL-I to IL-IRl (e.g., local or systemic inflammation, elaboration of inflammatory mediators (e.g., IL-6, 11-8, TNF), fever, activation of immune cells (e.g., lymphocytes, neutrophils), anorexia, hypotension, leucopenia, thrombocytopenia.)
  • the ligands or dAb monomers of the invention can bind IL-IRl and inhibit IL-IRl function without interfering with endogenous IL-IRl inhibitory pathways, such as binding of endogenous IL-lra to endogenous IL-IRl.
  • a ligand or dAb monomer can be administered to a subject to complement the endogenous regulatory pathways that inhibit the activity of IL-IRl or IL-I in vivo.
  • ligands or dAb monomers that bind IL-IRl and do not inhibit binding of IL-lra to IL-IRl provide advantages for use as diagnostic agents, because they can be used to bind and detect, quantify or measure IL- IRl in a sample and will not compete with IL-lra in the sample for binding to IL-IRl . Accordingly, an accurate determination of whether or how much IL-IRl is in the sample can be made.
  • dAb monomers that bind IL-IRl and inhibit binding of IL-I e.g., IL-l ⁇ and/or
  • IL- 1 ⁇ to the receptor but do not inhibit binding of IL-lra to IL-IRl also are useful as research tools.
  • a dAb monomer can be used to identify agents (e.g., other dAbs, small organic molecules) that bind IL-IRl and but do not inhibit binding of IL-lra to IL-IRl.
  • agents e.g., other dAbs, small organic molecules
  • an agent or collection of agents to be tested for the ability to inhibit binding of IL-I to IL-IRl are assayed in a competitive IL- IRl receptor binding assay, such as the receptor binding assay described herein.
  • Agents that inhibit binding of IL-I to IL-IRl in such an assay can then be studied in a similar competitive IL-IRl receptor binding assay to see if they compete with a dAb monomer that binds IL-IRl but does not inhibit binding of IL-lra to IL-IRl .
  • Competitive binding in such an assay indicates that the agent binds IL-IRl and inhibits binding of IL-I to the receptor but does not inhibit binding of IL-lra to the receptor.
  • the invention relates to a dAb monomer that has binding specificity for Interleukin-1 Receptor Type 1 (IL-IRl) and inhibits binding of Interleukin-1 (IL-I, e.g., Interleukin-1 ⁇ (IL- l ⁇ ) and/or Interleukin-1 ⁇ (IL-Ip)) to the receptor but does not inhibit binding of Interleukin-1 Receptor Antagonist (IL-lra) to IL-IRl.
  • IL-I Interleukin-1 Receptor Type 1
  • the dAb monomer inhibits binding of IL-I to IL-IRl with an IC50 that is ⁇ 1 ⁇ M.
  • the dAb monomer inhibits IL-I -induced release of Interleukin-8 by MRC-5 cells (ATCC Accession No. CCL-171) in an in vitro assay with a ND50 that is ⁇ 1 ⁇ M, or preferably ⁇ 1 nM. In other embodiments, the dAb monomer inhibits IL-I -induced release of Interleukin-6 in a whole blood assay with a ND50 that is ⁇ 1 ⁇ M. In other embodiments, the dAb monomer inhibits IL-I -induced release of Interleukin-6 in a whole blood assay with a ND50 that is ⁇ 1 ⁇ M.
  • One or more of the framework regions (FR) in the dAb monomer can comprise (a) the amino acid sequence of a human framework region, (b) at least 8 contiguous amino acids of the amino acid sequence of a human framework region, or (c) an amino acid sequence encoded by a human germline antibody gene segment, wherein said framework regions are as defined by Kabat.
  • the amino acid sequences of one or more framework regions in the dAb monomer can be the same as the amino acid sequence of a corresponding framework region encoded by a human germline antibody gene segment, or the amino acid sequences of one or more of said framework regions collectively comprise up to 5 amino acid differences relative to the corresponding framework regions encoded by a human germline antibody gene segment.
  • the amino acid sequences of FRl, FR2, FR3 and FR4 in the dAb monomer can be the same as the amino acid sequences of corresponding framework regions encoded by a human germline antibody gene segment, or the amino acid sequences of FRl , FR2, FR3 and FR4 collectively contain up to 10 amino acid differences relative to the corresponding framework regions encoded by a human germline antibody gene segment.
  • the dAb monomer can comprise FRl , FR2 and FR3 regions, and the amino acid sequence of said FRl , FR2 and FR3 can be the same as the amino acid sequences of corresponding framework regions encoded by a human germline antibody gene segment.
  • the human germline antibody gene segment is DPK9 and JKl
  • the dAb monomer competes for binding to IL-IRl with a dAb selected from the group consisting of DOM4- 122-23 (SEQ ID NO:1), DOM4-122- 24 (SEQ ID NO:2), DOM4-122 (SEQ ID NO:95), DOM4-122-1 (SEQ ID NO:96), DOM4-122-2 (SEQ ID NO.97), DOM4-122-3 (SEQ ID NO:98), DOM4-122-4 (SEQ ID NO:99), DOM4-122-5 (SEQ ID NO:100), DOM4-122-6 (SEQ ID NO:101), DOM4-122- 7 (SEQ ID NO:102), DOM4-122-8 (SEQ ID NO:103), DOM4-122-9 (SEQ ID NO:104), DOM4-122-10 (SEQ ID NO:105), DOM4-122-11 (SEQ ID NO.106), DOM4-122-12 (
  • the dAb monomer competes for binding to IL-IRl with a dAb selected from the group consisting of DOM4- 122-23 (SEQ ID NO:1), DOM4- 122-24 (SEQ ID NO:2), DOM4-122 (SEQ ID NO:95), DOM4-122-1 (SEQ ID NO:96), DOM4- 122-2 (SEQ ID NO:97), DOM4-122-3 (SEQ ID NO:98), DOM4-122-4 (SEQ ID NO:1), DOM4- 122-23 (SEQ ID NO:1), DOM4- 122-24 (SEQ ID NO:2), DOM4-122 (SEQ ID NO:95), DOM4-122-1 (SEQ ID NO:96), DOM4- 122-2 (SEQ ID NO:97), DOM4-122-3 (SEQ ID NO:98), DOM4-122-4 (SEQ ID NO:1), DOM4- 122-24 (SEQ ID NO:2), DOM4-122 (SEQ ID NO:95),
  • the dAb monomer comprises an amino acid sequence that has at least about 90% amino acid sequence identity with an amino acid sequence selected from the group consisting of DOM4-122-23 (SEQ ID NO:1), DOM4-122-24 (SEQ ID NO:2), DOM4-122 (SEQ ID NO:95), DOM4-122-1 (SEQ ID NO:96), DOM4- 122-2 (SEQ ID NO:97), DOM4-122-3 (SEQ ID NO:98), DOM4-122-4 (SEQ ID NO:1), DOM4-122-24 (SEQ ID NO:2), DOM4-122 (SEQ ID NO:95), DOM4-122-1 (SEQ ID NO:96), DOM4- 122-2 (SEQ ID NO:97), DOM4-122-3 (SEQ ID NO:98), DOM4-122-4 (SEQ ID NO:1), DOM4-122-23 (SEQ ID NO:2), DOM4-122 (SEQ ID NO:95), DOM4-122-1 (SEQ ID NO:96), DOM4- 12
  • the dAb monomer comprises an amino acid sequence that has at least about 90% amino acid sequence identity with an amino acid sequence selected from the group consisting of DOM4-122-23 (SEQ ID NO:1), DOM4-122-24 (SEQ ID NO:2), DOM4-122 (SEQ ID NO:95), DOM4-122-1 (SEQ ID NO:96), DOM4-122-2 (SEQ ID NO:97), DOM4-122-3 (SEQ ID NO:98), DOM4-122-4 (SEQ ID NO:99), DOM4-122-5 (SEQ ID NO: 100), DOM4-122-6 (SEQ ID NO.101), DOM4-122-7 (SEQ ID NO:102), DOM4-122-8 (SEQ ID NO:103), DOM4-122-9 (SEQ ID NO: 104), DOM4-122-10 (SEQ ID NO: 105), DOM4-122-11 (SEQ ID NO: 106), DOM4-122-12 (SEQ ID NO: 107), DOM4-122-13 (SEQ ID NO
  • the dAb monomer binds human IL-IRl with an affinity (KD) of about 300 nM to about 5 pM, as determined by surface plasmon resonance.
  • the invention in another aspect, relates to a ligand comprising a dAb monomer that has binding specificity for Interleukin-1 Receptor Type 1 (IL-IRl) and inhibits binding of Interleukin-1 (IL-I, e.g., Interleukin-1 ⁇ (IL- l ⁇ ) and/or Interleukin-1 ⁇ (IL- 1 ⁇ )) to the receptor but does not inhibit binding of Interleukin-1 Receptor Antagonist (IL- Ira) to IL-IRl, and a half-life extending moiety.
  • IL-IRl Interleukin-1 Receptor Type 1
  • IL-I Interleukin-1 Receptor Type 1
  • IL-I Interleukin-1 Receptor Antagonist
  • the half-life extending moiety can be a polyalkylene glycol moiety, serum albumin or a fragment thereof, transferrin receptor or a transfe ⁇ n-binding portion thereof, or an antibody or antibody fragment comprising a binding site for a polypeptide that enhances half-life in vivo.
  • the half-life extending moiety is an antibody or antibody fragment comprising a binding site for serum albumin or neonatal Fc receptor.
  • the half-life extending moiety is an immunoglobulin single variable domain that competes with an anti-serum albumin dAb disclosed herein for binding to human serum albumin.
  • the half-life extending moiety is an immunoglobulin single variable domain that comprises an amino acid sequence that has at least 90% amino acid sequence identity with the amino acid sequence of an antiserum albumin dAb disclosed herein.
  • the invention is a ligand comprising a dAb monomer that has binding specificity for IL-IRl and inhibits binding of IL-I to the receptor but does not inhibit binding of IL- Ira to IL-IRl, wherein said dAb monomer is selected from the group consisting of DOM4- 122-23, and D0M4- 122-24.
  • the ligand can be, for example, a dAb monomer, or a homodimer, homotrimer or homooligomer of said dAb monomer.
  • the ligand can further comprise a dAb monomer that binds serum albumin, such as DOM7h-8.
  • the ligand comprises DOM4-122-23 and DOM7h-8, or comprises DOM-122-24 and DOM7h-8.
  • the invention is a ligand comprising a dAb monomer that has binding specificity for IL-IRl and inhibits binding of IL-I to the receptor but does not inhibit binding of IL-lra to IL-IRl, and a dAb monomer that has binding specificity for tumor necrosis factor receptor 1 (TNFRl).
  • the ligand can further comprise a half-life extending moiety.
  • the dAb monomer that has binding specificity for TNFRl competes for binding to TNFRl with an anti-TNFRl dAb described herein.
  • the dAb monomer that has binding specificity for TNFRl comprises an amino acid sequence that has at least about 90% amino acid sequence identity with an amino acid sequence of an anti-TNFRl dAb described herein.
  • the invention also relates to an isolated or recombinant nucleic acid encoding a dAb monomer or ligand, and to vectors (e.g., expression vectors) that comprise the recombinant nucleic acid.
  • the invention also relates to a host cell comprising a recombinant nucleic acid or vector, and to a method of producing a ligand or dAb monomer that comprises maintaining a host cell of the invention under conditions suitable for expression of the nucleic acid that encodes a ligand or dAb monomer of the invention.
  • the invention also relates to pharmaceutical compositions comprising a dAb monomer or ligand and a physiologically acceptable carrier.
  • a pharmaceutical composition for intravenous, intramuscular, intraperitoneal, intraarterial, intrathecal, intraarticular, subcutaneous, pulmonary, intranasal, vaginal, or rectal administration for intravenous, intramuscular, intraperitoneal, intraarterial, intrathecal, intraarticular, subcutaneous, pulmonary, intranasal, vaginal, or rectal administration.
  • the invention also relates to a drug delivery device comprising the pharmaceutical composition of the invention.
  • the drug delivery device can be a parenteral delivery device, intravenous delivery device, intramuscular delivery device, intraperitoneal delivery device, transdermal delivery device, pulmonary delivery device, intraarterial delivery device, intrathecal delivery device, intraarticular delivery device, subcutaneous delivery device, intranasal delivery device, vaginal delivery device, or rectal delivery device.
  • Examples of such delivery devices include a syringe, a transdermal delivery device (e.g., a patch), a capsule, a tablet, a nebulizer, an inhaler, an atomizer, an aerosolizer, a mister, a dry powder inhaler, a metered dose inhaler, a metered dose sprayer, a metered dose mister, a metered dose atomizer, and a catheter.
  • the invention also relates to a method for treating an inflammatory disease comprising administering to a subject in need thereof, a therapeutically effective amount of a dAb monomer or ligand of the invention.
  • the invention also relates to a dAb monomer or ligand of the invention for use in therapy, diagnosis and/or prophylaxis, and to the use of a dAb monomer or ligand of the invention for the manufacture of a medicament for treating a disease described herein (e.g., an inflammatory disease, arthritis, a respiratory disease).
  • a disease described herein e.g., an inflammatory disease, arthritis, a respiratory disease.
  • the invention also relates to a method for treating a disease (e.g., an inflammatory disease, arthritis, a respiratory disease) comprising administering to a subject in need thereof a therapeutically effective amount of a dAb monomer that is resistant to protease degradation.
  • a disease e.g., an inflammatory disease, arthritis, a respiratory disease
  • the invention also relates a dAb monomer that is resistant to protease degradation for use in therapy, diagnosis or prophylaxis, and to the use of such a dAb monomer of the invention for the manufacture of a medicament for treating a disease described herein (e.g., an inflammatory disease, arthritis, a respiratory disease).
  • a disease described herein e.g., an inflammatory disease, arthritis, a respiratory disease.
  • FIG. 1 is a graph showing the results of an in vitro assay in which dAbs were tested for the ability to inhibit IL-I -induced IL-8 release from cultured MRC-5 cells (ATCC catalogue no. CCL-171).
  • FIG. 1 shows a dose-response curve for anti-IL-lRl dAbs referred to as DOM4-122 and DOM4-129 in such a cell assay.
  • the ND 50 values of both dAbs was about 1 ⁇ M.
  • FIG. 2 is a graph showing the results of in vitro assays in which dAbs that underwent affinity maturation were tested for the ability to inhibit IL-I -induced IL-8 release from cultured MRC-5 cells (ATCC catalogue no. CCL-171).
  • FIG. 2 shows a dose-response curve for DOM4-122-6, DOM4-129-1, D0M4- 122-23, and IL-lra.
  • DOM4-122-6 and DOM4-122-23 are affinity matured variants of DOM4-122
  • DOM4-129-1 is an affinity matured variant of DOM4-129.
  • FIGS. 3A and 3B are sensograms showing that DOM4-122-23 (FIG. 3A) but not
  • IL-l ⁇ (FIG. 3B) bound to IL-IRl to which IL-lra was already bound.
  • IL-lra was injected over immobilized IL-IRl and bound to the immobilized receptor. (Injection 1, from 0-60 seconds in FIGS. 3A and 3B.)
  • DOM4-122-23 or IL-I ⁇ was injected.
  • Injection 2 from 60-120 seconds in FIGS. 3A and 3B.
  • DOM4-122-23 bound to IL-IRl to which IL-lra was already bound, but IL- l ⁇ did not.
  • FIG. 4 is a graph showing that increasing concentrations of DOM4- 122-23 did not inhibit binding of IL-lra to IL-IRl in a competitive binding ELISA, but that IL-l ⁇ inhibited binding of IL-lra to IL-IRl in the assay.
  • Increasing concentrations of D0M4- 122-23 or IL-l ⁇ were mixed with 500 pM IL-lra, and the mixture was applied to an ELISA plate that was coated with IL- 1 Rl .
  • FIG. 5A-5Z illustrates the amino acid sequences of several human dAbs that bind human IL-IRl. In some of the sequences, the amino acids of CDRl, CDR2 and CDR3 are underlined.
  • FIG. 6A-6Z, 6AA-6ZZ, 6AAA and 6BBB illustrates the nucleotide sequences of nucleic acids that encode the human dAbs shown in FIG. 5 A-5Z. In some of the sequences, the nucleotides encoding CDRl, CDR2 and CDR3 are underlined.
  • FIG. 7A is an alignment of the amino acid sequences of three VKS selected by binding to mouse serum albumin (MSA).
  • the aligned amino acid sequences are from VKS designated MSAl 6, which is also referred to as DOM7m-16 (SEQ ID NO:723), MSA 12, which is also referred to as DOM7m-12 (SEQ ID NO:724), and MSA 26, which is also referred to as DOM7m-26 (SEQ ID NO:725).
  • FIG. 7B is an alignment of the amino acid sequences of six VKS selected by binding to rat serum albumin (RSA).
  • the aligned amino acid sequences are from VKS designated DOM7r-l (SEQ ID NO:726), DOM7r-3 (SEQ ID NO:727), DOM7r-4 (SEQ ID NO.-728), DOM7r-5 (SEQ ID NO.729), DOM7r-7 (SEQ ID NO:730), and DOM7r-8 (SEQ ID NO.-731).
  • FIG. 7C is an alignment of the amino acid sequences of six VKS selected by binding to human serum albumin (HSA).
  • the aligned amino acid sequences are from VKS designated DOM7h-2 (SEQ ID NO:732), DOM7h-3 (SEQ ID NO:733), DOM7h-4 (SEQ ID NO:734), DOM7h-6 (SEQ ID NO:735), DOM7h-l (SEQ ID NO:736), and DOM7h-7 (SEQ ID NO:737).
  • FIG. 7D is an alignment of the amino acid sequences of seven V H S selected by binding to human serum albumin and a consensus sequence (SEQ ID NO:738).
  • the aligned sequences are from V H s designated DOM7h-22 (SEQ ID NO:739), DOM7h-23 (SEQ ID NO:740), DOM7h-24 (SEQ ID NO:741), DOM7h-25 (SEQ ID NO:742), DOM7h-26 (SEQ ID NO:743), DOM7h-21 (SEQ ID NO:744), and DOM7h-27 (SEQ ID NO:745).
  • FIG. 7E is an alignment of the amino acid sequences of three VKS selected by binding to human serum albumin and rat serum albumin.
  • the aligned amino acid sequences are from VKS designated DOM7h-8 (SEQ ID NO.746), DOM7r-13 (SEQ ID NO:747), and DOM7r-14 (SEQ ID NO:748).
  • FIG. 8 is an illustration of the amino acid sequences of VKS selected by binding to rat serum albumin (RSA).
  • the illustrated sequences are from VKS designated DOM7r-15 (SEQ ID NO:749), DOM7r-16 (SEQ ID NO:750), DOM7r-17 (SEQ ID NO:751), DOM7r-18 (SEQ ID NO:752), DOM7r-19 (SEQ ID NO:753).
  • FIG. 9A-9B is an illustration of the amino acid sequences of the amino acid sequences of V H S that bind rat serum albumin (RSA).
  • the illustrated sequences are from V H S designated DOM7r-20 (SEQ ID NO:754), DOM7r-21 (SEQ ID NO:755), DOM7r- 22 (SEQ ID NO:756), DOM7r-23 (SEQ ID NO:757), DOM7r-24 (SEQ ID NO:758), DOM7r-25 (SEQ ID NO:759), DOM7r-26 (SEQ ID NO:760), DOM7r-27 (SEQ ID NO:761), DOM7r-28 (SEQ ID NO:762), DOM7r-29 (SEQ ID NO:763), DOM7r-30 (SEQ ID NO:764), DOM7r-31 (SEQ ID NO:765), DOM7r-32 (SEQ ID NO:766), and DOM7r-33 (SEQ ID NO:767).
  • FIG. 10 illustrates the amino acid sequences of several Camelid V HH S that bind mouse serum albumin that are disclosed in WO 2004/041862.
  • Sequence A (SEQ ID NO:768), Sequence B (SEQ ID NO:769), Sequence C (SEQ ID NO:770), Sequence D (SEQ ID NO:771), Sequence E (SEQ ID NO:772), Sequence F (SEQ ID NO:773), Sequence G (SEQ ID NO:774), Sequence H (SEQ ID NO:775), Sequence I (SEQ ID NO:776), Sequence J (SEQ ID NO:777), Sequence K (SEQ ID NO:778), Sequence L (SEQ ID NO:779), Sequence M (SEQ ID NO:780), Sequence N (SEQ ID NO:781), Sequence O (SEQ ID NO:782), Sequence P (SEQ ID NO:783), Sequence Q (SEQ ID NO:784).
  • FIG. 1 IA- 11 V illustrates the amino acid sequences of several human immunoglobulin variable domains that have binding specificity for human TNFRl .
  • the presented amino acid sequences are continuous with no gaps; the symbol ⁇ has been inserted into the sequences to indicate the locations of the complementarity determining regions (CDRs).
  • CDRl is flanked by ⁇
  • CDR2 is flanked by ⁇
  • CDR3 is flanked
  • FIG. 12A-12B illustrates the amino acid sequences of several human immunoglobulin variable domains that have binding specificity for mouse TNFRl .
  • the presented amino acid sequences are continuous with no gaps; the symbol ⁇ has been inserted into some of the sequences to indicate the locations of the complementarity determining regions (CDRs).
  • CDRl is flanked by ⁇
  • CDR2 is flanked by ⁇
  • CDR3 is flanked by ⁇ .
  • the term "ligand” refers to a polypeptide that comprises a domain that has binding specificity for a desired target.
  • the binding domain is an immunoglobulin single variable domain (e.g., V H , V L , V HH ) that has binding specificity for a desired target antigen (e.g., a receptor protein).
  • the binding domain can also comprises one or more complementarity determining regions (CDRs) of an immunoglobulin single variable domain that has binding specificity for a desired target antigen in a suitable format, such that the binding domain has binding specificity for the target antigen.
  • CDRs complementarity determining regions
  • the CDRs can be grafted onto a suitable protein scaffold or skeleton, such as an affibody, an SpA scaffold, an LDL receptor class A domain or an EGF domain.
  • the ligand can be monovalent (e.g., a dAb monomer), bivalent (homobivalent, heterobivalent) or multivalent (homomultivalent, heteromultivalent) as described herein.
  • ligands include polypeptides that consist of a dAb, include polypeptides that consist essentially of such a dAb, polypeptides that comprise a dAb (or the CDRs of a dAb) in a suitable format, such as an antibody format (e.g., IgG-like format, scFv, Fab, Fab', F(ab') 2 ) or a suitable protein scaffold or skeleton, such as an affibody, an SpA scaffold, an LDL receptor class A domain or an EGF domain, dual specific ligands that comprise a dAb that binds a first target protein, antigen or epitope (e.g., IL-IRl or TNFRl) and a second dAb that binds another target protein, antigen or epitope (e.g., serum albumin), and multispecific ligands as described herein.
  • a suitable format such as an antibody format (e.g., IgG-like format
  • the binding domain can also be a protein domain comprising a binding site for a desired target, e.g., a protein domain is selected from an affibody, an SpA domain, an LDL receptor class A domain an EGF domain, an avimer (see, e.g., U.S. Patent Application Publication Nos. 2005/0053973, 2005/0089932, 2005/0164301).
  • immunoglobulin single variable domain refers to an antibody variable region (V H , VH H , V L ) that specifically binds an antigen or epitope independently of other V regions or domains; however, as the term is used herein, an immunoglobulin single variable domain can be present in a format (e.g., homo- or hetero-mul timer) with other variable regions or variable domains where the other regions or domains are not required for antigen binding by the single immunoglobulin variable domain (i.e., where the immunoglobulin single variable domain binds antigen independently of the additional variable domains).
  • Immunoglobulin single variable domain encompasses not only an isolated antibody single variable domain polypeptide, but also larger polypeptides that comprise one or more monomers of an antibody single variable domain polypeptide sequence.
  • a “domain antibody” or “dAb” is the same as an "immunoglobulin single variable domain” polypeptide as the term is used herein.
  • An immunoglobulin single variable domain polypeptide, as used herein refers to a mammalian immunoglobulin single variable domain polypeptide, preferably human, but also includes rodent (for example, as disclosed in WO 00/29004, the contents of which are incorporated herein by reference in their entirety) or camelid V HH dAbs.
  • Camelid dAbs are immunoglobulin single variable domain polypeptides which are derived from species including camel, llama, alpaca, dromedary, and guanaco, and comprise heavy chain antibodies naturally devoid of light chain: V H H- VH H molecules are about ten times smaller than IgG molecules, and as single polypeptides, they are very stable, resisting extreme pH and temperature conditions.
  • dose refers to the quantity of agent (e.g. , anti- 1 L- 1 Rl dAb, antagonist of TNFRl) administered to a subject all at one time (unit dose), or in two or more administrations over a defined time interval.
  • dose can refer to the quantity of agent (e.g., anti-lL-lRl dAb, antagonist of TNFRl) administered to a subject over the course of one day (24 hours) (daily dose), two days, one week, two weeks, three weeks or one or more months (e.g., by a single administration, or by two or more administrations).
  • agent e.g., anti-lL-lRl dAb, antagonist of TNFRl
  • the interval between doses can be any desired amount of time.
  • Two immunoglobulin domains are "complementary" when they belong to families of structures which form cognate pairs or groups or are derived from such families and retain this feature. For example, a VH domain and a V L domain of an antibody are complementary; two V H domains are not complementary, and two V L domains are not complementary.
  • Complementary domains may be found in other members of the immunoglobulin superfamily, such as the V ⁇ and Vp (or ⁇ and ⁇ ) domains of the T-cell receptor. Domains which are artificial, such as domains based on protein scaffolds which do not bind epitopes unless engineered to do so, are non- complementary. Likewise, two domains based on (for example) an immunoglobulin domain and a fibronectin domain are not complementary. "Immunoglobulin” refers to a family of polypeptides which retain the immunoglobulin fold characteristic of antibody molecules, which contains two ⁇ sheets and, usually, a conserved disulphide bond.
  • immunoglobulin superfamily are involved in many aspects of cellular and non-cellular interactions in vivo, including widespread roles in the immune system (for example, antibodies, T-cell receptor molecules and the like), involvement in cell adhesion (for example the ICAM molecules) and intracellular signalling (for example, receptor molecules, such as the PDGF receptor).
  • the present invention is applicable to all immunoglobulin superfamily molecules which possess binding domains.
  • the present invention relates to antibodies.
  • a "domain" is a folded protein structure which retains its tertiary structure independent of the rest of the protein. Generally, domains are responsible for discrete functional properties of proteins, and in many cases may be added, removed or transferred to other proteins without loss of function of the remainder of the protein and/or of the domain.
  • a “single antibody variable domain” is a folded polypeptide domain comprising sequences characteristic of antibody variable domains. It therefore includes complete antibody variable domains and modified variable domains, for example, in which one or more loops have been replaced by sequences which are not characteristic of antibody variable domains, or antibody variable domains which have been truncated or comprise N- or C-terminal extensions, as well as folded fragments of variable domains which retain at least in part the binding activity and specificity of the full-length domain.
  • the term "repertoire” refers to a collection of diverse variants, for example polypeptide variants, which differ in their primary sequence.
  • a library used in the present invention will encompass a repertoire of polypeptides comprising at least 1000 members.
  • library refers to a mixture of heterogeneous polypeptides or nucleic acids.
  • the library is composed of members, each of which has a single polypeptide or nucleic acid sequence.
  • library is synonymous with "repertoire.” Sequence differences between library members are responsible for the diversity present in the library.
  • the library may take the form of a simple mixture of polypeptides or nucleic acids, or may be in the form of organisms or cells, for example bacteria, viruses, animal or plant cells and the like, transformed with a library of nucleic acids.
  • each individual organism or cell contains only one or a limited number of library members.
  • a library may take the form of a population of host organisms, each organism containing one or more copies of an expression vector containing a single member of the library in nucleic acid form which can be expressed to produce its corresponding polypeptide member.
  • the population of host organisms has the potential to encode a large repertoire of genetically diverse polypeptide variants.
  • an "antibody” for example IgG, IgM, IgA, IgD or IgE
  • fragment such as a Fab , F(ab') 2> Fv, disulphide linked Fv, scFv, closed conformation multispecific antibody, disulphide-linked scFv, diabody
  • an antibody for example IgG, IgM, IgA, IgD or IgE
  • fragment such as a Fab , F(ab') 2> Fv, disulphide linked Fv, scFv, closed conformation multispecific antibody, disulphide-linked scFv, diabody
  • a “dual-specific ligand” is a ligand comprising a first immunoglobulin single variable domain and a second immunoglobulin single variable domain as herein defined, wherein the variable regions are capable of binding to two different antigens or two epitopes on the same antigen which are not normally bound by a monospecific immunoglobulin.
  • the two epitopes may be on the same hapten, but are not the same epitope or sufficiently adjacent to be bound by a monospecific ligand.
  • the dual specific ligands according to the invention are composed of variable domains which have different specificities, and do not contain mutually complementary variable domain pairs which have the same specificity.
  • Dual-specific ligands and suitable methods for preparing dual-specific ligands are disclosed in WO 2004/058821, WO 2004/003019, and WO 03/002609, the entire teachings of each of these published international applications are incorporated herein by reference.
  • an "antigen” is a molecule that is bound by a ligand according to the present invention.
  • antigens are bound by antibody ligands and are capable of raising an antibody response in vivo. It may be a polypeptide, protein, nucleic acid or other molecule.
  • the dual specific ligands according to the invention are selected for target specificity against a particular antigen.
  • the antibody binding site defined by the variable loops (Ll, L2, L3 and H 1 , H2, H3) is capable of binding to the antigen.
  • epitope is a unit of structure conventionally bound by an immunoglobulin V H /V L pair. Epitopes define the minimum binding site for an antibody, and thus represent the target of specificity of an antibody. In the case of a single domain antibody, an epitope represents the unit of structure bound by a variable domain in isolation.
  • a “universal framework” is a single antibody framework sequence corresponding to the regions of an antibody conserved in sequence as defined by Kabat ("Sequences of Proteins of Immunological Interest", US Department of Health and Human Services) or corresponding to the human germline immunoglobulin repertoire or structure as defined by Chothia and Lesk, (1987) J. MoI. Biol. 196:910-917.
  • the invention provides for the use of a single framework, or a set of such frameworks, which has been found to permit the derivation of virtually any binding specificity though variation in the hypervariable regions alone.
  • “Half-life” is the time taken for the serum concentration of the ligand to reduce by 50%, in vivo, for example due to degradation of the ligand and/or clearance or sequestration of the ligand by natural mechanisms.
  • the ligands of the invention are stabilized in vivo and their half-life increased by binding to molecules which resist degradation and/or clearance or sequestration. Typically, such molecules are naturally occurring proteins which themselves have a long half-life in vivo.
  • the half-life of a ligand is increased if its functional activity persists, in vivo, for a longer period than a similar ligand which is not specific for the half-life increasing molecule.
  • a ligand specific for HSA and a target molecule is compared with the same ligand wherein the specificity for HSA is not present, that it does not bind HSA but binds another molecule. For example, it may bind a second epitope on the target molecule.
  • the half life is increased by 10%, 20%, 30%, 40%, 50% or more. Increases in the range of 2x, 3x, 4x, 5x, 10x, 2Ox, 30x, 4Ox, 50x or more of the half life are possible. Alternatively, or in addition, increases in the range of up to 30x, 4Ox, 5Ox, 6Ox, 7Ox, 80x, 9Ox, 10Ox, 15Ox of the half life are possible.
  • the term "competes" means that the binding of a first epitope to its cognate epitope binding domain is inhibited when a second epitope is bound to its cognate epitope binding domain.
  • binding may be inhibited sterically, for example by physical blocking of a binding domain or by alteration of the structure or environment of a binding domain such that its affinity or avidity for an epitope is reduced.
  • Amino acid and nucleotide sequence alignments and homology, similarity or identity, as defined herein are preferably prepared and determined using the algorithm BLAST 2 Sequences, using default parameters (Tatusova, T. A. et al., FEMS Microbiol Lett, 774:187-188 (1999)).
  • the BLAST algorithm version 2.0 is employed for sequence alignment, with parameters set to default values.
  • BLAST Basic Local Alignment Search Tool
  • blastp, blastn, blastx, tblastn, and tblastx are the heuristic search algorithm employed by the programs blastp, blastn, blastx, tblastn, and tblastx; these programs ascribe significance to their findings using the statistical methods of Karlin and Altschul, 1990, Proc. Natl. Acad. Sci. USA 87(6):2264-8
  • the invention relates to dAb monomers that bind IL-IRl and inhibit binding of IL-I ⁇ e.g., IL-I ⁇ and/or IL-I ⁇ ) to the receptor but do not inhibit binding of IL- Ira to IL- IRl, and to ligands comprising such dAb monomers.
  • IL-I ⁇ e.g., IL-I ⁇ and/or IL-I ⁇
  • ligands comprising such dAb monomers.
  • Such ligands and dAb monomers are useful as therapeutic agents for treating inflammation, disease or other conditions mediated in whole or in part by biological functions induced by binding of IL-I to IL- IRl (e.g., local or systemic inflammation, elaboration of inflammatory mediators (e.g., IL-6, 11-8, TNF), fever, activation of immune cells (e.g., lymphocytes, neutrophils), anorexia, hypotension, leucopenia, thrombocytopenia.)
  • the ligands or dAb monomers of the invention can bind IL-IRl and inhibit IL-IRl function without interfering with endogenous IL-IRl inhibitory pathways, such as binding of endogenous IL- Ira to endogenous IL-IRl .
  • a ligand or dAb monomer can be administered to a subject to complement the the endogenous regulatory pathways that inhibit the activity of IL-IRl or IL-I in vivo.
  • ligands or dAb monomers that bind IL- IRl and do not inhibit binding of IL- Ira to IL-IRl provide advantages for use as diagnostic agents, because they can be used to bind and detect, quantify or measure IL- IRl in a sample and will not compete with IL-lra in the sample for binding to " IL-IRl . Accordingly, an accurate determination of whether or how much IL-IRl is in the sample can be made.
  • dAb monomers that bind IL-IRl and inhibit binding of IL-I (e.g., IL- l ⁇ and/or IL-I ⁇ ) to the receptor but do not inhibit binding of IL-lra to IL-IRl also are useful as research tools.
  • a dAb monomer can be used to identify agents (e.g., other dAbs, small organic molecules) that bind IL-IRl but do not inhibit binding of IL- lra to IL-IRl .
  • an agent or collection of agents to be tested for the ability to inhibit binding of IL-I to IL-IRl are assayed in a competitive IL-IRl receptor binding assay, such as the receptor binding assay described herein.
  • Agents that inhibit binding of IL-I to IL-IRl in such an assay can then be studied in a similar competitive IL-IRl receptor binding assay to see if they compete with a dAb monomer that binds IL-IRl but does not inhibit binding of IL-lra to IL-IRl .
  • Competitive binding in such an assay indicates that the agent binds IL-IRl and inhibits binding of IL-I to the receptor but does not inhibit binding of IL-lra to the receptor.
  • the invention provides ligands that comprise a dAb (e.g., dual specific ligand comprising such a dAb, dAb monomer) that binds to IL-IRl with a K d of 300 nM to 5 pM (ie, 3 x 10 "7 to 5 x 10 "12 M), preferably 50 nM to 20 pM, more preferably 5 nM to 200 pM and most preferably 1 nM to 100 pM, for example 1 x 10 "7 M or less, preferably 1 x 10 "8 M or less, more preferably 1 x 10 "9 M or less, advantageously 1 x 10 ⁇ 10 M or less and most preferably 1 x 10 "n M or less; and/or a K off rate constant of 5 x 10 "1 s "1 to 1 x 10 "7 s " x 10 '5 for example 5 x 10 " ' s "1 or less, preferably 1 x 10 "2 s "1 or less, advantageous
  • the ligand or dAb monomer inhibits binding of IL-I (e.g., IL-I ⁇ and/or IL-I ⁇ ) to IL-IRl, for example in a receptor binding assay, with an inhibitory concentration 50 (IC50) that is equal to or less than about 1 ⁇ M, for example an IC50 of about 500 nM to about 50 pM, preferably about 100 nM to about 50 pM, more preferably about 10 nM to about 100 pM, advantageously about 1 nM to about 100 pM; for example about 50 nM or less, preferably about 5 nM or less, more preferably about 500 pM or less, advantageously about 200 pM or less, and most preferably about 100 pM or less.
  • IC50 inhibitory concentration 50
  • the ligand or dAb binds human IL-IRl and inhibits binding of human IL-I (e.g., IL- l ⁇ and/or IL-I ⁇ ) to human IL-IRl and inhibits signaling through human IL-IRl in response to IL-I binding.
  • human IL-I e.g., IL- l ⁇ and/or IL-I ⁇
  • the ligand or dAb monomer neutralizes (inhibits the activity of) IL-I or IL-IRl in a standard assay (e.g., IL-I -induced release of Interleukin-8 by MRC-5 cells, IL-I -induced release of Interleukin-6 by whole blood cells) with a neutralizing dose 50 (ND50) that is less than or equal to about 1 ⁇ M, for example an ND50 of about 500 nM to about 50 pM, preferably about 100 nM to about 50 pM, more preferably about 10 nM to about 100 pM, advantageously about 1 nM to about 100 pM; for example about 50 nM or less, preferably about 5 nM or less, more preferably about 500 pM or less, advantageously about 200 pM or less, and most preferably about 100 pM or less.
  • a neutralizing dose 50 ND50
  • the ligand or dAb monomer can inhibit IL-1-induced (e.g., IL- l ⁇ - or IL-I ⁇ - induced) release of Interleukin-8 by MRC-5 cells (ATCC Accession No. CCL-171) in an in vitro assay with a ND50 that is ⁇ 10 ⁇ M, ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 500 pM, ⁇ 300 pM, ⁇ 100 pM, or ⁇ 10 pM.
  • IL-1-induced e.g., IL- l ⁇ - or IL-I ⁇ - induced
  • the ligand or dAb monomer can inhibit IL-1-induced (e.g., IL- l ⁇ - or IL-l ⁇ -induced) release of Interleukin-6 in an in vitro whole blood assay with a ND50 that is ⁇ 10 ⁇ M, ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 500 pM, ⁇ 300 pM, ⁇ 100 pM, or ⁇ 10 pM.
  • the ligand can be monovalent (e.g., a dAb monomer) or multivalent (e.g., dual specific, multi-specific) as described herein.
  • the ligand is a dAb monomer that binds human IL-IRl and comprises a half-life extending moiety (as described herein) such as a polyethylene glycol moiety.
  • the ligand is multivalent and comprises two or more dAb monomers that bind IL-IRl .
  • Multivalent ligands can contain two or more copies of a particular dAb that binds IL-IRl or contain two or more dAbs that bind IL-IRl .
  • the ligand can be a dimer, trimer or multimer comprising two or more copies of a particular dAb that binds IL-IRl, or can comprise two or more different dAbs that bind IL-IRl .
  • the ligand is a homo dimer or homo trimer that comprises two or three copies of a particular dAb that binds IL-IRl, respectively.
  • a multivalent ligand does not substantially agonize IL-IRl (act as an agonist of IL-IRl) in a standard cell assay (i.e., when present at a concentration of 1 nM, 10 nJVl, 100 nM, 1 ⁇ M, 10 ⁇ M, 100 ⁇ M, 1000 ⁇ M or 5,000 ⁇ M, results in no more than about 5% of the IL- IRl -mediated activity induced by IL-I (100 pg/ml) in the assay).
  • the multivalent ligand contains two or more dAbs that bind a desired epitope or domain of IL-IRl.
  • the multivalent ligand can comprise two or more copies of a dAb that competes with IL-lra for binding to IL-IRl .
  • the multivalent ligand can comprise two or more copies of a dAb that does not compete with IL-lra for binding to IL-IRl .
  • the multivalent ligand contains two or more dAbs that bind to different epitopes or domains of IL-IRl .
  • the multivalent ligand comprises a first dAb that binds a first epitope of IL-IRl, and a second dAb that binds a second different epitope of IL-IRl.
  • Ligands of this type can bind IL-IRl with high aviditiy, and be more selective for binding to cells that overexpress IL-IRl or express IL-IRl on their surface at high density than other ligand formats, such as dAb monomers.
  • the ligands or dAb monomers of the invention are efficacious in a model disease [e.g., inflammatory disease) when an effective amount is administered.
  • a model disease e.g., inflammatory disease
  • an effective amount in a model of inflammatory disease is about 1 mg/kg to about 10 mg/kg (e.g., about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, or about 10 mg/kg).
  • the models of chronic inflammatory disease described herein are recognized by those skilled in the art as being predictive of therapeutic efficacy in humans. The prior art does not suggest using ligands or dAb monomers, as described herein, in these models, or that they would be efficacious.
  • suitable animal models of respiratory disease are known in the art, and are recognized by those skilled in the art as being predictive of therapeutic efficacy in humans.
  • suitable animal models of respiratory disease include models of chronic obstructive pulmonary disease (see, Groneberg, DA et al., Respiratory Research 5:18 (2004)), and models of asthma (see, Coffman et al, J. Exp. Med. 2 ⁇ 91(12):1875- 1879 (2001).
  • the ligand or dAb monomer can be efficacious in the mouse model of tobacco smoke-induced chronic obstructive pulmonary disease (COPD) (See, e.g., Wright JL and Churg A., Chest 122:301 S-306S (2002)).
  • COPD tobacco smoke-induced chronic obstructive pulmonary disease
  • administering an effective amount of the ligand or dAb monomer can reduce or delay onset of the symptoms of COPD, as compared to a suitable control.
  • the ligand or dAb monomer is efficacious in a standard model of arthritis (e.g., inflammatory arthritis, osteoarthritis).
  • a standard model of arthritis e.g., inflammatory arthritis, osteoarthritis.
  • suitable models are known in the art, for example, mouse collagen-induced arthritis model (see, e.g., Juarranz, et al, Arthritis Research and Therapy, 7:R1034-R1045 (2005)), rat adjuvant induced arthritis (see, e.g., Halloran, M. et al, J. Immunol, 65:7492 (1999), Halloran, M.
  • arthritis can be induced in DBA/1 mice by injecting animals with an emulsion of Arthro gen-CIA adjuvant and Arthrogen-CIA collagen (MD-biosciences). About 21 days after the injection, and ligand or dAb monomer to be tested can be administered (e.g., by intraperitoneal injection). Clinical arthritic scores on a scale of 0 to 4 can be measured for each of the 4 limbs of the animals assigning 0 for a normal limb and assigning 4 for a maximally inflamed limb with involvement of multiple joints.
  • Administering an effective amount of ligand or dAb monomer can reduce the average arthritic score of the summation of the four limbs in this mouse collagen-induced arthritis model, for example, the average arthritic score of the summation of the four limbs can be reduced by about 1 to about 16, about 3 to about 16, about 6 to about 16, about 9 to about 16, or about 12 to about 16, as compared to a suitable control, or can delay the onset of symptoms of arthritis, for example, by about 1 day, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 10 days, about 14 days, about 21 days or about 28 days, as compared to a suitable control.
  • administering an effective amount of the ligand can result in an average arthritic score of the summation of the four limbs in the standard mouse collagen-induced arthritis model of 0 to about 3, about 3 to about 5, about 5 to about 7, about 7 to about 15, about 9 to about 15, about 10 to about 15, about 12 to about 15, or about 14 to about 15.
  • the ligand or dAb monomer is efficacious in the mouse ⁇ ARE model of arthritis (Kontoyiannis et al. , J Exp Med 196: 1563-74 (2002)).
  • administering an effective amount of the ligand can reduce the average arthritic score in the mouse ⁇ ARE model of arthritis, for example, by about 0.1 to about 2.5, about 0.5 to about 2.5, about 1 to about 2.5, about 1.5 to about 2.5, or about 2 to about 2.5, as compared to a suitable control.
  • administering an effective amount of the ligand can delay the onset of symptoms of arthritis in the mouse ⁇ ARE model of arthritis by, for example, about 1 day, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 10 days, about 14 days, about 21 days or about 28 days, as compared to a suitable control.
  • administering an effective amount of the ligand can result in an average arthritic score in the mouse ⁇ ARE model of arthritis of 0 to about 0.5, about 0.5 to about 1, about 1 to about 1.5, about 1.5 to about 2, or about 2 to about 2.5.
  • the ligand or dAb monomer is efficacious in the mouse ⁇ ARE model of inflammatory bowel disease (IBD) (Kontoyiannis et al, J Exp Med 196:1563-14 (2002)).
  • administering an effective amount of the ligand can reduce the average acute and/or chronic inflammation score in the mouse ⁇ ARE model of IBD, for example, by about 0.1 to about 2.5, about 0.5 to about 2.5, about 1 to about 2.5, about 1.5 to about 2.5, or about 2 to about 2.5, as compared to a suitable control.
  • administering an effective amount of the ligand can delay the onset of symptoms of IBD in the mouse ⁇ ARE model of IBD by, for example, about 1 day, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 10 days, about 14 days, about 21 days or about 28 days, as compared to a suitable control.
  • administering an effective amount of the ligand can result in an average acute and/or chronic inflammation score in the mouse ⁇ ARE model of IBD of 0 to about 0.5, about 0.5 to about 1, about 1 to about 1.5, about 1.5 to about 2, or about 2 to about 2.5.
  • the ligand or dAb monomer is efficacious in the mouse dextran sulfate sodium (DSS) induced model of IBD (see, Okayasu I. et al,
  • administering an effective amount of the ligand can reduce the average severity score in the mouse DSS model of IBD, for example, by about 0.1 to about 2.5, about 0.5 to about 2.5, about 1 to about 2.5, about 1.5 to about 2.5, or about 2 to about 2.5, as compared to a suitable control.
  • administering an effective amount of the ligand can delay the onset of symptoms of IBD in the mouse DSS model of IBD by, for example, about 1 day, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 10 days, about 14 days, about 21 days or about 28 days, as compared to a suitable control.
  • administering an effective amount of the ligand can result in an average severity score in the mouse DSS model of IBD of 0 to about 0.5, about 0.5 to about 1, about 1 to about 1.5, about 1.5 to about 2, or about 2 to about 2.5.
  • the ligand comprises a dAb that specifically binds IL-IRl, inhibits binding of IL-I (e.g., IL- l ⁇ and/or IL-I ⁇ ) to the receptor but does not inhibit binding of IL-lra to IL-IRl, and competes for binding to IL-IRl with dAb selected from the group consisting of DOM4- 122-23 (SEQ ID NO:1), D0M4- 122-24 (SEQ ID NO:2), DOM4-122 (SEQ ID NO:95), DOM4-122-1 (SEQ ID NO:96), DOM4-122-2 (SEQ ID NO:97), DOM4-122-3 (SEQ ID NO.98), DOM4-122-4 (SEQ ID NO:99), DOM4-122-5 (SEQ ID NO: 100), D0M4- 122-6 (SEQ ID NO: 101), D0M4- 122-7 (SEQ ID NO: 102), DOM4-122-8 (SEQ ID NO:1
  • the ligand comprises a dAb that specifically binds IL-IR, inhibits binding of IL-I (e.g., IL- l ⁇ and/or IL-I ⁇ ) to the receptor but does not inhibit binding of IL- Ira to IL-IRl, and comprises an amino acid sequence that has at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% amino acid sequence identity with the amino acid sequence or a dAb selected from the group consisting of DOM4- 122-23 (SEQ ID NO:1), DOM4-122-24 (SEQ ID NO:2), DOM4-122 (SEQ ID NO:95), DOM4-122-1 (SEQ ID NO:96), DOM4-122-2 (SEQ ID NO:97), DOM4-122-3 (SEQ ID NO:
  • the ligand comprises a dAb that binds IL-IRl and competes with any of the dAbs disclosed herein for binding to IL-IRl (e.g., human IL- IRl).
  • the ligand comprises a dAb monomer selected from the group consisting of DOM4- 122-23, and DOM4- 122-24.
  • the ligand can be a monomer, or be a hetero- or homo- dimer, trimer or oligomer of these dAbs.
  • the ligand can further comprise a half-life extending moiety, such as a polyethylene glycol moiety.
  • the ligand comprises a dAb monomer selected from the group consisting of of DOM4- 122-23, and DOM4- 122-24, and a dAb monomer that binds serum albumin.
  • the ligand can be a dual specific ligand that comprises DOM4-122-23 and DOM7h-8, or DOM4-122-24 and DOM7h-8.
  • the dAb monomer can comprise any suitable immunoglobulin variable domain, and preferably comprises a human variable domain or a variable domain that comprises human framework regions.
  • the dAb monomer comprises a universal framework, as described herein.
  • the universal framework can be a VL framework (V ⁇ or VK) , such as a framework that comprises the framework amino acid sequences encoded by the human germline DPKl, DPK2, DPK3, DPK4, DPK5, DPK6, DPK7, DPK8, DPK9, DPKlO, DPK12, DPK13, DPK15, DPK16, DPKl 8, DPK19, DPK20, DPK21, DPK22, DPK23, DPK24, DPK25, DPK26 or DPK 28 immunoglobulin gene segment.
  • the V L framework can further comprises the framework amino acid sequence encoded by the human germline J K I, J K 2, J K 3, J K 4, or J K 5 immunoglobulin gene segment.
  • the universal framework can be a V H framework, such as a framework that comprises the framework amino acid sequences encoded by the human germline DP4, DP7, DP8, DP9, DPlO, DP31, DP33, DP38, DP45, DP46, DP47, DP49, DP50, DP51, DP53, DP54, DP65, DP66, DP67, DP68 or DP69 immunoglobulin gene segment.
  • the V H framework can further comprises the framework amino acid sequence encoded by the human germline J H I , JH2, J H 3, J H 4, J H 4b, J H 5 and J H 6 immunoglobulin gene segment.
  • the dAb monomer comprises one or more framework regions comprising an amino acid sequence that is the same as the amino acid sequence of a corresponding framework region encoded by a human germline antibody gene segment, or the amino acid sequences of one or more of said framework regions collectively comprise up to 5 amino acid differences relative to the amino acid sequence of said corresponding framework region encoded by a human germline antibody gene segment.
  • the amino acid sequences of FWl, FW2, FW3 and FW4 of the dAb monomer are the same as the amino acid sequences of corresponding framework regions encoded by a human germline antibody gene segment, or the amino acid sequences of FWl, FW2, FW3 and FW4 collectively contain up to 10 amino acid differences relative to the amino acid sequences of corresponding framework regions encoded by said human germline antibody gene segment.
  • the dAb monomer comprises FWl, FW2 and FW3 regions, and the amino acid sequence of said FWl, FW2 and FW3 regions are the same as the amino acid sequences of corresponding framework regions encoded by human germline antibody gene segments.
  • the dAb monomer ligand comprises the DPK9 V L framework, or a V H framework selected from the group consisting of DP47, DP45 and DP38.
  • the dAb monomer can comprise a binding site for a generic ligand, such as protein A, protein L and protein G.
  • the ligand or dAb monomer is substantially resistant to aggregation.
  • Aggregation can be assessed using any suitable method, such as, by microscopy, assessing turbidity of a solution by visual inspection or spectroscopy or any other suitable method.
  • aggregation is assessed by dynamic light scattering.
  • Ligands or dAb monomers that are resistant to aggregation provide several advantages. For example, such ligands or dAb monomers can readily be produced in high yield as soluble proteins by expression using a suitable biological production system, such as E. coli, and can be formulated and/or stored at higher concentrations than conventional polypeptides, and with less aggregation and loss of activity.
  • preparation of antigen- or epitope- binding polypeptides intended for in vivo applications includes processes (e.g., gel filtration) that remove aggregated polypeptides. Failure to remove such aggregates can result in a preparation that is not suitable for in vivo applications because, for example, aggregates of an antigen-binding polypeptide that is intended to act as an antagonist can function as an agonist by inducing cross-linking or clustering of the target antigen. Protein aggregates can also reduce the efficacy of therapeutic polypeptides by inducing an immune response in the subject to which they are administered.
  • the aggregation resistant ligands or dAb monomers of the invention can be prepared for in vivo applications without the need to include process steps that remove aggregates, and can be used in in vivo applications without the aforementioned disadvantages caused by polypeptide aggregates.
  • the ligand or dAb monomer unfolds reversibly when heated to a temperature (Ts) and cooled to a temperature (Tc), wherein Ts is greater than the melting temperature (Tm) of the dAb, and Tc is lower than the melting temperature of the dAb.
  • Ts a temperature
  • Tc melting temperature
  • the dAb monomer can unfold reversibly when heated to 80 0 C and cooled to about room temperature.
  • a polypeptide that unfolds reversibly loses function when unfolded but regains function upon refolding are distinguished from polypeptides that aggregate when unfolded or that improperly refold (misfolded polypeptides), i.e., do not regain function.
  • Polypeptide unfolding and refolding can be assessed, for example, by directly or indirectly detecting polypeptide structure using any suitable method.
  • polypeptide structure can be detected by circular dichroism (CD) ⁇ e.g., far-UV CD, near- UV CD), fluorescence ⁇ e.g., fluorescence of tryptophan side chains), susceptibility to proteolysis, nuclear magnetic resonance (NMR), or by detecting or measuring a polypeptide function that is dependent upon proper folding ⁇ e.g., binding to target ligand, binding to generic ligand).
  • CD circular dichroism
  • fluorescence ⁇ e.g., fluorescence of tryptophan side chains
  • susceptibility to proteolysis e.g., nuclear magnetic resonance (NMR)
  • NMR nuclear magnetic resonance
  • polypeptide unfolding is assessed using a functional assay in which loss of binding function ⁇ e.g., binding a generic and/or target ligand, binding a substrate) indicates that the polypeptide is unfolded.
  • loss of binding function ⁇ e.g., binding a generic and/or target ligand, binding a substrate
  • the extent of unfolding and refolding of a ligand or dAb monomer can be determined using an unfolding or denaturation curve.
  • An unfolding curve can be produced by plotting temperature as the ordinate and the relative concentration of folded polypeptide as the abscissa.
  • the relative concentration of folded ligand or dAb monomer can be determined directly or indirectly using any suitable method (e.g., CD, fluorescence, binding assay).
  • a ligand or dAb monomer solution can be prepared and ellipticity of the solution determined by CD.
  • the ellipticity value obtained represents a relative concentration of folded ligand or dAb monomer of 100%.
  • the ligand or dAb monomer in the solution is then unfolded by incrementally raising the temperature of the solution and ellipticity is determined at suitable increments (e.g., after each increase of one degree in temperature).
  • the ligand or dAb monomer in solution is then refolded by incrementally reducing the temperature of the solution and ellipticity is determined at suitable increments.
  • the data can be plotted to produce an unfolding curve and a refolding curve.
  • the unfolding and refolding curves have a characteristic sigmoidal shape that includes a portion in which the ligand or dAb monomer molecules are folded, an unfolding/refolding transition in which ligand or dAb monomer molecules are unfolded to various degrees, and a portion in which the ligand or dAb monomer molecules are unfolded.
  • the y-axis intercept of the refolding curve is the relative amount of refolded ligand or dAb monomer recovered.
  • a recovery of at least about 50%, or at least about 60%, or at least about 70%, or at least about 75%, or at least about 80%, or at least about 85%, or at least about 90%, or at least about 95% is indicative that the ligand or dAb monomer unfolds reversibly.
  • reversibility of unfolding of the ligand or dAb monomer is determined by preparing a ligand or dAb monomer solution and plotting heat unfolding and refolding curves.
  • the ligand or dAb monomer solution can be prepared in any suitable solvent, such as an aqueous buffer that has a pH suitable to allow the ligand or dAb monomer to dissolve (e.g., pH that is about 3 units above or below the isoelectric point (pi)).
  • the ligand or dAb monomer solution is concentrated enough to allow unfolding/folding to be detected.
  • the ligand or dAb monomer solution can be about 0.1 ⁇ M to about 100 ⁇ M, or preferably about 1 ⁇ M to about 10 ⁇ M. If the melting temperature (Tm) of the ligand or dAb monomer is known, the solution can be heated to about ten degrees below the Tm (Tm-IO) and folding assessed by ellipticity or fluorescence ⁇ e.g., far-UV CD scan from 200 nm to 250 nm, fixed wavelength CD at 235 nm or 225 nm; tryptophan fluorescent emission spectra at 300 to 450 nm with excitation at 298 nm) to provide 100% relative folded ligand or dAb monomer.
  • Tm melting temperature
  • the solution is then heated to at least ten degrees above Tm (Tm+ 10) in predetermined increments (e.g., increases of about 0.1 to about 1 degree), and ellipticity or fluorescence is determined at each increment.
  • the ligand or dAb monomer is refolded by cooling to at least Tm-10 in predetermined increments and ellipticity or fluorescence determined at each increment. If the melting temperature of the ligand or dAb monomer is not known, the solution can be unfolded by incrementally heating from about 25 0 C to about 100 0 C and then refolded by incrementally cooling to at least about 25°C, and ellipticity or fluorescence at each heating and cooling increment is determined.
  • the dAb monomer does not comprise a Camelid immunoglobulin variable domain, or one or more framework amino acids that are unique to immunoglobulin variable domains encoded by Camelid germline antibody gene segments.
  • the ligand or dAb monomer is secreted in a quantity of at least about
  • the dAb monomer is secreted in a quantity of at least about 0.75 mg/L, at least about 1 mg/L, at least about 4 mg/L, at least about 5 mg/L, at least about 10 mg/L, at least about 15 mg/L, at least about 20 mg/L, at least about 25 mg/L, at least about 30 mg/L, at least about 35 mg/L, at least about 40 mg/L, at least about 45 mg/L, or at least about 50 mg/L, or at least about 100 mg/L, or at least about 200 mg/L, or at least about 300 mg/L, or at least about 400 mg/L, or at least about 500 mg/L, or at least about 600 mg/L, or at least about 700 mg/L, or at least about 800 mg/L, at least about 900 mg/L, or at least about lg/L when expressed in E.
  • the dAb monomer is secreted in a quantity of at least about 1 mg/L to at least about lg/L, at least about 1 mg/L to at least about 750 mg/L, at least about 100 mg/L to at least about 1 g/L, at least about 200 mg/L to at least about 1 g/L, at least about 300 mg/L to at least about 1 g/L, at least about 400 mg/L to at least about 1 g/L, at least about 500 mg/L to at least about lg/L, at least about 600 mg/L to at least about 1 g/L, at least about 700 mg/L to at least about 1 g/L, at least about 800 mg/L to at least about lg/L, or at least about 900 mg/L to at least about lg/L when expressed in E.
  • the ligands and dAb monomers described herein can be secretable when expressed in E. coli or in Pichia species ⁇ e.g., P. pastoris), they can be produced using any suitable method, such as synthetic chemical methods or biological production methods that do not employ E. coli or Pichia species.
  • the ligand of the invention can comprise a dAb monomer that binds serum albumin (SA) with a K d of InM to 500 ⁇ M (ie, x 10 "9 to 5 x 10 "4 ), preferably 100 nM to 10 ⁇ M.
  • SA serum albumin
  • K d affinity
  • the affinity (eg K d and/or K off as measured by surface plasmon resonance, eg using BiaCore) of the second dAb for its target is from 1 to 100000 times (preferably 100 to 100000, more preferably 1000 to 100000, or 10000 to 100000 times) the affinity of the first dAb for SA.
  • the first dAb binds SA with an affinity of approximately 10 ⁇ M, while the second dAb binds its target with an affinity of 100 pM.
  • the serum albumin is human serum albumin (HSA).
  • the first dAb (or a dAb monomer) binds SA (eg, HSA) with a K d of approximately 50, preferably 70, and more preferably 100, 150 or 200 nM.
  • the dAb monomer that binds SA resists aggregation, unfolds reversibly and/or comprises a framework region as described above for dAb monomers that bind IL-IRl.
  • the antigen-binding fragment of an antibody that binds serum albumin is a dAb that binds human serum albumin.
  • the dAb binds human serum albumin and competes for binding to albumin with a dAb selected from the group consisting of DOM7m-16 (SEQ ID NO:723), DOM7m-12 (SEQ ID NO:724), DOM7m-26 (SEQ ID NO:725), DOM7r-l (SEQ ID NO:726), DOM7r-3 (SEQ ID NO:727), DOM7r-4 (SEQ ID NO:728), DOM7r-5 (SEQ ID NO.729), DOM7r- 7 (SEQ ID NO:730), DOM7r-8 (SEQ ID NO:731), DOM7h-2 (SEQ ID NO:732), DOM7h-3 (SEQ ID NO:733), DOM7h-4 (SEQ ID NO:734), DOM7h-6 (SEQ ID NO:723), DOM7
  • the dAb binds human serum albumin and comprises an amino acid sequence that has at least about 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% amino acid sequence identity with the amino acid sequence of a dAb selected from the group consisting of DOM7m-16 (SEQ ID NO:723), DOM7m-12 (SEQ ID NC-.724), DOM7m-26 (SEQ ID NO:725), DOM7r-l (SEQ ID NO:726), DOM7r-3 (SEQ ID NO:727), DOM7r-4 (SEQ ID NO:728), DOM7r-5 (SEQ ID NO:729), DOM7r-7 (SEQ ID NO:730), DOM7r-8 (SEQ ID NO:731), DOM7h-2 (SEQ ID NO:732), DOM7h-3 (SEQ ID NO:733)
  • the dAb that binds human serum albumin can comprise an amino acid sequence that has at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% amino acid sequence identity with DOM7h-2 (SEQ ID NO:732), DOM7h-3 (SEQ ID NO:733), DOM7h-4 (SEQ ID NO:734), DOM7h-6 (SEQ ID NO:735), DOM7h-l (SEQ ID NO.736), DOM7h-7 (SEQ ID NO:737), DOM7h-8 (SEQ ID NO:746), DOM7r-13 (SEQ ID NO:747), DOM7r-14 (SEQ ID NO:748), DOM7h-22 (SEQ ID NO:739), DOM7h-23 (SEQ ID NO:740), DOM7h-24 (SEQ ID NO:741), DOM7h-25 (SEQ ID NO:742),
  • DOM7h-26 (SEQ ID NO:743), DOM7h-21 (SEQ ID NO:744), and DOM7h-27 (SEQ ID NO:745).
  • Amino acid sequence identity is preferably determined using a suitable sequence alignment algorithm and default parameters, such as BLAST P (Karlin and Altschul, Proc. Natl. Acad. Sd. USA S7(6):2264-2268 (1990)).
  • the dAb is a V ⁇ dAb that binds human serum albumin and has a amino acid sequence selected from the group consisting of DOM7h-2 (SEQ ID NO:732), DOM7h-3 (SEQ ID NO:733), DOM7h-4 (SEQ ID NO:734), DOM7h-6 (SEQ ID NO.735), DOM7h-l (SEQ ID NO:736), DOM7h-7 (SEQ ID NO:737), DOM7h-8 (SEQ ID NO:746), DOM7r-13 (SEQ ID NO:747), and DOM7r-14 (SEQ ID NO:748), or a V H dAb that has an amino acid sequence selected from the group consisting of DOM7h-22 (SEQ ID NO:739), DOM7h-23 (SEQ ID NO:740), DOM7h-24 (SEQ ID NO:741), DOM7h-25 (SEQ ID NO:742), DOM7h-26 (SEQ ID NO:732
  • Suitable Camelid V HH that bind serum albumin include those disclosed in WO 2004/041862 (Ablynx N.V.) and herein (SEQ ID NOS:768-784).
  • the Camelid V HH binds human serum albumin and comprises an amino acid sequence that has at least about 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% amino acid sequence identity with SEQ ID NO.768, SEQ ID NO.769, SEQ ID NO:770, SEQ ID NO:771, SEQ ID NO:772, SEQ ID NO:773, SEQ ID NO:774, SEQ ID NO:775, SEQ ID NO:776, SEQ ID NO:777, SEQ ID NO:778, SEQ ID NO:779, SEQ ID NO:780, SEQ ID NO:781, SEQ ID NO:782, SEQ ID NO.783, or SEQ ID NO:
  • the ligand comprises an anti-serum albumin dAb that competes with any anti-serum albumin dAb disclosed herein for binding to serum albumin (e.g. , human serum albumin) .
  • serum albumin e.g. , human serum albumin
  • TNFRl Tumor Necrosis Factor Receptor 1
  • the ligand of the invention can comprise a dAb monomer that binds TNFRl .
  • TNFRl is a transmembrane receptor containing an extracellular region that binds ligand and an intracellular domain that lacks intrinsic signal transduction activity but can associate with signal transduction molecules.
  • the complex of TNFRl with bound TNF contains three TNFRl chains and three TNF chains. (Banner et al, Cell, 73(3) 431-445 (1993).)
  • the TNF ligand is present as a trimer, which is bound by three TNFRl chains. (Id.)
  • the three TNFRl chains are clustered closely together in the receptor-ligand complex, and this clustering is a prerequisite to TNFRl -mediated signal transduction.
  • multivalent agents that bind TNFRl can induce TNFRl clustering and signal transduction in the absence of TNF and are commonly used as TNFRl agonists.
  • TNFRl agonists See, e.g., Belka et al., EMBO, J4(6):l 156-1165 (1995); Mandik- Nayak et al, J. Immunol, 167:1920-192% (2001).
  • multivalent agents that bind TNFRl are generally not effective antagonists of TNFRl even if they block the binding of TNF ⁇ to TNFRl .
  • the extracellular region of TNFRl comprises a thirteen amino acid amino- terminal segment (amino acids 1-13 of SEQ ID NO.996 (human); amino acids 1-13 of SEQ ID NO:997 (mouse)), Domain 1 (amino acids 14-53 of SEQ ID NO:996 (human); amino acids 14-53 of SEQ ID NO:997 (mouse)), Domain 2 (amino acids 54-97 of SEQ ID NO:996 (human); amino acids 54-97 of SEQ ID NO:996 (human); amino acids 54-97 of SEQ ID NO:997 (mouse)), Domain 3 (amino acids 98-138 of SEQ ID NO:996 (human); amino acid 98-138 of SEQ ID NO:997 (mouse)), and Domain 4 (amino acids 139-167 of SEQ ID NO.996 (human); amino acids 139-167 of SEQ ID NO: 997 (mouse)) which is followed by a membrane-proximal region (amino acids 168-18
  • TNFRl is shed from the surface of cells in vivo through a process that includes proteolysis of TNFRl in Domain 4 or in the membrane-proximal region (amino acids 168-182 of SEQ ID NO:213, amino acids 168-183 of SEQ ID NO:215, respectively), to produce a soluble form of TNFRl .
  • Soluble TNFRl retains the capacity to bind TNF ⁇ , and thereby functions as an endogenous inhibitor of the activity of TNF ⁇ .
  • the extracellular region of human TNFRl has the following amino acid sequence.
  • the extracellular region of murine (Mus musculus) TNFRl has the following amino acid sequence. LVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGT FTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCS PCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQ DSGTA (SEQ ID NO:997)
  • Anti-TNFRl dAbs suitable for use in the invention have binding specificity for Tumor Necrosis Factor Receptor 1 (TNFRl ; p55; CD 120a).
  • TNFRl Tumor Necrosis Factor Receptor 1
  • the antagonists of TNFRl do not have binding specificity for Tumor Necrosis Factor 2 (TNFR2), or do not substantially antagonize TNFR2.
  • an antagonist of TNFRl does not substantially antagonize TNFR2 when the antagonist (1 nM, 10 nM, 100 nM, 1 ⁇ M, 10 ⁇ M or 100 ⁇ M) results in no more than about 5% inhibition of TNFR2 -mediated activity induced by TNF ⁇ (100 pg/ml) in a standard cell assay.
  • the dAb monomer that binds TNFRl resists aggregation, unfolds reversibly and/or comprises a framework region as described above for dAb monomers that bind IL- 1 Rl .
  • Suitable anti-TNFRl dAbs and ligands that comprise such dAbs do not induce cross-linking or clustering of TNFRl on the surface of cells which can lead to activation of the receptor and signal transduction.
  • the ligand comprises an anti-TNFRl dAb that binds to Domain 1 of TNFRl .
  • the ligand comprises an anti-TNFRl dAb that binds to Domain 1 of TNFRl, and competes with TAR2m-21-23 for binding to mouse TNFRl or competes with TAR2h- 205 for binding to human TNFRl .
  • the anti-TNFRl dAb binds Domain 2 and/or Domain 3 of TNFRl.
  • the anti-TNFRl dAb competes with TAR2h-10- 27, TAR2h-131-8, TAR2h-15-8, TAR2h-35-4, TAR2h-154-7, TAR2h-154-10 or TAR2h-l 85-25 for binding to TNFRl (e.g., human and/or mouse TNFRl).
  • anti-TNFRl dAb monomers suitable for use in the ligands of the invention bind TNFRl with a K d of 30O nM to 5 pM (ie, 3 x 10 "7 to 5 x 10 "12 M), preferably 50 nM to 20 pM, more preferably 5 nM to 200 pM and most preferably 1 nM to 100 pM, for example 1 x 10 " M or less, preferably 1 x 10 " M or less, more preferably 1 x 10 "9 M or less, advantageously 1 x 10 "10 M or less and most preferably 1 x 10 "1 ' M or less; and/or a K o ff rate constant of 5 x 10 "1 s "1 to 1 x 10 "7 s " ', preferably 1 x 10 "2 s "1 to 1 x 10 "6 s “1 , more preferably 5 x 10 "3 s "1 to 1 x 10 "5 for example 5 x
  • Certain anti-TNFRl dAb monomers suitable for use in the invention specifically bind human TNFRl with a K d of 50 nM to 20 pM, and a K Off rate constant of 5x10 "1 s "1 to 1x10 "7 s "1 , as determined by surface plasmon resonance. Some anti-TNFRl dAb monomers inhibit binding of TNF ⁇ to TNFRl .
  • some anti-TNFRl dAb monomers inhibit binding of TNF ⁇ to TNFRl with an inhibitory concentration 50 (IC50) of 500 nM to 50 pM, preferably 100 nM to 50 pM, more preferably 10 nM to 100 pM, advantageously 1 nM to 100 pM; for example 50 nM or less, preferably 5 nM or less, more preferably 500 pM or less, advantageously 200 pM or less, and most preferably 100 pM or less.
  • IC50 inhibitory concentration 50
  • the TNFRl is human TNFRl .
  • anti-TNFRl dAb monomers do not inhibit binding of TNF ⁇ to TNFRl, but inhibit signal transduction mediated through TNFRl .
  • an anti-TNFRl dAb monomer can inhibit TNF ⁇ -induced clustering of TNFRl, which precedes signal transduction through TNFRl .
  • certain anti-TNFRl dAb monomers can bind TNFRl and inhibit TNFRl -mediated signaling, but do not'substantially inhibit binding of TNF ⁇ to TNFRl .
  • the anti-TNFRl dAb monomer inhibits TNF ⁇ -induced crosslinking or clustering of TNFRl on the surface of a cell.
  • Such dAbs are advantageous because they can antagonize cell surface TNFRl but do not substantially reduce the inhibitory activity of endogenous soluble TNFRl.
  • the anti-TNFRl dAb can bind TNFRl, but inhibits binding of TNF ⁇ to TNFRl in a receptor binding assay by no more that about 10%, no more that about 5%, no more than about 4%, no more than about 3%, no more than about 2%, or no more than about 1%.
  • the anti-TNFRl dAb inhibits TNF ⁇ -induced crosslinking of TNFRl and/or TNFRl -mediated signaling in a standard cell assay by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 99%. Accordingly, administering a ligand that comprises such a dAb monomer to a mammal in need thereof can complement the endogenous regulatory pathways that inhibit the activity TNF ⁇ and the activity of TNFRl in vivo.
  • the ligand or dAb monomer neutralizes (inhibits the activity of) TNFRl in a standard assay (e.g., the standard L929 or standard HeLa IL-8 assays described herein) with a neutralizing dose 50 (ND50) of 500 nM to 50 pM, preferably 100 nM to 50 pM, more preferably 10 nM to 100 pM, advantageously 1 nM to 100 pM; for example 50 nM or less, preferably 5 nM or less, more preferably 500 pM or less, advantageously 200 pM or less, and most preferably 100 pM or less.
  • ND50 neutralizing dose 50
  • the anti-TNFRl dAb monomer binds TNFRI and antagonizes the activity of the TNFRl in a standard cell assay (e.g., the standard L929 or standard HeLa IL-8 assays described herein) with an ND50 of ⁇ 100 nM, and at a concentration of ⁇ lO ⁇ M the dAb agonizes the activity of the TNFRl by ⁇ 5% in the assay.
  • a standard cell assay e.g., the standard L929 or standard HeLa IL-8 assays described herein
  • the anti-TNFRl dAb monomer specifically binds TNFRl with a K d described herein and inhibits lethality in a standard mouse LPS/D- galactosamine-induced septic shock model (i.e., prevents lethality or reduces lethality by at least about 10%, as compared with a suitable control).
  • the anti-TNFRl dAb monomer inhibits lethality by at least about 25%, or by at least about 50%, as compared to a suitable control in a standard mouse LPS/D-galactosamine-induced septic shock model when administered at about 5 mg/kg or more preferably about 1 mg/kg.
  • the anti-TNFRl dAb monomer or a ligand of the invention that comprises such a dAb monomer does not substantially agonize TNFRl (act as an agonist of TNFRl) in a standard cell assay, such as the standard L929 or standard HeLa IL-8 assays described herein (i.e., when present at a concentration of 1 nM, 10 nM, 100 nM, 1 ⁇ M, 10 ⁇ M, 100 ⁇ M, 1000 ⁇ M or 5,000 ⁇ M, results in no more than about 5 % of the TNFR 1 -mediated activity induced by TNF ⁇ (100 pg/ml) in the assay).
  • a standard cell assay such as the standard L929 or standard HeLa IL-8 assays described herein
  • the ligand comprises a domain antibody (dAb) monomer that specifically binds Tumor Necrosis Factor Receptor 1 (TNFRl, p55, CD 120a) with a K d of 300 nM to 5 pM, and comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% homologous to the amino acid sequence or a dAb selected from the group consisting of TAR2h-12(SEQ ID NO:785),TAR2h- 13(SEQ ID NO:786),TAR2h-14(SEQ ID NO:787),TAR2h-16(SEQ ID NO:788),TAR2h- 17(SEQ ID NO:789),TAR2h-18(SEQ ID NO:790),TAR2h-19(
  • the ligand comprises a domain antibody (dAb) monomer that specifically binds Tumor Necrosis Factor Receptor 1 (TNFRl, p55, CD120a) with a K d of 300 iiM to 5 pM, and competes for binding to human TNFRl with a dAb selected from the group consisting of TAR2h-12(SEQ ID NO:785),TAR2h-13(SEQ ID NO:786),TAR2h-14(SEQ ID NO:787),TAR2h-16(SEQ ID NO:788),TAR2h-17(SEQ ID NO:789),TAR2h-18(SEQ ID NO:790),TAR2h-19(SEQ ID NO:791),TAR2h-20 (SEQ ID NO:792),TAR2h-21 (SEQ ID NO:793),TAR2h-22 (SEQ ID NO:794),TAR2h-23 (SEQ ID NO:795),TAR2h-24 (SEQ ID NO:796),TAR2h-25 (
  • the ligand comprises a domain antibody (dAb) monomer that specifically binds Tumor Necrosis Factor Receptor 1 (TNFRl, p55, CD120a) with a K d of 300 nM to 5 pM, and comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% homologous to the amino acid sequence or a dAb selected from the group consisting of TAR2m-14(SEQ ID NO:983),TAR2m- 15(SEQ ID NO:984),TAR2m-19(SEQ ID NO:985), TAR2m-20(SEQ ID NO:986), TAR2m-21(SEQ ID NO:987),TAR2m-24(SEQ ID NO:988), TAR2m-21-
  • the ligand comprises a dAb monomer that binds TNFRl and competes with any of the dAbs disclosed herein for binding to TNFRl (e.g., mouse and/or human TNFRl).
  • TNFRl e.g., mouse and/or human TNFRl.
  • the invention also relates to dAb monomers that are resistant to protease (e.g., serine protease, cysteine protease, matrix metalloprotease, pepsin, trypsin, elastase, chymotrypsin, carboxypeptidase, caihepsin (e.g., cathepsin G), proteinase 3) degradation and to ligands that comprise a protease resistant dAb.
  • protease e.g., serine protease, cysteine protease, matrix metalloprotease
  • proteases present in a tissue, organ or animal (e.g., in the lung, in or adjacent to a tumor) can increase.
  • This increase in proteases can result in accelerated degradation and inactivation of endogenous proteins and of therapeutic peptides, polypeptides and proteins that are administered.
  • agents that have potential for in vivo use e.g., use in treating, diagnosing or preventing disease
  • have only limited efficacy because they are rapidly degraded and inactivated by proteases.
  • the invention relates to a dAb or a ligand comprising a dAb that is resistant to protease degradation.
  • the protease resistant dAbs of the invention provide several advantages. For example, a protease resistant dAb can be administered to a subject and remain active in vivo longer than protease sensitive agents. Accordingly, protease resistant dAbs will remain functional for a period of time that is sufficient to produce biological effects.
  • a dAb that is resistant to protease degradation is not substantially degraded by a protease when incubated with the protease under conditions suitable for protease activity for at least about 2 hours, at least about 3 hours, at least about 4 hours, at least about 5 hours, at least about 6 hours, at least about 7 hours, at least about 8 hours, at least about 9 hours, at least about 10 hours, at least about 11 hours, at least about 12 hours, at least about 24 hours, at least about 36 hours, or at least about 48 hours.
  • a dAb is not substantially degraded when no more than about 25%, no more than about 20%, no more than about 15%, no more than about 14%, no more than about 13%, no more than about 12%, no more than about 11%, no more than about 10%, no more than about 9%, no more than about 8%, no more than about 7% no more than about 6%, no more than about 5%, no more than about 4%, no more than about 3%, no more than about 2%, no more than about 1%, or substantially none of the protein is degraded by protease after incubation with the protease for at least about 2 hours. Protein degradation can be assessed using any suitable method, for example, by SDS-PAGE as described herein.
  • Protease resistance can be assessed using any suitable method.
  • a protease can be added to a solution of dAb in a suitable buffer ⁇ e.g., PBS) to produce a dAb/protease solution, such as a solution of at least about 0.01% (w/w) protease, about 0.01% to about 5% (w/w) protease, about 0.05% to about 5% (w/w) protease, about 0.1% to about 5% (w/w) protease, about 0.5% to about 5% (w/w) protease, about 1% to about 5% (w/w) protease, at least about 0.01% (w/w) protease, at least about 0.02% (w/w) protease, at least about 0.03% (w/w) protease, at least about 0.04% (w/w) protease, at least about 0.05% (w/w) protease, at least about 0.06%
  • the dAb/protease mixture can be incubated at a suitable temperature for protease activity ⁇ e.g., at 37°C) and samples can be taken at time intervals ⁇ e.g., at 1 hour, 2 hours, 3 hours, etc.) and the protease reaction stopped.
  • the samples can then be analyzed for protein degradation using any suitable method, such as SDS-PAGE analysis. The results can be used to establish a time course of degradation.
  • the protease resistant dAb is resistant to degradation by elastase.
  • the elastase resistant dAb is not substantially degraded when incubated at 37°C in a 0.04% (w/w) solution of elastase for a period of at least about 2 hours.
  • the elastase resistant dAb is not substantially degraded when incubated at 37°C in a 0.04% (w/w) solution of elastase for a period of at least about 12 hours.
  • the elastase resistant dAb is not substantially degraded when incubated at 37 0 C in a 0.04% (w/w) solution of elastase for a period of at least about 24 hours, at least about 36 hours, or at least about 48 hours.
  • the protease resistant dAb is resistant to degradation by trypsin.
  • the trypsin resistant dAb is not substantially degraded when incubated at 37 0 C in a 0.04% (w/w) solution of trypsin for a period of at least about 2 hours.
  • the trypsin resistant dAb is not substantially degraded when incubated at 37 0 C in a 0.04% (w/w) solution of trypsin for a period of at least about 3 hours.
  • the trypsin resistant dAb is not substantially degraded when incubated at 37°C in a 0.04% (w/w) solution of trypsin for a period of at least about 4 hours, at least about 5 hours, at least about 6 hours, at least about 7 hours, at least about 8 hours, at least about 9 hours, at least about 10 hours, at least about 11 hours, or at least about 12 hours.
  • the invention does not include TARl -5- 19 disclosed in WO 2004/081026.
  • the protease resistant dAb is a light chain variable domain.
  • the protease resistant dAb can be a VK or a V ⁇ .
  • Protease resistance of dAbs can correlate with the melting temperature (Tm) of the dAbs. Generally, a higher melting temperature correlates with protease resistance.
  • the protease resistant dAb has a Tm between about 4O 0 C and about 95 0 C, about 40 0 C and about 85 0 C, about 4O 0 C and about 8O 0 C, about 45 0 C and about 95°C, about 45°C and about 85 0 C, 45 0 C and about 8O 0 C, at least about 4O 0 C, at least about 45 0 C, at least about 5O 0 C, at least about 55°C, at least about 6O 0 C, at least about 65 0 C, at least about 7O 0 C, at least about 75 0 C, at least about 80 0 C, at least about 85 0 C, at least about 9O 0 C, or at least about 95°C.
  • the protease resistant dAb can have binding specificity for any desired target, such as human or animal proteins, including cytokines, growth factors, cytokine receptors, growth factor receptors, enzymes (e.g., proteases), co-factors for enzymes and DNA binding proteins, lipids and carbohydrates.
  • cytokines cytokines
  • growth factors cytokine receptors
  • growth factor receptors e.g., growth factor receptors
  • enzymes e.g., proteases
  • co-factors for enzymes and DNA binding proteins lipids and carbohydrates.
  • Suitable targets including cytokines, growth factors, cytokine receptors, growth factor receptors and other proteins include but are not limited to: ApoE, Apo-SAA, BDNF, Cardiotrophin-1 , CEA, CD40, CD40 Ligand, CD56, CD38, CD138, EGF, EGF receptor, ENA-78, Eotaxin, Eotaxin-2, Exodus-2, FAP ⁇ , FGF-acidic, FGF-basic, fibroblast growth factor- 10, FLT3 ligand, Fractalkine (CX3C), GDNF, G-CSF, GM-CSF, GF- ⁇ l, human serum albumin, insulin, IFN- ⁇ , IGF-I, IGF-II, IL-I ⁇ , IL-I ⁇ , IL-I receptor, IL-I receptor type 1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8 (72 a.a.), IL-8 (77 a
  • the protease resistant dAbs binds a target in pulmonary tissue, such as a target selected from the group consisting of TNFRl, IL-I, IL-IR, IL-4, IL-4R, IL-5, IL-6, IL-6R, IL-8, IL-8R, IL-9, IL-9R, IL-IO, IL-12 IL-12R, IL-13, IL- 13R ⁇ l, IL-13Ra2, IL-15, IL-15R, IL-16, IL-17R, IL-17, IL-18, IL-18R, IL-23 IL-23R, IL-25, CD2, CD4, CDl Ia, CD23, CD25, CD27, CD28, CD30, CD40, CD40L, CD56, CD138, ALK5, EGFR, FcERl, TGFb, CCL2, CCL18, CEA, CR8, CTGF, CXCL12 (SDF-I), chymase, FGF
  • the protease resistant dAbs of the invention can be administered in vivo and will remain functional longer than compounds that are not similarly resistant to protease degradation.
  • a dAb of the invention that is resistant to protease degradation can be used for treating an inflammatory disease (e.g., by local delivery to the lung by pulmonary administration, e.g., by intranasal administration, e.g., by inhalation).
  • an inflammatory disease e.g., by local delivery to the lung by pulmonary administration, e.g., by intranasal administration, e.g., by inhalation.
  • a dAb monomer that is resistant to protease degradation.
  • the invention also relates to a dAb monomer that is resistant to protease degradation for use in therapy, diagnosis and/or prophylaxis, and to the use of such a dAb monomer of the invention for the manufacture of a medicament for treating a disease described herein (e.g., and inflammatory disease, arthritis, a respiratory disease).
  • a disease described herein e.g., and inflammatory disease, arthritis, a respiratory disease
  • the protease resistant dAb monomer can be used for treating an inflammatory disease, arthritis, or a respiratory disease via pulmonary administration.
  • the protease resistant dAb monomer can also be used in the manufacture of a medicament for the treatment of an inflammatory disease, arthritis, or a respiratory disease wherein the dAb monomer is administered via pulmonary administration.
  • protease resistant dAbs for pulmonary administration are elastase resistant, trypsin resistant, or elastase resistant and trypsin resistant.
  • the protease resistant dAb monomer binds IL-IRl and inhibits binding of IL-I (e.g., IL-l ⁇ and/or IL-l ⁇ ) to the receptor but does not inhibit binding of IL-lra to IL-IRl, and to ligands comprising such dAb monomers.
  • IL-I e.g., IL-l ⁇ and/or IL-l ⁇
  • Such dAb monomers are useful as therapeutic agents for treating inflammation, disease or other condition mediated in whole or in part by biological functions induced by binding of IL-I to IL-IRl (e.g., local or systemic inflammation, elaboration of inflammatory mediators (e.g., IL-6, 11-8, TNF), fever, activation immune cells (e.g., lymphocytes, neutrophils), anorexia, hypotension, leucopenia, thrombocytopenia.)
  • the protease resistant dAb monomers can bind IL-IRl and inhibit IL-IRl function without interfering with endogenous IL-IRl inhibitory pathways, such as binding of endogenous IL-lra to endogenous IL-IRl.
  • a dAb monomer can be administered to a subject to complement the endogenous regulatory pathways that inhibit the activity of IL-IRl or IL-I in vivo.
  • protease resistant dAb monomers that bind and IL-IRl do not inhibit binding of IL-lra to IL-IRl provide advantages for use as diagnostic agents, because they can be used to bind and detect, quantify or measure IL-IRl in a sample and will not compete with IL- lra in the sample for binding to IL-IRl . Accordingly, an accurate determination of whether or how much IL-IRl is in the sample can be made.
  • Protease resistant dAb monomers e.g., elastase resistant dAb monomers
  • IL-I e.g., IL-l ⁇ and/or IL-I ⁇
  • agents e.g., other dAbs, small organic molecules
  • an agent or collection of agents to be tested for the ability to inhibit binding of IL-I to IL-IRl are assayed in a competitive IL-IRl receptor binding assay, such as the receptor binding assay described herein.
  • Agents that inhibit binding of IL-I to IL-IRl in such an assay can then be studied in a similar competitive IL-IRl receptor binding assay to see if they compete with a dAb monomer that binds IL-IRl but does not inhibit binding of IL-lra to IL-IRl.
  • Competitive binding in such an assay indicates that the agent binds IL-IRl and inhibits binding of IL-I to the receptor but does not inhibit binding of IL-lra to the receptor.
  • the protease resistant dAb binds IL-IRl and competes with any of the dAbs disclosed herein for binding to IL-IRl (e.g., human IL-IRl).
  • the dAb is resistant to at least elastase and/or trypsin.
  • the protease reisistant dAb competes for binding to IL-
  • IRl with an anti-IL-lRl dAb wherein the anti-IL-lRl dAb comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% homologous to the amino acid sequence or a dAb selected from the group consisting of SEQ ID NO:1 through SEQ ID NO:349.
  • the protease resistant dAb competes for binding to IL- IRl with an anti-IL-lRl dAb, wherein the anti-IL-lRl dAb comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% homologous to the amino acid sequence or a dAb selected from the group consisting of SEQ ID NO:1 or SEQ ID NO:2.
  • the protease resistant dAb competes for binding to IL-IRl with an anti-IL-lRl dAb
  • the anti-IL-lRl dAb comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% homologous to the amino acid sequence or a dAb selected from the group consisting of SEQ ID NO:3 through SEQ ID NO:7.
  • the protease resistant dAb competes for binding to IL-IRl with an anti-IL-lRl dAb
  • the anti-IL-lRl dAb comprises the amino acid sequence DOM4-130-54 (SEQ ID NO: 7) or an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% homologous to DOM4-130-54 (SEQ ID NO:7).
  • Ligands and dAb monomers can be formatted as mono or multispecific antibodies or antibody fragments or into mono or multispecific non-antibody structures.
  • Suitable formats include, any suitable polypeptide structure in which an antibody variable domain or one or more of the CDRs thereof can be incorporated so as to confer binding specificity for antigen on the structure.
  • a variety of suitable antibody formats are known in the art, such as, IgG-like formats, chimeric antibodies, humanized antibodies, human antibodies, single chain antibodies, bispecific antibodies, antibody heavy chains, antibody light chains, homodimers and heterodimers of antibody heavy chains and/or light chains, antigen-binding fragments of any of the foregoing ⁇ e.g., a Fv fragment (e.g., single chain Fv (scFv), a disulfide bonded Fv), a Fab fragment, a Fab' fragment, a F(ab') 2 fragment), a single variable domain (e.g., V H , V L , V HH ), a dAb, and modified versions of any of the foregoing (e.g., modified by the covalent attachment of polyalkylene glycol (e.g., polyethylene glycol, polypropylene glycol, polybutylene glycol) or other suitable polymer).
  • polyalkylene glycol e.g., polyethylene glycol
  • ligands, including dAb monomers, dimers and trimers can be linked to an antibody Fc region, comprising one or both of C H 2 and C H 3 domains, and optionally a hinge region.
  • vectors encoding ligands linked as a single nucleotide sequence to an Fc region may be used to prepare such polypeptides.
  • Ligands and dAb monomers can also be combined and/or formatted into non- antibody multi-ligand structures to form multivalent complexes, which bind target molecules, thereby providing superior avidity.
  • natural bacterial receptors such as SpA can been used as scaffolds for the grafting of CDRs to generate ligands which bind specifically to one or more epitopes. Details of this procedure are described in US 5,831,012.
  • Other suitable scaffolds include those based on fibronectin and affibodies. Details of suitable procedures are described in WO 98/58965.
  • Other suitable scaffolds include lipocallin and CTLA4, as described in van den Beuken et ah, J. MoI. Biol.
  • Protein scaffolds may be combined; for example, CDRs may be grafted on to a CTLA4 scaffold and used together with immunoglobulin V H or V L domains to form a ligand. Likewise, fibronectin, lipocallin and other scaffolds may be combined.
  • antibody chains and formats e.g., IgG-like formats, chimeric antibodies, humanized antibodies, human antibodies, single chain antibodies, bispecific antibodies, antibody heavy chains, antibody light chains, homodimers and heterodimers of antibody heavy chains and/or light chains
  • suitable expression constructs and/or culture of suitable cells e.g., hybridomas, heterohybridomas, recombinant host cells containing recombinant constructs encoding the format).
  • formats such as antigen-binding fragments of antibodies or antibody chains can be prepared by expression of suitable expression constructs or by enzymatic digestion of antibodies, for example using papain or pepsin.
  • the ligand can be formatted as a dual specific ligand or a multispecific ligand, for example as described in WO 03/002609, the entire teachings of which are incorporated herein by reference.
  • the dual specific ligands comprise immunoglobulin single variable domains that have different binding specificities.
  • Such dual specific ligands can comprise combinations of heavy and light chain domains.
  • the dual specific ligand may comprise a V H domain and a V L domain, which may be linked together in the form of an scFv (e.g., using a suitable linker such as Gly 4 Ser), or formatted into a bispecific antibody or antigen-binding fragment theref (e.g. , F(ab') 2 fragment).
  • the dual specific ligands do not comprise complementary V H /V L pairs which form a conventional two chain antibody antigen-binding site that binds antigen or epitope co-operatively.
  • the dual format ligands comprise a V H /V L complementary pair, wherein the V domains have different bindng specificities.
  • the dual specific ligands may comprise one or more C H or C L domains if desired.
  • a hinge region domain may also be included if desired.
  • Such combinations of domains may, for example, mimic natural antibodies, such as IgG or IgM, or fragments thereof, such as Fv, scFv, Fab or F(ab') 2 molecules.
  • the dual specific ligand of the invention comprises only two variable domains although several such ligands may be incorporated together into the same protein, for example two such ligands can be incorporated into an IgG or a multimeric immunoglobulin, such as IgM.
  • a plurality of dual specific ligands are combined to form a multimer. For example, two different dual specific ligands are combined to create a tetra-specific molecule.
  • variable regions of a dual- specific ligand produced according to the method of the present invention may be on the same polypeptide chain, or alternatively, on different polypeptide chains.
  • variable regions are on different polypeptide chains, then they may be linked via a linker, generally a flexible linker (such as a polypeptide chain), a chemical linking group, or any other method known in the art.
  • the multispecific ligand possesses more than one epitope binding specificity.
  • the multi-specific ligand comprises two or more epitope binding domains, such dAbs or non-antibody protein domain comprising a binding site for an epitope, e.g., an affibody, an SpA domain, an LDL receptor class A domain, an EGF domain, an avimer.
  • Multispecific ligands can be formatted further as described herein.
  • the ligand is an IgG-like format.
  • Such formats have the conventional four chain structure of an IgG molecule (2 heavy chains and two light chains), in which one or more of the variable regions (V H and or V L ) have been replaced with a dAb or single variable domain of a desired specificity.
  • each of the variable regions (2 V H regions and 2 V L regions) is replaced with a dAb or single variable domain.
  • the dAb(s) or single variable domain(s) that are included in an IgG- like format can have the same specificity or different specificities.
  • the IgG-like format is tetravalent and can have one, two, three or four specificities.
  • the IgG-like format can be monospecific and comprises 4 dAbs that have the same specificity; bispecific and comprises 3 dAbs that have the same specificity and another dAb that has a different specificity; bispecific and comprise two dAbs that have the same specificity and two dAbs that have a common but different specificity; trispecific and comprises first and second dAbs that have the same specificity, a third dAb with a different specificity and a fourth dAb with a different specificity from the first, second and third dAbs; or tetraspecific and comprise four dAbs that each have a different specificity.
  • Antigen-binding fragments of IgG-like formats e.g., Fab, F(ab') 2 , Fab', Fv, scFy
  • the IgG-like formats or antigen-binding fragments thereof do not crosslink TNFRl.
  • the ligand such as a dAb monomers
  • Such fragments Fvs, disulphide bonded Fvs, Fabs, scFvs, dAbs
  • Fvs, disulphide bonded Fvs, Fabs, scFvs, dAbs are rapidly cleared from the body, which can limit clinical applications.
  • Small ligands such as a dAb monomer
  • a dAb monomer can be formatted as a larger antigen- binding fragment of an antibody or as an antibody (e.g., formatted as a Fab, Fab', F(ab) 2 , F(ab') 2 , IgG, scFv).
  • a ligand e.g., dAb monomer
  • Ligands can also be formatted to have a larger hydrodynamic size, for example, by attachment of a polyalkyleneglycol group (e.g., polyethyleneglycol (PEG) group, polypropylene glycol, polybutylene glycol), serum albumin, transferrin, transferrin receptor or at least the transferrin-binding portion thereof, an antibody Fc region, or by conjugation to an antibody domain.
  • a polyalkyleneglycol group e.g., polyethyleneglycol (PEG) group, polypropylene glycol, polybutylene glycol
  • serum albumin e.g., transferrin, transferrin receptor or at least the transferrin-binding portion thereof, an antibody Fc region, or by conjugation to an antibody domain.
  • the ligand e.g., dAb monomer
  • the PEGylated ligand binds IL-IRl with substantially the same affinity as the same ligand that is not PEGylated.
  • the ligand can be a PEGylated dAb monomer that binds IL-IRl, wherein the PEGylated dAb monomer binds IL-IRl with an affinity that differs from the affinity of dAb in unPEGylated form by no more than a factor of about 1000, preferably no more than a factor of about 100, more preferably no more than a factor of about 10, or with substantially unchanged affinity relative to the unPEGylated form.
  • Hydrodynamic size of the ligands (e.g., dAb monomers and multimers) of the invention may be determined using methods which are well known in the art. For example, gel filtration chromatography may be used to determine the hydrodynamic size of a ligand. Suitable gel filtration matrices for determining the hydrodynamic sizes of ligands, such as cross-linked agarose matrices, are well known and readily available.
  • the size of a ligand format e.g., the size of a PEG moiety attached to a dAb monomer), can be varied depending on the desired application.
  • the hydrodynamic size of the ligand can be increased, for example by formatting as and Ig-like protein or by addition of a 30 to 60 IdDa PEG moiety (e.g., linear or branched PEG 30 to 40 kDa PEG, such as addition of two 2OkDa PEG moieties.)
  • the hydrodynamic size of a ligand (e.g., dAb monomer) and its serum half-life can also be increased by conjugating or linking the ligand to a binding domain (e.g., antibody or antibody fragment) that binds an antigen or epitope that increases half-life in vivo, as described herein.
  • the ligand e.g., dAb monomer
  • an anti-serum albumin or anti-neonatal Fc receptor antibody or antibody fragment e.g an anti-SA or anti-neonatal Fc receptor dAb, Fab, Fab' or scFv, or to an anti-SA affibody or anti-neonatal Fc receptor affibody.
  • albumin, albumin fragments or albumin variants for use in a ligand according to the invention are described in WO 2005/077042A2, which is incorporated herein by reference in its entirety.
  • albumin, albumin fragments or albumin variants can be used in the present invention:
  • Albumin fragment or variant comprising or consisting of amino acids 1-387 of SEQ ID NO:1 in WO 2005/077042A2; • Albumin, or fragment or variant thereof, comprising an amino acid sequence selected from the group consisting of: (a) amino acids 54 to 61 of SEQ ID NO:1 in WO 2005/077042A2; (b) amino acids 76 to 89 of SEQ ID NO:1 in WO 2005/077042A2; (c) amino acids 92 to 100 of SEQ ID NO:1 in WO 2005/077042A2; (d) amino acids 170 to 176 of SEQ ID NO:1 in WO 2005/077042A2; (e) amino acids 247 to 252 of SEQ ID NO: 1 in WO
  • albumin fragments and analogs for use in a ligand according to the invention are described in WO 03/076567 A2, which is incorporated herein by reference in its entirety.
  • albumin, fragments or variants can be used in the present invention:
  • Human serum albumin as described in WO 03/076567A2, eg, in figure 3 (this sequence information being explicitly incorporated into the present disclosure by reference); • Human serum albumin (HA) consisting of a single non-glycosylated polypeptide chain of 585 amino acids with a formula molecular weight of 66,500 (See, Meloun, et al, FEBS Letters 58:136 (1975); Behrens, et al, Fed. Proc. 34:591 (1975); Lawn, et al, Nucleic Acids Research 9:6102-6114 (1981); Minghetti, et al., J. Biol. Chem. 261:6147 (1986)); • A polymorphic variant or analog or fragment of albumin as described in
  • An albumin fragment or variant as described in EP 322094 eg, HA(I -373., HA(l-388), HA(l-389), HA(l-369), and HA(1-419) and fragments between 1- 369 and 1-419; • An albumin fragment or variant as described in EP 399666, eg, HA(I -177) and
  • a (one or more) half-life extending moiety eg, albumin, transferrin and fragments and analogues thereof
  • it can be conjugated using any suitable method, such as, by direct fusion to the IL- IRl -binding moiety (eg, anti-IL-lRl dAb or antibody fragment), for example by using a single nucleotide construct that encodes a fusion protein, wherein the fusion protein is encoded as a single polypeptide chain with the half-life extending moiety located N- or C- terminally to the IL-IRl binding moiety.
  • conjugation can be achieved by using a peptide linker between moieties, eg, a peptide linker as described in WO 03/076567A2 or WO 2004/003019 (these linker disclosures being incorporated by reference in the present disclosure to provide examples for use in the present invention).
  • a polypeptide that enhances serum half-life in vivo is a polypeptide which occurs naturally in vivo and which resists degradation or removal by endogenous mechanisms which remove unwanted material from the organism ⁇ e.g., human).
  • a polypeptide that enhances serum half-life in vivo can be selected from proteins from the extracellular matrix, proteins found in blood, proteins found at the blood brain barrier or in neural tissue, proteins localized to the kidney, liver, lung, heart, skin or bone, stress proteins, disease-specific proteins, or proteins involved in Fc transport.
  • Suitable polypeptides that enhance serum half-life in vivo include, for example, transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins (see U.S. Patent No. 5,977,307, the teachings of which are incorporated herein by reference), brain capillary endothelial cell receptor, transferrin, transferrin receptor (e.g., soluble transferrin receptor), insulin, insulin-like growth factor 1 (IGF 1) receptor, insulin-like growth factor 2 (IGF 2) receptor, insulin receptor, blood coagulation factor X, ⁇ l- antitrypsin and HNF l ⁇ .
  • transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins see U.S. Patent No. 5,977,307, the teachings of which are incorporated herein by reference
  • brain capillary endothelial cell receptor e.g., transferrin receptor
  • transferrin receptor e.g., soluble transferrin receptor
  • insulin insulin-like growth factor
  • Suitable polypeptides that enhance serum half-life also include alpha- 1 glycoprotein (orosomucoid; AAG), alpha- 1 antichymotrypsin (ACT), alpha- 1 microglobulin (protein HC; AIM), antithrombin III (AT III), apolipoprotein A-I (Apo A- 1), apolipoprotein B (Apo B), ceruloplasmin (Cp), complement component C3 (C3), complement component C4 (C4), Cl esterase inhibitor (Cl INH), C-reactive protein (CRP), ferritin (FER), hemopexin (HPX), lipoprotein(a) (Lp(a)), mannose-binding protein (MBP), myoglobin (Myo), prealbumin (transthyretin; PAL), retinol-binding protein (RBP), and rheumatoid factor (RF).
  • alpha- 1 glycoprotein orosomucoid
  • AAG alpha- 1 antichy
  • Suitable proteins from the extracellular matrix include, for example, collagens, laminins, integrins and fibronectin.
  • Collagens are the major proteins of the extracellular matrix.
  • about 15 types of collagen molecules are currently known, found in different parts of the body, e.g., type I collagen (accounting for 90% of body collagen) found in bone, skin, tendon, ligaments, cornea, internal organs or type II collagen found in cartilage, vertebral disc, notochord, and vitreous humor of the eye.
  • Suitable proteins from the blood include, for example, plasma proteins (e.g., fibrin, ⁇ -2 macroglobulin, serum albumin, fibrinogen (e.g., fibrinogen A, fibrinogen B), serum amyloid protein A 3 haptoglobin, profilin, ubiquitin, uteroglobulin and ⁇ -2- microglobulin), enzymes and enzyme inhibitors ⁇ e.g., plasminogen, lysozyme, cystatin C, alpha- 1 -antitrypsin and pancreatic trypsin inhibitor), proteins of the immune system, such as immunoglobulin proteins (e.g., IgA, IgD, IgE, IgG, IgM, immunoglobulin light chains (kappa/lambda)), transport proteins (e.g., retinol binding protein, ⁇ -1 microglobulin), defensins ⁇ e.g., beta-defensin 1, neutrophil defensin 1, neutrophil de
  • Suitable proteins found at the blood brain barrier or in neural tissue include, for example, melanocortin receptor, myelin, ascorbate transporter and the like.
  • Suitable polypeptides that enhances serum half-life in vivo also include proteins localized to the kidney (e.g., polycystin, type IV collagen, organic anion transporter Kl, Heymann's antigen), proteins localized to the liver (e.g., alcohol dehydrogenase, G250), proteins localized to the lung (e.g., secretory component, which binds IgA), proteins localized to the heart (e.g., HSP 27, which is associated with dilated cardiomyopathy), proteins localized to the skin (e.g., keratin), bone specific proteins such as morphogenic proteins (BMPs), which are a subset of the transforming growth factor ⁇ superfamily of proteins that demonstrate osteogenic activity (e.g., BMP-2, BMP -4, BMP-5, BMP-6, BMP
  • Suitable disease-specific proteins include, for example, antigens expressed only on activated T-cells, including LAG-3 (lymphocyte activation gene), osteoprotegerin ligand (OPGL; sec Nature 402, 304-309 (1999)), OX40 (a member of the TNF receptor family, expressed on activated T cells and specifically up-regulated in human T cell leukemia virus type-I (HTLV-I)-producing cells; see Immunol. 165 (1 ):263-70 (2000)).
  • LAG-3 lymphocyte activation gene
  • osteoprotegerin ligand OPGL
  • OX40 a member of the TNF receptor family, expressed on activated T cells and specifically up-regulated in human T cell leukemia virus type-I (HTLV-I)-producing cells; see Immunol. 165 (1 ):263-70 (2000)).
  • Suitable disease-specific proteins also include, for example, metalloproteases (associated with arthritis/cancers) including CG6512 Drosophila, human paraplegin, human FtsH, human AFG3L2, murine ftsH; and angiogenic growth factors, including acidic fibroblast growth factor (FGF-I), basic fibroblast growth factor (FGF-2), vascular endothelial growth factor/vascular permeability factor (VEGF/VPF), transforming growth factor- ⁇ (TGF ⁇ ), tumor necrosis factor-alpha (TNF- ⁇ ), angiogenin, interleukin-3 (IL-3), interleukin-8 (IL-8), platelet-derived endothelial growth factor (PD-ECGF), placental growth factor (PlGF), midkine platelet-derived growth factor-BB (PDGF), and fractalkine.
  • metalloproteases associated with arthritis/cancers
  • FGF-I acidic fibroblast growth factor
  • FGF-2 basic fibroblast growth factor
  • Suitable polypeptides that enhance serum half-life in vivo also include stress proteins such as heat shock proteins (HSPs).
  • HSPs are normally found intracellularly. When they are found extracellularly, it is an indicator that a cell has died and spilled out its contents. This unprogrammed cell death (necrosis) occurs when as a result of trauma, disease or injury, extracellular HSPs trigger a response from the immune system. Binding to extracellular HSP can result in localizing the compositions of the invention to a disease site.
  • Suitable proteins involved in Fc transport include, for example, Brambell receptor (also known as FcRB). This Fc receptor has two functions, both of which are potentially useful for delivery.
  • the functions are (1) transport of IgG from mother to child across the placenta (2) protection of IgG from degradation thereby prolonging its serum half-life. It is thought that the receptor recycles IgG from endosomes. (See, Holliger et al, Nat Biotechnol 15(7):632-6 (1997).)
  • nucleic Acid Molecules Vectors and Host Cells
  • the invention also provides isolated and/or recombinant nucleic acid molecules that encode the anti-IL-lRl ligands and dAb monomers described herein, including dual specific ligands ⁇ e.g., ligands that bind IL-IRl and serum albumin; ligands that bind IL- IRl and TNFRl) and multispecific ligands ⁇ e.g., ligands that bind IL-IRl, serum albumin and TNFRl).
  • the invention also provides isolated and/or recombinant nucleic acid molecules that encode a protease ⁇ e.g., ⁇ e.g., pepsin, trypsin, elastase, chymotrypsin, carboxypeptidase, cathepsin ⁇ e.g., cathepsin G) and proteinase 3) resistant dAb monomer or a ligand that comprises a protease resistant dAb monomer as described herein.
  • a protease ⁇ e.g., pepsin, trypsin, elastase, chymotrypsin, carboxypeptidase, cathepsin ⁇ e.g., cathepsin G
  • proteinase proteinase
  • the isolated and/or recombinant nucleic acid comprises a nucleotide sequence that encodes a domain antibody (dAb) that specifically binds IL-IR, inhibits binding of IL-I (e.g., IL- l ⁇ and/or IL-I ⁇ ) and IL- Ira to IL-IRl, and comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% homologous to the amino acid sequence or a dAb selected from the group consisting of DOM4-122-23 (SEQ ID NO:1), DOM4-122-24 (SEQ ID NO:2), DOM4- 122 (SEQ ID NO:95), DOM4-122-1 (SEQ ID NO:96), DOM4-122-2 (SEQ ID NO:
  • the isolated and/or recombinant nucleic acid comprises a nucleotide sequence that encodes a domain antibody (dAb) monomer that specifically binds IL-IRl and inhibits binding of IL-I to the receptor, wherein said nucleotide sequence has at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% nucleotide sequence identity with a nucleotide sequence selected from the group consisting of DOM4-122-23 (SEQ ID NO:1), DOM4-122-24 (SEQ ID NO:2), DOM4-122 (SEQ ID NO:95), DOM4-122-1 (SEQ ID NO:96), DOM4-122-2 (SEQ ID NO:97), DOM4-122-3 (SEQ ID NO:98), DOM4-122-4 (SEQ ID NO
  • DOM4-122-6 (SEQ ID NO:101), DOM4-122-7 (SEQ ID NO:102), DOM4-122-8 (SEQ ID NO:103), DOM4-122-9 (SEQ ID NO:104), DOM4-122-10 (SEQ ID NO:105), DOM4-122-11 (SEQ ID NO:106), DOM4-122-12 (SEQ ID NO:107), DOM4-122-13 (SEQ ID NO:108), DOM4-122-14 (SEQ ID NO:109), DOM4-122-15 (SEQ ID NO:110), DOM4-122-16 (SEQ ID NO:111), DOM4-122-17 (SEQ ID NO:112), DOM4-122-18
  • the isolated and/or recombinant nucleic acid comprises a nucleotide sequence that encodes a protease (e.g., (e.g., pepsin, trypsin, elastase, chymotrypsin, carboxypeptidase, cathepsin (e.g., cathepsin G) and proteinase 3) resistant dAb as described herein.
  • a protease e.g., (e.g., pepsin, trypsin, elastase, chymotrypsin, carboxypeptidase, cathepsin (e.g., cathepsin G) and proteinase 3) resistant dAb as described herein.
  • the invention also provides a vector comprising a recombinant nucleic acid molecule of the invention.
  • the vector is an expression vector comprising one or more expression control elements or sequences that are operably linked to the recombinant nucleic acid of the invention
  • the invention also provides a recombinant host cell comprising a recombinant nucleic acid molecule or vector of the invention.
  • Suitable vectors e.g., plasmids, phagmids
  • expression control elements e.g., plasmids, phagmids
  • host cells and methods for producing recombinant host cells of the invention are well-known in the art, and examples are further described herein.
  • Suitable expression vectors can contain a number of components, for example, an origin of replication, a selectable marker gene, one or more expression control elements, such as a transcription control element (e.g., promoter, enhancer, terminator) and/or one or more translation signals, a signal sequence or leader sequence, and the like.
  • expression control elements and a signal sequence can be provided by the vector or other source.
  • the transcriptional and/or translational control sequences of a cloned nucleic acid encoding an antibody chain can be used to direct expression.
  • a promoter can be provided for expression in a desired host cell. Promoters can be constitutive or inducible. For example, a promoter can be operably linked to a nucleic acid encoding an antibody, antibody chain or portion thereof, such that it directs transcription of the nucleic acid.
  • suitable promoters for procaryotic e.g., lac, tac, T3, T7 promoters for E. coli
  • expression vectors typically comprise a selectable marker for selection of host cells carrying the vector, and, in the case of a replicable expression vector, an origin of replication.
  • Genes encoding products which confer antibiotic or drug resistance are common selectable markers and may be used in procaryotic cells (e.g., lactamase gene (ampicillin resistance), Tet gene for tetracycline resistance) and eucaryotic cells (e.g., neomycin (G418 or geneticin), gpt (mycophenolic acid), ampicillin, or hygromycin resistance genes).
  • Dihydro folate reductase marker genes permit selection with methotrexate in a variety of hosts.
  • auxotrophic markers of the host e.g., LEU2, URAS, HIS3
  • vectors which are capable of integrating into the genome of the host cell such as retroviral vectors
  • Suitable expression vectors for expression in mammalian cells and prokaryotic cells E. coli
  • insect cells Drosophila Schnieder S2 cells, Sf9
  • yeast P. methanolica, P. pastoris, S. cerevisiae
  • Suitable host cells can be prokaryotic, including bacterial cells such as E.
  • eukaryotic cells such as fungal or yeast cells (e.g., Pichia pastoris, Aspergillus sp., Saccharomyces cerevisiae, Schizosaccharomyces pombe, Neurospora crassa), or other lower eukaryotic cells, and cells of higher eukaryotes such as those from insects (e.g., Drosophila Schnieder S2 cells, Sf9 insect cells (WO 94/26087 (O'Connor)), mammals (e.g. , COS cells, such as COS-I (ATCC Accession No. CRL-1650) and COS-7 (ATCC Accession No.
  • COS cells such as COS-I (ATCC Accession No. CRL-1650) and COS-7 (ATCC Accession No.
  • CRL- 1651 CHO (e.g., ATCC Accession No. CRL-9096, CHO DG44 (Urlaub, G. and Chasin, LA., Proc. Natl. Acac. ScL USA, 77(7):4216-4220 (1980))), 293 (ATCC Accession No. CRL-1573), HeLa (ATCC Accession No. CCL-2), CVl (ATCC Accession No. CCL-70), WOP (Dailey, L., et all, J. Virol, 54:739-749 (1985), 3T3, 293T (Pear, W. S., et al, Proc. Natl. Acad.
  • CHO e.g., ATCC Accession No. CRL-9096, CHO DG44 (Urlaub, G. and Chasin, LA., Proc. Natl. Acac. ScL USA, 77(7):4216-4220 (1980)
  • 293 ATCC Accession No. CRL
  • the host cell is an isolated host cell and is not part of a multicellular organism ⁇ e.g., plant or animal). In preferred embodiments, the host cell is a non-human host cell.
  • the invention also provides a method for producing a ligand ⁇ e.g., dAb monomer, dual-specific ligand, multispecific ligand) of the invention, comprising maintaining a recombinant host cell comprising a recombinant nucleic acid of the invention under conditions suitable for expression of the recombinant nucleic acid, whereby the recombinant nucleic acid is expressed and a ligand is produced.
  • the method further comprises isolating the ligand.
  • Ligands ⁇ e.g., dual specific ligands, dAb monomers
  • Ligands can be prepared according to previously established techniques, used in the field of antibody engineering, for the preparation of scFv, "phage" antibodies and other engineered antibody molecules. Techniques for the preparation of antibodies are for example described in the following reviews and the references cited therein: Winter & Milstein, (1991) Nature 349:293-299; Pluckthun (1992) Immunological Reviews 130:151-188; Wright et al, (1992) Crti. Rev. Immunol .12:125-168; Holliger, P. & Winter, G. (1993) Curr. Op. Biotechn. 4, 446-449; Carter, et al. (1995) J.
  • Suitable techniques employed for selection of antibody variable domains with a desired specificity employ libraries and selection procedures which are known in the art.
  • Natural libraries Marks et al. (1991) J. MoI. Biol, 222: 581; Vaughan et al. (1996) Nature Biotech., 14: 309) which use rearranged V genes harvested from human B cells are well known to those skilled in the art.
  • Synthetic libraries Hoogenboom & Winter
  • V H and/or VL libraries may be selected against target antigens or epitopes separately, in which case single domain binding is directly selected for, or together.
  • Bacteriophage lambda expression systems may be screened directly as bacteriophage plaques or as colonies of lysogens, both as previously described (Huse et al (1989) Science, 246: 1275; Caton and Koprowski (1990) Proc. Natl. Acad. Sci. U.S.A., 87; Mullinax et al. (1990) Proc. Natl. Acad. Sci. U.S.A., 87: 8095; Persson et al (1991) Proc. Natl. Acad. Sci.
  • U.S.A., 88: 2432 U.S.A., 88: 2432
  • expression systems can be used to screen up to 10 6 different members of a library, they are not really suited to screening of larger numbers (greater than 10 6 members).
  • selection display systems which enable a nucleic acid to be linked to the polypeptide it expresses.
  • a selection display system is a system that permits the selection, by suitable display means, of the individual members of the library by binding the generic and/or target ligands.
  • Selection protocols for isolating desired members of large libraries are known in the art, as typified by phage display techniques.
  • Such systems in which diverse peptide sequences are displayed on the surface of filamentous bacteriophage (Scott and Smith (1990) Science, 249: 386), have proven useful for creating libraries of antibody fragments (and the nucleotide sequences that encoding them) for the in vitro selection and amplification of specific antibody fragments that bind a target antigen (McCafferty et al, WO 92/01047).
  • the nucleotide sequences encoding the variable regions are linked to gene fragments which encode leader signals that direct them to the periplasmic space of E.
  • phagebodies lambda phage capsids
  • An advantage of phage-based display systems is that, because they are biological systems, selected library members can be amplified simply by growing the phage containing the selected library member in bacterial cells. Furthermore, since the nucleotide sequence that encode the polypeptide library member is contained on a phage or phagemid vector, sequencing, expression and subsequent genetic manipulation is relatively straightforward.
  • RNA molecules are selected by alternate rounds of selection against a target ligand and PCR amplification (Tuerk and Gold (1990) Science, 249: 505; Ellington and Szostak (1990) Nature, 346: 818).
  • a similar technique may be used to identify DNA sequences which bind a predetermined human transcription factor (Thiesen and Bach (1990) Nucleic Acids Res., 18: 3203; Beaudry and Joyce (1992) Science, 257: 635;
  • a still further category of techniques involves the selection of repertoires in artificial compartments, which allow the linkage of a gene with its gene product.
  • a selection system in which nucleic acids encoding desirable gene products may be selected in microcapsules formed by water-in-oil emulsions is described in WO99/02671, WO00/40712 and Tawfik & Griffiths (1998) Nature Biotechnol 16(7), 652-6.
  • Genetic elements encoding a gene product having a desired activity are compartmentalised into microcapsules and then transcribed and/or translated to produce their respective gene products (RNA or protein) within the microcapsules.
  • Genetic elements which produce gene product having desired activity are subsequently sorted. This approach selects gene products of interest by detecting the desired activity by a variety of means.
  • Libraries intended for selection may be constructed using techniques known in the art, for example as set forth above, or may be purchased from commercial sources. Libraries which are useful in the present invention are described, for example, in WO99/20749.
  • PCR polymerase chain reaction
  • PCR is performed using template DNA (at least lfg; more usefully, 1-1000 ng) and at least 25 pmol of oligonucleotide primers; it may be advantageous to use a larger amount of primer when the primer pool is heavily heterogeneous, as each sequence is represented by only a small fraction of the molecules of the pool, and amounts become limiting in the later amplification cycles.
  • a typical reaction mixture includes: 2 ⁇ l of DNA, 25 pmol of oligonucleotide primer, 2.5 ⁇ l of 1OX PCR buffer 1 (Perkin-Elmer, Foster City, CA), 0.4 ⁇ l of 1.25 ⁇ M dNTP, 0.15 ⁇ l (or 2.5 units) of Taq DNA polymerase (Perkin Elmer, Foster City, CA) and deionized water to a total volume of 25 ⁇ l.
  • Mineral oil is overlaid and the PCR is performed using a programmable thermal cycler. The length and temperature of each step of a PCR cycle, as well as the number of cycles, is adjusted in accordance to the stringency requirements in effect.
  • Annealing temperature and timing are determined both by the efficiency with which a primer is expected to anneal to a template and the degree of mismatch that is to be tolerated; obviously, when nucleic acid molecules are simultaneously amplified and mutagenised, mismatch is required, at least in the first round of synthesis.
  • the ability to optimise the stringency of primer annealing conditions is well within the knowledge of one of moderate skill in the art.
  • An annealing temperature of between 30 0 C and 72 0 C is used.
  • Initial denaturation of the template molecules normally occurs at between 92 0 C and 99 0 C for 4 minutes, followed by 20-40 cycles consisting of denaturation (94-99 0 C for 15 seconds to 1 minute), annealing (temperature determined as discussed above; 1-2 minutes), and extension (72 0 C for 1-5 minutes, depending on the length of the amplified product).
  • Final extension is generally for 4 minutes at 72 0 C, and may be followed by an indefinite (0-24 hour) step at 4 0 C.
  • Immunoglobulin variable domains useful in the invention may be combined by a variety of methods known in the art, including covalent and non-covalent methods.
  • Preferred methods include the use of polypeptide linkers, as described, for example, in connection with scFv molecules (Bird et al, (1988) Science 242:423-426). Discussion of suitable linkers is provided in Bird et al. Science 242, 423-426; Hudson et al , Journal Immunol Methods 231 (1999) 177-189; Hudson et al, Proc Nat Acad Sci USA 85, 5879-5883. Linkers are preferably flexible, allowing the two single domains to interact.
  • the linkers used in diabodies, which are less flexible, may also be employed (Holliger et al. , (1993) Proc Nat Acad Sci (USA) 90:6444-6448).
  • the linker employed is not an immunoglobulin hinge region.
  • Variable domains may be combined using methods other than linkers. For example, the use of disulphide bridges, provided through naturally-occurring or engineered cysteine residues, may be exploited to stabilise V H "V H> VL"V L or VH-V L dimers (Reiter et al. , (1994) Protein Eng. 7:697-704) or by remodelling the interface between the variable domains to improve the "fit” and thus the stability of interaction (Ridgeway et al, (1996) Protein Eng. 7:617-621; Zhu et al, (1997) Protein Science 6:781-788). Other techniques for joining or stabilising variable domains of immunoglobulins, and in particular antibody V H domains, may be employed as appropriate.
  • a ligand e.g., dAb monomer, dual -specific ligand
  • binding is tested using monoclonal phage ELISA.
  • Phage ELISA may be performed according to any suitable procedure: an exemplary protocol is set forth below.
  • phage produced at each round of selection can be screened for binding by ELISA to the selected antigen or epitope, to identify "polyclonal" phage antibodies. Phage from single infected bacterial colonies from these populations can then be screened by ELISA to identify "monoclonal” phage antibodies. It is also desirable to screen soluble antibody fragments for binding to antigen or epitope, and this can also be undertaken by ELISA using reagents, for example, against a C- or N-terminal tag (see for example Winter et al. (1994) Ann. Rev. Immunology 12, 433-55 and references cited therein.
  • the diversity of the selected phage monoclonal antibodies may also be assessed by gel electrophoresis of PCR products (Marks et al. 1991, supra; Nissim et al. 1994 supra), probing (Tomlinson et al, 1992) J. MoI. Biol. 227, 116) or by sequencing of the vector DNA.
  • variable domains are selected from V-gene repertoires for instance using phage display technology as herein described, then these variable domains comprise a universal framework region, such that they may be recognised by a specific generic ligand as herein defined.
  • the use of universal frameworks, generic ligands and the like is described in WO99/20749.
  • V-gene repertoires are used variation in polypeptide sequence is preferably located within the structural loops of the variable domains.
  • the polypeptide sequences of either variable domain may be altered by DNA shuffling or by mutation in order to enhance the interaction of each variable domain with its complementary pair.
  • DNA shuffling is known in the art and taught, for example, by Stemmer, 1994, Nature 370: 389-391 and U.S. Patent No. 6,297,053, both of which are incoiporated herein by reference. Other methods of mutagenesis are well known to those of skill in the art.
  • nucleic acid molecules and vector constructs required for selection, preparation and formatting ligands may be constructed and manipulated as set forth in standard laboratory manuals, such as Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual, Cold Spring Harbor, USA.
  • vector refers to a discrete element that is used to introduce heterologous DNA into cells for the expression and/or replication thereof. Methods by which to select or construct and, subsequently, use such vectors are well known to one of ordinary skill in the art. Numerous vectors are publicly available, including bacterial plasmids, bacteriophage, artificial chromosomes and episomal vectors. Such vectors may be used for simple cloning and mutagenesis; alternatively gene expression vector is employed.
  • a vector of use according to the invention may be selected to accommodate a polypeptide coding sequence of a desired size, typically from 0.25 kilobase (kb) to 40 kb or more in length.
  • a suitable host cell is transformed with the vector after in vitro cloning manipulations.
  • Each vector contains various functional components, which generally include a cloning (or "polylinker") site, an origin of replication and at least one selectable marker gene. If a given vector is an expression vector, it additionally possesses one or more of the following: an enhancer element, promoter, transcription termination and signal sequences, each positioned in the vicinity of the cloning site, such that they are operatively linked to the gene encoding a ligand according to the invention.
  • Both cloning and expression vectors generally contain nucleic acid sequences that enable the vector to replicate in one or more selected host cells.
  • this sequence is one that enables the vector to replicate independently of the host chromosomal DNA and includes origins of replication or autonomously replicating sequences.
  • origins of replication or autonomously replicating sequences are well known for a variety of bacteria, yeast and viruses.
  • the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, the 2 micron plasmid origin is suitable for yeast, and various viral origins ⁇ e.g., SV 40, adenovirus) are useful for cloning vectors in mammalian cells.
  • the origin of replication is not needed for mammalian expression vectors unless these are used in mammalian cells able to replicate high levels of DNA, such as COS cells.
  • a cloning or expression vector may contain a selection gene also referred to as selectable marker.
  • This gene encodes a protein necessary for the survival or growth of transformed host cells grown in a selective culture medium. Host cells not transformed with the vector containing the selection gene will therefore not survive in the culture medium.
  • Typical selection genes encode proteins that confer resistance to antibiotics and other toxins, e.g., ampicillin, neomycin, methotrexate or tetracycline, complement auxotrophic deficiencies, or supply critical nutrients not available in the growth media.
  • an E. c ⁇ /z-selectable marker for example, the ⁇ -lactamase gene that confers resistance to the antibiotic ampicillin, is of use.
  • E. coli plasmids such as pBR322 or a pUC plasmid such as pUC18 or pUC19.
  • Expression vectors usually contain a promoter that is recognised by the host organism and is operably linked to the coding sequence of interest. Such a promoter may be inducible or constitutive.
  • operably linked refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner.
  • a control sequence "operably linked" to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.
  • Promoters suitable for use with prokaryotic hosts include, for example, the ⁇ - lactamase and lactose promoter systems, alkaline phosphatase, the tryptophan (trp) promoter system and hybrid promoters such as the tac promoter. Promoters for use in bacterial systems will also generally contain a Shine-Delgarno sequence operably linked to the coding sequence.
  • the preferred vectors are expression vectors that enable the expression of a nucleotide sequence corresponding to a polypeptide library member.
  • selection with the first and/or second antigen or epitope can be performed by separate propagation and expression of a single clone expressing the polypeptide library member or by use of any selection display system.
  • the preferred selection display system is bacteriophage display.
  • phage or phagemid vectors may be used, eg pITl or pIT2.
  • Leader sequences useful in the invention include pelB, stll, ompA, phoA, bla and pelA.
  • phagemid vectors which have an E.
  • the vector contains a ⁇ -lactamase gene to confer selectivity on the phagemid and a lac promoter upstream of an expression cassette that consists (N to C terminal) of a pelB leader sequence (which directs the expressed polypeptide to the periplasmic space), a multiple cloning site (for cloning the nucleotide version of the library member), optionally, one or more peptide tag (for detection), optionally, one or more TAG stop codon and the phage protein pill.
  • a ⁇ -lactamase gene to confer selectivity on the phagemid and a lac promoter upstream of an expression cassette that consists (N to C terminal) of a pelB leader sequence (which directs the expressed polypeptide to the periplasmic space), a multiple cloning site (for cloning the nucleotide version of the library member), optionally, one or more peptide tag (for detection), optionally, one or more TAG stop codon and the phage protein pill
  • the vector is able to replicate as a plasmid with no expression, produce large quantities of the polypeptide library member only or produce phage, some of which contain at least one copy of the polypeptide-pIII fusion on their surface.
  • Construction of vectors encoding ligands according to the invention employs conventional ligation techniques. Isolated vectors or DNA fragments are cleaved, tailored, and religated in the form desired to generate the required vector. If desired, analysis to confirm that the correct sequences are present in the constructed vector can be performed in a known fashion. Suitable methods for constructing expression vectors, preparing in vitro transcripts, introducing DNA into host cells, and performing analyses for assessing expression and function are known to those skilled in the ait.
  • telomere sequence The presence of a gene sequence in a sample is detected, or its amplification and/or expression quantified by conventional methods, such as Southern or Northern analysis, Western blotting, dot blotting of DNA, RNA or protein, in situ hybridisation, immunocytochemistry or sequence analysis of nucleic acid or protein molecules. Those skilled in the art will readily envisage how these methods may be modified, if desired.
  • Skeletons may be based on immunoglobulin molecules or may be non- immunoglobulin in origin as set forth above.
  • Preferred immunoglobulin skeletons as herein defined includes any one or more of those selected from the following: an immunoglobulin molecule comprising at least (i) the CL (kappa or lambda subclass) domain of an antibody; or (ii) the CHl domain of an antibody heavy chain; an immunoglobulin molecule comprising the CHl and CH2 domains of an antibody heavy chain; an immunoglobulin molecule comprising the CHl, CH2 and CH3 domains of an antibody heavy chain; or any of the subset (ii) in conjunction with the CL (kappa or lambda subclass) domain of an antibody.
  • a hinge region domain may also be included.
  • Such combinations of domains may, for example, mimic natural antibodies, such as IgG or IgM, or fragments thereof, such as Fv, scFv, Fab or F(ab') 2 molecules. Those skilled in the art will be aware that this list is not intended to be exhaustive.
  • Each epitope binding domain comprises a protein scaffold and one or more CDRs which are involved in the specific interaction of the domain with one or more epitopes.
  • an epitope binding domain according to the present invention comprises three CDRs.
  • Suitable protein scaffolds include any of those selected from the group consisting of the following: those based on immunoglobulin domains, those based on fibronectin, those based on aff ⁇ bodies, those based on CTLA4, those based on chaperones such as GroEL, those based on lipocallin and those based on the bacterial Fc receptors SpA and SpD. Those skilled in the art will appreciate that this list is not intended to be exhaustive.
  • the members of the immunoglobulin superfamily all share a similar fold for their polypeptide chain.
  • antibodies are highly diverse in terms of their primary sequence
  • comparison of sequences and crystallographic structures has revealed that, contrary to expectation, five of the six antigen binding loops of antibodies (Hl, H2, Ll, L2, L3) adopt a limited number of main-chain confo ⁇ nations, or canonical structures (Chothia and Lesk (1987) J. MoI Biol, 196: 901; Chothia et al. (1989) Nature, 342: 877).
  • H3 region is much more diverse in terms of sequence, length and structure (due to the use of D segments), it also forms a limited number of main-chain conformations for short loop lengths which depend on the length and the presence of particular residues, or types of residue, at key positions in the loop and the antibody framework (Martin et al. (1996) J. MoI Biol, 263: 800; Shirai et al (1996) FEBS Letters, 399: 1).
  • Libraries of ligands and/or domains can be designed in which certain loop lengths and key residues have been chosen to ensure that the main-chain conformation of the members is known.
  • these are real conformations of immunoglobulin superfamily molecules found in nature, to minimise the chance that they are nonfunctional, as discussed above.
  • Germline V gene segments serve as one suitable basic framework for constructing antibody or T-cell receptor libraries; other sequences are also of use. Variations may occur at a low frequency, such that a small number of functional members may possess an altered main-chain conformation, which does not affect its function.
  • Canonical structure theory is also of use to assess the number of different main- chain confo ⁇ nations encoded by ligands, to predict the main-chain conformation based on ligand sequences and to choose residues for diversification which do not affect the canonical structure. It is known that, in the human V ⁇ domain, the Ll loop can adopt one of four canonical structures, the L2 loop has a single canonical structure and that 90% of human V ⁇ domains adopt one of four or five canonical structures for the L3 loop (Tomlinson et al. (1995) supra); thus, in the V ⁇ domain alone, different canonical structures can combine to create a range of different main-chain conformations.
  • the Y ⁇ domain encodes a different range of canonical structures for the Ll, L2 and L3 loops and that V ⁇ and Yx domains can pair with any V H domain which can encode several canonical structures for the Hl and H2 loops
  • the number of canonical structure combinations observed for these five loops is very large. This implies that the generation of diversity in the main-chain conformation may be essential for the production of a wide range of binding specificities.
  • by constructing an antibody library based on a single known main-chain conformation it has been found, contrary to expectation, that diversity in the main-chain conformation is not required to generate sufficient diversity to target substantially all antigens.
  • the single main-chain conformation need not be a consensus structure - a single naturally occurring conformation can be used as the basis for an entire library.
  • the dual-specific ligands of the invention possess a single known main-chain conformation.
  • the single main-chain conformation that is chosen is preferably commonplace among molecules of the immunoglobulin superfamily type in question. A conformation is commonplace when a significant number of naturally occurring molecules are observed to adopt it.
  • the natural occurrence of the different main-chain conformations for each binding loop of an immunoglobulin domain are considered separately and then a naturally occurring variable domain is chosen which possesses the desired combination of main-chain conformations for the different loops.
  • the nearest equivalent may be chosen. It is preferable that the desired combination of main-chain conformations for the different loops is created by selecting germline gene segments which encode the desired main-chain conformations. It is more preferable, that the selected germline gene segments are frequently expressed in nature, and most preferable that they are the most frequently expressed of all natural germline gene segments. In designing ligands (e.g., dAbs) or libraries thereof the incidence of the different main-chain conformations for each of the six antigen binding loops maybe considered separately. For Hl, H2, Ll, L2 and L3, a given conformation that is adopted by between 20% and 100% of the antigen binding loops of naturally occurring molecules is chosen.
  • Hl - CS 1 (79% of the expressed repertoire), H2 - CS 3 (46%), Ll - CS 2 of V ⁇ (39%), L2 - CS 1 (100%), L3 - CS 1 of V ⁇ (36%) (calculation assumes a ⁇ : ⁇ ratio of 70:30, Hood et a!. (1967) Cold Spring Harbor Symp. Quant. Biol., 48: 133).
  • H3 loops that have canonical structures a CDR3 length (Kabat et ⁇ /. (1991) Sequences of proteins of immunological interest, U.S.
  • the natural occurrence of combinations of main-chain conformations is used as the basis for choosing the single main-chain conformation.
  • the natural occurrence of canonical structure combinations for any two, three, four, five or for all six of the antigen binding loops can be determined.
  • the chosen conformation is commonplace in naturally occurring antibodies and most preferable that it observed most frequently in the natural repertoire.
  • ligands ⁇ e.g., dAbs) or libraries for use in the invention can be constructed by varying the binding site of the molecule in order to generate a repertoire with structural and/or functional diversity. This means that variants are generated such that they possess sufficient diversity in their structure and/or in their function so that they are capable of providing a range of activities.
  • the desired diversity is typically generated by varying the selected molecule at one or more positions. The positions to be changed can be chosen at random or are preferably selected.
  • variation can then be achieved either by randomisation, during which the resident amino acid is replaced by any amino acid or analogue thereof, natural or synthetic, producing a very large number of variants or by replacing the resident amino acid with one or more of a defined subset of amino acids, producing a more limited number of variants.
  • H3 region of a human tetanus toxoid-binding Fab has been randomised to create a range of new binding specificities (Barbas et al. (1992) Proc. Natl. Acad. ScL USA, 89: 4457). Random or semi-random H3 and L3 regions have been appended to germline V gene segments to produce large libraries with unmutated framework regions (Hoogenboom & Winter (1992) J MoI Biol, 227: 381; Barbas et al (1992) Proc. Natl. Acad. ScL USA, 89: 4457; Nissim et al.
  • loop randomisation has the potential to create approximately more than 10 15 structures for H3 alone and a similarly large number of variants for the other five loops, it is not feasible using current transformation technology or even by using cell free systems to produce a library representing all possible combinations.
  • 6 x 10 10 different antibodies which is only a fraction of the potential diversity for a library of this design, were generated (Griffiths et al. (1994) supra).
  • the residues which are directly involved in creating or modifying the desired function of the molecule are diversified.
  • the function will be to bind a target and therefore diversity should be concentrated in the target binding site, while avoiding changing residues which are crucial to the overall packing of the molecule or to maintaining the chosen main-chain conformation.
  • the binding site for the target is most often the antigen binding site.
  • residues in the antigen binding site are varied.
  • These residues are extremely diverse in the human antibody repertoire and are known to make contacts in high-resolution antibody/antigen complexes.
  • positions 50 and 53 are diverse in naturally occurring antibodies and are observed to make contact with the antigen.
  • the conventional approach would have been to diversify all the residues in the corresponding Complementarity Determining Region (CDRl) as defined by Kabat et al. (1991, supra), some seven residues compared to the two diversified in the library for use according to the invention.
  • CDRl Complementarity Determining Region
  • antibody diversity is the result of two processes: somatic recombination of germline V, D and J gene segments to create a naive primary repertoire (so called germline and junctional diversity) and somatic hypermutation of the resulting rearranged V genes.
  • somatic recombination of germline V, D and J gene segments to create a naive primary repertoire (so called germline and junctional diversity)
  • somatic hypermutation of the resulting rearranged V genes The analysis of human antibody sequences has shown that diversity in the primary repertoire is focused at the centre of the antigen binding site whereas somatic hypermutation spreads diversity to regions at the periphery of the antigen binding site that are highly conserved in the primary repertoire (see Tomlinson et al. (1996) J. MoL Biol, 256: 813).
  • an initial 'naive' repertoire can be created where some, but not all, of the residues in the antigen binding site are diversified.
  • the term "naive” refers to antibody molecules that have no pre-determined target. These molecules resemble those which are encoded by the immunoglobulin genes of an individual who has not undergone immune diversification, as is the case with fetal and newborn individuals, whose immune systems have not yet been challenged by a wide variety of antigenic stimuli.
  • This repertoire is then selected against a range of antigens or epitopes. If required, further diversity can then be introduced outside the region diversified in the initial repertoire. This matured repertoire can be selected for modified function, specificity or affinity.
  • Naive repertoires of binding domains for the construction of ligands in which some or all of the residues in the antigen binding site are varied are known in the art. (See, WO 2004/058821, WO 2004/003019, and WO 03/002609).
  • the "primary" library mimics the natural primary repertoire, with diversity restricted to residues at the centre of the antigen binding site that are diverse in the germline V gene segments (germline diversity) or diversified during the recombination process (junctional diversity).
  • residues which are diversified include, but are not limited to, H50, H52, H52a, H53, H55, H56, H58, H95, H96, H97, H98, L50, L53, L91, L92, L93, L94 and L96.
  • diversity is restricted to residues that are diversified during the recombination process (junctional diversity) or are highly somatically mutated).
  • residues which are diversified include, but are not limited to: H31, H33, H35, H95, H96, H97, H98, L30, L31, L32, L34 and L96.
  • diversification of chosen positions is typically achieved at the nucleic acid level, by altering the coding sequence which specifies the sequence of the polypeptide such that a number of possible amino acids (all 20 or a subset thereof) can be incorporated at that position.
  • the most versatile codon is NNK, which encodes all amino acids as well as the TAG stop codon.
  • the NNK codon is preferably used in order to introduce the required diversity.
  • Other codons which achieve the same ends are also of use, including the NNN codon, which leads to the production of the additional stop codons TGA and TAA.
  • a feature of side-chain diversity in the antigen binding site of human antibodies is a pronounced bias which favours certain amino acid residues. If the amino acid composition of the ten most diverse positions in each of the V H , V K and V*. regions are summed, more than 76% of the side-chain diversity comes from only seven different residues, these being, serine (24%), tyrosine (14%), asparagine (11%), glycine (9%), alanine (7%), aspartate (6%) and threonine (6%).
  • the codons (AGT)(AGC)T, (AGT)(AGC)C and (AGT)(AGC)(CT) - that is, DVT, DVC and DVY, respectively using IUPAC nomenclature - are those closest to the desired amino acid profile: they encode 22% serine and 11 % tyrosine, asparagine, glycine, alanine, aspartate, threonine and cysteine.
  • libraries are constructed using either the DVT, DVC or DVY codon at each of the diversified positions.
  • the invention provides compositions comprising a ligand of the invention ⁇ e.g., dual-specific ligand, multi-specific ligand, dAb monomer) and a pharmaceutically acceptable carrier, diluent or excipient, and therapeutic and diagnostic methods that employ the ligands or compositions of the invention.
  • Ligands e.g., dual-specific ligands, multispecific ligands, dAb monomers
  • Ligands e.g., dual-specific ligands, multispecific ligands, dAb monomers
  • ligands ⁇ e.g., multispecific ligands, dual- specific ligands, dAb monomers
  • ligands according to the invention involve the administration of ligands according to the invention to a recipient mammal, such as a human.
  • Dual-specific and multi-specific ligands e.g., dual-specific antibody formats
  • ligands can allow the cross-linking of two antigens, for example in recruiting cytotoxic T-cells to mediate the killing of tumour cell lines.
  • Substantially pure ligands for example dAb monomers, of at least 90 to 95% homogeneity are preferred for administration to a mammal, and 98 to 99% or more homogeneity is most preferred for pharmaceutical uses, especially when the mammal is a human.
  • the ligands may be used diagnostically or therapeutically (including extracorporeally) or in developing and performing assay procedures, immunofluorescent stainings and the like (Lefkovite and Pernis, (1979 and 1981) Immunological Methods, Volumes I and II, Academic Press, NY).
  • the ligands (e.g., dAb monomers), of the present invention will typically find use in preventing, suppressing or treating inflammation or inflammatory states including acute inflammatory diseases and/or chronic inflammatory diseases.
  • the ligands (e.g., dAb monomers), of the present invention can also be admininstered to inhibit biological processes that are induced by bindng of IL-I (e.g., IL-I ⁇ and/or IL-I ⁇ ) to IL-IRl.
  • IL-I e.g., IL-I ⁇ and/or IL-I ⁇
  • prevention involves administration of the protective composition prior to the induction of the disease.
  • suppression refers to administration of the composition after an inductive event, but prior to the clinical appearance of the disease.
  • Treatment involves administration of the protective composition after disease symptoms become manifest.
  • the ligands of the invention can be administed to prevent, suppress or treat a chronic inflammatory disease, allergic hypersensitivity, cancer, bacterial or viral infection, autoimmune disorders (which include, but are not limited to, Type I diabetes, asthma, multiple sclerosis, systemic lupus erythematosus, inflammatory bowel disease (e.g., Crohn's disease, ulcerative colitis), myasthenia gravis and Behcet's syndrome), psoriasis, endometriosis, and abdominal adhesions (e.g., post abdominal surgery).
  • autoimmune disorders which include, but are not limited to, Type I diabetes, asthma, multiple sclerosis, systemic lupus erythematosus, inflammatory bowel disease (e.g., Crohn's disease, ulcerative colitis), myasthenia gravis and Behcet's syndrome), psoriasis, endometriosis, and abdominal adhesions (e.g., post abdominal surgery).
  • the ligands of the invention can be administed to prevent, suppress or treat lung inflammation, chronic obstructive respiratory disease (e.g., chronic bronchitis, chronic obstructive bronchitis, emphysema), asthma (e.g., steroid resistant asthma), pneumonia (e.g., bacterial pneumonia, such as Staphylococcal pneumonia), hypersensitivity pneumonitis, pulmonary infiltrate with eosinophilia, environmental lung disease, bronchiectasis, cystic fibrosis, interstitial lung disease, primary pulmonary hypertension, pulmonary thromboembolism, disorders of the pleura, disorders of the mediastinum, disorders of the diaphragm, hypoventilation, hyperventilation, sleep apnea, acute respiratory distress syndrome, mesothelioma, sarcoma, graft rejection, graft versus host disease, lung cancer, allergic rhinitis, allergy
  • the ligands of the invention can be administed to prevent, suppress or treat osteoarthritis or inflammatory arthritis.
  • “Inflammatory arthritis” refers to those diseases of joints where the immune system is causing or exacerbating inflammation in the joint, and includes rheumatoid arthritis, juvenile rheumatoid arthritis, and spondyloarthropathies, such as ankylosing spondylitis, reactive arthritis, Reiter's syndrome, psoriatic arthritis, psoriatic spondylitis, enteropathic arthritis, enteropathic spondylitis, juvenile-onset spondyloarthropathy and undifferentiated spondyloarthropathy.
  • Inflammatory arthritis is generally characterized by infiltration of the synovial tissue and/or synovial fluid by leukocytes.
  • Ligands according to the invention e.g., dual-specific ligands, multispecific ligands, dAb monomers
  • extracellular targets involved in endocytosis e.g ⁇ Clathrin
  • dual or multispecific ligands provide a means by which a binding domain (e.g., a dAb monomer) that is able to bind to an intracellular target can be delivered to an intracellular environment.
  • This strategy requires, for example, a dual-specific ligand with physical properties that enable it to remain functional inside the cell.
  • a well folding ligand may not need to be disulphide free.
  • dual- or multi-specific ligands may be used to target cytokine receptors and other molecules which cooperate synergistically in therapeutic situations in the body of an organism.
  • the invention therefore provides a method for synergising the activity of two or more binding domains ⁇ e.g., dAbs) that bind cytokine receptors or other molecules, comprising administering a dual- or multi-specific ligand capable of binding to said two or more molecules (e.g., cytokine receptors).
  • the dual- or multi-specific ligand may be any dual- or multi-specific ligand, for example, this aspect of the invention relates to combinations of V H domains and V L domains, V H domains only and V L domains only.
  • Synergy in a therapeutic context may be achieved in a number of ways. For example, target combinations may be therapeutically active only if both targets are targeted by the ligand, whereas targeting one target alone is not therapeutically effective. In another embodiment, one target alone may provide some therapeutic effect, but together with a second target the combination provides a synergistic increase in therapeutic effect (a more than additive effect).
  • Animal model systems which can be used to screen the effectiveness of the ligands of the inventon in protecting against or treating the disease are available.
  • the demyelinating disease is induced by administration of myelin basic protein (see Paterson (1986) Textbook oflmmunopathology, Mischer et al, eds., Grune and Stratton, New York, pp. 179-213; McFarlin et al. (1973) Science, 179: 478: and Satoh et al. (1987) J. Immunol, 138: 179).
  • Other suitable models are described herein.
  • the ligands will be utilised in purified form together with pharmacologically appropriate carriers.
  • these carriers include aqueous or alcoholic/aqueous solutions, emulsions or suspensions, including saline and/or buffered media.
  • Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride and lactated Ringer's.
  • Suitable physiologically-acceptable adjuvants, if necessary to keep a polypeptide complex in suspension, may be chosen from thickeners such as carboxymethylcellulose, polyvinylpyrrolidone, gelatin and alginates.
  • Intravenous vehicles include fluid and nutrient replenishers and electrolyte replenishers, such as those based on Ringer's dextrose. Preservatives and other additives, such as antimicrobials, antioxidants, chelating agents and inert gases, may also be present. Formualtion will depend on the route of administration, a variety of suitable formulations can be used, including extended release formulations. (See, e.g., Mack (1982) Remington's Pharmaceutical Sciences, 16th Edition.)
  • the ligands e.g., dAb monomers
  • the ligand e.g., dAb monomer
  • additional agent are administered in a manner that provides an overlap of therapeutic effect.
  • Additional agents that can be administered or formulated with the ligand of the invention include, for example, various immunotherapeutic drugs, such as cylcosporine, methotrexate, adriamycin or cisplatinum, antibiotics, antimycotics, anti-viral agents and immunotoxins.
  • the antagonist when administered to prevent, suppress or treat lung inflammation or a respiratory disease, it can be administered in conjuction with phosphodiesterase inhibitors (e.g., inhibitors of phosphodiesterase 4), bronchodilators (e.g., beta2-agonists, anticholinergerics, theophylline), short-acting beta-agonists (e.g., albuterol, salbutamol, bambuterol, fenoterol, isoetherine, isoproterenol, levalbuterol, metaproterenol, pirbuterol, terbutaline and tornlate), long-acting beta-agonists (e.g., formoterol and salmeterol), short acting anticholinergics (e.g., ipratropium bromide and oxitropium bromide), long-acting anticholinergics (e.g., tiotropium), theophylline (e.g., short acting formulation, long acting phosphodie
  • the antagonist When the antagonist is administered to prevent, suppress or treat arthritis (e.g., inflammatory arthritis (e.g., rheumatoid arthritis)), it can be administered in conjuction with a disease modifying anti-rheumatic agent (e.g., methotrexate, hydroxychloroquine, sulfasalazine, leflunomide, azathioprine, D-penicillamine, gold (oral or intramuscular), minocycline, cyclosporine, staphylococcal protein A), nonsteroidal anti-inflammatory agent (e.g., COX-2 selective NSAIDS such as rofecoxib), salicylates, glucocoricoids (e.g., predisone) and analgesics.
  • a disease modifying anti-rheumatic agent e.g., methotrexate, hydroxychloroquine, sulfasalazine, leflunomide, azathioprine,
  • compositions can include "cocktails" of various cytotoxic or other agents in conjunction with ligands of the present invention, or even combinations of ligands according to the present invention having different specificities, such as ligands selected using different target antigens or epitopes, whether or not they are pooled prior to administration.
  • the route of administration of pharmaceutical compositions according to the invention may be any of those commonly known to those of ordinary skill in the art.
  • the selected ligands thereof of the invention can be administered to any patient in accordance with standard techniques.
  • the administration can be by any appropriate mode, including parenterally (e.g.
  • the dosage and frequency of administration will depend on the age, sex and condition of the patient, concurrent administration of other drugs, counterindications and other parameters to be taken into account by the clinician.
  • Administration can be local (e.g., local delivery to the lung by pulmonary administration, e.g., intranasal administration) or systemic as indicated.
  • the ligands of this invention can be lyophilised for storage and reconstituted in a suitable carrier prior to use. This technique has been shown to be effective with conventional immunoglobulins and art-known lyophilisation and reconstitution techniques can be employed.
  • compositions containing the present antagonists can be administered for prophylactic and/or therapeutic treatments.
  • an adequate amount to accomplish at least partial inhibition, suppression, modulation, killing, or some other measurable parameter, of a population of selected cells is defined as a "therapeutically-effective dose.”
  • FEV (I) forced expiratory volume in one second
  • George's Respiratory Questionnaire (e.g., an improvement score of 4 points) can be administerd.
  • arthritis e.g., inflammatory arthritis (e.g., rheumatoid arthritis)
  • an amount sufficient to achieve a 20% or greater improvement in at least 3 of the American College of Rheumatology core set measures can be administered (Felson et al., Arthritis and Rheumatism, 38:727-735 (1995)).
  • Amounts needed to achieve this dosage will depend upon the severity of the disease and the general state of the patient, including the patients age, sex, weight, general health (e.g., the state of the patients immune system). Based on these and other appropriate criteria, the skilled clinician can determine the appropropriate amount of ligand to be administered. Generally the amount can range from 0.005 to 5.0 mg of ligand per kilogram of body weight, with doses of 0.05 to 2.0 mg/kg/dose being more commonly used. For prophylactic applications, compositions containing the present ligands or cocktails thereof may also be administered in similar or slightly lower dosages, to prevent, inhibit or delay onset of disease (e.g., to sustain remission or quiescence, or to prevent acute phase).
  • the ligand of the invention can be administered up to four times per day, twice weekly, once weekly, once every two weeks, once a month, or once every two months, at a dose off, for example, about 10 ⁇ g/kg to about 80 mg/kg, about 100 ⁇ g/kg to about 80 mg/kg, about 1 mg/kg to about 80 mg/kg, about 1 mg/kg to about 70 mg/kg, about 1 mg/kg to about 60 mg/kg, about 1 mg/kg to about 50 mg/kg, about 1 mg/kg to about 40 mg/kg, about 1 mg/kg to about 30 mg/kg, about 1 mg/kg to about 20 mg/kg , about 1 mg/kg to about 10 mg/kg, about 10 ⁇ g/kg to about 10 mg/kg, about 10 ⁇ g/kg to about 5 mg/kg, about 10 ⁇ g/kg to about 2.5 mg/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg
  • the ligand is administered to treat, suppress or prevent a chronic inflammatory disease once every two weeks or once a month at a dose of about 10 ⁇ g/kg to about 10 mg/kg (e.g., about 10 ⁇ g/kg, about 100 ⁇ g/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg or about 10 mg/kg.)
  • Treatment or therapy performed using the compositions described herein is considered “effective” if one or more symptoms are reduced (e.g., by at least 10% or at least one point on a clinical assessment scale), relative to such symptoms present before treatment, or relative to such symptoms in an individual (human or model animal) not treated with such composition or other suitable control. Symptoms will obviously vary depending upon the disease or disorder targeted, but can be measured by an ordinarily skilled clinician or technician.
  • Such symptoms can be measured, for example, by monitoring the level of one or more biochemical indicators of the disease or disorder (e.g., levels of an enzyme or metabolite correlated with the disease, affected cell numbers, etc.), by monitoring physical manifestations (e.g., inflammation, tumor size, etc.), or by an accepted clinical assessment scale, for example, the Expanded Disability Status Scale (for multiple sclerosis), the Irvine Inflammatory Bowel Disease Questionnaire (32 point assessment evaluates quality of life with respect to bowel function, systemic symptoms, social function and emotional status - score ranges from 32 to 224, with higher scores indicating a better quality of life), the Quality of Life
  • biochemical indicators of the disease or disorder e.g., levels of an enzyme or metabolite correlated with the disease, affected cell numbers, etc.
  • physical manifestations e.g., inflammation, tumor size, etc.
  • an accepted clinical assessment scale for example, the Expanded Disability Status Scale (for multiple sclerosis), the Irvine Inflammatory Bowel Disease Questionnaire (32 point assessment
  • Rheumatoid Arthritis Scale the American College of Rheumatology core set measures, or other accepted clinical assessment scale as known in the field.
  • a sustained (e.g., one day or more, preferably longer) reduction in disease or disorder symptoms by at least 10% or by one or more points on a given clinical scale is indicative of "effective” treatment.
  • prophylaxis performed using a composition as described herein is "effective” if the onset or severity of one or more symptoms is delayed, reduced or abolished relative to such symptoms in a similar individual (human or animal model) not treated with the composition.
  • a composition containing an ligand or cocktail thereof according to the present invention may be utilised in prophylactic and therapeutic settings to aid in the alteration, inactivation, killing or removal of a select target cell population in a mammal.
  • the selected repertoires of polypeptides described herein may be used extracorporeally or in vitro selectively to kill, deplete or otherwise effectively remove a target cell population from a heterogeneous collection of cells.
  • Blood from a mammal may be combined extracorporeally with the ligands, e.g., antibodies, cell-surface receptors or binding proteins thereof whereby the undesired cells are killed or otherwise removed from the blood for return to the mammal in accordance with standard techniques.
  • a composition containing an antagonist ⁇ e.g., ligand) according to the present invention may be utilised in prophylactic and therapeutic settings to aid in the alteration, inactivation, killing or removal of a select target cell population in a mammal.
  • the invention is a method for treating, suppressing or preventing a chronic inflammatory disease, comprising administering to a mammal in need thereof a therapeutically-effective dose or amount of a ligand of the invention.
  • the invention is a method for treating, suppressing or preventing arthritis (e.g., Inflammatory arthritis (e.g., rheumatoid arthritis, juvenile rheumatoid arthritis, and spondyloarthropathies, such as ankylosing spondylitis, reactive arthritis, Reiter's syndrome, psoriatic arthritis, psoriatic spondylitis, enteropathic arthritis, enteropathic spondylitis, juvenile-onset spondyloarthropathy and undifferentiated spondyloarthropathy)) comprising administering to a mammal in need thereof a therapeutically-effective dose or amount of a ligand of the invention.
  • arthritis e.g., Inflammatory arthritis (e.g., rheumatoid arthritis, juvenile rheumatoid arthritis, and spondyloarthropathies, such as ankylosing spondylitis, reactive arthritis, Reiter's syndrome, psori
  • the invention is a method for treating, suppressing or preventing inflammatory bowel disease (e.g., Crohn's disease, ulcerative colitis) comprising administering to a mammal in need thereof a therapeutically-effective dose or amount of a ligand of the invention.
  • inflammatory bowel disease e.g., Crohn's disease, ulcerative colitis
  • 4G-K2 library of VK dAbs was panned against IL-IRl-Fc fusion protein (Axxora, Nottingham, UK). Domain antibodies from the primary selection were subjected to three further rounds of selection. Round 1 was performed using protein G coated magnetic beads (Dynal, Norway) and 100 nM IL-IRl-Fc; round 2 was performed using anti-human IgG beads (Novagen, Merck Biosciences, Nottingham, UK) and 10 nM IL-IRl-Fc; and round 3 was performed using protein G beads and 1 nM IL-IRl-Fc. (Henderikx et al., Selection of antibodies against biotinylated antigens.
  • the wells were washed with phosphate buffered saline (PBS) containing 0.1% (v/v) Tween-20 and then blocked with 1% (w/v) BSA in PBS before being incubated with recombinant IL-IRI (500 ng/ml, R&D Systems).
  • PBS phosphate buffered saline
  • IL-IRI 500 ng/ml, R&D Systems
  • IL- 1 ⁇ binding was detected using biotinylated anti-IL-1 ⁇ antibody (R&D Systems), followed by peroxidase labelled anti-biotin antibody (Stratech, Soham, UK) and then, incubation with 3,3',5,5'-tetramethylbenzidine (TMB) substrate (KPL, Gaithersburg, USA). The reaction was stopped by the addition of HCl and the absorbance was read at 450 nm. Anti-IL-1RI dAb activity caused a decrease in IL-l ⁇ binding and therefore a decrease in absorbance compared with the IL-l ⁇ only control.
  • Isolated dAbs were tested for their ability to inhibit IL-I -induced IL-8 release from cultured MRC-5 cells (ATCC catalogue no. CCL- 171). Briefly, 5000 trypsinised MRC-5 cells in RPMI media were placed in the well of a tissue-culture microtitre plate and mixed with IL-I ⁇ or ⁇ (R&D Systems, 200 pg/ml final concentration) and a dilution of the dAb to be tested. The mixture was incubated overnight at 37°C and IL-8 released by the cells into to culture media was quantified in an ELISA (DuoSet ® , R&D Systems). Anti-IL-1 RI dAb activity caused a decrease in IL-I binding and a corresponding reduction in IL-8 release.
  • IL- Ira competition ELISA A MaxiSorpTM immunoassay plate (Nunc, Denmark) was coated overnight with 1 ⁇ g/ml IL-IRl-Fc, then washed three times with PBS before blocking with 1% (v/v) Tween 20 in PBS. The plates were washed again, before the addition of 500 pM IL-lra mixed with a dilution series of DOM4-130-3 or IL-l ⁇ .
  • Binding of IL-lra to the receptor was detected using biotinylated anti-IL-lra antibody (DuoSet ® , R&D Systems), followed by streptavidin-HRP and developed with with 3,3',5,5'-tetramethylbenzidine (TMB) substrate (KPL, Gaithersburg, USA) as described above. Competition with IL-lra for binding to IL-IRl was indicated by a reduction in A 450 compared to control wells containing no IL-lra.
  • CDR-re-diversified libraries Two types were constructed: CDR-re-diversified libraries and error- prone libraries.
  • PCR reactions were performed, using degenerate oligonucleotides containing NNK or NNS codons, to diversify the required positions in the dAb to be affinity matured. Assembly PCR was then used to generate a full length diversified insert.
  • plasmid DNA encoding the dAb to be affinity matured was amplified by PCR, using the GeneMorph ® II Random Mutagenesis kit (Stratagene). Inserts produced by either method were digested with Sal I and Not I and used in a ligation reaction with cut phage vector. This ligation was then used to transform E. coli strain TBl by electroporation and the transformed cells were plated on 2xTY agar containing 15 ⁇ g/ml tetracycline, yielding library sizes of >lxl ⁇ clones.
  • FIG. 1 shows a dose-response curve for anti-IL-lRl dAbs DOM4-122 and DOM4-129 in such a cell assay.
  • the neutralizing dose 50 (ND 50 ) for each dAb was about 1 ⁇ M in the assay.
  • DOM4-122 and DOM4-129 have the same amino acid sequence in CDRs 1 and 2, and have two out of five amino acid residues identical in CDR3, and therefore were predicted to bind to the same epitope on the receptor.
  • FIG. 2 depicts a dose-response curve for improved variants DOM4-122-6 and DOM4-129-1, which both had an ND 50 values of -10 nM.
  • Stage II maturation Stage I affinity maturation of anti-IL-lRl dAb DOM4-122 (ND 50 ⁇ 1 ⁇ M) by re- diversification of CDRs 1 and 3 yielded DOM4-122-6 (-10 nM), Maturation of D0M4- 129 (-1 ⁇ M) by error-prone PCR produced DOM4-129-1 (-10 nM).
  • DOM4-129-1 and DOM4-122-6 gained a mutation, L46F, in common during maturation while DOM4-129- 1 has an additional mutation, S56R. Both changes were frequently found in clones isolated from maturation selections, therefore the S56R mutation was introduced into DOM4- 122-6, yielding DOM4-122-23.
  • This combination mutant dAb has an ND 50 of approximately 1 nM (FIG. 2).
  • An additional point mutation, K45M, gained in both DOM4-122 and DOM4-129 was shown to be non-essential when reverted to germline in DOM4-122-23, yielding DOM4-122-24.
  • FIGS. 3 A and 3B show that D0M4-122-23 bound to IL-I RI that already had bound IL-lra.
  • FIG. 3 A shows that D0M4-122-23 bound to IL-I RI that already had bound IL-lra.
  • IL-lra When an injection of IL-lra was followed by an injection of IL-I ⁇ , two molecules that are known to compete for binding to the receptor, the IL- l ⁇ was also unable to bind the receptor (FIG. 3B).
  • the results were confirmed using a competition ELISA in which binding of IL-lra to IL-IRl in the presence of a DOM4-122-23 or IL-Ia (in a series of concentrations) of was determined.
  • DOM4-122-23 did not inhibit binding of IL-lra (500 pM) to IL-IRl even when present at concentrations up to 1 ⁇ M, wherein IL-Ia did inhibit binding of IL-lra to IL-IRl (FIG. 4).
  • Example 2 Protease stability
  • dAbs and ligands that comprise dAbs are useful for treating a variety of conditions, such as inflammatory conditions.
  • the half- life of dAbs and ligands can be tailored, for example, by PEGylation.
  • dAbs and ligands can be administered, for example, systemically (e.g., PEGylated dAb to treat arthritis) or locally (e.g., dAb monomer to treat COPD).
  • the stability of two dAbs that bind IL-IRl to the action of elastase or trypsin was investigated. Both of these proteases are found naturally at low levels within the lung, but in conditions such as COPD the levels of proteases, such as elastase, can become elevated.
  • the dAb monomers DOM4-130-54, and a variant of DOM4-130-54 containing a point mutation that provides a cysteine residue for the specific attachment of PEG, were used in the study.
  • a 1 mg/ml solution of DOM4-130-54 in PBS was incubated with either 0.04% w/w trypsin or elastase (human sputum leucocyte elastase purchased from the Elastin Products Company Inc).
  • the dAb/protease mixture was then incubated at 30 0 C and samples were taken at defined time intervals (0, 1, 3 and 24 hrs) for SDS-PAGE analysis. At the given time points, the reaction was stopped by the addition SDS-PAGE loading buffer (xlO concentrated stock solution), followed by the snap freezing the samples in liquid nitrogen. Samples were analyzed by SDS-PAGE, and protein bands were visualized to reveal a time course for the protease degradation of the dAbs.
  • DOM4-130-54 Two forms of DOM4-130-54 were tested for their stability to the action of elastase; E. coli expressed monomer and the cysteine engineered variant P80C expressed from P. pastoris.
  • the P80C point mutation of D0M4-130-54 provides a cysteine residue for the specific attachment of PEG.
  • dAbs are stable and resistant to elastase- or trypsin-mediated degradation.
  • the demonstrated stability of dAbs to protease degradation indicates that dAbs can be administered in vivo and will remain functional for a sufficient amount of time to produce significant biological effects.
  • the results indicate that when dAbs are administered to the lung, they will be resistant to protease degradation and, thus, will be functional for a period of time that is sufficient to produce significant biological effects ⁇ e.g., bind and inhibit the activity of a target protein such as IL-IRl).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biomedical Technology (AREA)
  • Rheumatology (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Physics & Mathematics (AREA)
  • Pulmonology (AREA)
  • Plant Pathology (AREA)
  • Pain & Pain Management (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Mycology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/GB2006/004471 2005-12-01 2006-11-30 Noncompetitive domain antibody formats that bind interleukin 1 receptor type 1 Ceased WO2007063308A2 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
JP2008542829A JP2009519011A (ja) 2005-12-01 2006-11-30 インターロイキン1受容体1型に結合する非競合ドメイン抗体フォーマット
AU2006321364A AU2006321364B2 (en) 2005-12-01 2006-11-30 Noncompetitive domain antibody formats that bind Interleukin 1 Receptor type 1
EA200801170A EA200801170A1 (ru) 2005-12-01 2006-11-30 Форматы неконкурентного доменного антитела, которые связываются с рецептором интерлейкина 1 первого типа
BRPI0619225A BRPI0619225A2 (pt) 2005-12-01 2006-11-30 monômero de anticorpo de domínio, ligando, ácidos nucleicos isolado e recombinante, vetor, célula hospedeira, método para produzir um monômero de dab de ligando, composição farmacêutica, dispositivo de liberação de medicamento, uso de um monômero de anticorpo de domínio, e, método para tratar uma doença inflamatória, artrite ou doença respiratória
EP06820376A EP1957536A2 (en) 2005-12-01 2006-11-30 Noncompetitive domain antibody formats that bind interleukin 1 receptor type 1
CA002632866A CA2632866A1 (en) 2005-12-01 2006-11-30 Noncompetitive domain antibody formats that bind interleukin 1 receptor type 1
US12/085,920 US20090155283A1 (en) 2005-12-01 2006-11-30 Noncompetitive Domain Antibody Formats That Bind Interleukin 1 Receptor Type 1
NO20082215A NO20082215L (no) 2005-12-01 2008-05-15 Ikke-kompetitive domene-antistofformater som binder interleukin 1 reseptortype 1

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US74206205P 2005-12-01 2005-12-01
US60/742,062 2005-12-01

Publications (2)

Publication Number Publication Date
WO2007063308A2 true WO2007063308A2 (en) 2007-06-07
WO2007063308A3 WO2007063308A3 (en) 2007-09-20

Family

ID=37885775

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2006/004471 Ceased WO2007063308A2 (en) 2005-12-01 2006-11-30 Noncompetitive domain antibody formats that bind interleukin 1 receptor type 1

Country Status (14)

Country Link
US (1) US20090155283A1 (https=)
EP (1) EP1957536A2 (https=)
JP (1) JP2009519011A (https=)
KR (1) KR20080077238A (https=)
CN (1) CN101454344A (https=)
AU (1) AU2006321364B2 (https=)
BR (1) BRPI0619225A2 (https=)
CA (1) CA2632866A1 (https=)
CR (1) CR10022A (https=)
EA (1) EA200801170A1 (https=)
MA (1) MA30300B1 (https=)
NO (1) NO20082215L (https=)
TW (1) TW200730539A (https=)
WO (1) WO2007063308A2 (https=)

Cited By (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008149149A3 (en) * 2007-06-06 2009-04-02 Domantis Ltd Polypeptides, antibody variable domains and antagonists
WO2009121152A2 (en) 2008-04-03 2009-10-08 Katholieke Universiteit Leuven Gene signatures
WO2010060768A1 (en) * 2008-11-26 2010-06-03 Glaxo Group Limited Polypeptides, antibody variable domains & antagonists
WO2010094720A3 (en) * 2009-02-19 2011-01-13 Glaxo Group Limited Improved anti-tnfr1 polypeptides, antibody variable domains & antagonists
WO2011095545A1 (en) 2010-02-05 2011-08-11 Ablynx Nv Peptides capable of binding to serum albumin and compounds, constructs and polypeptides comprising the same
US8217140B2 (en) 2008-04-17 2012-07-10 Ablynx N.V. Peptides capable of binding to serum proteins and compounds, constructs and polypeptides comprising the same
US8298533B2 (en) 2008-11-07 2012-10-30 Medimmune Limited Antibodies to IL-1R1
US8324350B2 (en) 2006-12-29 2012-12-04 Abbott Laboratories Dual-specific IL-1α/IL-1β antibodies
JP2012532620A (ja) * 2009-07-16 2012-12-20 グラクソ グループ リミテッド 改良型抗血清アルブミン結合単一可変ドメイン
WO2012175741A2 (en) 2011-06-23 2012-12-27 Ablynx Nv Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains
US8475766B2 (en) 2000-06-29 2013-07-02 Abbvie Inc. Dual specificity antibodies and methods of making and using
WO2013024059A3 (en) * 2011-08-17 2014-05-30 Glaxo Group Limited Modified single variable domain antibodies with reduced binding to anti-drug-antibodies
EP2944653A1 (en) 2011-06-23 2015-11-18 Ablynx N.V. Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains
WO2015173342A1 (en) 2014-05-16 2015-11-19 Ablynx Nv Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies
US9562090B2 (en) 2007-12-13 2017-02-07 Domantis Limited Polypeptides, antibody variable domains and antagonists
WO2017080850A1 (en) 2015-11-13 2017-05-18 Ablynx Nv Improved serum albumin-binding immunoglobulin variable domains
WO2017087588A1 (en) 2015-11-18 2017-05-26 Merck Sharp & Dohme Corp. Ctla4 binders
WO2017085172A2 (en) 2015-11-18 2017-05-26 Ablynx Nv Improved serum albumin binders
EP3248986A2 (en) 2014-05-16 2017-11-29 Ablynx NV Immunoglobulin variable domains
WO2017210749A1 (en) * 2016-06-10 2017-12-14 Adelaide Research & Innovation Pty Ltd Methods and products for treating autoimmune diseases
WO2017220645A1 (en) 2016-06-23 2017-12-28 Ablynx N.V. Improved pharmacokinetic assays for immunoglobulin single variable domains
EP3266798A2 (en) 2015-11-12 2018-01-10 Ablynx NV Improved tnf binders
WO2018104444A1 (en) 2016-12-07 2018-06-14 Ablynx Nv Improved serum albumin binding immunoglobulin single variable domains
WO2018134234A1 (en) 2017-01-17 2018-07-26 Ablynx Nv Improved serum albumin binders
WO2018134235A1 (en) 2017-01-17 2018-07-26 Ablynx Nv Improved serum albumin binders
WO2018178307A1 (en) 2017-03-31 2018-10-04 Ablynx N.V. Improved immunogenicity assays
WO2018178392A1 (en) * 2017-03-31 2018-10-04 Swedish Orphan Biovitrum Ab (Publ) Il-1r-i binding polypeptide
WO2019230866A1 (en) * 2018-05-30 2019-12-05 Chugai Seiyaku Kabushiki Kaisha Polypeptide comprising il-1r1 binding domain and carrying moiety
US11168139B2 (en) 2016-11-28 2021-11-09 Chugai Seiyaku Kabushiki Kaisha Antigen-binding domain, and polypeptide including conveying section
EP4350345A2 (en) 2011-06-23 2024-04-10 Ablynx N.V. Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains
US12030955B2 (en) 2017-11-28 2024-07-09 Chugai Seiyaku Kabushiki Kaisha Polypeptide including antigen-binding domain and carrying section
US12060654B2 (en) 2016-11-28 2024-08-13 Chugai Seiyaku Kabushiki Kaisha Ligand-binding molecule having adjustable ligand binding activity
US12077577B2 (en) 2018-05-30 2024-09-03 Chugai Seiyaku Kabushiki Kaisha Polypeptide comprising aggrecan binding domain and carrying moiety
US12195528B2 (en) 2017-11-28 2025-01-14 Chugai Seiyaku Kabushiki Kaisha Ligand-binding molecule having adjustable ligand-binding activity

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3301208B1 (en) * 2009-09-18 2020-11-04 Codexis, Inc. Reduced codon mutagenesis
US20110082055A1 (en) * 2009-09-18 2011-04-07 Codexis, Inc. Reduced codon mutagenesis
JP2013525310A (ja) * 2010-04-16 2013-06-20 メディミューン リミテッド Copd増悪を治療するための組成物および方法
WO2012172070A1 (en) * 2011-06-17 2012-12-20 Glaxo Group Limited Tumour necrosis factor receptor 1 antagonists
CN109336977A (zh) * 2018-10-11 2019-02-15 暨南大学 肿瘤干细胞标志分子EpCAM的结合蛋白及其应用

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997008320A1 (en) 1995-08-18 1997-03-06 Morphosys Gesellschaft Für Proteinoptimierung Mbh Protein/(poly)peptide libraries
WO2004022718A2 (en) 2002-09-06 2004-03-18 Amgen, Inc. Therapeutic human anti-il-1r1 monoclonal antibody

Family Cites Families (78)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CU22545A1 (es) * 1994-11-18 1999-03-31 Centro Inmunologia Molecular Obtención de un anticuerpo quimérico y humanizado contra el receptor del factor de crecimiento epidérmico para uso diagnóstico y terapéutico
US3907502A (en) * 1973-12-11 1975-09-23 Miless L Brink Method for identifying Bence Jones proteins
GB2148299B (en) * 1983-09-01 1988-01-06 Hybritech Inc Antibody compositions of therapeutic agents having an extended serum half-life
US5120712A (en) * 1986-05-05 1992-06-09 The General Hospital Corporation Insulinotropic hormone
US6511665B1 (en) * 1987-11-25 2003-01-28 Immunex Corporation Antibodies to interleukin-1 receptors
AU4128089A (en) * 1988-09-15 1990-03-22 Rorer International (Overseas) Inc. Monoclonal antibodies specific to human epidermal growth factor receptor and therapeutic methods employing same
EP0368684B2 (en) * 1988-11-11 2004-09-29 Medical Research Council Cloning immunoglobulin variable domain sequences.
US5116964A (en) * 1989-02-23 1992-05-26 Genentech, Inc. Hybrid immunoglobulins
US6448380B2 (en) * 1989-08-07 2002-09-10 Peptech Limited Tumor necrosis factor antibodies
US5459061A (en) * 1990-01-26 1995-10-17 W. Alton Jones Cell Science Center, Inc. Hybridomas producing monoclonal antibodies which specifically bind to continuous epitope on the human EGF receptor and compete with EGF for binding to the EGF receptor
US5726152A (en) * 1990-09-21 1998-03-10 Merck & Co., Inc. Vascular endothelial cell growth factor II
US5843440A (en) * 1990-10-03 1998-12-01 Redcell Canada, Inc. Cellular and serum protein anchors for modulating pharmacokinetics
EP0531472B1 (en) * 1991-03-06 2003-08-13 MERCK PATENT GmbH Humanized monoclonal antibodies
OA10149A (en) * 1991-03-29 1996-12-18 Genentech Inc Vascular endothelial cell growth factor antagonists
AU665360B2 (en) * 1991-07-05 1996-01-04 Seragen, Inc. Epidermal growth factor receptor targeted molecules for treatment of inflammatory arthritis
US5965132A (en) * 1992-03-05 1999-10-12 Board Of Regents, The University Of Texas System Methods and compositions for targeting the vasculature of solid tumors
IL112372A (en) * 1994-02-07 2001-08-26 Res Dev Foundation Non-viral vector for the delivery of genetic information to cells
GB9410533D0 (en) * 1994-05-26 1994-07-13 Lynxvale Ltd In situ hybridisation and immuno-Chemical localisation of a growth factor
ES2167391T3 (es) * 1994-09-16 2002-05-16 Merck Patent Gmbh Inmunoconjugados ii.
US5928939A (en) * 1995-03-01 1999-07-27 Ludwig Institute For Cancer Research Vascular endothelial growth factor-b and dna coding therefor
US5869046A (en) * 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US7060808B1 (en) * 1995-06-07 2006-06-13 Imclone Systems Incorporated Humanized anti-EGF receptor monoclonal antibody
US6410690B1 (en) * 1995-06-07 2002-06-25 Medarex, Inc. Therapeutic compounds comprised of anti-Fc receptor antibodies
US5770190A (en) * 1995-07-14 1998-06-23 Schering Corporation Method of treatment of acute leukemia with inteleukin-10
US6020473A (en) * 1995-08-25 2000-02-01 Genentech, Inc. Nucleic acids encoding variants of vascular endothelial cell growth factor
US5989830A (en) * 1995-10-16 1999-11-23 Unilever Patent Holdings Bv Bifunctional or bivalent antibody fragment analogue
US5664034A (en) * 1996-05-21 1997-09-02 Lucent Technologies Inc. Lightwave communication monitoring switch
US5922845A (en) * 1996-07-11 1999-07-13 Medarex, Inc. Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies
US6013780A (en) * 1996-09-06 2000-01-11 Technion Research & Development Co. Ltd. VEGF145 expression vectors
US6750044B1 (en) * 1996-10-17 2004-06-15 Genentech, Inc. Variants of vascular endothelial cell growth factor having antagonistic properties, nucleic acids encoding the same and host cells comprising those nucleic acids
US20030165467A1 (en) * 1997-01-21 2003-09-04 Technion Research & Development Co., Ltd. Angiogenic factor and use thereof in treating cardiovascular disease
US6294170B1 (en) * 1997-08-08 2001-09-25 Amgen Inc. Composition and method for treating inflammatory diseases
US6485942B1 (en) * 1997-02-14 2002-11-26 Genentech, Inc. Variants of vascular endothelial cell growth factor having altered pharmacological properties, and recombinant methods of production
US20020032315A1 (en) * 1997-08-06 2002-03-14 Manuel Baca Anti-vegf antibodies
US20020173629A1 (en) * 1997-05-05 2002-11-21 Aya Jakobovits Human monoclonal antibodies to epidermal growth factor receptor
US6777534B1 (en) * 1997-12-09 2004-08-17 Children's Medical Center Corporation Peptide antagonists of vascular endothelial growth factor
US20020192211A1 (en) * 1998-03-17 2002-12-19 Hudziak Robert M. Method of treating tumor cells by inhibiting growth factor receptor function
US20030224001A1 (en) * 1998-03-19 2003-12-04 Goldstein Neil I. Antibody and antibody fragments for inhibiting the growth of tumors
ZA200007412B (en) * 1998-05-15 2002-03-12 Imclone Systems Inc Treatment of human tumors with radiation and inhibitors of growth factor receptor tyrosine kinases.
US20030175271A1 (en) * 1998-05-20 2003-09-18 Kyowa Hakko Kogyo Co., Ltd. VEGF activity inhibitor
US7264801B2 (en) * 1998-08-11 2007-09-04 Genentech, Inc. EG-VEGF nucleic acids and polypeptides and method of use
US20020172678A1 (en) * 2000-06-23 2002-11-21 Napoleone Ferrara EG-VEGF nucleic acids and polypeptides and methods of use
US7488590B2 (en) * 1998-10-23 2009-02-10 Amgen Inc. Modified peptides as therapeutic agents
WO2000037502A2 (en) * 1998-12-22 2000-06-29 Genentech, Inc. Vascular endothelial cell growth factor antagonists and uses thereof
US6703020B1 (en) * 1999-04-28 2004-03-09 Board Of Regents, The University Of Texas System Antibody conjugate methods for selectively inhibiting VEGF
EP1179541B1 (en) * 1999-04-28 2004-06-16 Board Of Regents, The University Of Texas System Compositions and methods for cancer treatment by selectively inhibiting VEGF
US7049410B2 (en) * 1999-05-14 2006-05-23 Majumdar Adhip P N Antibodies to a novel EGF-receptor related protein (ERRP)
HK1047236A1 (zh) * 1999-05-14 2003-02-14 Imclone Llc 用表皮生长因子受体拮抗剂治疗难治的人肿瘤
US6475796B1 (en) * 1999-05-20 2002-11-05 Scios, Inc. Vascular endothelial growth factor variants
AU3988401A (en) * 2000-02-25 2001-09-03 Ludwig Inst Cancer Res Materials and methods involving hybrid vascular endothelial growth factor dnas and proteins
JP2003528632A (ja) * 2000-03-31 2003-09-30 インスティティ・パスツール 血管内皮成長因子(vegf)−媒介性脈管形成を阻害するペプチド、該ペプチドをエンコードするポリヌクレオチド及びその使用方法
CN101289511A (zh) * 2000-04-11 2008-10-22 杰南技术公司 多价抗体及其应用
WO2001089549A2 (en) * 2000-05-22 2001-11-29 Hyseq, Inc. Therapeutic uses of il-1 receptor antagonist
EP1299419A2 (en) * 2000-05-24 2003-04-09 Imclone Systems, Inc. Bispecific immunoglobulin-like antigen binding proteins and method of production
DE10038624C2 (de) * 2000-08-03 2002-11-21 Broekelmann Aluminium F W Wärmeübertragungsrohr mit gedrallten Innenrippen
US6699473B2 (en) * 2000-10-13 2004-03-02 Uab Research Foundation Human anti-epidermal growth factor receptor single-chain antibodies
US20030133939A1 (en) * 2001-01-17 2003-07-17 Genecraft, Inc. Binding domain-immunoglobulin fusion proteins
US7667004B2 (en) * 2001-04-17 2010-02-23 Abmaxis, Inc. Humanized antibodies against vascular endothelial growth factor
JP2004528368A (ja) * 2001-05-08 2004-09-16 メルク パテント ゲゼルシャフト ミット ベシュレンクテル ハフトング 抗egfr抗体と抗ホルモン剤を用いた組合せ療法
NZ530212A (en) * 2001-06-13 2006-09-29 Genmab As An isolated human monoclonal antibody that binds to human epidermal growth factor receptor (EGFR)
DK1399484T3 (da) * 2001-06-28 2010-11-08 Domantis Ltd Dobbelt-specifik ligand og anvendelse af denne
JP2005508887A (ja) * 2001-08-03 2005-04-07 コモンウェルス サイエンティフィック アンド インダストリアル リサーチ オーガニゼイション Egf受容体の結晶構造に基づいたスクリーニング方法
PL374495A1 (en) * 2001-10-15 2005-10-31 Immunomedics, Inc. Direct targeting binding proteins
DE10163459A1 (de) * 2001-12-21 2003-07-03 Merck Patent Gmbh Lyophilisierte Zubereitung enthaltend Antikörper gegen EGF-Rezeptor
CA2478011C (en) * 2002-03-01 2013-05-21 Immunomedics, Inc. Bispecific antibody point mutations for enhancing rate of clearance
ES2263984T3 (es) * 2002-06-28 2006-12-16 Domantis Limited Ligandos doble-especificos con una vida media serica aumentada.
TW200501960A (en) * 2002-10-02 2005-01-16 Bristol Myers Squibb Co Synergistic kits and compositions for treating cancer
AU2003290330A1 (en) * 2002-12-27 2004-07-22 Domantis Limited Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand
US20050043233A1 (en) * 2003-04-29 2005-02-24 Boehringer Ingelheim International Gmbh Combinations for the treatment of diseases involving cell proliferation, migration or apoptosis of myeloma cells or angiogenesis
MXPA05012723A (es) * 2003-05-30 2006-02-08 Genentech Inc Tratamiento con anticuerpos anti-vgf.
CN102558352A (zh) * 2003-06-27 2012-07-11 艾默根佛蒙特有限公司 针对表皮生长因子受体的缺失突变体的抗体及其使用
CN1845938B (zh) * 2003-06-30 2010-05-26 杜门蒂斯有限公司 多肽
SI1651265T1 (sl) * 2003-07-24 2008-10-31 Merial Ltd Formulacije cepiva, ki obsegajo emulzijo olje v vodi
AR046510A1 (es) * 2003-07-25 2005-12-14 Regeneron Pharma Composicion de un antagonista de vegf y un agente anti-proliferativo
US20050196340A1 (en) * 2003-08-06 2005-09-08 Jocelyn Holash Use of a VEGF antagonist in combination with radiation therapy
WO2005070966A2 (en) * 2004-01-16 2005-08-04 Regeneron Pharmaceuticals, Inc. Fusion polypeptides capable of activating receptors
US7767792B2 (en) * 2004-02-20 2010-08-03 Ludwig Institute For Cancer Research Ltd. Antibodies to EGF receptor epitope peptides
CA2588892A1 (en) * 2004-12-02 2006-06-08 Dormantis Limited Anti-il-1r1 single domain antibodies and therapeutic uses

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997008320A1 (en) 1995-08-18 1997-03-06 Morphosys Gesellschaft Für Proteinoptimierung Mbh Protein/(poly)peptide libraries
WO2004022718A2 (en) 2002-09-06 2004-03-18 Amgen, Inc. Therapeutic human anti-il-1r1 monoclonal antibody

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
HOLT, L. J. ET AL.: "Domain antibodies: proteins for therapy", TRENDS IN BIOTECHNOLOGY, vol. 21, no. 11, 2003, pages 484 - 490

Cited By (67)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8475766B2 (en) 2000-06-29 2013-07-02 Abbvie Inc. Dual specificity antibodies and methods of making and using
US8324350B2 (en) 2006-12-29 2012-12-04 Abbott Laboratories Dual-specific IL-1α/IL-1β antibodies
EA018129B1 (ru) * 2007-06-06 2013-05-30 Домантис Лимитед Полипептиды, вариабельные домены антитела и антагонисты
US10072089B2 (en) 2007-06-06 2018-09-11 Domantis Limited Polypeptides, antibody variable domains and antagonists
WO2008149149A3 (en) * 2007-06-06 2009-04-02 Domantis Ltd Polypeptides, antibody variable domains and antagonists
US8398979B2 (en) 2007-06-06 2013-03-19 Domantis Limited Polypeptides, antibody variable domains and antagonists
US9562090B2 (en) 2007-12-13 2017-02-07 Domantis Limited Polypeptides, antibody variable domains and antagonists
WO2009121152A2 (en) 2008-04-03 2009-10-08 Katholieke Universiteit Leuven Gene signatures
US8217140B2 (en) 2008-04-17 2012-07-10 Ablynx N.V. Peptides capable of binding to serum proteins and compounds, constructs and polypeptides comprising the same
US9200074B2 (en) 2008-11-07 2015-12-01 Medimmune Limited Antibodies to IL-1 R1 and methods of making them
US8298533B2 (en) 2008-11-07 2012-10-30 Medimmune Limited Antibodies to IL-1R1
US8741604B2 (en) 2008-11-07 2014-06-03 Medimmune Limited Nucleic acid molecule encoding a specific IL-1R1 antibody
WO2010060768A1 (en) * 2008-11-26 2010-06-03 Glaxo Group Limited Polypeptides, antibody variable domains & antagonists
WO2010094720A3 (en) * 2009-02-19 2011-01-13 Glaxo Group Limited Improved anti-tnfr1 polypeptides, antibody variable domains & antagonists
CN102405236A (zh) * 2009-02-19 2012-04-04 葛兰素集团有限公司 改进的抗-tnfr1多肽,抗体可变结构域和拮抗剂
AU2010215479B2 (en) * 2009-02-19 2015-01-22 Glaxo Group Limited Improved anti-TNFR1 polypeptides, antibody variable domains & antagonists
JP2012532620A (ja) * 2009-07-16 2012-12-20 グラクソ グループ リミテッド 改良型抗血清アルブミン結合単一可変ドメイン
WO2011095545A1 (en) 2010-02-05 2011-08-11 Ablynx Nv Peptides capable of binding to serum albumin and compounds, constructs and polypeptides comprising the same
WO2012175741A2 (en) 2011-06-23 2012-12-27 Ablynx Nv Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains
EP4350345A2 (en) 2011-06-23 2024-04-10 Ablynx N.V. Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains
EP2944654A1 (en) 2011-06-23 2015-11-18 Ablynx N.V. Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains
EP2974737A1 (en) 2011-06-23 2016-01-20 Ablynx N.V. Techniques for predicting, detecting and reducing a specific protein interference in assays involving immunoglobulin single variable domains
EP3020728A1 (en) 2011-06-23 2016-05-18 Ablynx N.V. Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains
EP3363812A1 (en) 2011-06-23 2018-08-22 Ablynx NV Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains
EP2944653A1 (en) 2011-06-23 2015-11-18 Ablynx N.V. Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains
EP3363813A1 (en) 2011-06-23 2018-08-22 Ablynx NV Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains
AU2012296961B2 (en) * 2011-08-17 2017-02-16 Glaxo Group Limited Modified proteins and peptides
EP2987806A3 (en) * 2011-08-17 2016-07-13 Glaxo Group Limited Modified single variable domain antibodies with reduced binding to anti-drug-antibodies
AU2016277685B2 (en) * 2011-08-17 2019-03-28 Glaxo Group Limited Modified proteins and peptides
EA027160B1 (ru) * 2011-08-17 2017-06-30 Глаксо Груп Лимитед Модифицированные белки и пептиды
US10808040B2 (en) 2011-08-17 2020-10-20 Glaxo Group Limited Modified proteins and peptides
WO2013024059A3 (en) * 2011-08-17 2014-05-30 Glaxo Group Limited Modified single variable domain antibodies with reduced binding to anti-drug-antibodies
EP3982124A1 (en) 2014-05-16 2022-04-13 Ablynx NV Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies
WO2015173342A1 (en) 2014-05-16 2015-11-19 Ablynx Nv Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies
EP4707303A2 (en) 2014-05-16 2026-03-11 Ablynx NV Improved immunoglobulin variable domains
EP3693386A1 (en) 2014-05-16 2020-08-12 Ablynx NV Immunoglobulin variable domains
EP3248986A2 (en) 2014-05-16 2017-11-29 Ablynx NV Immunoglobulin variable domains
EP3702369A1 (en) 2014-05-16 2020-09-02 Ablynx NV Immunoglobulin variable domains
EP3266798A2 (en) 2015-11-12 2018-01-10 Ablynx NV Improved tnf binders
WO2017080850A1 (en) 2015-11-13 2017-05-18 Ablynx Nv Improved serum albumin-binding immunoglobulin variable domains
EP3974449A1 (en) 2015-11-13 2022-03-30 Ablynx NV Improved serum albumin-binding immunoglobulin variable domains
WO2017087588A1 (en) 2015-11-18 2017-05-26 Merck Sharp & Dohme Corp. Ctla4 binders
WO2017085172A2 (en) 2015-11-18 2017-05-26 Ablynx Nv Improved serum albumin binders
WO2017210749A1 (en) * 2016-06-10 2017-12-14 Adelaide Research & Innovation Pty Ltd Methods and products for treating autoimmune diseases
EP4119944A1 (en) 2016-06-23 2023-01-18 Ablynx N.V. Improved pharmacokinetic assays for immunoglobulin single variable domains
WO2017220645A1 (en) 2016-06-23 2017-12-28 Ablynx N.V. Improved pharmacokinetic assays for immunoglobulin single variable domains
US11932697B2 (en) 2016-11-28 2024-03-19 Chugai Seiyaku Kabushiki Kaisha Antigen-binding domain, and polypeptide including conveying section
US12060654B2 (en) 2016-11-28 2024-08-13 Chugai Seiyaku Kabushiki Kaisha Ligand-binding molecule having adjustable ligand binding activity
US11168139B2 (en) 2016-11-28 2021-11-09 Chugai Seiyaku Kabushiki Kaisha Antigen-binding domain, and polypeptide including conveying section
WO2018104444A1 (en) 2016-12-07 2018-06-14 Ablynx Nv Improved serum albumin binding immunoglobulin single variable domains
EP4471058A2 (en) 2017-01-17 2024-12-04 Ablynx NV Improved serum albumin binders
WO2018134235A1 (en) 2017-01-17 2018-07-26 Ablynx Nv Improved serum albumin binders
WO2018134234A1 (en) 2017-01-17 2018-07-26 Ablynx Nv Improved serum albumin binders
EP4442709A2 (en) 2017-01-17 2024-10-09 Ablynx NV Improved serum albumin binders
EP4442708A2 (en) 2017-01-17 2024-10-09 Ablynx NV Improved serum albumin binders
EP4442707A2 (en) 2017-01-17 2024-10-09 Ablynx NV Improved serum albumin binders
WO2018178307A1 (en) 2017-03-31 2018-10-04 Ablynx N.V. Improved immunogenicity assays
IL269477B2 (en) * 2017-03-31 2024-06-01 Swedish Orphan Biovitrum Ab Publ Il-1r-i binding polypeptide
IL269477B1 (en) * 2017-03-31 2024-02-01 Swedish Orphan Biovitrum Ab Publ Polypeptides that bind to IL-1R-1
AU2018242224B2 (en) * 2017-03-31 2021-09-02 Swedish Orphan Biovitrum Ab (Publ) IL-1R-I binding polypeptide
US12116397B2 (en) 2017-03-31 2024-10-15 Swedish Orphan Biovitrum Ab (Publ) IL-IR-I binding polypeptide
WO2018178392A1 (en) * 2017-03-31 2018-10-04 Swedish Orphan Biovitrum Ab (Publ) Il-1r-i binding polypeptide
US12030955B2 (en) 2017-11-28 2024-07-09 Chugai Seiyaku Kabushiki Kaisha Polypeptide including antigen-binding domain and carrying section
US12195528B2 (en) 2017-11-28 2025-01-14 Chugai Seiyaku Kabushiki Kaisha Ligand-binding molecule having adjustable ligand-binding activity
US12077577B2 (en) 2018-05-30 2024-09-03 Chugai Seiyaku Kabushiki Kaisha Polypeptide comprising aggrecan binding domain and carrying moiety
WO2019230866A1 (en) * 2018-05-30 2019-12-05 Chugai Seiyaku Kabushiki Kaisha Polypeptide comprising il-1r1 binding domain and carrying moiety
JP2021525065A (ja) * 2018-05-30 2021-09-24 中外製薬株式会社 Il−1r1結合ドメインおよび運搬部分を含むポリペプチド

Also Published As

Publication number Publication date
EP1957536A2 (en) 2008-08-20
BRPI0619225A2 (pt) 2017-11-07
CN101454344A (zh) 2009-06-10
CA2632866A1 (en) 2007-06-07
TW200730539A (en) 2007-08-16
EA200801170A1 (ru) 2008-12-30
AU2006321364A1 (en) 2007-06-07
AU2006321364B2 (en) 2011-11-10
CR10022A (es) 2008-09-22
KR20080077238A (ko) 2008-08-21
MA30300B1 (fr) 2009-04-01
JP2009519011A (ja) 2009-05-14
WO2007063308A3 (en) 2007-09-20
NO20082215L (no) 2008-08-14
US20090155283A1 (en) 2009-06-18

Similar Documents

Publication Publication Date Title
AU2006321364B2 (en) Noncompetitive domain antibody formats that bind Interleukin 1 Receptor type 1
AU2006321367B2 (en) Competitive domain antibody formats that bind Interleukin 1 Receptor type 1
US9629909B2 (en) Methods for targeting pulmonary diseases with agents that bind a target in pulmonary tissue
AU2005311101B8 (en) Anti-IL-IRI single domain antibodies and therapeutic uses
US20090060916A1 (en) Ligands that bind IL-4 and/or IL-13
EP2493504B1 (en) Stable anti-tnfr1 polypeptides, antibody variable domains and antagonists
US9028817B2 (en) Stable anti-TNFR1 polypeptides, antibody variable domains and antagonists
MX2008006882A (en) Noncompetitive domain antibody formats that bind interleukin 1 receptor type 1

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200680051883.2

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 191388

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 568374

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2006321364

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 200801170

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: CR2008-010022

Country of ref document: CR

WWE Wipo information: entry into national phase

Ref document number: MX/a/2008/006882

Country of ref document: MX

Ref document number: 12008501264

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 08054863

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: 2008542829

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 2008060910

Country of ref document: EG

WWE Wipo information: entry into national phase

Ref document number: 2632866

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2342/KOLNP/2008

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2006321364

Country of ref document: AU

Date of ref document: 20061130

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2006321364

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2006820376

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 1020087015994

Country of ref document: KR

Ref document number: DZP2008000415

Country of ref document: DZ

WWE Wipo information: entry into national phase

Ref document number: 12085920

Country of ref document: US

WWP Wipo information: published in national office

Ref document number: 2006820376

Country of ref document: EP

ENP Entry into the national phase

Ref document number: PI0619225

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20080529