WO2007021841A2 - Identification and engineering of antibodies with variant fc regions and methods of using same - Google Patents

Identification and engineering of antibodies with variant fc regions and methods of using same Download PDF

Info

Publication number
WO2007021841A2
WO2007021841A2 PCT/US2006/031201 US2006031201W WO2007021841A2 WO 2007021841 A2 WO2007021841 A2 WO 2007021841A2 US 2006031201 W US2006031201 W US 2006031201W WO 2007021841 A2 WO2007021841 A2 WO 2007021841A2
Authority
WO
WIPO (PCT)
Prior art keywords
region
leucine
substitution
antibody
variant
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2006/031201
Other languages
English (en)
French (fr)
Other versions
WO2007021841A3 (en
WO2007021841A9 (en
Inventor
Jeffery Stavenhagen
Sergey Gorlatov
Christopher Rankin
Nadine Tuaillon
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Macrogenics Inc
Original Assignee
Macrogenics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to SI200631873T priority Critical patent/SI1919503T1/sl
Priority to ES06801146.9T priority patent/ES2526811T3/es
Priority to DK06801146.9T priority patent/DK1919503T3/en
Priority to PL06801146T priority patent/PL1919503T3/pl
Priority to AU2006279945A priority patent/AU2006279945B2/en
Priority to JP2008526195A priority patent/JP5105485B2/ja
Priority to EP06801146.9A priority patent/EP1919503B1/en
Application filed by Macrogenics Inc filed Critical Macrogenics Inc
Priority to CA2618681A priority patent/CA2618681C/en
Publication of WO2007021841A2 publication Critical patent/WO2007021841A2/en
Priority to IL189263A priority patent/IL189263B/en
Anticipated expiration legal-status Critical
Publication of WO2007021841A3 publication Critical patent/WO2007021841A3/en
Publication of WO2007021841A9 publication Critical patent/WO2007021841A9/en
Priority to CY20141101083T priority patent/CY1115879T1/el
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/283Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/44Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/72Increased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/734Complement-dependent cytotoxicity [CDC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present invention relates to molecules, particularly polypeptides, more particularly immunoglobulins ⁇ e.g., antibodies), comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, which variant Fc region binds Fc ⁇ RIIIA and/or Fc ⁇ RIIA with a greater affinity, relative to a comparable molecule comprising the wild-type Fc region.
  • the molecules of the invention are particularly useful in preventing, treating, or ameliorating one or more symptoms associated with a disease, disorder, or infection.
  • the molecules of the invention are particularly useful for the treatment or prevention of a disease or disorder where an enhanced efficacy of effector cell function ⁇ e.g., ADCC) mediated by Fc ⁇ R is desired, e.g., cancer, infectious disease, and in enhancing the therapeutic efficacy of therapeutic antibodies the effect of which is mediated by ADCC.
  • ADCC effector cell function
  • the Fc receptors members of the immunoglobulin gene superfamily of proteins, are surface glycoproteins that can bind the Fc portion of immunoglobulin molecules. Each member of the family recognizes immunoglobulins of one or more isotypes through a recognition domain on the ⁇ chain of the Fc receptor. Fc receptors are defined by their specificity for immunoglobulin subtypes. Fc receptors for IgG are referred to as Fc ⁇ R, for IgE as F ⁇ R, and for IgA as Fc ⁇ R.
  • Different accessory cells bear Fc receptors for antibodies of different isotype, and the isotype of the antibody determines which accessory cells will be engaged in a given response (reviewed by Ravetch J.V. et al.
  • Fc ⁇ RII proteins are 40KDa integral membrane glycoproteins which bind only the complexed IgG due to a low affinity for monomeric Ig (10 6 M '1 ). This receptor is the most widely expressed Fc ⁇ R, present on all hematopoietic cells, including monocytes, macrophages, B cells, NK cells, neutrophils, mast cells, and platelets. Fc ⁇ RII has only two immunoglobulin-like regions in its immunoglobulin binding chain and hence a much lower affinity for IgG than Fc ⁇ RI.
  • Fc ⁇ RII-A There are three human Fc ⁇ RII genes (Fc ⁇ RII- A, Fc ⁇ RII-B, Fc ⁇ RII-C), all of which bind IgG in aggregates or immune complexes. [0006] Distinct differences within the cytoplasmic domains of Fc ⁇ RII-A and
  • Fc ⁇ RII-B create two functionally heterogenous responses to receptor ligation.
  • the fundamental difference is that the A isoform initiates intracellular signaling leading to cell activation such as phagocytosis and respiratory burst, whereas the B isoform initiates inhibitory signals, e.g., inhibiting B-cell activation.
  • Fc ⁇ RIIA gene express the Fc ⁇ RIIA gene.
  • Fc ⁇ RIIA clustering via immune complexes or specific antibody cross-linking serves to aggregate ITAMs along with receptor-associated kinases which facilitate ITAM phosphorylation.
  • ITAM phosphorylation serves as a docking site for Syk kinase, activation of which results in activation of downstream substrates (e.g., PI 3 K).
  • downstream substrates e.g., PI 3 K
  • a neoplasm, or tumor is a neoplastic mass resulting from abnormal uncontrolled cell growth which can be benign or malignant. Benign tumors generally remain localized. Malignant tumors are collectively termed cancers.
  • malignant generally means that the tumor can invade and destroy neighboring body structures and spread to distant sites to cause death (for review, see Robbins and Angell, 1976, Basic Pathology, 2d Ed., W.B. Saunders Co., Philadelphia, pp. 68-122). Cancer can arise in many sites of the body and behave differently depending upon its origin. Cancerous cells destroy the part of the body in which they originate and then spread to other part(s) of the body where they start new growth and cause more destruction.
  • cancer therapy may involve surgery, chemotherapy, hormonal therapy and/or radiation treatment to eradicate neoplastic cells in a patient (See, for example, Stockdale, 1998, "Principles of Cancer Patient Management", in Scientific American: Medicine, vol. 3, Rubenstein and Federman, eds., Chapter 12, Section IV).
  • cancer therapy could also involve biological therapy or immunotherapy. All of these approaches pose significant drawbacks for the patient.
  • Surgery for example, may be contraindicated due to the health of the patient or may be unacceptable to the patient. Additionally, surgery may not completely remove the neoplastic tissue. Radiation therapy is only effective when the neoplastic tissue exhibits a higher sensitivity to radiation than normal tissue, and radiation therapy can also often elicit serious side effects.
  • Hormonal therapy is rarely given as a single agent and although can be effective, is often used to prevent or delay recurrence of cancer after other treatments have removed the majority of the cancer cells.
  • Biological therapies/immunotherapies are limited in number and may produce side effects such as rashes or swellings, flu-like symptoms, including fever, chills and fatigue, digestive tract problems or allergic reactions.
  • chemotherapeutic agents available for treatment of cancer.
  • a significant majority of cancer chemotherapeutics act by inhibiting DNA synthesis, either directly, or indirectly by inhibiting the biosynthesis of the deoxyribonucleotide triphosphate precursors, to prevent DNA replication and concomitant cell division (See, for example, Gilman et al, Goodman and Gilman's: The Pharmacological Basis of Therapeutics, Eighth Ed. (Pergamom Press, New York, 1990)).
  • agents which include alkylating agents, such as nitrosourea, anti-metabolites, such as methotrexate and hydroxyurea, and other agents, such as etoposides, campathecins, bleomycin, doxorubicin, daunorubicin, etc. , although not necessarily cell cycle specific, kill cells during S phase because of their effect on DNA replication.
  • agents specifically colchicine and the vinca alkaloids, such as vinblastine and vincristine, interfere with microtubule assembly resulting in mitotic arrest.
  • Chemotherapy protocols generally involve administration of a combination of chemotherapeutic agents to increase the efficacy of treatment.
  • chemotherapeutic agents have many drawbacks (See, for example, Stockdale, 1998, "Principles Of Cancer Patient Management” in Scientific American Medicine, vol. 3, Rubenstein and Federman, eds., ch. 12, sect. 10). Almost all chemotherapeutic agents are toxic, and chemotherapy causes significant, and often dangerous, side effects, including severe nausea, bone marrow depression, immunosuppression, etc. Additionally, even with administration of combinations of chemotherapeutic agents, many tumor cells are resistant or develop resistance to the chemotherapeutic agents.
  • those cells resistant to the particular chemotherapeutic agents used in the treatment protocol often prove to be resistant to other drugs, even those agents that act by mechanisms different from the mechanisms of action of the drugs used in the specific treatment; this phenomenon is termed pleiotropic drug or multidrug resistance.
  • drug resistance many cancers prove refractory to standard chemotherapeutic treatment protocols.
  • Inflammation is a process by which the body's white blood cells and chemicals protect our bodies from infection by foreign substances, such as bacteria and viruses. It is usually characterized by pain, swelling, warmth and redness of the affected area. Chemicals known as cytokines and prostaglandins control this process, and are released in an ordered and self-limiting cascade into the blood or affected tissues. This release of chemicals increases the blood flow to the area of injury or infection, and may result in the redness and warmth. Some of the chemicals cause a leak of fluid into the tissues, resulting in swelling. This protective process may stimulate nerves and cause pain. These changes, when occurring for a limited period in the relevant area, work to the benefit of the body.
  • autoimmune and/or inflammatory disorders the immune system triggers an inflammatory response when there are no foreign substances to fight and the body's normally protective immune system causes damage to its own tissues by mistakenly attacking self.
  • autoimmune disorders which affect the body in different ways.
  • the brain is affected in individuals with multiple sclerosis
  • the gut is affected in individuals with Crohn's disease
  • the synovium, bone and cartilage of various joints are affected in individuals with rheumatoid arthritis.
  • the autoimmune disorder may affect only one organ or tissue type or may affect multiple organs and tissues.
  • Rheumatoid arthritis and juvenile rheumatoid arthritis are types of inflammatory arthritis.
  • Arthritis is a general term that describes inflammation in joints. Some, but not all, types of arthritis are the result of misdirected inflammation.
  • other types of arthritis associated with inflammation include the following: psoriatic arthritis, Reiter's syndrome, ankylosing spondylitis arthritis, and gouty arthritis.
  • Rheumatoid arthritis is a type of chronic arthritis that occurs in joints on both sides of the body (such as both hands, wrists or knees). This symmetry helps distinguish rheumatoid arthritis from other types of arthritis.
  • Rheumatoid arthritis is an autoimmune disorder where the body's immune system improperly identifies the synovial membranes that secrete the lubricating fluid in the joints as foreign. Inflammation results, and the cartilage and tissues in and around the joints are damaged or destroyed. In severe cases, this inflammation extends to other joint tissues and surrounding cartilage, where it may erode or destroy bone and cartilage and lead to joint deformities. The body replaces damaged tissue with scar tissue, causing the normal spaces within the joints to become narrow and the bones to fuse together. Rheumatoid arthritis creates stiffness, swelling, fatigue, anemia, weight loss, fever, and often, crippling pain.
  • rheumatoid arthritis can also cause the rheumatoid factor to be produced in the blood. That is why the diagnosis of rheumatoid arthritis is based on a combination of several factors and not just the presence of the rheumatoid factor in the blood.
  • the typical course of the disease is one of persistent but fluctuating joint symptoms, and after about 10 years, 90% of sufferers will show structural damage to bone and cartilage. A small percentage will have a short illness that clears up completely, and another small percentage will have very severe disease with many joint deformities, and occasionally other manifestations of the disease.
  • the inflammatory process causes erosion or destruction of bone and cartilage in the joints.
  • rheumatoid arthritis In rheumatoid arthritis, there is an autoimmune cycle of persistent antigen presentation, T-cell stimulation, cytokine secretion, synovial cell activation, and joint destruction.
  • the disease has a major impact on both the individual and society, causing significant pain, impaired function and disability, as well as costing millions of dollars in healthcare expenses and lost wages. (See, for example, the NIH website and the NIAID website).
  • recombinant soluble receptors for tumor necrosis factor (TNF)- ⁇ have been used in combination with methotrexate in the treatment of arthritis.
  • TNF tumor necrosis factor
  • only about 50% of the patients treated with a combination of methotrexate and anti-TNF- ⁇ agents such as recombinant soluble receptors for TNF- ⁇ show clinically significant improvement.
  • Many patients remain refractory despite treatment.
  • Difficult treatment issues still remain for patients with rheumatoid arthritis.
  • Many current treatments have a high incidence of side effects or cannot completely prevent disease progression. So far, no treatment is ideal, and there is no cure. Novel therapeutics are needed that more effectively treat rheumatoid arthritis and other autoimmune disorders.
  • the remarkable variety of these pathogens has caused the natural selection of two crucial features of adaptive immunity.
  • the characteristic features of each pathogen are its mode of transmission, its mechanism of replication, its pathogenesis or the means by which it causes disease, and the response it elicits.
  • the present invention is based, in part, on the identification of mutant human
  • IgGl heavy chain Fc regions with altered affinities for Fc ⁇ R receptors ⁇ e.g., activating Fc ⁇ Rs, inhibitory Fc ⁇ Rs), using a yeast display system.
  • Fc region plays an essential role in determining the outcome of monoclonal antibody therapy.
  • Current approaches to optimize the Fc region function e.g., antibody-dependent cell mediated cytotoxicity (ADCC), complement dependent cytotoxicity (CDC) activity
  • ADCC antibody-dependent cell mediated cytotoxicity
  • CDC complement dependent cytotoxicity
  • the present invention provides methods for engineering Fc regions and identification and screening of novel Fc variants outside the expected regions identified by structural studies.
  • Expected regions as used herein refer to those regions that based on structural and/or biochemical studies are in contact with an Fc ligand.
  • Fc variants with improvement in one or more Fc effector function by combining cell based functional assays and combinatorial library construction with state of the art automation.
  • the present invention assembles complete combinatorial libraries by saturating regions of interest within the Fc with modifications that cover all possible amino acid changes. Combinatorial libraries will be tested using a set of binding and functional assays to select mutants based on improved biological function.
  • the invention relates to molecules, preferably polypeptides, and more preferably immunoglobulins (e.g., antibodies), comprising a variant Fc region, having one or more amino acid modifications (e.g., substitutions, but also including insertions or deletions) in one or more regions, which modifications alter, e.g., increase or decrease, the affinity of the variant Fc region for an Fc ⁇ R.
  • said one or more amino acid modification increases the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA.
  • the molecules of the invention further specifically bind Fc ⁇ RIIB (via the Fc region) with a lower affinity than a comparable molecule (i.e., having the same amino acid sequence as the molecule of the invention except for the one or more amino acid modifications in the Fc region) comprising the wild-type Fc region binds Fc ⁇ RIIB.
  • the invention encompasses molecules with variant Fc regions, having one or more amino acid modifications, which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA and enhance the affinity of the variant Fc region for Fc ⁇ RIIB relative to a comparable molecule with a wild type Fc region.
  • the invention encompasses molecules with variant Fc regions, having one or more amino acid modifications, which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA but do not alter the affinity of the variant Fc regions for Fc ⁇ RIIB relative to a comparable molecule with a wild type Fc region.
  • a preferred embodiment is a variant Fc region that has enhanced affinity for Fc ⁇ RIIIA and Fc ⁇ RIIA but reduced affinity for Fc ⁇ RIIB relative to a comparable molecule with a wild type Fc region.
  • the Fc variants of the present invention may be combined with other Fc modifications, including but not limited to modifications that alter effector function.
  • the invention encompasses combining an Fc variant of the invention with other Fc modifications to provide additive, synergistic, or novel properties in antibodies or Fc fusions.
  • the Fc variants of the invention enhance the phenotype of the modification with which they are combined. For example, if an Fc variant of the invention is combined with a mutant known to bind Fc ⁇ RIIIA with a higher affinity than a comparable molecule comprising a wild type Fc region; the combination with a mutant of the invention results in a greater fold enhancement in Fc ⁇ RIIIA affinity.
  • the Fc variants of the present invention may be combined with other known Fc variants such as those disclosed in Duncan et al, 1988, Nature 332:563- 564; Lund et al., 1991, J. Immunol 147:2657-2662; Lund et al, 1992, MoI Immunol 29:53-59; Alegre et al, 1994, Transplantation 57:1537-1543; Hutchins et al. , 1995, Proc Natl. Acad Sci U S A 92:11980-11984; Jefferis et al, 1995, Immunol Lett.
  • the Fc variants of the present invention may be combined with one or more of the Fc variants, i.e., amino acid modifications relative to a wild-type Fc region, presented in tables 5, 6, 7, and 8, infra.
  • the invention encompasses molecules that are homodimers or heterodimers of
  • heterodimers comprising Fc regions refer to molecules where the two Fc chains have the same or different sequences.
  • each chain has one or more different modifications from the other chain.
  • one chain contains the wild-type Fc region and the other chains comprises one or or more modifications.
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild type Fc region, which variant Fc region does not bind any Fc ⁇ R or binds with a reduced affinity, relative to a comparable molecule comprising the wild- type Fc region, as determined by standard assays (e.g., in vitro assays) known to one skilled in the art.
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild type Fc region, which variant Fc region only binds one Fc ⁇ R, wherein said Fc ⁇ R is Fc ⁇ lllA.
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild type Fc region, which variant Fc region only binds one Fc ⁇ R, wherein said Fc ⁇ R is Fc ⁇ RIIA.
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild type Fc region, which variant Fc region only binds one Fc ⁇ R, wherein said Fc ⁇ R is Fc ⁇ RIIB.
  • Fc ⁇ R are initially determined using in vitro assays (biochemical or immunological based assays) known in the art for determining Fc-Fc ⁇ R interactions, i.e., specific binding of an Fc region to an Fc ⁇ R including but not limited to ELISA assay, surface plasmon resonance assay, immunoprecipitation assays (See Section 5.2.1).
  • in vitro assays biochemical or immunological based assays
  • the binding properties of the molecules of the invention are also characterized by in vitro functional assays for determining one or more Fc ⁇ R mediator effector cell functions (See Section 5.2.6).
  • the molecules of the invention have similar binding properties in in vivo models (such as those described and disclosed herein) as those in in vitro based assays
  • the present invention does not exclude molecules of the invention that do not exhibit the desired phenotype in in vitro based assays but do exhibit the desired phenotype in vivo.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable molecule comprising the wild-type Fc region binds Fc ⁇ RIIIA, provided that said variant Fc region does not solely have a substitution at any one of positions 329, 331, or 332, and do not include or are not solely substitution with any one of: alanine at any of positions 256, 290, 298, 312, 333, 334, 359, 360, 326, or 430; a lysine at position 330; a threonine at position 339; a methionine at position 320; a serine at position 326; an asparagine at position 326; an aspartic acid at position 326; a glutamic acid at position 326; a glutamic acid at position 326;
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIA with a greater affinity than a comparable molecule comprising the wild-type Fc region binds Fc ⁇ RIIA, provided that the one or more amino acid modifications do not include or are not solely substitution with an alanine at any of positions 256, 290, 326, 255, 258, 267, 272, 276, 280, 283, 285, 286, 331, 337, 268, 272, or 430; an asparagine at position 268; a glutamine at position 272; a glutamine, serine, or aspartic acid at position 286; a serine at position 290; a methionine, glutamine, glutamic acid, or arginine at position 320; a glutamic acid at position 322; a serine
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule has an altered affinity for an Fc ⁇ R, provided that said variant Fc region does not have a substitution at positions that make a direct contact with Fc ⁇ R based on crystallographic and structural analysis of Fc-Fc ⁇ R interactions such as those disclosed by Sondermann et al, (2000 Nature, 406: 267-273, which is incorporated herein by reference in its entirety).
  • positions within the Fc region that make a direct contact with Fc ⁇ R are amino acids 234-239 (hinge region), amino acids 265-269 (B/C loop), amino acids 297-299 (CVE loop), and amino acids 327-332 (F/G) loop.
  • the molecules of the invention comprising variant Fc regions comprise modification of at least one residue that does not make a direct contact with an Fc ⁇ R based on structural and crystallographic analysis, e.g., is not within the Fc-Fc ⁇ R binding site.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule binds an Fc ⁇ R with an altered affinity relative to a molecule comprising a wild-type Fc region, provided that said at least one amino acid modification do not include or are not solely a substitution at any of positions 255, 256, 258, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 300, 301, 303, 305, 307, 309, 312, 320, 322, 326, 329, 330, 332, 331, 333, 334, 335, 337, 338, 339, 340, 359, 360, 373, 376, 416, 419, 430, 434, 435, 437, 438, 439
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule binds an Fc ⁇ R with an altered affinity relative to a molecule comprising a wild-type Fc region, provided that said variant Fc region does not include or are not solely a substitution at any of positions 255, 258, 267, 269, 270, 276, 278, 280, 283, 285, 289, 292, 293, 294, 295, 296, 300, 303, 305, 307, 309, 322, 329, 332, 331, 337, 338, 340, 373, 376, 416, 419, 434, 435, 437, 438, 439 and does not have an alanine at any of positions 256, 290, 298, 312, 333, 334, 359, 360 ?
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region does not include or are not solely a substitution at any of positions 268, 269, 270, 272, 276, 278, 283, 285, 286, 289, 292, 293, 301, 303, 305, 307, 309, 331, 333, 334, 335, 337, 338, 340, 360, 373, 376, 416, 419, 430, 434, 435, 437, 438 or 439 and does not have a histidine, glutamine, or tyrosine at position 280; a serine, glycine, threonine or tyrosine at position 290, a leucine or isoleucine at position 300; an asparagine at position 294, a proline at position 296; a proline, asparagine, aspartic acid, or valine at position 298; a lysine
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule binds an Fc ⁇ R with a reduced affnity relative to a molecule comprising a wild-type Fc region provided that said variant Fc region does not have or are not solely have a substitution at any of positions 252, 254, 265, 268, 269, 270, 278, 289, 292, 293, 294, 295, 296, 298, 300, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438, or 439.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule binds an Fc ⁇ R with an enhanced affnity relative to a molecule comprising a wild-type Fc region provided that said variant Fc region does not have or are not solely a substitution at any of positions 280, 283, 285, 286, 290, 294, 295, 298, 300, 301, 305, 307, 309, 312, 315, 331, 333, 334, 337, 340, 360, 378, 398, or 430.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region does not include a substitution or does not solely have a substitution at any of positions 330, 243, 247, 298, 241, 240, 244, 263, 262, 235, 269, or 328 and does not have a leucine at position 243, an asparagine at position 298, a leucine at position 241, and isoleucine or an alanine at position 240, a histidine at position 244, a valine at position 330, or an isoleucine at position 328.
  • molecules of the invention comprise a variant Fc region having one or more amino acid modifications (e.g., substitutions), which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA by at least 2-fold, relative to a comparable molecule comprising a wild-type Fc region.
  • amino acid modifications e.g., substitutions
  • molecules of the invention comprise a variant Fc region having one or more amino acid modifications (e.g., substitutions), which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA by greater than 2-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 8-fold, or at least 10-fold relative to a comparable molecule comprising a wild-type Fc region.
  • amino acid modifications e.g., substitutions
  • molecules of the invention comprising a variant Fc region specifically bind Fc ⁇ RIIIA and/or Fc ⁇ RIIA with at least 65%, at least 75%, at least 85%, at least 95%, at least 100%, at least 150%, at least 200% greater affinity relative to a molecule comprising a wild-type Fc region.
  • Such measurements are preferably in vitro assays.
  • the invention encompasses molecules with altered affinities for the activating and/or inhibitory Fc ⁇ receptors.
  • the invention contemplates molecules with variant Fc regions, having one or more amino acid modifications, which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIB but decrease the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA, relative to a comparable molecule with a wild-type Fc region.
  • the invention encompasses molecules with variant Fc regions, having one or more amino acid modifications, which modifcations decrease the affinity of the variant Fc region for Fc ⁇ RIIB and also decrease the affinity of the variant Fc regions for Fc ⁇ RIIIA and/or Fc ⁇ RIIA relative to a comparable molecule with a wild-type Fc region.
  • the invention encompasses molecules with variant Fc regions, having one or more amino acid modifications, which modifcations increase the affinity of the variant Fc region for Fc ⁇ RIIB and also increase the affinity of the variant Fc regions for Fc ⁇ RIIIA and/or Fc ⁇ RIIA relative to a comparable molecule with a wild-type Fc region.
  • the invention encompasses molecules with variant Fc regions, which modifications decrease the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA but do not alter the affinity of the variant Fc region for Fc ⁇ RIIB relative to a comparable molecule with a wild-type Fc region.
  • the invention encompasses molecules with variant Fc regions, which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA but reduce the affinity of the variant Fc region for Fc ⁇ RIIB relative to a comparable molecule with a wild-type Fc region.
  • the molecules of the invention comprise a variant
  • the Fc region having one or more amino acid modifications (e.g., substitutions), which one or more modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and decrease the affinity of the variant Fc region for Fc ⁇ RIIB, relative to a comparable molecule comprising a wild-type Fc region which binds Fc ⁇ RIIIA and Fc ⁇ RIIB with wild-type affinity.
  • the one or more amino acid modifications are not a substitution with alanine at any of positions 256, 298, 333, or 334.
  • the molecules of the invention comprise a variant Fc region, having one or more amino acid modifications (e.g., substitutions), which one or more modifications increase the affinity of the variant Fc region for Fc ⁇ RIIA and decrease the affinity of the variant Fc region for Fc ⁇ RIIB, relative to a comparable molecule comprising a wild-type Fc region which binds Fc ⁇ RIIA and Fc ⁇ RIIB with wild-type affinity.
  • the one or more amino acid modifications is not a substitution with arginine at position 320.
  • the molecules of the invention with altered affinities for activating and/or inhibitory receptors having variant Fc regions have one or more amino acid modifications, wherein said one or more amino acid modification is a substitution at position 288 with asaparagine, at position 330 with serine and at position 396 with leucine (MgFcIO) (See Tables 5 & 6); or a substitution at position 334 with glutamic acid, at position 359 with asparagine, and at position 366 with serine (MgFcI 3); or a substitution at position 316 with aspartic acid, at position 378 with valine, and at position 399 with glutamic acid (MgFc27); or a substitution at position 392 with threonine, and at position 396 with leucine (MgFc38); or a substitution at position 221 with glutamic acid, at position 270 with glutamic acid, at position 308 with alanine, at position 311 with histidine, at position
  • the variant Fc region further comprises one or more amino acid modifications disclosed in tables 5, 6, 7, and 8. infra.
  • the preferred method for screening and identifying molecules comprising variant Fc regions with altered Fc ⁇ R affinities is yeast surface display technology (for review see Boder and Wittrup, 2000, Methods in Enzymology, 328: 430-444, which is incorporated herein by reference in its entirety).
  • yeast surface display is a genetic method whereby polypeptides comprising Fc mutants are expressed on the yeast cell wall in a form accessible for interacting with Fc ⁇ R.
  • Yeast surface display of the mutant Fc containing polypeptides of the invention may be performed in accordance with any of the techniques known to those skilled in the art or the specific methods described herein.
  • Yeast display offers the advantage of utilizing actual binding to a desired receptor to identify variant Fc regions that have enhanced binding to that receptor.
  • One aspect of the invention provides a method for selecting mutant Fc fusion proteins with a desirable binding property, e.g., the ability of the mutant Fc fusion protein to bind Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising a wild-type Fc region binds Fc ⁇ RIIIA.
  • Yeast cells displaying the mutant Fc fusion proteins can be screened and characterized by any biochemical or immunological based assays known to those skilled in the art for assessing binding interactions.
  • screening of mutant Fc fusion proteins is done using one or more biochemical based assays, e.g., an ELISA assay.
  • screening and identifying molecules comprising variant Fc regions with altered Fc ⁇ R affinities are done using the yeast display technology as described herein in combination with one or more biochemical based assays, preferably in a high throughput manner.
  • the one or more biochemical assays can be any assay known in the art for identifying Fc-Fc ⁇ R interaction, i.e., specific binding of an Fc region to an Fc ⁇ R, including, but not limited to, an ELISA assay, surface plasmon resonance assays, immunoprecipitation assay, affinity chromatography, and equilibrium dialysis.
  • screening and identifying molecules comprising variant Fc regions with altered Fc ⁇ R affinities are done using the yeast display technology as described herein in combination with one or more functional based assays, preferably in a high throughput manner.
  • the functional based assays can be any assay known in the art for characterizing one or more Fc ⁇ R mediated effector cell function such as those described herein in Section 5.2.6.
  • Non-limiting examples of effector cell functions include but are not limited to, antibody-dependent cell mediated cytotoxicity (ADCC), antibody-dependent phagocytosis, phagocytosis, opsonization, opsonophagocytosis, cell binding, rosetting, CIq binding, and complement dependent cell mediated cytotoxicity.
  • ADCC antibody-dependent cell mediated cytotoxicity
  • screening and identifying molecules comprising variant Fc regions with altered Fc ⁇ R affinities are done using the yeast display technology as described herein in combination with one or more biochemical based assays in combination or in parallel with one or more functional based assays, preferably in a high throughput manner.
  • a preferred method for measuring the Fc ⁇ R-Fc interaction in accordance with the invention is an assay developed by the inventors, which allows detection and quantitation of the interaction, despite the inherently weak affinity of the receptor for its ligand, e.g., in the micromolar range for Fc ⁇ RIIB and Fc ⁇ RIIIA.
  • the method involves the formation of an Fc ⁇ R complex (e.g., Fc ⁇ RIIIA, Fc ⁇ RIIB) that has an improved avidity for an Fc region, relative to an uncomplexed Fc ⁇ R.
  • the invention encompasses a method for producing a tetrameric Fc ⁇ R complex, wherein said tetrameric complex has an enhanced affinity for an Fc region, relative to the affinity of a monomeric Fc ⁇ R for the Fc region, said method comprising: (i) producing a fusion protein, such that a 15 amino acid AVITAG sequence operably linked to the soluble region of Fc ⁇ R; (ii) biotinylating the protein produced using an E. coli BirA enzyme; (iii) mixing the biotinylated protein produced with streptaividn-phycoerythrin in an appropriate molar ratio, such that a tetrameric Fc ⁇ R complex is formed.
  • polypeptides comprising Fc regions bind the tetrameric Fc ⁇ R complexes, formed according to the methods of the invention, with at least an 8-fold higher affinity than they bind the monomeric uncomplexed Fc ⁇ R.
  • the binding of polypeptides comprising Fc regions to the tetrameric Fc ⁇ R complexes may be determined using standard techniques known to those skilled in the art, such as for example, fluorescence activated cell sorting (FACS), radioimmunoassays, ELISA assays, etc.
  • the invention encompasses the use of the immune complexes formed according to the methods described above for determining the functionality of molecules comprising an Fc region in cell-based or cell-free assays.
  • the invention provides modified immunoglobulins comprising a variant Fc region with an enhanced affinity for Fc ⁇ RJIIA and/or Fc ⁇ RIIA.
  • immunoglobulins include IgG molecules that naturally contain Fc ⁇ R binding regions (e.g., Fc ⁇ RIIIA and/or Fc ⁇ RIIB binding regions), or immunoglobulin derivatives that have been engineered to contain an Fc ⁇ R binding region (e.g., Fc ⁇ RIIIA and/or Fc ⁇ RIIB binding regions).
  • the modified immunoglobulins of the invention include any immunoglobulin molecule that binds, preferably, immunospecifically, i.e., competes off non-specific binding as determined by immunoassays well known in the art for assaying specific antigen-antibody binding, an antigen and contains an Fc ⁇ R binding region (e.g., a Fc ⁇ RIIIA and/or Fc ⁇ RIIB binding region).
  • immunospecifically i.e., competes off non-specific binding as determined by immunoassays well known in the art for assaying specific antigen-antibody binding, an antigen and contains an Fc ⁇ R binding region (e.g., a Fc ⁇ RIIIA and/or Fc ⁇ RIIB binding region).
  • Such antibodies include, but are not limited to, polyclonal, monoclonal, bi- specific, multi-specific, human, humanized, chimeric antibodies, single chain antibodies, Fab fragments, F(ab') 2 fragments, disulfide-linked Fvs, and fragments containing either a VL or VH domain or even a complementary determining region (CDR) that specifically binds an antigen, in certain cases, engineered to contain or fused to an Fc ⁇ R binding region.
  • CDR complementary determining region
  • the invention encompasses immunoglobulins comprising a variant Fc region with an enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA such that the immunoglobulin has an enhanced effector function, e.g., antibody dependent cell mediated cytotoxicity.
  • the effector function of the molecules of the invention can be assayed using any assay described herein or known to those skilled in the art.
  • immunoglobulins comprising a variant Fc region with an enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA have an enhanced ADCC activity relative to wild-type by at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 50-fold, or at least 100-fold.
  • the invention encompasses engineering human or humanized therapeutic antibodies (e.g., tumor specific monoclonal antibodies) in the Fc region by modification (e.g., substitution, insertion, deletion) of one or more amino acid residues, which modifications modulate the affinity of the therapeutic antibody for an Fc ⁇ R activating receptor and/or an Fc ⁇ R inhibitory receptor.
  • the invention relates to engineering human or humanized therapeutic antibodies (e.g., tumor specific monoclonal antibodies) in the Fc region by modification of one or more amino acid residues, which modifications increase the affinity of the Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA.
  • the invention relates to engineering human or humanized therapeutic antibodies (e.g., tumor specific monoclonal antibodies) in the Fc region by modification of one or more amino acid residues, which modification increases the affinity of the Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA and further decreases the affinity of the Fc region for Fc ⁇ RIIB.
  • the engineered therapeutic antibodies may further have an enhanced effector function, e.g., enhanced ADCC activity, phagocytosis activity, etc. , as determined by standard assays known to those skilled in the art.
  • the invention encompasses engineering a humanized monoclonal antibody specific for Her2/neu protooncogene (e.g., Ab4D5 humanized antibody as disclosed in Carter et al, 1992, Proc. Natl. Acad. ScI USA 89:4285- 9) by modification (e.g., substitution, insertion, deletion) of at least one amino acid residue which modification increases the affinity of the Fc rgion for Fc ⁇ RIIIA and/or Fc ⁇ RIIA.
  • modification of the humanized Her2/neu monoclonal antibody may also further decrease the affinity of the Fc region for Fc ⁇ RIIB.
  • the engineered humanized monoclonal antibodies specific for Her2/neu may further have an enhanced effector function as determined by standard assays known in the art and disclosed and exemplified herein.
  • the invention encompasses engineering an anti-CD20 antibody by modification (e.g., substitution, insertion, deletion) of at least one amino acid residue which modification increases the affinity of the Fc rgion for Fc ⁇ RIIIA and/or Fc ⁇ RIIA,
  • the anti-CD20 antibody is mouse human chimeric anti-CD20 monoclonal antibody, 2H7
  • Further nonlimiting examples of anti-CD20 atibodies that can be used in the methods of the invention are disclosed in U.S. Patent Application No.: 11/271,140, filed November 10, 2005, hereby incorporated by reference in its entirety.
  • modification of the anti-CD20 monoclonal antibody, 2H7 may also further decrease the affinity of the Fc region for Fc ⁇ RIIB.
  • the engineered anti-CD20 monoclonal antibody, 2H7 may further have an enhanced effector function as determined by standard assays known in the art and disclosed and exemplified herein.
  • the invention encompasses engineering an anti-Fc ⁇ RIIB antibody, in particular an anti-Fc ⁇ RIIB antibody that specifically binds human Fc ⁇ RIIB, more particularly native human Fc ⁇ RIIB, by modification (e.g., substitution, insertion, deletion) of at least one amino acid residue which modification increases the affinity of the Fc rgion for Fc ⁇ RIIIA and/or Fc ⁇ RIIA.
  • modification e.g., substitution, insertion, deletion
  • Non-limiting examples of representaive anti-Fc ⁇ RIIB antibodies are disclosed in U.S. Provisional Application No. 60/403,266 filed on August 12, 2002; U.S. Application No.
  • anti-Fc ⁇ RIIB antibodies that may be engineered in accordance with the methods of the invention are the monoclonal antibodies produced by clone 2B6, 3H7, 8B5.4.3, 1D5, 2El, 2H9, 2Dl 1 and 1F2 having ATCC accession numbers PTA-4591, PTA-4592, PTA- 7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960, and PTA-5959, respectively (deposited at ATCC, 10801 University Boulevard, Manassas, VA 02209-2011, all of which are incorporated herein by reference), or chimeric, humanized or other engineered versions thereof.
  • the invention encompasses engineering a humanized antibody comprising the heavy chain variable domain and/or light chain variable domain of 2B6, 3H7 or 8B5.3.4. In another specific embodiment, the invention encompasses engineering a humanized antibody comprising the CDRs of 2B6, 3H7 or 8B5.3.4. In a specific embodiment, the invention encompasses engineering a humanized antibody comprising the heavy chain variable domain having the amino acid sequence of SEQ ID NO: I 5 SEQ ID NO: 2 or SEQ ID NO: 3 and the light chain variable domain having the amino acid sequence of SEQ ID NO: 4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7 or SEQ ID NO: 8.
  • the invention encompasses engineering a humanized antibody comprising the heavy chain variable domain having the amino acid sequence of SEQ ID NO: 9 and the light chain variable domain having the amino acid sequence of SEQ ID NO: 10.
  • modification of the anti-Fc ⁇ RIIB antibody may also further decrease the affinity of the Fc region for Fc ⁇ RIIB.
  • the engineered anti-Fc ⁇ RIIB antibody may further have an enhanced effector function as determined by standard assays known in the art and disclosed and exemplified herein.
  • the anti-Fc ⁇ RIIB monoclonal antibody comprises a modification at position 334 with glutamic acid, at position 359 with asparagine, and at position 366 with serine (MgFcI 3); or a substitution at position 316 with aspartic acid, at position 378 with valine, and at position 399 with glutamic acid (MgFc27); or a substitution at position 243 with isoleucine, at position 379 with leucine, and at position 420 with valine (MgFc29); or a substitution at positon 392 with threonine and at position 396 with leucine (MgFc38); or a substitution at position 221 with glutamic acid, at positon 270 with glutamic acid, at positon 308 with alanine, at position 311 with histidine, at position 396 with leucine, and at position 402 with aspartic (MgFc42); or a substitution at position 410 with his
  • the present invention also includes polynucleotides that encode a molecule of the invention, including polypeptides and antibodies, identified by the methods of the invention.
  • the polynucleotides encoding the molecules of the invention may be obtained, and the nucleotide sequence of the polynucleotides determined, by any method known in the art.
  • the invention relates to an isolated nucleic acid encoding a molecule of the invention.
  • the invention also provides a vector comprising said nucleic acid.
  • the invention further provides host cells containing the vectors or polynucleotides of the invention.
  • the invention further provides methods for the production of the molecules of the invention.
  • the molecules of the invention including polypeptides and antibodies, can be produced by any method known to those skilled in the art, in particular, by recombinant expression.
  • the invention relates to a method for recombinantly producing a molecule of the invention, said method comprising: (i) culturing in a medium a host cell comprising a nucleic acid encoding said molecule, under conditions suitable for the expression of said molecule; and (ii) recovery of said molecule from said medium.
  • the molecules identified in accordance with the methods of the invention are useful in preventing, treating, or ameliorating one or more symptoms associated with a disease, disorder, or infection.
  • the molecules of the invention are particularly useful for the treatment or prevention of a disease or disorder where an enhanced efficacy of effector cell function (e.g., ADCC) mediated by Fc ⁇ R is desired, e.g., cancer, infectious disease, and in enhancing the therapeutic efficacy of therapeutic antibodies the effect of which is mediated by ADCC.
  • ADCC effector cell function
  • the invention encompasses a method of treating cancer in a patient having a cancer characterized by a cancer antigen, said method comprising administering a therapeutically effective amount of a therapeutic antibody that binds the cancer antigen, which has been engineered in accordance with the methods of the invention.
  • the invention encompasses a method for treating cancer in a patient having a cancer characterized by a cancer antigen, said method comprising administering a therapeutically effective amount of a therapeutic antibody that specifically binds said cancer antigen, said therapeutic antibody comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said therapeutic antibody specifically binds Fc ⁇ RIIIA with a greater affinity than the therapeutic antibody comprising the wild-type Fc region binds Fc ⁇ RIIIA, provided that said variant Fc region does not have a substitution at positions 329, 331, or 332, and does not have an alanine at any of positions 256, 290, 298, 312, 333, 334, 359, 360, or 430; a lysine at position 330; a threonine at position 339; a methionine at position 320; a serine at position 326; an asparagine at position 326;
  • the invention encompasses a method for treating cancer in a patient having a cancer characterized by a cancer antigen, said method comprising administering a therapeutically effective amount of a therapeutic antibody that specifically binds a cancer antigen, said therapeutic antibody comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region such that said therapeutic antibody specifically binds Fc ⁇ RIIIA with a greater affinity than a therapeutic antibody comprising the wild-type Fc region binds Fc ⁇ RIIIA, and said therapeutic antibody further specifically binds Fc ⁇ RIIB with a lower affinity than a therapeutic antibody comprising the wild-type Fc region binds Fc ⁇ RIIB, provided that said variant Fc region does not have an alanine at any of positions 256, 298, 333, or 334.
  • the invention encompasses a method for treating cancer in a patient characterized by a cancer antigen, said method comprising administering a therapeutically effective amount of a therapeutic antibody that specifically binds said cancer antigen and said therapeutic antibody comprises a variant Fc region so that the antibody has an enhanced ADCC activity.
  • the invention encompasses a method of treating an autoimmune disorder and/or inflammatory disorder in a patient in need thereof, said method comprising administering to said patient a therapeutically effective amount of a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild type Fc region, such that said molecule specifically binds Fc ⁇ RIIB with a greater affinity than a comparable molecule comprising the wild type Fc region, and said molecule further specifically binds Fc ⁇ RIIIA with a lower affinity than a comparable molecule comprising the wild type Fc region., and said molecule binds an immune complex (e.g., an antigen/antibody complex).
  • an immune complex e.g., an antigen/antibody complex
  • the invention encompasses a method of treating an autoimmune disorder and/or inflammatory disorder further comprising administering one or more additional prophylactic or therapeutic agents, e.g., immunomodulatory agents, anti-inflammatory agents, used for the treatment and/or prevention of such diseases.
  • additional prophylactic or therapeutic agents e.g., immunomodulatory agents, anti-inflammatory agents
  • the invention also encompasses methods for treating or preventing an infectious disease in a subject comprising administering a therapeutically or prophylactically effective amount of one or more molecules of the invention that bind an infectious agent or cellular receptor therefor.
  • infectious diseases that can be treated or prevented by the molecules of the invention are caused by infectious agents including but not limited to viruses, bacteria, fungi, protozae, and viruses.
  • molecules of the invention comprising variant Fc regions have an enhanced antibody effector function towards an infectious agent, e.g., a pathogenic protein, relative to a comparable molecule comprising a wild-type Fc region.
  • molecules of the invention enhance the efficacy of treatment of an infectious disease by enhancing phagocytosis and/or opsonization of the infectious agent causing the infectious disease.
  • molecules of the invention enhance the efficacy of treatment of an infectious disease by enhancing ADCC of infected cells causing the infectious disease.
  • the molecules of the invention may be administered in combination with a therapeutically or prophylactically effective amount of one or additional therapeutic agents known to those skilled in the art for the treatment and/or prevention of an infectious disease.
  • the invention contemplates the use of the molecules of the invention in combination with antibiotics known to those skilled in the art for the treatment and or prevention of an infectious disease.
  • the invention provides pharmaceutical compositions comprising a molecule of the invention, e.g., a polypeptide comprising a variant Fc region, an immunoglobulin comprising a variant Fc region, a therapeutic antibody engineered in accordance with the invention, and a pharmaceutically acceptable carrier.
  • the invention additionally provides pharmaceutical compositions further comprising one or more additional therapeutic agents, including but not limited to anti-cancer agents, anti-inflammatory agents, immunomodulatory agents.
  • the term "Fc region” is used to define a C-terminal region of an IgG heavy chain. Although the boundaries may vary slightly, the human IgG heavy chain Fc region is defined to stretch from Cys226 to the carboxy terminus.
  • the Fc region of an IgG comprises two constant domains, CH2 and CH3.
  • the CH2 domain of a human IgG Fc region (also referred to as "C ⁇ 2" domain) usually extends from amino acid 231 to amino acid 338.
  • the CH3 domain of a human IgG Fc region usually extends from amino acids 342 to 447.
  • the CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG.
  • the numbering of the residues in an IgG heavy chain is that of the EU index as in Kabat et ah, Sequences of Proteins of Immunological Interest, 5 th Ed. Public Health Service, NHl, MD (1991), expressly incorporated herein by references.
  • the "EU index as in Kabat” refers to the numbering of the human IgGl EU antibody.
  • the "hinge region” is generally defined as stretching from Glu216 to Pro230 of human IgGl . Hinge regions of other IgG isotypes may be aligned with the IgGl sequence by placing the first and last cysteine residues forming inter-heavy chain S-S bonds in the same positions.
  • antibody refers to monoclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, synthetic antibodies, chimeric antibodies, polyclonal antibodies, camelized antibodies, single-chain Fvs (scFv), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked bispecific Fvs (sdFv), intrabodies, and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id and anti-anti-Id antibodies to antibodies of the invention), and epitope-binding fragments of any of the above.
  • scFv single-chain Fvs
  • Fab fragments single chain antibodies
  • F(ab') fragments fragments
  • disulfide-linked bispecific Fvs sdFv
  • intrabodies and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id and anti-anti-Id antibodies to antibodies of the invention), and epitope-binding fragments of any
  • antibodies include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an antigen binding site.
  • Immunoglobulin molecules can be of any type ⁇ e.g. , IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG 1 , IgG 2 , IgG 3 , IgG 4 , IgA 1 and IgA 2 ) or subclass.
  • the term "derivative" in the context of polypeptides or proteins refers to a polypeptide or protein that comprises an amino acid sequence which has been altered by the introduction of amino acid residue substitutions, deletions or additions.
  • derivative also refers to a polypeptide or protein which has been modified, i.e, by the covalent attachment of any type of molecule to the polypeptide or protein.
  • an antibody may be modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc.
  • a derivative polypeptide or protein may be produced by chemical modifications using techniques known to those of skill in the ait, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Further, a derivative polypeptide or protein derivative possesses a similar or identical function as the polypeptide or protein from which it was derived.
  • the term "derivative" in the context of a non-proteinaceous derivative refers to a second organic or inorganic molecule that is formed based upon the structure of a first organic or inorganic molecule.
  • a derivative of an organic molecule includes, but is not limited to, a molecule modified, e.g., by the addition or deletion of a hydroxyl, methyl, ethyl, carboxyl or amine group.
  • An organic molecule may also be esterified, alkylated and/or phosphorylated.
  • the terms “disorder” and “disease” are used interchangeably to refer to a condition in a subject.
  • autoimmune disease is used interchangeably with the term “autoimmune disorder” to refer to a condition in a subject characterized by cellular, tissue and/or organ injury caused by an immunologic reaction of the subject to its own cells, tissues and/or organs.
  • inflammatory disease is used interchangeably with the term “inflammatory disorder” to refer to a condition in a subject characterized by inflammation, preferably chronic inflammation.
  • Autoimmune disorders may or may not be associated with inflammation.
  • inflammation may or may not be caused by an autoimmune disorder.
  • certain disorders may be characterized as both autoimmune and inflammatory disorders.
  • cancer refers to a neoplasm or tumor resulting from abnormal uncontrolled growth of cells.
  • cancer explicitly includes, leukemias and lymphomas.
  • cancer refers to a benign tumor, which has remained localized.
  • cancer refers to a malignant tumor, which has invaded and destroyed neighboring body structures and spread to distant sites.
  • the cancer is associated with a specific cancer antigen.
  • an immunomodulatory agent refers to an agent that modulates a host's immune system.
  • an immunomodulatory agent is an immunosuppressant agent.
  • an immunomodulatory agent is an immunostimulatory agent.
  • Immunomodatory agents include, but are not limited to, small molecules, peptides, polypeptides, fusion proteins, antibodies, inorganic molecules, mimetic agents, and organic molecules.
  • epitope refers to a fragment of a polypeptide or protein or a non-protein molecule having antigenic or immunogenic activity in an animal, preferably in a mammal, and most preferably in a human.
  • An epitope having immunogenic activity is a fragment of a polypeptide or protein that elicits an antibody response in an animal.
  • An epitope having antigenic activity is a fragment of a polypeptide or protein to which an antibody immunospecifically binds as determined by any method well-known to one of skill in the art, for example by immunoassays. Antigenic epitopes need not necessarily be immunogenic.
  • fragment refers to a peptide or polypeptide comprising an amino acid sequence of at least 5 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least contiguous 80 amino acid residues, at least contiguous 90 amino acid residues, at least contiguous 100 amino acid residues, at least contiguous 125 amino acid residues, at least 150 contiguous amino acid residues, at least contiguous 175 amino acid residues, at least contiguous 200 amino acid residues, or at least contiguous 250 amino acid residues of the amino acid sequence of another polypeptide.
  • a fragment of a polypeptide retains at least one function of
  • nucleic acids and “nucleotide sequences” include
  • DNA molecules e.g., cDNA or genomic DNA
  • RNA molecules e.g., mRNA
  • combinations of DNA and RNA molecules or hybrid DNA/RNA molecules e.g., DNA molecules, and analogs of DNA or RNA molecules.
  • analogs can be generated using, for example, nucleotide analogs, which include, but are not limited to, inosine or tritylated bases.
  • Such analogs can also comprise DNA or RNA molecules comprising modified backbones that lend beneficial attributes to the molecules such as, for example, nuclease resistance or an increased ability to cross cellular membranes.
  • a "therapeutically effective amount” refers to that amount of the therapeutic agent sufficient to treat or manage a disease or disorder.
  • a therapeutically effective amount may refer to the amount of therapeutic agent sufficient to delay or minimize the onset of disease, e.g., delay or minimize the spread of cancer.
  • a therapeutically effective amount may also refer to the amount of the therapeutic agent that provides a therapeutic benefit in the treatment or management of a disease.
  • a therapeutically effective amount with respect to a therapeutic agent of the invention means the amount of therapeutic agent alone, or in combination with other therapies, that provides a therapeutic benefit in the treatment or management of a disease.
  • prophylactic agent and “prophylactic agents” refer to any agent(s) which can be used in the prevention of a disorder, or prevention of recurrence or spread of a disorder.
  • a prophylactically effective amount may refer to the amount of prophylactic agent sufficient to prevent the recurrence or spread of hyperproliferative disease, particularly cancer, or the occurrence of such in a patient, including but not limited to those predisposed to hyperproliferative disease, for example those genetically predisposed to cancer or previously exposed to carcinogens.
  • a prophylactically effective amount may also refer to the amount of the prophylactic agent that provides a prophylactic benefit in the prevention of disease.
  • a prophylactically effective amount with respect to a prophylactic agent of the invention means that amount of prophylactic agent alone, or in combination with other agents, that provides a prophylactic benefit in the prevention of disease.
  • the terms “prevent”, “preventing” and “prevention” refer to the prevention of the recurrence or onset of one or more symptoms of a disorder in a subject as result of the administration of a prophylactic or therapeutic agent.
  • the term “in combination” refers to the use of more than one prophylactic and/or therapeutic agents. The use of the term “in combination” does not restrict the order in which prophylactic and/or therapeutic agents are administered to a subject with a disorder. A first prophylactic or therapeutic agent can be administered prior to (e.g.
  • Effector function as used herein is meant a biochemical event that results from the interaction of an antibody Fc region with an Fc receptor or ligand. Effector functions include but are not limited to antibody dependent cell mediated cytotoxicity (ADCC), antibody dependent cell mediated phagocytosis (ADCP), and complement dependent cytotoxicity (CDC). Effector functions include both those that operate after the binding of an antigen and those that operate independent of antigen binding.
  • ADCC antibody dependent cell mediated cytotoxicity
  • ADCP antibody dependent cell mediated phagocytosis
  • CDC complement dependent cytotoxicity
  • Appector cell as used herein is meant a cell of the immune system that expresses one or more Fc receptors and mediates one or more effector functions. Effector cells include but are not limited to monocytes, macrophages, neutrophils, dendritic cells, eosinophils, mast cells, platelets, B cells, large granular lymphocytes, Langerhans' cells, natural killer (NK) cells, and may be from any organism including but not limited to humans, mice, rats, rabbits, and monkeys.
  • Effector cells include but are not limited to monocytes, macrophages, neutrophils, dendritic cells, eosinophils, mast cells, platelets, B cells, large granular lymphocytes, Langerhans' cells, natural killer (NK) cells, and may be from any organism including but not limited to humans, mice, rats, rabbits, and monkeys.
  • Fc ligand as used herein is meant a molecule, preferably a polypeptide, from any organism that binds to the Fc region of an antibody to form an Fc-ligand complex.
  • Fc ligands include but are not limited to Fc ⁇ Rs, Fc ⁇ Rs, Fc ⁇ Rs, FcRn, CIq, C3, staphylococcal protein A, streptococcal protein G, and viral Fc ⁇ R.
  • Fc ligands may include undiscovered molecules that bind Fc.
  • FIG. 1 SCHEMATIC OF SEQUENCE OF 8B5.3.4 VARIABLE LIGHT
  • FIG. 2 SCHEMATIC OF SEQUENCE OF 8B5.3.4 VARIABLE HEAVY
  • FIG. 3 SDS-PAGE ANALYSIS OF RECOMBINANT SOLUBLE Fc ⁇ R
  • FIG. 4 ELISA ASSAY OF RECOMBINANT SOLUBLE Fc ⁇ R
  • FIGs. 5 A and B CHARACTERIZATION OF Fc ⁇ RIIIA TETRAMERIC COMPLEX USING AN ELISA ASSAY
  • Soluble tetrameric Fc ⁇ RIIIA complex binds soluble monomeric human IgG specifically. Binding of soluble tetrameric Fc ⁇ RIIIA to human IgG is blocked by 3G8 ( ⁇ ), a mouse anti-Fc ⁇ lllA monoclonal antibody; the 4-4-20 monoclonal antibody harboring the D265A mutation was not able to block the binding of soluble tetrameric Fc ⁇ RIIIA to aggregated human IgG ( ⁇ ).
  • Binding of soluble tetrameric Fc ⁇ RIIIA complex to soluble monomeric human IgG ( ⁇ ) is compared to the binding of monomeric soluble Fc ⁇ RIIIA to soluble monomeric human IgG ( ⁇ ).
  • FIGS. 6 A and B CHARACTERIZATION OF Fc ⁇ RIIIA TETRAMERIC COMPLEX USING A MAGNETIC BEAD ASSAY
  • Fc ⁇ RIIIA Complex two Fc ⁇ RIIIA(filled shape) are joined by a monoclonal antibody DJl 30c (1 st Ab); the anti-mouse F(ab) 2 is conjugated to PE (circle).
  • FACS analysis of Fc ⁇ RIIIA bound to Fc coated beads (a) beads alone; (b) complex without Fc ⁇ RIIIA; (c) complex with Fc ⁇ RIIIA; (d) complex with Fc ⁇ RIIIA and LNKl 6.
  • FIG. 7 SCHEMATIC PRESENTATION OF Fc CONTAINING
  • the open box represents the hinge-CH2-CH3 domains; parallel vertical lines represent the CHl domain.
  • the N-terminal amino acids are shown.
  • the underlined residues correspond to the hinge region;
  • the * represents the Xpress epitope tag;
  • hatched boxes represent the Gly4-Ser linker, and the stippled boxes represent the Aga2p gene.
  • FIGS. 8A-H FACS ANALYSIS OF THE Fc FUSION PROTEINS ON THE YEAST CELL WALL
  • Fc antibody (FIGS. 8A-D) or with HP6017 (Sigma), a mouse anti-human IgGl Fc (CH3) specific monoclonal antibody (FIGS. 8E-H).
  • a and E represent vector alone; Panels B and F represent the CH1-CH3 construct; Panels C and G represent the GIF227; and Panels D and H represent the GIF 206 construct.
  • FIGS. 9A-C BINDING OF SOLUBLE TETRAMERIC Fc ⁇ RIIIA TO THE SURFACE DISPLAYED Fc FUSION PROTEINS
  • Cells containing pYDl-CHl (A); pYD-CHl-D265A (B); and pYD vector (C) were grown under conditions to express Aga2p fusion proteins on the cell surface.
  • Cells were incubated with Fc ⁇ RIIIA at 0.15 niM , 7.5 mM , and 7.5 mM, respectively, and analyzed by FACS.
  • FIG. 10 CHARACTERIZATION OF THE BINDING OF SOLUBLE
  • FIG. 11 EXAMPLE OF SORT GATE FOR SELECTING Fc MUTANTS
  • FIGS. 12A-N FACS ANALYSIS OF SOME OF THE Fc MUTANTS IDENTIFIED HAVING AN INCREASED AFFINITY FOR Fc ⁇ RIIIA TETRAMERIC COMPLEXES
  • FIGS. 12A and B represent cells harboring wild-type Fc; FIGS. 12C and D represent mutant # 5; FIGS. 12E and F represent mutant # 20; FIGS. 12G and H represent mutant # 21 ; FIGS. 12 I and J represent mutant # 24; FIGS. 12K and L represent mutant # 25; FIGS. 12M and N represent mutant # 27.
  • Cells were stained with Fc ⁇ RIIIA tetrameric complex (FIGS. 12 A, C, E, G, I, K, and M) or Fc ⁇ RIIB tetrameric complex (FIGS. 12 B, D, F 5 H 5 J 5 L, and N).
  • FIGS. 13 A-B CHARACTERIZATION OF Fc MUTANTS IN THE 4-4-20 MONOCLONAL ANTIBODY BY ELISA
  • Fc domains from the pYD-CHl plasmids were cloned into the heavy chain of the chimeric 4-4-20 monoclonal antibody.
  • the 4-4-20 monoclonal antibody was expressed in 293 cells and supernatants were collected.
  • ELISA plates were coated with fluoresceine conjugated BSA to capture the chimeric 4-4-20 mutant antibodies.
  • Fc ⁇ RIIIA (A) and Fc ⁇ RIIB (B) receptors were then coated onto the ELISA plates to which the 4-4-20 monoclonal antibodies had been absorbed in order to determine the relative affinities of the variant receptors to the Fc domains. Mutants # 15 and # 29 were non-binding isolates included as controls.
  • FIG. 14 ADCC ACTIVITY OF MUTANTS IN THE 4-4-20
  • mutants containing mutant Fc regions were assessed for their ADCC activity, and compared to the ADCC activity of a wild type 4-4-20 antibody.
  • the mutants analyzed are as follows: MGFc-10 (K288N, A330S, P396L), MGFc-26 (D265A), MGFc-27 (G316D, A378V, D399E), MGFc28 (N315I, A379M, D399E), MGFc29 (F243I, V379L, G420V), MGFc30 (F275V), MGFc-31 (P247L, N421K), MGFc-32 (D280E, S354F, A431D, IMlT), MGFc-33 (K317N, F423 deleted), MGFc-34 (F241L, E258G), MGFc-35 (R255Q, K326E), MGFc-36 (K218R, G281D, G385R)
  • FIGS. 15 A and B ADCC ACTIVITY OF MUTANTS IN THE HER2/NEU
  • mutants containing mutant Fc regions were assessed for their ADCC activity and compared to the ADCC activity of a wild type Her2/neu antibody.
  • the mutants analyzed are as follows: MGFc-5 (V379M), MGFc-9 (F243I, V379L), MGFc-IO (K288N, A330S, P396L), MGFc-13 (K334E, T359N, T366S), MGFc-27 (G316D, A378V, D399E).
  • FIG. 16 CAPTURE OF CH 4-4-20 ANTIBODY ON
  • FIG. 17 SENSOGRAM OF REAL TIME BINDING OF Fc ⁇ RIIIA TO CH 4-4-
  • Binding of Fc ⁇ RIIIA to ch-4-4-20 antibodies carrying variant Fc regions was analyzed at 200 nM concentration. Responses were normalized at the level of ch-4-4-20 antibody obtained for wild-type.
  • Mutants used were as follows: Mut 6 (S219V), Mut 10 (P396L, A330S,
  • K288N Mut 18 (K326E); Mut 14 (K334E, K288N); Mut 11 (R255L, F243L); Mut 16 (F372Y); Mut 19 (K334N, K246I).
  • FIGS. 18 A-H ANALYSIS OF KINETIC PARAMETERS OF Fc ⁇ RIIIA
  • FIG. 19 SENSOGRAM OF REAL TIME BINDING OF Fc ⁇ RIIB-Fc FUSION
  • FIGs. 20 A-C ANALYSIS OF KINETIC PARAMETERS Fc ⁇ RIIB-Fc FUSION
  • Mutants used were as follows: Mut 6 (S219V), Mut 10 (P396L, A330S,
  • K288N Mut 18 (K326E); Mut 14 (K334E, K288N); Mut 11 (R255L, F243L); Mut 16 (F372Y); Mut 19 (K334N, K246I).
  • FIG. 21 RATIOS OF K off (WT)/K off (MUT) FOR Fc ⁇ RIIIA-Fc PLOTTED
  • FIG. 22 COMPETITION WITH UNLABELED Fc ⁇ RIIIA
  • a kinetic screen was implemented to identify Fc region mutants with improved K off rates for binding Fc ⁇ RIIIA.
  • a library of Fc region variants containing P396L mutation was incubated with 0.1 ⁇ M biotinylated Fc ⁇ RIIIA-Linker-Avitag for one hour and then washed. Subsequently 0.8 uM unlabeled Fc ⁇ RIIIA was incubatd with the labeled yeast for different time points. Yeast was spun down and unlabeled Fc ⁇ RIIIA was removed, Receptor bound yease was stained with SA (streptavidin):PE (phycoerythrin) for FACS analysis. Fl ⁇ S.
  • FIGS. 24 A-B SELECTION BASED ON SOLID PHASE DEPLETION OF Fc ⁇ RIIB Fc BINDERS
  • Fc ⁇ RIIIA selection using magnetic beads The Fc ⁇ RIIB depletion by magnetic beads was repeated 5 times.
  • the resulting yeast population was analyzed and found to show greater than 50% cell staining with goat anti-human Fc and a very small percentage of cells stained with Fc ⁇ RIIIA. Subsequently cells were selected twice by FACS using 0.1 ⁇ M biotinylated Fc ⁇ RIIIA linker-avitag. Yeast cells were analyzed for both Fc ⁇ RIIIA and Fc ⁇ RIIB binding after each sort and compared to wild type binding.
  • Fc Mutants were selected from the Fc ⁇ RIIB depleted yeast population using biotinylated Fc ⁇ RIIIA 158F linker avitag monomer as a ligand.
  • the sort gate was set to select the top 0.25% Fc ⁇ RIIIA 158F binders.
  • the resulting enriched population was analyzed by FACS for binding to the different Fc ⁇ RIIIA (158F and 158V), Fc ⁇ RIIIB and Fc ⁇ RIIA (131R).
  • FIG. 25 RELATIVE RATES OF SKBR3 TARGET CELL LYSIS MEDIATED
  • 4D5 antibody with Fc mutants were divided by the rate of lysis mediated by wild type 4D5 antibody. Data from at least 2 independent assays were averaged and plotted on the histogram. For each Fc mutant data from two different antibody concentrations are shown. The antibody concentrations were chosen to flank the point along the curve at which lysis was -50%.
  • FIG. 26 RELATIVE RATES OF DAUDI CELL LYSIS MEDIATED BY
  • FIG. 27 SCHEME FOR LIBRARY PRODUCTION.
  • DNA strands are represented.
  • Forward arrows represent primers containing mutant codons.
  • Reverse arrow represent reverse gene specific oligo.
  • FIG. 28 STRATEGY FOR PRODUCTION OF LIBRARIES BY BUILD A
  • the rectangular boxes represent the hinge, CH2, and CH3 domains, respectively.
  • the short black lines represent the double stranded oligos with 5' overhangs.
  • FIG. 29 NOVEL Fc MUTANTS IMPROVE PBMC MEDIATED ADCC IN
  • FIG. 30 NOVEL Fc MUTANTS IMPROVE PBMC MEDIATED ADCC IN
  • FIG. 31 Fc RECPETOR PROFILES VIA FACS UPON CYTOKINE
  • Elutriated monocytes were cultured using specific cytokines in serum free media. Fc receptor profiles were assayed using FACS.
  • FIG. 32 IMPROVED TUMOR CELL KILLING USING FC MUTANTS IN
  • FIG. 33 COMPLEMENT DEPENDENT CYTOTOXICITY ASSAY FLOW
  • FIG.34 COMPLEMENT DEPENDENT CYTOTOXICITY ACTIVITY
  • Fc mutants that show enhanced binding to Fc ⁇ RIIIA also showed improved complement activity.
  • Anti-CD20 ChMAb over 3 orders of magnitude was titrated. Percent lysis was calculated as in as in FIG. 30.
  • FIG. 35 DECISION TREE FOR SELECTION OF Fc MUTANTS
  • FIG. 36 CIq BINDING TO 2B6 ANTIBODY
  • FIGS. 37 A-D CIq BINDING TO 2B6 MUTANT ANTIBODY.
  • FIGS. 38 A-D Fc VARIANTS WITH DECREASED BINDING TO Fc ⁇ RIIB
  • KD was analyzed at different concentrations of FcR; 40OnM CD16A 158V; 80OnM CD16A 158F; 20OnM CD32B; 20OnM CD32A 131H. Analysis was performed using separate KQ using Biacore 3000 software.
  • FIGS. 39 A-D KINETIC CHARACTERISTICS OF 4D5 MUTANTS SELECTED FROM Fc ⁇ RIIB DEPLETIONS/Fc ⁇ RIIAH131 SELECTION
  • FIG. 40 PLOT OF MDM ADCC DATA AGAINST THE K O FF DETERMINED
  • mutants are as follows: MgFc 25 (E333A, K334A, S298A); MgFc68
  • FIGS. 41 A-B ADCC ACTIVITY OF MUTANTS IN A HER2/NEU CHIMERIC MONOCLONAL ANTIBODY
  • mutants analyzed are as follows: MGFc88 (F243L, R292P, Y300L, V305I, P396L), MGFc88A (F243L, R292P, Y300L, P396L), MGFcI 55 (F243L, R292P, Y300L).
  • FIGS. 42 A-B ESTIMATED TUMOR WEIGHT IN MICE TREATED WITH WILD-TYPE OR Fc MUTANT h2B6
  • Balb/c nude mice were inoculated subcutaneously with Daudi cells and administered 25 ⁇ g, 2.5 ⁇ g or 0.25 ⁇ g weekly doses of either wild-type h2B6 (A) or h2B6 harboring Fc mutant MGFc 0088 (F243L, R292P, Y300L, V305I, P396L) (B). Mice administered buffer alone were used as control. Tumor wieght was calculated based on the estimated volume of the subcutaneous tumor according to the formula (width 2 X length)/2.
  • FIGS. 43 A-B SURVIVAL IN TUMOR BEARING MICE TREATED WITH WILD- TYPE OR Fc MUTANT h2B6
  • the present invention relates to molecules, preferably polypeptides, and more preferably immunoglobulins (e.g., antibodies), comprising a variant Fc region, having one or more amino acid modifications (e.g., substitutions, but also including insertions or deletions) in one or more regions, which modifications alter, e.g., increase or decrease, the affinity of the variant Fc region for an Fc ⁇ R.
  • the invention comprises modifications to the Fc region including but not limited to any of the modifications disclosed in U.S. Application Serial No. 10/754,922 filed Jaunuary 9, 2004; U.S. Provisional Application Serial No. 60/439,498 filed Jaunuary 9, 2003; U.S. Provisional Application Serial No.
  • the invention provides molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, which variant Fc region binds Fc ⁇ RIIIA with a greater affinity, relative to a comparable molecule, i.e., being the same as said molecule with a variant Fc region but not having the one or more amino acid modifications, comprising the wild-type Fc region as determined by methods known to one skilled in the art for determining Fc-Fc ⁇ R interactions and methods disclosed herein, for example, an ELISA assay or a surface plasmon resonance assay.
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, which variant Fc region binds Fc ⁇ RIIIA with a reduced affinity relative to a comparable molecule comprising the wild-type Fc region.
  • the molecules of the invention further specifically bind Fc ⁇ RIIB (via the Fc region) with a lower affinity than a comparable molecule comprising the wild- type Fc region binds Fc ⁇ RIIB.
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, which variant Fc region binds Fc ⁇ RIIIA and Fc ⁇ RIIB with a greater affinity, relative to a comparable molecule comprising the wild- type Fc region.
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, which variant Fc region binds Fc ⁇ RIIB with a greater affinity, relative to a comparable molecule comprising the wild-type Fc region.
  • the invention encompasses molecules comprising variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, which variant Fc region binds Fc ⁇ RIIB with a reduced affinity, relative to a- comparable molecule comprising the wild-type Fc region.
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild type Fc region, which variant Fc region does not show a detectable binding to any Fc ⁇ R (e.g., does not bind Fc ⁇ RIIA, Fc ⁇ RIIB, or Fc ⁇ RIIIA, as determined by, for example, an ELISA assay), relative to a comparable molecule comprising the wild-type Fc region.
  • Fc ⁇ R e.g., does not bind Fc ⁇ RIIA, Fc ⁇ RIIB, or Fc ⁇ RIIIA, as determined by, for example, an ELISA assay
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild type Fc region, which variant Fc region only binds one Fc ⁇ R, wherein said Fc ⁇ R is Fc ⁇ lllA.
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild type Fc region, which variant Fc region only binds one Fc ⁇ R, wherein said Fc ⁇ R is Fc ⁇ RIIA.
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild type Fc region, which variant Fc region only binds one Fc ⁇ R, wherein said Fc ⁇ R is Fc ⁇ RIIB.
  • the invention particularly relates to the modification of human or humanized therapeutic antibodies (e.g., tumor specific anti-angiogenic or anti-inflammatory monoclonal antibodies) for enhancing the efficacy of therapeutic antibodies by enhancing, for example, the effector function of the therapeutic antibodies, e.g., enhancing ADCC.
  • Fc ⁇ R are initially determined using in vitro assays (biochemical or immunological based assays) known in the art for determining Fc-Fc ⁇ R interactions, i.e., specific binding of an Fc region to an Fc ⁇ R including but not limited to ELISA assay, surface plasmon resonance assay, immunoprecipitation assays (See Section 5.2.5.1).
  • in vitro assays biochemical or immunological based assays
  • the binding properties of the molecules of the invention are also characterized by in vitro functional assays for determining one or more Fc ⁇ R mediator effector cell functions (See Section 5.2.7).
  • the molecules of the invention have similar binding properties in in vivo models (such as those described and disclosed herein) as those in in vitro based assays
  • the present invention does not exclude molecules of the invention that do not exhibit the desired phenotype in in vitro based assays but do exhibit the desired phenotype in vivo.
  • the molecules of the invention comprising a variant Fc region comprise at least one amino acid modification in the CH3 domain of the Fc region, which is defined as extending from amino acids 342-447. In other embodiments, the molecules of the invention comprising a variant Fc region comprise at least one amino acid modification in the CH2 domain of the Fc region, which is defined as extending from amino acids 231-341. In some embodiments, the molecules of the invention comprise at least two amino acid modifications, wherein one modification is in the CH3 region and one modification is in the CH2 region. The invention further encompasses amino acid modification in the hinge region.
  • Molecules of the invention with one or more amino acid modifications in the CH2 and/or CH3 domains have altered affinities for an Fc ⁇ R as determined using methods described herein or known to one skilled in the art.
  • the invention encompasses amino acid modification in the CHl domain of the Fc region.
  • the invention encompasses molecules comprising a variant Fc region wherein said variant has an increased binding to Fc ⁇ RIIA (CD32A) and/or an increased ADCC activity, as measured using methods known to one skilled in the art and exemplified herein.
  • the ADCC assays used in accordance with the methods of the invention may be NK dependent or macrophage dependent.
  • the Fc variants of the present invention may be combined with other known
  • an Fc variant of the invention comprising a first amino acid modification in the CH3 domain, CH2 domain or the hinge region may be combined with a second Fc modification such that the second Fc modification is not in the same domain as the first so that the first Fc modification confers an additive, synergistic or novel property on the second Fc modification.
  • the Fc variants of the invention do not have any amino acid modification in the CH2 domain.
  • the Fc variants of the present invention may be combined with any of the known Fc modifications in the art such as those disclosed in Table 2 below. TABLE 2.
  • the Fc variants of the present invention may be combined with any of the known Fc modifications in the art such as those disclosed in Tables 3 A and B below.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule has an altered affinity for an Fc ⁇ R, provided that said variant Fc region does not have a substitution at positions that make a direct contact with Fc ⁇ R based on crystallographic and structural analysis of Fc-Fc ⁇ R interactions such as those disclosed by Sondermann et al, 2000 (Nature, 406: 267-273 which is incorporated herein by reference in its entirety).
  • positions within the Fc region that make a direct contact with Fc ⁇ R are amino acids 234- 239 (hinge region), amino acids 265-269 (B/C loop), amino acids 297-299 (C '/E loop), and amino acids 327-332 (PIQ) loop.
  • the molecules of the invention comprising variant Fc regions comprise modification of at least one residue that makes a direct contact with an Fc ⁇ R based on structural and crystallographic analysis.
  • the Fc ⁇ R interacting domain maps to the lower hinge region and select sites within the CH2 and CH3 domains of the IgG heavy chain.
  • Amino acid residues flanking the actual contact positions and amino acid residues in the CH3 domain play a role in IgG/Fc ⁇ R interactions as indicated by mutagenesis studies and studies using small peptide inhibitors, respectively (Sondermann et al, 2000 Nature, 406: 267-273; Melnhofer et al., 1981, Biochemistry, 20: 2361-2370; Shields et al., 2001, J. Biol. Chem. 276: 6591-6604; each of which is incorporated herein by reference in its entirety).
  • Direct contact refers to those amino acids that are within at least 1 A, at least 2, or at least 3 angstroms of each other or within 1 A, 1.2 A, 1.5 A, 1.7 A or 2 A Van Der Waals radius.
  • An exemplary list of previously identified sites on the Fc that effect binding of Fc interacting proteins is listed in the Table 4 below.
  • the invention encompasses Fc variants that do not have any modifications at the sites listed below.
  • the invention encompasses Fc variants comprising amino acid modifications at one or more sites listed below in combination with other modifications disclosed herein such that such modification has a synergistic or additive effect on the property of the mutant.
  • the invention encompasses a molecule, comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule binds an Fc ⁇ R with an altered affinity relative to a molecule comprising a wild-type Fc region, provided that said variant Fc region does not have or is not solely a substitution at any of positions 255, 256, 258, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 300, 301, 303, 305, 307, 309, 312, 320, 322, 326, 329, 330, 332, 331, 333, 334, 335, 337, 338, 339, 340, 359, 360, 373, 376, 416, 419, 430, 434, 435, 437, 438, 439.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule binds an Fc ⁇ R with an altered affinity relative to a molecule comprising a wild-type Fc region, provided that said variant Fc region does not have or is not solely a substitution at any of positions 255, 258, 267, 269, 270, 276, 278, 280, 283, 285, 289, 292, 293, 294, 295, 296, 300, 303, 305, 307, 309, 322, 329, 332, 331, 337, 338, 340, 373, 376, 416, 419, 434, 435, 437, 438, 439 and does not have an alanine at any of positions 256, 290, 298, 312, 333, 334, 359, 360 ?
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region does not have or is not solely a substitution at any of positions 268, 269, 270, 272, 276, 278, 283, 285, 286, 289, 292, 293, 3Oi.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule binds an Fc ⁇ R with a reduced affinity relative to a molecule comprising a wild-type Fc region provided that said variant Fc region does not have or is not solely a substitution at any of positions 252, 254, 265, 268, 269, 270, 278, 289, 292, 293, 294, 295, 296, 298, 300, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438, or 439.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule binds an Fc ⁇ R with an enhanced affnity relative to a molecule comprising a wild-type Fc region provided that said variant Fc region does not have or is not solely a substitution at any of positions 280, 283, 285, 286, 290, 294, 295, 298, 300, 301, 305, 307, 309, 312, 315, 331, 333, 334, 337, 340, 360, 378, 398, or 430.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region does not include or are not solely a substitution at any of positions 330, 243, 247, 298, 241, 24O 5 244, 263, 262, 235, 269, or 328 and does not have a leucine at position 243, an asparagine at position 298, a leucine at position 241, and isoleucine or an alanine at position 240, a histidine at position 244, a valine at position 330, or an isoleucine at position 328.
  • the molecules of the invention with altered affinities for activating and/or inhibitory receptors having variant Fc regions have one or Tiore amino acid modifications, wherein said one or more amino acid modification is a substitution at position 288 with asaparagine, at position 330 with serine and at position 396 ⁇ th leucine (MgFcl0)(See Tables 5 & 6); or a substitution at position 334 with glutamic icid, at position 359 with asparagine, and at position 366 with serine (MgFcl3); or a substitution at position 316 with aspartic acid, at position 378 with valine, and at position 599 with glutamic acid (MgFc27); or a substitution at position 392 with threonine, and at )osition 396 with leucine (MgFc38); or a substitution at position 221 with glutamic acid, at )osition 270 with glutamic acid, at position 308 with
  • the invention encompasses a molecule comprising a variant Fc region wherein said variant Fc region comprises a substitution at position 396 with leucine, at position 270 with glutamic acid and at position 243 with leucine.
  • the molecule further comprises one or more amino acid modification such as those disclosed herein.
  • the invention encompasses molecules comprising a variant Fc region having an amino acid modification at one or more of the following positions: 119, 125, 132, 133, 141, 142, 147, 149, 162, 166, 185, 192, 202, 205, 210, 214, 217, 219, 215, 216, 217, 218, 219, 221, 222, 223, 224, 225, 227, 288, 229, 231, 232, 233, 235, 240, 241, 242, 243, 244, 246, 247, 248, 250, 251, 252, 253, 254, 255, 256, 258, 261, 262, 263, 268, 269, 270, 272, 273, 274, 275, 276, 279, 280, 281, 282, 284, 287, 288, 289, 290, 291, 292, 293, 295, 298, 300, 301, 303, 304, 305, 306, 307, 308, 309,
  • mutations result in molecules that have an altered affinity for an Fc ⁇ R and/or have an altered effecteor cell mediated function as 'c
  • the invention encompasses molecules comprising variant Fc regions consisting of or comprising any of the mutations listed in the table below in Table 5.
  • the invention encompasses molecules comprising variant Fc regions having more than two amino acid modifications.
  • a non-limiting example of such variants is listed in the table below (Table 6).
  • the invention encompasses mutations listed in Table 6 which further comprise one or more amino acid modifications such as those disclosed herein.
  • the molecules, preferably the immunoglobulins of the invention further comprise one or more glycosylation sites, so that one or more covalently attached to the molecule.
  • the antibodies of the invention with one or more glycosylation sites and/or one or more modifications in the Fc region have an enhanced antibody mediated effector function, e.g., enhanced ADCC activity.
  • the invention further comprises antibodies comprising one or more modifications of amino acids that are directly or indirectly known to interact with a carbohydrate moiety of the antibody, including but not limited to amino acids at positions 241, 243, 244, 245, 245, 249, 256, 258, 260, 262, 264, 265, 296, 299, and 301.
  • the invention encompasses antibodies that have been modified by introducing one or more glycosylation sites into one or more sites of the antibodies, preferably without altering the functionality of the antibody, e.g., binding activity to Fc ⁇ R.
  • Glycosylation sites may be introduced into the variable and/or constant region of the antibodies of the invention.
  • "glycosylation sites” include any specific amino acid sequence in an antibody to which an oligosaccharide (i.e., carbohydrates containing two or more simple sugars linked together) will specifically and covalently attach. Oligosaccharide side chains are typically linked to the backbone of an antibody via either N-or 0-linkages.
  • N-linked glycosylation refers to the attachment of an oligosaccharide moiety to the side chain of an asparagine residue.
  • 0-linked glycosylation refers to the attachment of an oligosaccharide moiety to a hydroxyamino acid, e.g., serine, threonine.
  • the antibodies of the invention may comprise one or more glycosylation sites, including N-linked and Q-linked glycosylation sites. Any glycosylation site for N-linked or O-linked glycosylation known in the art may be used in accordance with the instant invention.
  • N-linked glycosylation site that is useful in accordance with the methods of the present invention, is the amino acid sequence: Asn-X-Thr/Ser, wherein X may be any amino acid and Thr/Ser indicates a threonine or a serine.
  • a site or sites may be introduced into an antibody of the invention using methods well known in the art to which this invention pertains. See, for example, "In Vitro Mutagenesis," Recombinant DNA: A Short Course. J. D. Watson, et ⁇ l. W.H. Freeman and Company, New York, 1983, chapter 8, pp. 106-116, which is incorporated herein by reference in its entirety.
  • An exemplary method for introducing a glycosylation site into an antibody of the invention may comprise: modifying or mutating an amino acid sequence of the antibody so that the desired Asn-X-Thr/Ser sequence is obtained.
  • the invention encompasses methods of modifying the carbohydrate content of an antibody of the invention by adding or deleting a glycosylation site. Methods for modifying the carbohydrate content of antibodies are well known in the art and encompassed within the invention, see, e.g., U.S. Patent No. 6,218,149; EP 0 359 096 Bl; U.S. Publication No. US 2002/0028486; WO 03/035835; U.S.
  • the invention encompasses methods of modifying the carbohydrate content of an antibody of the invention by deleting one or more endogenous carbohydrate moieties of the antibody.
  • the invention encompasses shifting the glycosylation site of the Fc region of an antibody, by modifying positions adjacent to 297.
  • the invention encompasses modifying position 296 so that position 296 and not position 297 is glycosylated.
  • the present invention is based, in part, on the identification of mutant human
  • the invention relates to molecules, preferably polypeptides, and more preferably immunoglobulins ⁇ e.g., antibodies), comprising a variant Fc region, having one or more amino acid modifications (e.g., substitutions, but also including insertions or deletions) in one or more regions, which modifications alter the affinity of the variant Fc region for an Fc ⁇ R.
  • the present invention contemplates other modifications of the Fc region amino acid sequence in order to generate an Fc region variant with one or more altered properties, e.g., altered effector function.
  • the invention contemplates deletion of one or more amino acid residues of the Fc region in order to reduce binding to an Fc ⁇ R. Preferably, no more than 5, no more than 10, no more than 20, no more than 30, no more than 50 Fc region residues will be deleted according to this embodiment of the invention.
  • the Fc region herein comprising one or more amino acid deletions will preferably retain at least about 80%, and preferably at least about 90%, and most preferably at least about 95%, of the wild type Fc region.
  • one or more properties of the molecules are maintained such as for example, non-immunogenicity, Fc ⁇ RIIIA binding, Fc ⁇ RIIA binding, or a combination of these properties.
  • the invention encompasses amino acid insertion to generate the Fc region variants, which variants have altered properties including altered effector function.
  • the invention encompasses introducing at least one amino acid residue, for example one to two amino acid residues and preferably no more than 10 amino acid residues adjacent to one or more of the Fc region positions identified herein.
  • the invention further encompasses introducing at least one amino acid residue, for example one to two amino acid residues and preferably no more than 10 amino acid residues adjacent to one or more of the Fc region positions known in the art as impacting Fc ⁇ R interaction and/or binding.
  • the invention further encompasses incorporation of unnatural amino acids to generate the Fc variants of the invention.
  • unnatural amino acids to generate the Fc variants of the invention.
  • Such methods are known to those skilled in the art such as those using the natural biosynthetic machinery to allow incorporation of unnatural amino acids into proteins, see, e.g., Wang et al., 2002 Chem. Comm. 1: 1-11; Wang et al., 2001, Science, 292: 498-500; van Hest et al., 2001. Chem. Comm. 19: 1897- 1904, each of which is incorporated herein by reference in its entirety.
  • Alternative strategies focus on the enzymes responsible for the biosynthesis of amino acyl-tRNA, see, e.g., Tang et al., 2001, J. Am. Chem.
  • Fc ⁇ R are initially determined using in vitro assays (biochemical or immunological based assays) known in the art for determining Fc-Fc ⁇ R interactions, i.e., specific binding of an Fc region to an Fc ⁇ R including but not limited to ELISA assay, surface plasmon resonance assay, immunoprecipitation assays ⁇ See Section 5.2.5.1).
  • in vitro assays biochemical or immunological based assays
  • the binding properties of the molecules of the invention are also characterized by in vitro functional assays for determining one or more Fc ⁇ R mediator effector cell functions ⁇ See Section 5.2.7).
  • the molecules of the invention have similar binding properties in in vivo models (such as those described and disclosed herein) as those in in vitro based assays
  • the present invention does not exclude molecules of the invention that do not exhibit the desired phenotype in in vitro based assays but do exhibit the desired phenotype in vivo.
  • a representative flow chart of the screening and characterization of molecules of the invention is described in FIG. 35.
  • the invention encompasses molecules comprising a variant Fc region that binds with a greater affinity to one or more Fc ⁇ Rs. Such molecules preferably mediate effector function more effectively as discussed infra.
  • the invention encompasses molecules comprising a variant Fc region that bind with a weaker affinity to • ⁇ »r ⁇ iri!3r ⁇ F:(wB.s:'.'.!tRi?4pction or elimination of effector function is desirable in certain cases for example in the case of antibodies whose mechanism of action involves blocking or antagonism but not killing of the cells bearing a target antigen. Reduction or elimination of effector function would be desirable in cases of autoimmune disease where one would block Fc ⁇ R activating receptors in effector cells (This type of function would be present in the host cells). In general increased effector function would be directed to tumor and foreign cells.
  • the Fc variants of the present invention may be combined with other Fc modifications, including but not limited to modifications that alter effector function.
  • the invention encompasses combining an Fc variant of the invention with other Fc modifications to provide additive, synergistic, or novel properties in antibodies or Fc fusions.
  • the Fc variants of the invention enhance the phenotype of the modification with which they are combined. For example, if an Fc variant of the invention is combined with a mutant known to bind Fc ⁇ RIIIA with a higher affinity than a comparable molecule comprising a wild type Fc region; the combination with a mutant of the invention results in a greater fold enhancement in Fc ⁇ RIIIA affinity.
  • the Fc variants of the present invention may be combined with other known Fc variants such as those disclosed in Duncan et al, 1988, Nature 332:563-564; Lund et al., 1991, J. Immunol 147:2657-2662; Lund et al, 1992, MoI Immunol 29:53-59; Alegre et al, 1994, Transplantation 57:1537-1543; Hutchins et al. , 1995, Proc Natl. Acad Sci U S A 92:11980-11984; Jefferis et al, 1995, Immunol Lett.
  • the Fc variants of the present invention are incorporated into an antibody or Fc fusion that comprises one or more engineered glycoforms, i.e., a carbohydrate composition that is covalently attached to a molecule comprising an Fc region, wherein said carbohydrate composition differs chemically from that of a parent molecule comprising an Fc region.
  • a carbohydrate composition that is covalently attached to a molecule comprising an Fc region, wherein said carbohydrate composition differs chemically from that of a parent molecule comprising an Fc region.
  • Engineered glycoforms may be useful for a variety of purposes, including but not limited to enhancing or reducing effector fraetiraii:::;Ejagi
  • one or more enzymes for example DI N-acetylglucosaminyltransferase III (GnTIl 1)
  • GlycoMAbTM glycosylation engineering technology (GLYCART biotechnology AG, Zurich, Switzerland); each of which is incorporated herein by reference in its entirety. See, e.g., WO 00061739; EA01229125; US 20030115614; Okazaki et al., 2004, JMB, 336: 1239-49 each of which is incorporated herein by reference in its entirety.
  • the Fc variants of the present invention may be optimized for a variety of properties. Properties that may be optimized include but are not limited to enhanced or reduced affinity for an Fc ⁇ R, enhanced or reduced effector function.
  • the Fc variants of the present invention are optimized to possess enhanced affinity for a human activating Fc ⁇ R, preferably Fc ⁇ R, Fc ⁇ RIIA, Fc ⁇ RIIc, Fc ⁇ RIIIA, and Fc ⁇ RIIIB, most preferably Fc ⁇ RIIIA.
  • the Fc variants are optimized to possess reduced affinity for the human inhibitory receptor Fc ⁇ RIIB.
  • These preferred embodiments are anticipated to provide antibodies and Fc fusions with enhanced therapeutic properties in humans, for example enhanced effector function and greater anticancer potency as described and exemplified herein. These preferred embodiments are anticipated to provide antibodies and Fc fusions with enhanced tumor elimination in mouse xenograft tumor models.
  • the Fc variants of the present invention are optimized to have reduced affinity for a human Fc ⁇ R, including but not limited to Fc ⁇ RI, Fc ⁇ RIIA, Fc ⁇ RIIB, Fc ⁇ RIIc, Fc ⁇ RIIIA, and Fc ⁇ RIIIB. These embodiments are anticipated to provide antibodies and Fc fusions with enhanced therapeutic properties in humans,for example reduced effector function and reduced toxicity.
  • the Fc variants of the present invention possess enhanced or reduced affinity for Fc ⁇ Rs from non-human organisms, including but not ⁇ r ⁇ teAtemie®, -Pte wbbits, and monkeys.
  • Fc variants that are optimized for binding to a non-human Fc ⁇ R may find use in experimentation.
  • mouse models are available for a variety of diseases that enable testing of properties such as efficacy, toxicity, and pharmacokinetics for a given drug candidate.
  • cancer cells can be grafted or injected into mice to mimic a human cancer, a process referred to as xenografting.
  • Testing of antibodies or Fc fusions that comprise Fc variants that are optimized for one or more mouse Fc ⁇ Rs may provide valuable information with regard to the efficacy of the antibody or Fc fusion, its mechanism of action, and the like.
  • FcRn neonatal receptor
  • Fc region variants with improved affinity for FcRn are anticipated to have longer serum half-lives, and such molecules will have useful applications in methods of treating mammals where long half- life of the administered polypeptide is desired, e.g. , to treat a chronic disease or disorder.
  • Fc region variants with decreased FcRn binding affinity are expected to have shorter half- lives, and such molecules may, for example, be administered to a mammal where a shortened circulation time may be advantageous, e.g., for in vivo diagnostic imaging or for polypeptides which have toxic side effects when left circulating in the blood stream for extended periods.
  • Fc region variants with decreased FcRn binding affinity are anticipated to be less likely to cross the placenta, and thus may be utilized in the treatment of diseases or disorders in pregnant women.
  • these variants may be combined with other known Fc modifications with altered FcRn affinity such as those disclosed in International Publication Nos. WO 98/23289; and WO 97/34631; and U.S. Patent No. 6,277,375, each of which is incorporated herein by reference in its entirety.
  • the invention encompasses any other method known in the art for generating antibodies having an increased half-life in vivo, for example, by introducing one or more amino acid modifications (i.e., substitutions, insertions or deletions) into an IgG constant domain, or FcRn binding fragment thereof (preferably a Fc or hinge-Fc domain fragment). See, e.g., International Publication Nos. WO 98/23289; and WO 97/34631; and U.S. Patent No. 6,277,375, each of which is incorporated herein by reference in its entirety to be used in combination with the Fc variants of the invention.
  • antibodies of the invention can be conjugated to albumin in order to make the antibody or antibody fragment more stable in vivo or have a longer half-life in vivo.
  • albumin The techniques well-known in the art, see, e.g., Htmatim ⁇ b$qg$w$to&. WO 93/15199, WO 93/15200, and WO 01/77137, and European Patent No. EP 413,622, all of which are incorporated herein by reference in their entirety.
  • variant(s) described herein may be subjected to further modifications, often times depending on the intended use of the variant. Such modifications may involve further alteration of the amino acid sequence (substitution, insertion and/or deletion of amino acid residues), fusion to heterologous polypeptide(s) and/or covalent modifications. Such further modifications may be made prior to, simultaneously with, or following, the amino acid modification(s) disclosed herein which results in altered properties such as an alteration of Fc receptor binding and/or ADCC activity.
  • the invention encompasses combining the amino acid modifications disclosed herein with one or more further amino acid modifications that alter CIq binding and/or complement dependent cytoxicity function of the Fc region as determined in vitro and/or in vivo.
  • the starting molecule of particular interest herein is usually one that binds to CIq and displays complement dependent cytotoxicity (CDC).
  • CDC complement dependent cytotoxicity
  • the further amino acid substitutions described herein will generally serve to alter the ability of the starting molecule to bind to CIq and/or modify its complement dependent cytotoxicity function, e.g., to reduce and preferably abolish these effector functions.
  • molecules comprising substitutions at one or more of the described positions with improved CIq binding and/or complement dependent cytotoxicity (CDC) function are contemplated herein.
  • the starting molecule may be unable to bind CIq and/or mediate CDC and may be modified according to the teachings herein such that it acquires these further effector functions.
  • molecules with preexisting CIq binding activity, optionally further having the ability to mediate CDC may be modified such that one or both of these activities are altered, e.g. , enhanced.
  • the invention encompasses variant Fc regions with altered CDC activity without any alteration in CIq binding.
  • the invention encompasses variant Fc regions with altered CDC activity and altered CIq binding.
  • the amino acid positions to be modified are generally selected from positions 270, 322, 326, 327, 329, 331, 333, and 334, where the numbering of the residues in an IgG heavy chain is that of the EU index as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (199).
  • amino acid modifications may be combined with one or more Fc modifications disclosed herein to provide a synergistic or ⁇ ⁇ .a4diM : v ⁇ ' ⁇ ffe ⁇ t" ⁇ a»Gl ⁇ q «.biHding and/or CDC activity.
  • the invention encompasses Fc variants with altered CIq binding and/or complement dependent cytotoxicity (CDC) function comprising an amino acid substitution at position 396 with leucine and at position 255 with leucine; or an amino acid substitution at position 396 with leucine and at position 419 with histidine; an amino acid substitution at position 396 with leucine and at position 370 with glutamic acid; an amino acid substitution at position 396 with leucine and at position 240 with alanine; an amino acid substitution at position 396 with leucine and at position 392 with threonine; an amino acid substitution at position 247 with leucine and at position 421 with lysine.
  • CDC complement dependent cytotoxicity
  • the invention encompasses any known modification of the Fc region which alters CIq binding and/or complement dependent cytotoxicity (CDC) function such as those disclosed in Idusogie et al, 2001, J. Immunol. 166(4) 2571-5; Idusogie et al, J. Immunol 2000 164(8): 4178-4184; each of which is incorporated herein by reference in its entirety.
  • CDC complement dependent cytotoxicity
  • the invention encompasses an Fc region with altered effector function, e.g., modified CIq binding and/or FcR binding and thereby altered CDC activity and/or ADCC activity.
  • the invention encompasses variant Fc regions with improved CIq binding and improved Fc ⁇ RIII binding; e.g. having both improved ADCC activity and improved CDC activity.
  • the invention encompasses a variant Fc region with reduced CDC activity and/or reduced ADCC activity. In other embodiments, one may increase only one of these activities, and optionally also reduce the other activity, e.g. to generate an Fc region variant with improved ADCC activity, but reduced CDC activity and vice versa.
  • the invention encompasses molecules comprising a variant Fc region, having one or more amino acid modifications ⁇ e.g., substitutions) in one or more regions, wherein such modifications alter the affinity of the variant Fc region for an activating Fc ⁇ R.
  • molecules of the invention comprise a variant Fc region, having one or more amino acid modifications ⁇ e.g., substitutions) in one or more regions, which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA by at least 2-fold, relative to a comparable molecule comprising a wild-type Fc region.
  • molecules of the invention comprise a variant Fc region, having one or more amino acid modifications (e.g. , substitutions) in one or more regions, which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and/or
  • the one or more amino acid modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA by at least 3 -fold, 4-fold, 5-fold, 6-fold, 8-fold, or 10-fold relative to a comparable molecule comprising a wild-type Fc region.
  • the one or more amino acid modifications decrease the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA by at least 3-fold, 4-fold, 5-fold, 6-fold, 8-fold, or 10-fold relative to a comparable molecule comprising a wild-type Fc region.
  • fold increases are preferably determined by an ELISA or surface plasmon resonance assays.
  • the one or more amino acid modifications do not include or are not solely a substitution at any one of positions 329, 331, or 322 with any amino acid.
  • the one or more amino acid modifications do not include or are not solely a substitution with any one of alanine at positions 256, 290, 298, 312, 333, 334, 359, 360, or 430; with lysine at position 330; with threonine at position 339; with methionine at position 320; with serine, asparagine, aspartic acid, or glutamic acid at position 326 with glutamine, glutamic acid, methionine, histidine, valine, or leucine at position 334.
  • the one or more amino acid modifications do not include or are not solely a substitution at any of positions 280, 290, 300, 294, or 295.
  • the one or more amino acid modifications do not include or are not solely a substitution at position 300 with leucine or isoleucine; at position 295 with lysine; at position 294 with asparagine; at position 298 with valine; aspartic acid proline, aspargine, or valine; at position 280 with histidine, glutamine or tyrosine; at position 290 with serine, glycine, theonine or tyrosine.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIA with a greater affinity than a comparable molecule comprising the wild-type Fc region binds Fc ⁇ RIIA, provided that said variant Fc region does not have an alanine at any of positions 256, 290, 326, 255, 258, 267, 272, 276, 280, 283, 285, 286, 331, 337, 268, 272, or 430; an asparagine at position 268; a glutamine at position 272; a glutamine, serine, or aspartic acid at position 286; a serine at position 290; a methionine, glutamine, glutamic acid, or arginine at position 320; a glutamic acid at position322; a serine, glutamic acid, or aspart
  • molecules of the invention comprise a variant Fc region, having one or more amino acid modifications (e.g., substitutions) in one or more regions, which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIA by at least 2-fold, relative to a comparable molecule comprising a wild-type Fc ragionnifcapoifcheir gpec&ific embodiment, molecules of the invention comprise a variant Fc region, having one or more amino acid modifications (e.g., substitutions) in one or more regions, which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIA by greater than 2 fold, relative to a comparable molecule comprising a wild-type Fc region.
  • amino acid modifications e.g., substitutions
  • the one or more amino acid modifications increase the affinity of the variant Fc region for Fc ⁇ RIIA by at least 3-fold, 4-fold, 5-fold, 6-fold, 8-fold, or 10-fold relative to a comparable molecule comprising a wild-type Fc region
  • the invention encompasses molecules, preferably polypeptides, and more preferably immunoglobulins (e.g., antibodies), comprising a variant Fc region, having one or more amino acid modifications (e.g., substitutions but also include insertions or deletions), which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA by at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 99%, at least 100%, at least 150%, and at least 200%, relative to a comparable molecule comprising a wild-type Fc region.
  • immunoglobulins e.g., antibodies
  • the one or more amino acid modifications which increase the affinity of the variant Fc region for one or more activating Fc ⁇ Rs comprise a substitution at position 347 with histidine, and at position 339 with valine; or a substitution at position 425 with isoleucine and at position 215 with phenylalanine; or a substitution at position 408 with isoleucine, at position 215 with isoleucine, and at position 125 with leucine; or a substitution at position 385 with glutamic acid and at position 247 with histidine; or a substitution at position 348 with methionine, at position 334 with asparagine, at position 275 with isoleucine, at position 202 with methionine, and at position 147 with threonine; or a substitution at position 275 with isoleucine, at position 334 with asparagine, and at position 348 with methionine; or a substitution at position 279 with leucine and at position 3
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 243 with isoleucine and at position 379 with leucine, such that said molecule binds Fc ⁇ RIIIA with about a 1.5 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 288 with asparagine, at position 330 with serine, and at position 396 with leucine, such that said molecule binds Fc ⁇ RIIIA with about a 5 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 243 with leucine and at position 255 with leucine such lfoafeaMffioleeute bktdS'Fc ⁇ RIIIA with about a 1 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIlA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 334 with glutamic acid, at position 359 with asparagine, and at position 366 with serine, such that said molecule binds Fc ⁇ RIIIA with about a 1.5 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 288 with methionine and at position 334 with glutamic acid, such that said molecule binds Fc ⁇ RIIIA with about a 3 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 316 with aspartic acid, at position 378 with valine, and at position 399 with glutamic acid, such that said molecule binds Fc ⁇ RIIIA with about a 1.5 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 315 with isoleucine, at position 379 with methionine, and at position 399 with glutamic acid, such that said molecule binds Fc ⁇ RIIIA with about a 1 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 243 with isoleucine, at position 379 with leucine, and at position 420 with valine, such that said molecule binds Fc ⁇ RIIIA with about a 2.5 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 247 with leucine, and at position 421 with lysine, such that said molecule binds Fc ⁇ RIIIA with about a 3 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 392 with threonine and at position 396 with leucine such that said about a 4.5 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 293 with valine, at position 295 with glutamic acid, and at position 327 with threonine, such that said molecule binds Fc ⁇ RIIIA with about a 1.5 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 268 with asparagine and at position 396 with leucine, such that said molecule binds Fc ⁇ RIIIA with about a 2 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses a molecule comprising a variant Fc region, wherein said variant Fc region comprises a substitution at position 319 with phenylalanine, at position 352 with leucine, and at position 396 with leucine, such that said molecule binds Fc ⁇ RIIIA with about a 2 fold higher affinity than a comparable molecule comprising the wild type Fc region binds Fc ⁇ RIIIA, as determined by an ELISA assay.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild- type Fc region, wherein said at least one amino acid modification comprises substitution at position 396 with histidine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 248 with methionine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a similar affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 392 with arginine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said Wr ⁇ WiS!
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a similar affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 132 with isoleucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a similar affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 162 with valine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 396 with leucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 379 with methionine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 219 with tyrosine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 282 with methionine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said v ⁇ iant-FiffiirQgisngCoijiiarises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 401 with valine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 222 with asparagine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 334 with glutamic acid.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 377 with phenylalaine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 334 with isoleucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 247 with leucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 326 with glutamic acid.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIHA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 372 with tyrosine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 224 with leucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 275 with tyrosine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 398 with valine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 334 with asparagine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 400 with proline.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 407 with isoleucine.
  • the invention encompasses an isolated polypeptide comprising a variant ⁇ Q P. ⁇ gr ⁇ B% wherein ⁇ said-yariant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 372 with tyrosine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a similar affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 366 with asparagine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a reduced affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 414 with asparagine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a reduced affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 225 with serine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a reduced affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 377 with asparagine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 243 with leucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 292 with proline.
  • the invention encompasses an isolated polypeptide comprising a variant Fc Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 300 with leucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 305 with isoleucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 396 with leucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with a greater affinity than a comparable polypeptide comprising the wild-type Fc region, wherein said at least one amino acid modification comprises substitution at position 273 with phenylalanine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with about a 2 fold greater affinity than a comparable polypeptide comprising the wild-type Fc region as determined by an ELISA assay, wherein said at least one amino acid modification comprises substitution at position 379 with methionine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIIA with about a 1.5 fold greater affinity than a comparable polypeptide comprising the wild-type Fc region as determined by an ELISA assay, wherein said at least one amino acid modification comprises substitution at position 248 with methionine.
  • the molecules of the invention have an altered affintiy for Fc ⁇ RIIIA and/or Fc ⁇ RIIA as determined using in vitro assays (biochemical or immunological based assays) known in the art for determining Fc-Fc ⁇ R interactions, i.e., sp:ee ⁇ " ii ⁇ dinfft ⁇ f aB!pip , .jjegion to an Fc ⁇ R includ ng ut not mited to ELISA assay, surface plasmon resonance assay, inimunoprecipitation assays (See Section 5.2.5.1).
  • in vitro assays biochemical or immunological based assays
  • the binding properties of these molecules with altered affinities for activating Fc ⁇ R receptors are also correlated to their activity as determined by in vitro functional assays for determining one or more Fc ⁇ R mediator effector cell functions (See Section 5.2.7), e.g., molecules with variant Fc regions with enhanced affinity for Fc ⁇ RIIIA have an enhanced ADCC activity.
  • the molecules of the invention that have an altered binding property for an activating Fc receptor, e.g., Fc ⁇ RIIIA in an in vitro assay also have an altered binding property in in vivo models (such as those described and disclosed herein).
  • the present invention does not exclude molecules of the invention that do not exhibit an altered Fc ⁇ R binding in in vitro based assays but do exhibit the desired phenotype in vivo.
  • the molecules of the invention comprise a variant
  • Fc region having one or more amino acid modifications (i.e., substitutions) in one or more regions, which one or more modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and decreases the affinity of the variant Fc region for Fc ⁇ RIIB, relative to a comparable molecule comprising a wild-type Fc region which binds Fc ⁇ RIIIA and Fc ⁇ RIIB with wild-type affinity.
  • amino acid modifications i.e., substitutions
  • the one or more amino acid modifications do not include or are not solely a substitution with alanine at any of positions 256, 298, 333, 334, 280, 290, 294, 298, or 296; or a substitution at position 298 with asparagine, valine, aspartic acid, or proline; or a substitution 290 with serine.
  • the one or more amino acid modifications increases the affinity of the variant Fc region for Fc ⁇ RIIIA by at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 99%, at least 100%, at least 200%, at least 300%, at leat 400% and decreases the affinity of the variant Fc region for Fc ⁇ RIIB by at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 99%, at least 100%, at least 200%, at least 300%, at leat 400%.
  • the molecule of the invention comprising a variant
  • Fc region with an enhanced affinity for Fc ⁇ RIIIA and a lowered affinity or no affinity for Fc ⁇ RIIB, as determined based on an ELISA assay and/or an ADCC based assay using ch-4- 4-20 antibody, or a surface plasmon resonance assay using a chimeric 4D5 antibody, carrying the variant Fc region comprises a substitution at position 275 with isoleucine, at position 334 with asparagine, and at position 348 with methionine; or a substitution at pp$it ⁇ r ⁇ a79-vs!itk leucine and at position 395 with serine; or a substitution at position 246 with threonine and at position 319 with phenylalanine; or a substitution at position 243 with leucine, at position 255 with leucine, and at position 318 with lysine; or a substitution at position 334 with glutamic acid, at position 359 with asparagine and at position 366 with serine; or a substitution at
  • the molecule of the invention comprising a variant Fc region with an enhanced affinity for Fc ⁇ RIIIA and a lowered affinity or no affinity for Fc ⁇ RIIB as determined based on an ELISA assay and/or an ADCC based assay using ch-4-4-20 antibody, or a surface plasmon resonance assay using a chimeric 4D5 antibody, carrying the variant Fc region comprises a substitution at position 243 with leucine; at position 292 with proline; and at position 300 with leucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIB with about a 3 fold lower affinity than a comparable polypeptide comprising the wild-type Fc region as determined by an ELISA assay, wherein said at least one amino acid modification comprises substitution at position 288 with asparagine, at position 330 with serine, and at position 396 with leucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIB with about a 10-15 fold lower affinity than a comparable polypeptide comprising the wild-type Fc region as determined by an ELISA assay, wherein said at least one amino acid modification comprises substitution at position 316 with aspartic acid, at position 378 with valine, and at position 399 with glutamic acid.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIB with about a 10 fold lower affinity than a comparable polypeptide comprising the wild-type Fc region as determined by an ELISA assay, wherein said at least one amino acid modification comprises substitution at position 315 with isoleucine, at position 379 with methionine, and at position 399 with glutamic acid.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIB with about a 7 fold lower affinity than a comparable polypeptide comprising the wild-type Fc region as determined by an ELISA assay, wherein said at least one amino acid modification comprises substitution at position 243 with isoleucine, at position 379 with leucine, and at p ⁇ sitiD ⁇ ⁇ C'-wkht vsali ⁇ e ?
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIB with about a 3 fold lower affinity than a comparable polypeptide comprising the wild-type Fc region as determined by an ELISA assay, wherein said at least one amino acid modification comprises substitution at position 392 with threonine and at position 396 with leucine.
  • the invention encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIB with about a 5 fold lower affinity than a comparable polypeptide comprising the wild-type Fc region as determined by an ELISA assay, wherein said at least one amino acid modification comprises substitution at position 268 with asparagine and at position 396 with leucine.
  • the invention also encompasses an isolated polypeptide comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said polypeptide specifically binds Fc ⁇ RIIB with about a 2 fold lower affinity than a comparable polypeptide comprising the wild-type Fc region as determined by an ELISA assay, wherein said at least one amino acid modification comprises substitution at position 319 with phenylalanine, at position 352 with leucine, and at position 396 with leucine.
  • the invention encompasses molecules comprising variant Fc regions, having one or more amino acid modifications, which modifications increase the affinity of the variant Fc region for Fc ⁇ RIIIA and Fc ⁇ RIIB by at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 99%, at least 100%, at least 200%, at least 300%, at leat 400% and decreases the affinity of the variant Fc region for Fc ⁇ RIIB by at least 65%, at least 70%, at least 75%, at least 85%, at least 90%, at least 95%, at least 99%, at least 100%, at least 200%, at least 300%, at leat 400%.
  • the molecule of the invention comprising a variant Fc region with an enhanced affinity for Fc ⁇ RIIIA and an enhanced affinity for Fc ⁇ RIIB (as determined based on an ELISA assay and/or an ADCC based assay using ch-4-4-20 antibody, or a surface plasmon resonance assay using a chimeric 4D5 antibody, carrying the variant Fc region as described herein) comprises a substitution at position 415 with isoleucine and at position 251 with phenylalanine; or a substitution at positon 399 with glutamic acid, at position 292 with leucine, and at position 185 with methionine; or a substitution at position 408 with ,isp];e!Ufiii3ie;s.at'D. ⁇ sition'p2!l»S with isoleucine, and at position 125 with leucine; or a substitution at position 385 with glutamic acid and at position 247 with histidine; or a substitution
  • the invention encompasses molecules comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, which variant Fc region does not bind any Fc ⁇ R, as determined by standard assays known in the art and disclosed herein, relative to a comparable molecule comprising the wild type Fc region.
  • the one or more amino acid modifications which abolish binding to all Fc ⁇ Rs comprise a substitution at position 232 with serine and at position 304 with glycine; or a substitution at position 269 with lysine, at position 290 with asparagine, at position 311 with arginine, and at position 433 with tyrosine; or a substitution at position 252 with leucine; or a substitution at position 216 with aspartic acid, at position 334 with arginine, and at position 375 with isoleucine; or a substitution at position 247 with leucine and at position 406 with phenylalanine, or a substitution at position 335 with asparagine, at position 387 with serine, and at position 435 with glutamine; or a substitution at position 334 with glutamic acid, at position 380 with aspartic acid, and at position 446 with valine; or a substitution at position 303 with isoleucine, at position 369 with
  • the invention encompasses immunoglobulin comprising Fc variants with altered effector functions.
  • immunoglobulins comprising Fc variants mediate effector function more effectively in the presence of effector cells as determined using assays known in the art and exemplified herein.
  • immunoglobulins comprising Fc variants mediate effector function less effectively in the presence of effector cells as determined using assays known in the art and exemplified hr ⁇ iuu ,In soecifi ⁇ > ⁇ mb. ⁇ diments, the Fc variants of the invention may be combined with other known Fc modifications that alter effector function, such that the combination has an additive, synergistic effect.
  • the Fc variants of the invention have altered effector function in vitro and/or in vivo.
  • the immunoglobulins of the invention with enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA have an enhanced Fc ⁇ R-mediated effector function as determined using ADCC activity assays disclosed herein.
  • effector functions that could be mediated by the molecules of the invention include, but are not limited to, CIq binding, complement-dependent cytotoxicity, antibody-dependent cell mediate cytotoxicity (ADCC), phagocytosis, etc.
  • the effector functions of the molecules of the invention can be assayed using standard methods known in the art, examples of which are disclosed in Section 5.2.6.
  • the immunoglobulins of the invention comprising a variant Fc region with enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA mediate antibody dependent cell mediated cytotoxicity (ADCC) 2- fold more effectively, than an immunoglobulin comprising a wild-type Fc region.
  • ADCC antibody dependent cell mediated cytotoxicity
  • the immunoglobulins of the invention comprising a variant Fc region with enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA mediate antibody dependent cell mediated cytotoxicity (ADCC) at least 4- fold, at least 8-fold, at least 10-fold, at least 100-fold, at least 1000-fold, at least 10 4 -fold, at least 10 5 -fold more effectively, than an immunoglobulin comprising a wild-type Fc region.
  • the immunoglobulins of the invention with enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA have altered CIq binding activity.
  • the immunoglobulins of the invention with enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA have at least 2-fold, at least 4- fold, at least 8-fold, at least 10-fold, at least 100-fold, at least 1000-fold, at least 10 4 -fold, at least 10 5 -fold higher CIq binding activity than an immunoglobulin comprising a wild- type Fc region.
  • the immunoglobulins of the invention with enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA have altered complement dependent cytotoxicity.
  • the immunoglobulins of the invention with enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA have an enhanced complement dependent cytotoxicity than an immunoglobulin comprising a wild-type Fc region.
  • the immunoglobulins of the invention with enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA have at least 2-fold, at least 4- fold, at least 8-fold, at least 10-fold, at least 100-fold, at least 1000-fold, at least 10 4 -fold, at least 10 5 -fold higher complement dependent cytotoxicity than an immunoglobulin comprising a wild-type Fc region.
  • immunoglobulins of the invention with enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA have enhanced phagocytosis activity relative to an immunoglobulin comprising a wild-type Fc region, as determined by standard assays known to one skilled in the art or disclosed herein.
  • the immunoglobulins of the invention with enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA have at least 2-fold, at least 4- fold, at least 8-fold, at least 10-fold higher phagocytosis activity relative to an immunoglobulin comprising a wild-type Fc region.
  • the invention encompasses an immunoglobulin comprising a variant Fc region with one or more amino acid modifications, with an enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA such that the immunoglobulin has an enhanced effector function, e.g., antibody dependent cell mediated cytotoxicity, or phagocytosis.
  • an immunoglobulin comprising a variant Fc region with one or more amino acid modifications, with an enhanced affinity for Fc ⁇ RIIIA and/or Fc ⁇ RIIA such that the immunoglobulin has an enhanced effector function, e.g., antibody dependent cell mediated cytotoxicity, or phagocytosis.
  • the one or more amino acid modifications which increase the affinity of the variant Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA and increase the ADCC activity of the immunoglobulin comprise a substitution at position 379 with methionine; or a substitution at position 243 with isoleucine and at position 379 with leucine; or a substitution at position 288 with asparagine, at position 330 with serine, and at position 396 with leucine; or a substitution at position 243 leucine and at position 255 with leucine; or a substitution at position 334 with glutamic acid, at position 359 with asparagine, and at position 366 with serine; or a substitution at position 288 with methionine and at position 334 with glutamic acid; or a substitution at position 334 with glutamic acid and at position 292 with leucine; or a substitution at position 316 with aspartic acid, at position 378 with valine, and at position 399 with glutamic acid;
  • the starting molecule of particular interest herein is usually one that binds to CIq and displays complement dependent cytotoxicity (CDC).
  • the further amino acid substitutions described herein will generally serve to alter the ability of the starting molecule to bind to CIq and/or modify its complement dependent cytotoxicity function, e.g., to reduce and preferably abolish these effector functions.
  • molecules comprising substitutions at one or more of the described positions with improved CIq binding and/or complement dependent cytotoxicity (CDC) function are contemplated herein.
  • the starting molecule may be unable to bind CIq and/or mediate CDC and may be modified according to the teachings herein such that it acquires these further effector functions.
  • molecules with preexisting CIq binding activity, optionally further having the ability to mediate CDC may be modified such that one or both of these activities are enhanced.
  • an Fc region with altered effector function e.g., by modifying CIq binding and/or FcR binding and thereby changing CDC activity and/or ADCC activity.
  • the invention encompasses specific variants of the Fc region that have been identified using the methods of the invention from a yeast library of mutants after 2nd-4th- round of sorting are listed in Table 8. Table 8 summarizes the various mutants that were identified using the methods of the invention.
  • the mutants were assayed using an ELISA assay for determining binding to Fc ⁇ RIIIA and Fc ⁇ RIIB.
  • the mutants were also tested in an ADCC assay, by cloning the Fc variants into a ch 4-4-20 antibody using methods disclosed and exemplified herein.
  • Bolded items refer to experiments, in which the ch4-4-20 were purified prior the ADCC assay.
  • the antibody concentration used was in the range 0.5 ⁇ g/mL - 1.0 ⁇ g/mL.
  • immunoglobulins include IgG molecules that naturally contain Fc ⁇ R binding regions (e.g., Fc ⁇ RIIIA and/or Fc ⁇ RJIB binding region), or immunoglobulin derivatives that have been engineered to contain an Fc ⁇ R binding region (e.g., Fc ⁇ RIIIA and/or Fc ⁇ RIIB binding region).
  • the modified immunoglobulins of the invention include any immunoglobulin molecule that binds, preferably, immunospecifically, i.e., competes off non-specific binding as determined by immunoassays well known in the art for assaying specific antigen-antibody binding, an antigen and contains an Fc ⁇ R binding region (e.g., a Fc ⁇ RIIIA and/or Fc ⁇ RIIB binding region).
  • immunospecifically i.e., competes off non-specific binding as determined by immunoassays well known in the art for assaying specific antigen-antibody binding, an antigen and contains an Fc ⁇ R binding region (e.g., a Fc ⁇ RIIIA and/or Fc ⁇ RIIB binding region).
  • Such antibodies include, but are not limited to, polyclonal, monoclonal, bi-specific, multi-specific, human, humanized, chimeric antibodies, single chain antibodies, Fab fragments, F(ab') 2 fragments, disulfide- linked Fvs, and fragments containing either a VL or VH domain or even a complementary determining region (CDR) that specifically binds an antigen, in certain cases, engineered to contain or fused to an Fc ⁇ R binding region.
  • CDR complementary determining region
  • the molecules of the invention comprise portions of an Fc region.
  • portion of an Fc region refers to fragments of the Fc region, preferably a portion with effector activity and/or Fc ⁇ R binding activity (or a comparable region of a mutant lacking such activity).
  • the fragment of an Fc region may range in size from 5 amino acids to the entire Fc region minus one amino acids.
  • the portion of an Fc region may be missing up to 10, up to 20, up to 30 amino acids from the N- terminus or C-terminus.
  • the IgG molecules of the invention are preferably IgGl subclass of IgGs, but may also be any other IgG subclasses of given animals.
  • the IgG class includes IgGl, IgG2, IgG3, and IgG4; and mouse IgG includes IgGl, IgG2a, IgG2b, IgG2c and IgG3.
  • the immunoglobulins may be from any animal origin including birds and mammals.
  • the antibodies are human, rodent (e.g., mouse and rat), donkey, sheep, rabbit, goat, guinea pig, camel, horse, or chicken.
  • "human” antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulin and that do not express endogenous immunoglobulins, as described infi'a and, for example, in U.S. Patent No.
  • Q, ⁇ !;i ⁇ , ⁇ )!3jJ TtaanTOodies of the present invention may be monospecific, bispecit ⁇ c, trispecific or of greater multispecificity.
  • Multispecific antibodies may be specific for different epitopes of a polypeptide or may be specific for heterologous epitopes, such as a heterologous polypeptide or solid support material. See, e.g., PCT publications WO 93/17715; WO 92/08802; WO 91/00360; WO 92/05793; Tutt, et al. , J. Immunol. , 147:60- 69, 1991; U.S. Patent Nos. 4,474,893; 4,714,681; 4,925,648; 5,573,920; 5,601,819; Kosbe&ny et al., J. Immunol., 148:1547-1553, 1992.
  • Multispecific antibodies have binding specificities for at least two different antigens. While such molecules normally will only bind two antigens (i.e. bispecific antibodies, BsAbs), antibodies with additional specificities such as trispecific antibodies are encompassed by the instant invention.
  • BsAbs include without limitation those with one arm directed against a tumor cell antigen and the other arm directed against a cytotoxic molecule.
  • antibody variable domains with the desired binding specificities are fused to immunoglobulin constant domain sequences.
  • the fusion preferably is with an immunoglobulin heavy chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CHl) containing the site necessary for light chain binding, present in at least one of the fusions.
  • DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are co- transfected into a suitable host organism.
  • This provides for great flexibility in adjusting the mutual proportions of the three polypeptide fragments in embodiments when unequal ratios of the three polypeptide chains used in the construction provide the optimum yields. It is, however, possible to insert the coding sequences for two or all three polypeptide chains in oneffixcjr ⁇ ssionwec ⁇ K'w en, e expression o a eas wo po ypep i e c ams in equa ra ios results in high yields or when the ratios are of no particular significance.
  • the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid immunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm. It was found that this asymmetric structure facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations, as the presence of an immunoglobulin light chain in only one half of the bispecific molecule provides for a facile way of separation. This approach is disclosed in WO 94/04690. For further details of generating bispecific antibodies see, for example, Suresh et al., Methods in Enzymology, 121 :210 (1986).
  • a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture.
  • the preferred interface comprises at least a part of the CH3 domain of an antibody constant domain.
  • one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan).
  • Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
  • Bispecific antibodies include cross-linked or "heteroconjugate" antibodies.
  • one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin.
  • Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (U.S. Pat. No. 4,676,980), and for treatment of HIV infection (WO 91/00360, WO 92/200373, and EP 03089).
  • Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Pat. No. 4,676,980, along with a number of cross-linking techniques.
  • Antibodies with more than two valencies are contemplated.
  • trispecific antibodies can be prepared. See, e.g., Tutt et al. J. Immunol. 147: 60 (1991), which is incorporated herein by reference.
  • the antibodies of the invention include derivatives that are otherwise modified, i.e., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from binding antigen and/or generating an anti-idiotypic response.
  • a chimeric antibody is a molecule in which different portions of the antibody are derived from different animal species, such as antibodies having a variable region derived from a murine monoclonal antibody and a constant region derived from a human immunoglobulin.
  • Methods for producing chimeric antibodies are known in the art. See e.g., Morrison, Science, 229:1202, 1985; Oi et al, BioTechniques, 4:214 1986; Gillies et al, J. Immunol. Methods, 125:191-202, 1989; U.S. Patent Nos.
  • Humanized antibodies are antibody molecules from non-human species that bind the desired antigen having one or more complementarity determining regions (CDRs) from the non-human species and framework regions and constant domains from a human immunoglobulin molecule.
  • CDRs complementarity determining regions
  • framework residues in the human framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding.
  • framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. See, e.g.
  • Antibodies can be humanized using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; PCT publication WO 91/09967; U.S. Patent Nos.
  • Human antibodies are particularly desirable for therapeutic treatment of human patients.
  • Human antibodies can be made by a variety of methods known in the art including phage display methods described above using antibody libraries derived from human immunoglobulin sequences. See U.S. Patent Nos. 4,444,887 and 4,716,111; and PCT publications WO 98/46645; WO 98/50433; WO 98/24893; WO 98/16654; WO 96/34096; WO 96/33735; and WO 91/10741, each of which is incorporated herein by reference in its entirety.
  • Human antibodies can also be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes.
  • transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes.
  • human antibodies see Lonberg and Huszar, Int. Rev. Immunol, 13:65-93, 1995.
  • the invention encompasses engineering human or humanized therapeutic antibodies ⁇ e.g., tumor specific monoclonal antibodies) in the Fc region, by modification ⁇ e.g., substitution, insertion, deletion) of at least one amino acid residue, which modification increases the affinity of the Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA.
  • the invention relates to engineering human or humanized therapeutic antibodies ⁇ e.g., tumor specific monoclonal antibodies) in the Fc region, by modification of at least one amino acid residue, which modification increases the affinity of the Fc region for Fc ⁇ RIIIA and/or Fc ⁇ RIIA and further decreases the affinity of the Fc region for Fc ⁇ RIIB.
  • the engineered therapeutic antibodies may further have an enhanced effector U ⁇ i 'r ⁇ i ! i:::p. , g'. 5 ,:gn i3iiw i ac ivi y, p agocy osis ac ivi y, e c., as determined by standard assays known to those skilled in the art.
  • the invention encompasses engineering a humanized monoclonal antibody specific for Her2/neu protooncogene (e.g., Ab4D5 humanized antibody as disclosed in Carter et al, 1992, Proc. Natl. Acad. Sci. USA 89:4285- 9) by modification (e.g., substitution, insertion, deletion) of at least one amino acid residue which modification increases the affinity of the Fc rgion for Fc ⁇ RIIIA and/or Fc ⁇ RIIA.
  • modification of the humanized Her2/neu monoclonal antibody may also further decrease the affinity of the Fc region for Fc ⁇ RIIB.
  • the engineered humanized monoclonal antibodies specific for Her2/neu may further have an enhanced effector function as determined by standard assays known in the art and disclosed and exemplified herein.
  • the invention encompasses engineering a mouse human chimeric anti-CD20 monoclonal antibody, 2H7 by modification (e.g., substitution, insertion, deletion) of at least one amino acid residue which modification increases the affinity of the Fc rgion for Fc ⁇ RIIIA and/or Fc ⁇ RIIA.
  • modification of the anti-CD20 monoclonal antibody, 2H7 may also further decrease the affinity of the Fc region for Fc ⁇ RIIB.
  • the engineered anti-CD20 monoclonal antibody, 2H7 may further have an enhanced effector function as determined by standard assays known in the art and disclosed and exemplified herein.
  • the invention encompasses engineering an antibody
  • the invention encompasses engineering a humanized antibody comprising the heavy chain variable and/or light chain variable domains of 2B6, 3H7 or 8B5.3.4. In another specific embodiment, the invention encompasses engineering a humanized antibody comprising the CDRs of 2B6, 3H7 or 8B5.3.4. In another specific embodiment, the invention encompasses engineering a humanized antibody comprising the heavy chain variable domain having the amino acid sequence of SEQ ID NO: 1, SEQ ID NO:2 or SEQ ID NO:3 and the light chain variable domain having the amino acid sequence of SEQ ID NO: 4, SEQ ID NO:5, SEQ ID ⁇ P iSEQ ID NO: 8.
  • the invention encompasses engineering an anti-Fc ⁇ RIIB antibody comprising the heavy chain variable domain having the amino acid sequence of SEQ ID NO: 13 and the light chain variable domain having the amino acid sequence of SEQ ID NO: 14.
  • the invention encompasses engineering a humanized anti-Fc ⁇ RIIB antibody comprising the heavy chain variable domain having the amino acid sequence of SEQ ID NO: 3 and the light chain variable domain having the amino acid sequence of SEQ ID NO: 8.
  • the invention encompasses engineering a humanized anti- Fc ⁇ RIIB antibody comprising the heavy chain variable domain having the amino acid sequence of SEQ ID NO: 9 and the light chain valuable domain having the amino acid sequence of SEQ ID NO: 10.
  • the invention encompasses engineering an anti-Fc ⁇ RIIB antibody including but not limited to any of the antibodies disclosed in U.S. Provisional Application No. 60/403,266 filed on August 12, 2002, U.S. Application No. 10/643,857 filed on August 14, 2003, U.S. Provisional Application No. 60/562,804 filed on April 16, 2004, U.S. Provisional Application No. 60/582,044 filed on June 21, 2004, U.S. Provisional Application No. 60/582,045 filed on June 21, 2004, U.S. Provisional Application No. 60/636,663 filed on December 15, 2004 and U.S. Application Serial No.
  • the invention encompasses engineering a humanized anti-Fc ⁇ RIIB antibody including but not limited to any of the antibodies disclosed in U.S. Provisional Application No. 60/569,882 filed on May 10, 2004, U.S. Provisional Application No. 60/582, 043 filed on June 21, 2004 and U.S. Application No.
  • anti-Fc ⁇ RIIB antibodies which may or may not be humanized, that may be engineered in accordance with the methods of the invention are 2B6 monoclonal antibody having ATCC accession number PTA-4591 and 3H7 having ATCC accession number PTA-4592 ,1D5 monoclonal antibody having ATCC accession number PTA-5958, 1F2 monoclonal antibody having ATCC accession number PTA-5959, 2Dl 1 monoclonal antibody having ATCC accession number PTA-5960, 2El monoclonal antibody having ATCC accession number PTA-5961, 8B5.3.4 having ATCC accession number PTA-7610, and 2H9 monoclonal antibody having ATCC TO numoer: - a epos e n vers y ox 02209-2011), which are incorporated herein by reference.
  • modification of the anti-Fc ⁇ RIIB antibody may also further decrease the affinity of the Fc region for Fc ⁇ RIIB.
  • the engineered anti-Fc ⁇ RIIB antibody may further have an enhanced effector function as determined by standard assays known in the art and disclosed and exemplified herein.
  • the invention encompasses engineering an anti-
  • Fc ⁇ RIIB antibody according to methods of the present invention that comprises one or more complementarily determining regions (CDRs), preferably all 6 CDRs, of the antibody produced by clone 2B6, 3H7, or 8B5.3.4 with ATCC accession numbers PTA-4591, PTA- 4592, and PTA-7610, respectively (e.g., the heavy chain CDR3).
  • CDRs complementarily determining regions
  • an anti-Fc ⁇ RIIB antibody engineered according to methods of the invention comprises one or more complementarily determining regions (CDRs), preferably all 6 CDRs, of the antibody produced by clone 1D5, 2El, 2H9, 2Dl 1, and 1F2 having ATCC Accession numbers, PTA-5958, PTA-5961, PTA-5962, PTA-5960, and PTA-5959, respectively (e.g., the heavy chain CDR3).
  • CDRs complementarily determining regions
  • an anti-Fc ⁇ RIIB antibody engineered according to methods of the invention binds to the same epitope as the mouse monoclonal antibody produced from clone 2B6, 3H7, or 8B5.3.4 with ATCC accession numbers PTA- 4591, PTA-4592, and PTA-7610, respectively and/or competes with the mouse monoclonal antibody produced from clone 2B6, 3H7, or 8B5.3.4 with ATCC accession numbers PTA- 4591, PTA-4592, and PTA-7610, respectively as determined, e.g., in an ELISA assay or other appropriate competitive immunoassay, and also binds Fc ⁇ RIIB with a greater affinity than said antibody or a fragment thereof binds Fc ⁇ RIIA.
  • an anti- Fc ⁇ RIIB antibody engineered according to methods of the invention binds to the same epitope as the mouse monoclonal antibody produced from clone 1D5, 2El, 2H9, 2Dl 1, and 1F2 having ATCC Accession numbers, PTA-5958, PTA-5961, PTA-5962, PTA-5960, and PTA-5959, respectively, and/or competes with the mouse monoclonal antibody produced from clone 1D5, 2El, 2H9, 2Dl 1, and 1F2 having ATCC Accession numbers, PTA-5958, PTA-5961, PTA-5962, PTA-5960, and PTA-5959, respectively, as determined, e.g., in an ELISA assay or other appropriate competitive immunoassay, and also binds Fc ⁇ RIIB, via its variable region, with a greater affinity than said antibody or a fragment thereof binds Fc ⁇ RIIA.
  • the present invention also encompasses engineering an anti-Fc ⁇ RIIB antibody comprising a heavy chain variable domain and/or light chain variable domain amino acid sequence that is at least 45%, at least 50%, at least 55%, at least 60%, at least ' , , , least 99% identical to the amino acid sequence of the heavy chain variable domain and/or light chain variable domain of the mouse monoclonal antibody produced by clone 2B6, 3H7, 8B5.3.4, 1D5, 2El, 2H9, 2Dl 1, or 1F2 having ATCC accession numbers PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960, and PTA-5959, respectively.
  • the present invention further encompasses the engineering of anti-Fc ⁇ RIIB antibodies comprising an amino acid sequence of one or more CDRs that is at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of one or more CDRs of the mouse monoclonal antibody produced by clone 2B6, 3H7, 8B5.3.4, 1D5, 2El 3 2H9, 2Dl 1, or 1F2 having ATCC accession numbers PTA-4591, PTA- 4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960, and PTA-5959, respectively.
  • the determination of percent identity of two amino acid sequences can be determined by any method known to one skilled in the art, including BLAST protein searches.
  • the present invention also encompasses the engineering of one or more anti-Fc ⁇ RIIB antibodies comprising one or more variable domains encoded by a nucleotide sequence that hybridizes to the nucleotide sequence of one or more variable domains of a mouse monoclonal antibody produced by clone 2B6, 3H7, 8B5.3.4, 1D5, 2El, 2H9, 2Dl 1, or 1F2 having ATCC accession numbers PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960, and PTA-5959, respectively, under stringent conditions.
  • the invention encompasses engineering one or more anti- Fc ⁇ RIIB antibodies comprising a variable light chain and/or variable heavy chain domain encoded by a nucleotide sequence that hybridizes under stringent conditions to the nucleotide sequence of the variable light chain and/or variable heavy chain domain of the mouse monoclonal antibody produced by clone 2B6, 3H7, 8B5.3.4, 1D5, 2El, 2H9, 2Dl 1, or 1F2 having ATCC accession numbers PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA-5961, PTA-5962, PTA-5960, and PTA-5959, respectively, under stringent conditions.
  • the invention provides engineering anti-Fc ⁇ RIIB antibodies comprising one or more CDRs encoded by a nucleotide sequence that hybridizes under stringent conditions to the nucleotide sequence of one or more CDRs of the mouse monoclonal antibody produced by clone 2B6, 3H7, 8B5.3.4, 1D5, 2El, 2H9, 2Dl 1, or 1F2 having ATCC accession numbers PTA-4591, PTA-4592, PTA-7610, PTA-5958, PTA- 5961, PTA-5962, PTA-5960, and PTA-5959, respectively.
  • Stringent hybridization conditions include, but are not limited to, hybridization to filter-bound DNA in 6X sodium 'Ipte ⁇ feQdiiui- ⁇ etot ⁇ (SSC) at about 45°C followed by one or more washes in 0.2X SSC/0.1% SDS at about 50-65°C, highly stringent conditions such as hybridization to filter- bound DNA in 6X SSC at about 45°C followed by one or more washes in 0.1X SSC/0.2% SDS at about 6O 0 C, or any other stringent hybridization conditions known to those skilled in the art (see, for example, Ausubel, F.M. et al, eds. 1989 Current Protocols in Molecular Biology, vol. I 5 Green Publishing Associates, Inc.
  • the engineered antibodies of the invention are humanized by any method known in the art or described herein and/or comprise the CDR regions of a humanized Fc ⁇ RIIB specific antibody or humanized CD20 specific antibody, whrein said CDRs are derived from a murine antibody specific for Fc ⁇ RIIB or CD20, respectively.
  • the humanized antibodies described herein comprise alterations, including but not limited to amino acid deletions, insertions, modifications, of the acceptor antibody, i.e., human, heavy and/or light chain variable domain framework regions that are necessary for retaining binding specificity of the donor monoclonal antibody.
  • the framework regions of the humanized antibodies described herein do not necessarily consist of the precise amino acid sequence of the framework region of a natural occurring human antibody variable region, but contains various alterations, including but not limited to amino acid deletions, insertions, modifications that alter the property of the humanized antibody, for example, improve the binding properties of a humanized antibody variable region specific for the same target as the murine Fc ⁇ RIIB or CD20 specific antibody.
  • the donor monoclonal antibody is preferably a monoclonal antibody produced by clones 2B6, 3H7, 8B5.3.4, 1D5, 2El, 2H9, 2Dl 1, or 1F2 (having ATCC accession numbers PTA-4591, PTA-4592, PTA-7610, PTA- 5958, PTA-5961, PTA-5962, PTA-5960, and PTA-5959, respectively) which bind Fc ⁇ RIIB, or the monoclonal antibody is a CD20 antibody, such as rituximab or 2H7.
  • the invention encompasses engineering a CDR- grafted antibody that comprises a heavy chain variable region domain comprising framework residues of the recipient antibody and residues from the donor monoclonal antibody, which specifically binds Fc ⁇ RIIB, e.g., monoclonal antibody produced from clones 2B6, 3H7, 8B5.3.4, 1D5, 2El, 2H9, 2Dl 1, or 1F2 having ATCC accession numbers
  • the invention encompasses engineering a CDR-grafted antibody that comprises a light chain variable region domain comprising framework residues of the recipient antibody and residues from the donor monoclonal antibody, which specifically binds Fc ⁇ RIIB, e.g., monoclonal antibody produced from clones 2B6, 3H7, 8B5.3.4, 1D5, 2El, 2H9, 2Dl 1, or 1F2.
  • Fc ⁇ RIIB e.g., monoclonal antibody produced from clones 2B6, 3H7, 8B5.3.4, 1D5, 2El, 2H9, 2Dl 1, or 1F2.
  • the Fc ⁇ RIIB humanized antibodies bind the extracellular domain of native human Fc ⁇ RIIB.
  • the humanized anti- Fc ⁇ RIIB antibodies of the combinations can have a heavy chain variable region comprising the amino acid sequence of CDRl (SEQ ID NO: 15 or SEQ ID NO: 16) and/or CDR2 (SEQ ID NO:17 or SEQ ID NO:18) and/or CDR3 (SEQ ID NO: 19 or SEQ ID NO:20) and/or a light chain variable region comprising the amino acid sequence of CDRl (SEQ ID NO:21 or SEQ ID NO:22) and/or a CDR2 (SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, or SEQ ID NO:26) and/or CDR3 (SEQ ID NO:27 or SEQ ID NO:28).
  • the invention encompasses the engineering of a humanized anti-Fc ⁇ RIIB antibody with the heavy chain variable domain having the amino acid sequence of SEQ ID NQ: 1, SEQ ID NO:2, or SEQ ID NO:3 and a light chain variable domain having the amino acid sequence of SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6; SEQ ID NO:7 or SEQ ID NO:8.
  • the invention encompasses engineering a humanized anti-Fc ⁇ RIIB antibody, wherein the VH region of the Fc ⁇ RIIB antibody consists of the FR segments from the human germline VH segment VH1-18 (Matsuda et al, 1998, J. Exp. Med. 188:2151062) and JH6 (Ravetch et al, 1981, Cell 27(3 Pt. 2): 583-91), and one or more CDR regions of a 2B6 VH, having the amino acid sequence of SED ID NO: 1, SEQ ID NO:17, or SEQ ID NO: 19.
  • the 2B6 VH has the amino acid sequence of SEQ ID NO:1, SEQ ID NO:3, or SEQ ID NO:29.
  • the humanized anti-Fc ⁇ RIIB antibody further comprises a VL region, which consists of the FR segments of the human germline VL segment VK- A26 (Lautner-Rieske et al, 1992, Eur. J. Immunol. 22:1023-1029) and JK4 (Hieter et al, 1982, J. Biol. Chem.
  • the 2B6 VL has the amino acid sequence of SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6; SEQ ID NO:7, SEQ ID NO:8, or SEQ ID NO:30, and optionally in combination with one of the above-referenced 2B6 VH.
  • the anti-Fc ⁇ RIIB antibody angineered in accordance with the methods ot the invention has a VH chain and/or a VH domain comprising the amino acid sequence (H2B6VH-3):
  • the anti-Fc ⁇ RIIB antibody angineered in accordance with the methods of the invention has a VL chain and/or VL domain comprising the amino acid sequence (H2B6VL-5):
  • FSGSGSGTDFTLTINSLEAEDAATYYCQQSNTWPFTFGGGTKVEIK SEQ ID NO:8.
  • the anti-Fc ⁇ RIIB antibody angineered in accordance with the methods of the invention has a VH chain and/or VH domain comprising the amino acid sequence (H2B6VH-3):
  • FSGSGSGTDFTLTINSLEAEDAATYYCQQSNTWPFTFGGGTKVEIK SEQ ID NO:8.
  • the anti-Fc ⁇ RIIB antibody angineered in accordance with the methods of the invention has a VH domain and/or VH chain comprising the amino acid sequence (8B5.3.4 VH, see FIG. 2):
  • the anti-Fc ⁇ RIIB antibody angineered in accordance with the methods of the invention has a VL domain and/or VL chain comprising the amino acid sequence (8B5.3.4 VL, see FIG. 1):
  • the anti-Fc ⁇ RIIB antibody angineered in accordance with the methods of the invention has a VH domain and/or VH chain comprising the amino acid sequence (8B5.3.4 VH): f wft W ⁇ SQ FSDAWMD R WVAElRN ⁇ C ⁇ K HATy
  • YAESVIGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCGALGLDYWGQGTTLTVSS (SEQ ID NO:9, see FIG. 2), and a VL domain and/or VL chain comprising the amino acid sequence (8B5.3.4 VL, see FIG 1):
  • the anti-Fc ⁇ RIIB antibody engineered in accordance with the methods of the invention is a humanized 3H7 antibody, wherein the Fc ⁇ RIIB VH region consists of the FR segments from a human germline VH segment and the CDR regions of the 3H7 VH, having the amino acid sequence of SED ID NO: 37.
  • the humanized 3H7 antibody further comprises a VL region, which consists of the FR segments of a human germline VL segment and the CDR regions of 3H7VL, having the amino acid sequence of SEQ ID NO:7.
  • the invention encompasses the engineering of an anti-Fc ⁇ RIIB antibody wherein the antibody immunospecifically binds to an extracellular domain of native human Fc ⁇ RIIB, said Fc ⁇ RIIB antibody comprising (or alternatively, consisting of) CDR sequences of 2B6, 3H7, or 8B5.3.4 in any of the following combinations: a VH CDRl and a VL CDRl ; a VH CDRl and a VL CDR2; a VH CDRl and a VL CDR3; a VH CDR2 and a VL CDRl ; VH CDR2 and VL CDR2; a VH CDR2 and a VL CDR3; a VH CDR3 and a VH CDRl; a VH CDR3 and a VL CDR2; a VH CDR3 and a VL CDR3; a VHl CDRl, a VH CDR3 and a VL CDR2;
  • the anti-Fc ⁇ RIIB monoclonal antibody comprises a modification at position 334 with glutamic acid, at position 359 with asparagine, and at position 366 with serine (MgFcI 3); or a substitution at position 316 with aspartic acid, at position 378 with valine, and at position 399 with glutamic acid (MgFc27); or a substitution at position 243 with isoleucine, at position 379 with leucine, and at position 420 with valine (MgFc29); or a substitution at positon 392 with threonine and at position 396 with leucine (MgFc38); or a substitution at position 221 with glutamic acid, at positon 270 with glutamic acid, at positon 308 with alanine, at position 311 with histidine, at position 396 with leucine, and at position 402 with aspartic (MgFc42); or a substitution at position 334 with glutamic acid, at
  • Molecules of the invention i.e., polypeptides, antibodies
  • variants of the invention i.e., polypeptides, antibodies
  • Fc regions may be recombinantly fused or chemically conjugated (including both covalently and non-coval entry conjugations) to heterologous polypeptides (i.e., an unrelated polypeptide; or portion thereof, preferably at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 amino acids of the polypeptide) to generate fusion proteins.
  • heterologous polypeptides i.e., an unrelated polypeptide; or portion thereof, preferably at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 amino acids of the polypeptide
  • the fusion does not necessarily need to be direct, but may occur through linker sequences.
  • po ypep i es, anuouuies comprising variant Fc regions may be conjugated to a therapeutic agent or a drug moiety that modifies a given biological response.
  • Therapeutic agents or drug moieties are not to be construed as limited to classical chemical therapeutic agents.
  • the drug moiety may be a protein or polypeptide possessing a desired biological activity.
  • Such proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin (i.e., PE-40), or diphtheria toxin, ricin, gelonin, and pokeweed antiviral protein, a protein such as tumor necrosis factor, interferons including, but not limited to, ⁇ -interferon (IFN- ⁇ ), ⁇ -interferon (IFN- ⁇ ), nerve growth factor (NGF), platelet derived growth factor (PDGF), tissue plasminogen activator (TPA), an apoptotic agent (e.g., TNF- ⁇ , TNF- ⁇ , AIM I as disclosed in PCT Publication No.
  • a toxin such as abrin, ricin A, pseudomonas exotoxin (i.e., PE-40), or diphtheria toxin, ricin, gelonin, and pokeweed antiviral protein
  • a protein such as tumor necrosis factor
  • interferons
  • WO 97/33899 AIM II (see, PCT Publication No. WO 97/34911), Fas Ligand (Takahashi et al., J. Immunol, 6:1567-1574, 1994), and VEGI (PCT Publication No. WO 99/23105), a thrombotic agent or an anti-angiogenic agent (e.g.
  • angiostatin or endostatin or a biological response modifier such as, for example, a lymphokine (e.g., interleukin-1 ("IL- 1”), interleukin-2 (“IL-2”), interleukin-6 (“IL-6”), granulocyte macrophage colony stimulating factor (“GM-CSF”), and granulocyte colony stimulating factor (“G-CSF”), macrophage colony stimulating factor, (“M-CSF”), or a growth factor (e.g., growth hormone (“GH”); proteases, or ribonucleases.
  • a lymphokine e.g., interleukin-1 ("IL- 1"), interleukin-2 ("IL-2”), interleukin-6 (“IL-6”), granulocyte macrophage colony stimulating factor (“GM-CSF”), and granulocyte colony stimulating factor (“G-CSF”), macrophage colony stimulating factor, (“M-CSF)
  • a growth factor e.g., growth hormone (“GH”
  • Molecules of the invention can be fused to marker sequences, such as a peptide to facilitate purification.
  • the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, CA, 91311), among others, many of which are commercially available.
  • a pQE vector QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, CA, 91311
  • hexa-histidine provides for convenient purification of the fusion protein.
  • peptide tags useful for purification include, but are not limited to, the hemagglutinin "HA” tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al, Cell, 31:161 1984) and the "flag” tag (Knappik et al, Biotechniques, 17(4):754-761, 1994).
  • DNA shuffling may be employed to alter the activities of molecules of the invention (e.g., antibodies with higher affinities and lower dissociation rates). See, generally, U.S. Patent Nos. 5,605,793; 5,811,238; 5,830,721; 5,834,252; and 5,837,458, and Patten et al, 1997, Curr. Opinion Biotechnol. 8:724-33; Harayama, 1998, Trends Biotechnol.
  • Molecules of the invention comprising variant Fc regions, or the nucleic acids encoding the molecules of the invention, may be further altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion or other methods prior to recombination.
  • One or more portions of a polynucleotide encoding a molecule of the invention may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.
  • the present invention also encompasses molecules of the invention comprising variant Fc regions (i.e., antibodies, polypeptides) conjugated to a diagnostic or therapeutic agent or any other molecule for which serum half-life is desired to be increased and/or targeted to a particular subset of cells.
  • the molecules of the invention can be used diagnostically to, for example, monitor the development or progression of a disease, disorder or infection as part of a clinical testing procedure to, e.g., determine the efficacy of a given treatment regimen.
  • Detection can be facilitated by coupling the molecules of the invention to a detectable substance.
  • detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals, and nonradioactive paramagnetic metal ions.
  • the detectable substance may be coupled or conjugated either directly to the molecules of the invention or indirectly, through an intermediate (such as, for example, a linker known in the art) using techniques known in the art. See, for example, U.S. Patent No. 4,741,900 for metal ions which can be conjugated to antibodies for use as diagnostics according to the present invention.
  • Such diagnosis and detection can be accomplished by coupling the molecules of the invention to detectable substances including, but not limited to, various enzymes, enzymes including, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic group complexes such as, but not limited to, streptavidin/biotin and avidin/biotin; fluorescent materials such as, but not limited to, umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; luminescent material such as, but not limited to, luminol; bioluminescent materials such as, but not limited to, luciferase, luciferin, and aequorin; radioactive material such as, but not limited to, bismuth ( 213 Bi), carbon ( 14 C), chromium (
  • Molecules of the invention comprising a variant Fc region may be conjugated to a therapeutic moiety such as a cytotoxin (e.g., a cytostatic or cytocidal agent), a therapeutic agent or a radioactive element (e.g., alpha- emitters, gamma-emitters, etc.).
  • cytotoxin e.g., a cytostatic or cytocidal agent
  • a therapeutic agent e.g., a therapeutic agent
  • a radioactive element e.g., alpha- emitters, gamma-emitters, etc.
  • Cytotoxins or cytotoxic agents include any agent that is detrimental to cells.
  • Examples include paclitaxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
  • Therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cisdichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC), and anti-mitotic agents (e.g., vin
  • a molecule of the invention can be conjugated to therapeutic moieties such as a radioactive materials or macrocyclic chelators useful for conjugating radiometal ions (see above for examples of radioactive materials).
  • the macrocyclic chelator is l,4,7,10-tetraazacyclododecane-N,N',N",N'"-tetraacetic acid (DOTA) which can be attached to the antibody via a linker molecule.
  • linker molecules are commonly known in the art and described in Denardo et ⁇ l, 1998, Clin Cancer Res. 4:2483-90; Peterson et al, 1999, Bioconjug. Chem. 10:553; and Zimmerman et al., 1999, Nucl. Med. Biol. 26:943-50 each of which is incorporated herein by reference in their entireties.
  • the molecule of the invention is an antibody comprising a variant Fc region
  • it can be administered with or without a therapeutic moiety conjugated to it, administered alone, or in combination with cytotoxic factor(s) and/or cytokine(s) for use as a therapeutic treatment.
  • an antibody of the invention can be conjugated to a second antibody to form an antibody heteroconjugate as described by Segal in U.S. Patent No. 4,676,980, which is incorporated herein by reference in its entirety.
  • Antibodies of the invention may also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen.
  • Such solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
  • screening and identifying molecules comprising variant Fc regions with altered Fc ⁇ R affinities ⁇ e.g. , enhanced Fc ⁇ RIII A affinity are done using the yeast display technology as described herein in combination with one or more biochemical based assays, preferably in a high throughput manner.
  • the one or more biochemical assays can be any assay known in the art for identifying Fc-Fc ⁇ R interaction, i.e., specific binding of an Fc region to an Fc ⁇ R, including, but not limited to, an ELISA assay, surface plasmon resonance assays, immunoprecipitation assay, affinity chromatography, and equilibrium dialysis.
  • screening and identifying molecules comprising variant Fc regions with altered Fc ⁇ R affinities are done using the yeast display technology as described herein in combination with one or more functional based assays, preferably in a high throughput manner.
  • the functional based assays can be any assay known in the art for characterizing one or more Fc ⁇ R mediated effector cell functions such as those described herein in Section 5.2.7.
  • Non-limiting examples of effector cell functions include but are not limited to, antibody-dependent cell mediated cytotoxicity (ADCC), antibody-dependent phagocytosis, phagocytosis, / i ⁇ pspf ⁇ i'if; ⁇ .tion; i :: ⁇ s>pSQB ⁇ ph ⁇ gocytosis, cell binding, resetting, CIq binding, and complement dependent cell mediated cytotoxicity.
  • ADCC antibody-dependent cell mediated cytotoxicity
  • ADCC antibody-dependent mediated cytotoxicity
  • phagocytosis phagocytosis
  • / i ⁇ pspf ⁇ i'if; ⁇ .tion; i :: ⁇ s>pSQB ⁇ ph ⁇ gocytosis cell binding, resetting, CIq binding, and complement dependent cell mediated cytotoxicity.
  • screening and identifying molecules comprising variant Fc regions with altered Fc ⁇ R affinities are done using the yeast display technology as described herein in combination with one or more biochemical based assays in combination or in parallel with one or more functional based assays, preferably in a high throughput manner.
  • the term "specific binding" of an Fc region to an Fc ⁇ R refers to an interaction of the Fc region and a particular Fc ⁇ R which has an affinity constant of at least about 150 nM, in the case of monomeric Fc ⁇ RIIIA and at least about 60 nM in the case of dimeric Fc ⁇ RIIB as determined using, for example, an ELISA or surface plasmon resonance assay (e.g., a BIAcoreTM).
  • the affinity constant of an Fc region for monomeric Fc ⁇ RIIIA may be 150 nM, 200 nM or 30OnM.
  • the affinity constant of an Fc region for dimeric Fc ⁇ RIIB may be 60 nM, 80 nM, 90 nM, or 100 nM.
  • Dimeric Fc ⁇ RIIB for use in the methods of the invention may be generated using methods known to one skilled in the art.
  • the extracellular region of Fc ⁇ RIIB is covalently linked to a heterologous polypeptide which is capable of dimerization, so that the resulting fusion protein is a dimer, e.g., see, U.S. Application No. 60/439,709 filed on January 13, 2003 (Attorney Docket No. I l l 83-005-888), which is incorporated herein by reference in its entirety.
  • a specific interaction generally is stable under physiological conditions, including, for example, conditions that occur in a living individual such as a human or other vertebrate or invertebrate, as well as conditions that occur in a cell culture such conditions as used for maintaining and culturing mammalian cells or cells from another vertebrate organism or an invertebrate organism.
  • screening for and identifying molecules comprising variant Fc regions and altered Fc ⁇ R affinities comprise: displaying the molecule comprising a variant Fc region on the yeast surface; and characterizing the binding of the molecule comprising the variant Fc region to a Fc ⁇ R (one or more), using a biochemical assay for determining Fc-Fc ⁇ R interaction, preferably, an ELISA based assay.
  • a biochemical assay for determining Fc-Fc ⁇ R interaction preferably, an ELISA based assay.
  • the molecule maybe engineered into a complete immunoglobulin, using standard recombinant DNA technology methods known in the art, and the immunoglobulin comprising the variant Fc region expressed in mammalian cells for further biochemical characterization.
  • the immunoglobulin into which a variant Fc ⁇ ⁇ mQ ⁇ &im&v ⁇ m' ⁇ in ro uce e.g., rep acing e c region o e immunog o u n can be any immunoglobulin including, but not limited to, polyclonal antibodies, monoclonal antibodies, bispecific antibodies, multi-specific antibodies, humanized antibodies, and chimeric antibodies.
  • a variant Fc region is introduced into an immunoglobulin specific for a cell surface receptor, a tumor antigen, or a cancer antigen.
  • the immunoglobulin into which a variant Fc region of the invention is introduced may specifically bind a cancer or tumor antigen for example, including, but not limited to, KS 1/4 pan-carcinoma antigen (Perez and Walker, 1990, J Immunol 142: 3662-3667; Bumal, 1988, Hybridoma 7(4): 407-415), ovarian carcinoma antigen (CA125) (Yu et al, 1991, Cancer Res. 51(2): 468-475), prostatic acid phosphate (Tailor et al, 1990, Nucl. Acids Res.
  • prostate specific antigen Henttu and Vihko, 1989, Biochem. Biophys. Res. Comm. 160(2): 903-910; Israeli et al, 1993, Cancer Res. 53: 227-230
  • melanoma- associated antigen ⁇ 97 Estin et al, 1989, J Natl. Cancer Instit. 81(6): 445-446
  • melanoma antigen g ⁇ 75 Vijayasardahl ⁇ tf ⁇ /., 1990, J Exp. Med.
  • HMW-MAA high molecular weight melanoma antigen
  • CEA carcinoembryonic antigen
  • TAG-72 Yokata et al, 1992, Cancer Res.
  • melanoma specific antigens such as ganglioside GD2 (Saleh et ah, 1993, J. Immunol, 151, 3390-3398), ganglioside GD3 (Shitara et ⁇ /., 1993, Cancer Immunol. Immunother. 36:373-380), ganglioside GM2 (Livingston et al, 1994, J Clin. Oncol 12: 1036-1044), ganglioside GM3 (Hoon et al, 1993, Cancer Res.
  • tumor-specific transplantation type of cell-surface antigen such as virally-induced tumor antigens including T-antigen DNA tumor viruses and Envelope antigens of RNA tumor viruses, oncofetal antigen-alpha-fetoprotein such as CEA of colon, bladder tumor oncofetal antigen (Hellstrom et al, 1985, Cancer. Res. 45:2210-2188), differentiation antigen such as human lung carcinoma antigen L6, L20 (Hellstrom et al, 1986, Cancer Res. 46: 3917- 3923), antigens of fibrosarcoma, human leukemia T cell antigen-Gp37 (Bhattacharya- Chatterjee et al, 1988, J oflmmun.
  • TSTA tumor-specific transplantation type of cell-surface antigen
  • neoglycoprotein neoglycoprotein
  • sphingolipids breast cancer antigen such as EGFR (Epidermal growth factor receptor), HER2 antigen Fjj f ' ⁇ Q yKQrp' i ⁇ epi e ia mucin ens e a , , ren s n o. Chem. Sci.
  • malignant human lymphocyte antigen-APO-1 (Bernhard et ah, 1989, Science 245: 301-304), differentiation antigen (Feizi, 1985, Nature 314: 53-57) such as I antigen found in fetal erythrocytes, primary endoderm I antigen found in adult erythrocytes, preimplantation embryos, I(Ma) found in gastric adenocarcinomas, Ml 8, M39 found in breast epithelium, SSEA-I found in myeloid cells, VEP8, VEP9, MyI, VIM-D5, Dj56-22 found in colorectal cancer, TRA-1-85 (blood group H), C14 found in colonic adenocarcinoma, F3 found in lung adenocarcinoma, AH6 found in gastric cancer, Y hapten, Le y found in embryonal carcinoma cells, TL5 (blood group A), EGF receptor found in A431 cells , E 1 series (blood group B) found
  • the antigen is a T cell receptor derived peptide from a Cutaneous Tcell Lymphoma ⁇ see, Edelson, 1998, The Cancer Journal 4:62).
  • a variant Fc region of the invention is introduced into an anti-fluoresceine monoclonal antibody, 4-4-20 (Kranz et al, 1982 J Biol. Chem. 257(12): 6987-6995; which is incorporated herein by reference in its entirety).
  • a variant Fc region of the invention is introduced into a mouse-human chimeric anti-CD20 monoclonal antibody 2H7, which recognizes the CD20 cell surface phosphoprotein on B cells (Liu et al., 1987, Journal of Immunology, 139: 3521-6; which is incorporated herein by reference in its entirety).
  • a variant Fc region of the invention is introduced into a humanized antibody (Ab4D5) against the human epidermal growth factor receptor 2 (pl85 HER2) as described by Carter et al. (1992, Proc. Natl. Acad. Sci. USA 89: 4285-9; which is incorporated herein by reference in its entirety).
  • a variant Fc region of the invention is introduced into a humanized anti-TAG72 antibody (CC49) (Sha et al., 1994 Cancer Biother. 9(4): 341-9). In other embodiments, a variant Fc region of the invention is introduced into Rituxan which is used for treating lymphomas.
  • the invention encompasses engineering an anti-Fc ⁇ RIIB antibody including but not limited to any of the antibodies disclosed in U.S. Provisional Application No. 60/403,266 filed on August 12, 2002, U.S. Application No. " ( - 1 ' e QBf ugus , , . . rovisiona pp ica ion o. o ⁇ /3 ⁇ /,8U4 me on April 16, 2004, U.S. Provisional Application No. 60/582,044 filed on June 21, 2004, U.S. Provisional Application No. 60/582,045 filed on June 21, 2004, U.S. Provisional Application No. 60/636,663 filed on December 15, 2004 and U.S. Application Serial No.
  • the invention encompasses engineering a humanized anti-Fc ⁇ RIIB antibody including but not limited to any of the antibodies disclosed in U.S. Provisional Application No. 60/569,882 filed on May 10, 2004, U.S. Provisional Application No. 60/582, 043 filed on June 21, 2004 and U.S. Application No.
  • anti-Fc ⁇ RIIB antibodies which may or may not be humanized, that may be engineered in accordance with the methods of the invention are 2B6 monoclonal antibody having ATCC accession number PTA-4591 and 3H7 having ATCC accession number PTA-4592, 1D5 monoclonal antibody having ATCC accession number PTA-5958, 1F2 monoclonal antibody having ATCC accession number PTA-5959, 2Dl 1 monoclonal antibody having ATCC accession number PTA-5960, 2El monoclonal antibody having ATCC accession number PTA-5961 and 2H9 monoclonal antibody having ATCC accession number PTA-5962 (all deposited at 10801 University Boulevard, Manassas, VA 02209-2011), which are incorporated herein by reference.
  • modification of the anti-Fc ⁇ RIIB antibody may also further decrease the affinity of the Fc region for Fc ⁇ RIIB.
  • the engineered anti-Fc ⁇ RIIB antibody may further have an enhanced effector function as determined by standard assays known in the art and disclosed and exemplified herein.
  • a variant Fc region of the invention is introduced into a therapeutic monoclonal antibody specific for a cancer antigen or cell surface receptor including but not limited to, ErbituxTM (also known as IMC-C225) (ImClone Systems Inc.), a chimerized monoclonal antibody against EGFR; HERCEPTIN® (Trastuzumab) (Genentech, CA) which is a humanized anti-HER2 monoclonal antibody for the treatment of patients with metastatic breast cancer; REOPRO® (abciximab) (Centocor) which is an anti-glycoprotein Ilb/IIIa receptor on the platelets for the prevention of clot formation; ZENAP AX® (daclizumab) (Roche Pharmaceuticals, Switzerland) which is an immunosuppressive, humanized anti-CD25 monoclonal antibody for the prevention of acute ; • ⁇ er examp es are a umanize an i- f(at>')2 enen e
  • the variant Fc regions of the invention can be further characterized using one or more biochemical assays and/or one or more functional assays, preferably in a high throughput manner. In some alternate embodiments, the variant Fc regions of the inventions are not introduced into an immunoglobulin and are further characterized using one or more biochemical based assays and/or one or more functional assays, preferably in a high throughput manner.
  • the one or more biochemical assays can be any assay known in the art for identifying Fc-Fc ⁇ R interactions, including, but not limited to, an ELISA assay, and surface plasmon resonance- based assay for determining the kinetic parameters of Fc-Fc ⁇ R interaction, e.g., BIAcore assay.
  • the one or more functional assays can be any assay known in the art for characterizing one or more Fc ⁇ R mediated effector cell function as known to one skilled in the art or described herein.
  • the immunoglobulins comprising the variant Fc regions are assayed in an ELISA assay for binding to one or more Fc ⁇ Rs, e.g., Fc ⁇ RIIIA, Fc ⁇ RIIA, Fc ⁇ RIIA; followed by one or more ADCC assays.
  • the immunoglobulins comprising the variant Fc regions are assayed further using a surface plasmon resonance-based assay, e.g. , BIAcore.
  • Surface plasmon resonance-based assays are well known in the art, and are further discussed in Section 5.2.7, and exemplified herein in Example 6.8.
  • An exemplary high throughput assay for characterizing immunoglobulins comprising variant Fc regions may comprise: introducing a variant Fc region of the invention, e.g., by standard recombinant DNA technology methods, in a 4-4-20 antibody; characterizing the specific binding of the 4-4-20 antibody comprising the variant Fc region to an Fc ⁇ R (e.g., Fc ⁇ RIIIA, Fc ⁇ RIIB) in an ELISA assay; characterizing the 4-4-20 antibody comprising the variant Fc region in an ADCC assay (using methods disclosed herein) wherein the target cells are opsonized with the 4-4-20 antibody comprising the variant Fc region; the variant Fc region may then be cloned into a second immunoglobulin, e.g., 4D5, 2H7, and that second immunoglobulin characterized in an ADCC assay, wherein the target cells are opsonized with the second antibody comprising the variant Fc region.
  • the second antibody comprising the variant Fc region is then be
  • a variant Fc region of the invention binds Fc ⁇ RIIIA and/or
  • Fc ⁇ RIIA with a higher affinity than a wild type Fc region as determined in an ELISA assay.
  • fc ⁇ «_— c-_i_i , _ —- -: -K-* Fc region of the invention binds Fc ⁇ RIIIA an ⁇ / or fc ⁇ i with a higher affinity and binds Fc ⁇ RIIB with a lower affinity than a wild type Fc region as determined in an ELISA assay.
  • the variant Fc region binds Fc ⁇ RIIIA and/or Fc ⁇ RIIA with at least 2-fold higher, at least 4-fold higher, more preferably at least 6-fold higher, most preferably at least 8 to 10-fold higher affinity than a wild type Fc region binds Fc ⁇ RIIIA and/or Fc ⁇ RIIA and binds Fc ⁇ RIIB with at least 2-fold lower, at least 4-fold lower, more preferably at least 6-fold lower, most preferably at least 8 to 10- fold lower affinity than a wild type Fc region binds Fc ⁇ RIIB as determined in an ELISA assay.
  • the immunoglobulin comprising the variant Fc regions may be analyzed at any point using a surface plasmon based resonance based assay, e.g., BIAcore, for defining the kinetic parameters of the Fc-Fc ⁇ R interaction, using methods disclosed herein and known to those of skill in the art.
  • a surface plasmon based resonance based assay e.g., BIAcore
  • the Kd of a variant Fc region of the invention for binding to a monomeric Fc ⁇ RIIIA and/or Fc ⁇ RIIA as determined by BIAcore analysis is about 100 nM, preferably about 70 nM, most preferably about 40 nM.; and the Kd of the variant Fc region of the invention for binding a dimeric Fc ⁇ RIIB is about 80 nM, about 100 nM, more preferably about 200 nM.
  • the immunoglobulin comprising the variant
  • Fc regions is further characterized in an animal model for interaction with an Fc ⁇ R.
  • Preferred animal models for use in the methods of the invention are, for example, transgenic mice expressing human Fc ⁇ Rs, e.g., any mouse model described in U.S. Patent No. 5,877,397, and 6,676,927 which are incorporated herein by reference in their entirety.
  • Transgenic mice for use in the methods of the invention include, but are not limited to, nude knockout Fc ⁇ RIIIA mice carrying human Fc ⁇ RIIIA; nude knockout Fc ⁇ RIIIA mice carrying human Fc ⁇ RIIA; nude knockout Fc ⁇ RIIIAmice carrying human Fc ⁇ RIIB and human Fc ⁇ RIIIA; nude knockout Fc ⁇ RIIIA mice carrying human Fc ⁇ RIIB and human Fc ⁇ RIIA; nude knockout Fc ⁇ RIIIA and Fc ⁇ RIIA mice carrying human Fc ⁇ RIIIA and Fc ⁇ RIIA and nude knockout Fc ⁇ RIIIA, Fc ⁇ RIIA and Fc ⁇ RIIB mice carrying human Fc ⁇ RIIIA, Fc ⁇ RIIA and Fc ⁇ RIIB mice carrying human Fc ⁇ RIIIA, Fc ⁇ RIIA and Fc ⁇ RIIB.
  • the present invention encompasses engineering methods to generate Fc variants including but not limited to computational design strategies, library generation methods, and experimental production and screening methods. These strategies may be i rianxs oi me insiai invention.
  • the engineering methods of the invention comprise methods in which amino acids at the interface between an Fc region and the Fc ligand are not modified.
  • Fc ligands include but are not limited to Fc ⁇ Rs, CIq, FcRn, C3, mannose receptor, protein A, protein G, mannose receptor, and undiscovered molecules that bind Fc.
  • Amino acids at the interface between an Fc region and an Fc ligand is defined as those amino acids that make a direct and/ or indirect contact between the Fc region and the ligand, play a structural role in determining the conformation of the interface, or are within at least 3 angstroms, preferably at least 2 angstroms of each other as determined by structural analysis, such as x-ray crystallography and molecular modeling
  • the amino acids at the interface between an Fc region and an Fc ligand include those amino acids that make a direct contact with an Fc ⁇ R based on crystallographic and structural analysis of Fc-Fc ⁇ R interactions such as those disclosed by Sondermann et al., (2000, Nature, 406: 267-273; which is incorporated herein by reference in its entirety).
  • positions within the Fc region that make a direct contact with Fc ⁇ R are amino acids 234-239 (hinge region), amino acids 265-269 (B/C loop), amino acids 297-299 (CVE loop), and amino acids 327- 332 (F/G) loop.
  • the molecules of the invention comprising variant Fc regions comprise modification of at least one residue that does not make a direct contact with an Fc ⁇ R based on structural and crystallographic analysis, e.g., is not within the Fc- Fc ⁇ R binding site.
  • the engineering methods of the invention do not modify any of the amino acids as identified by Shields et al,. which are located in the CH2 domain of an Fc region proximal to the hinge region, e.g., Leu234-Pro238; Ala327, Pro329, and affect binding of an Fc region to all human Fc ⁇ Rs.
  • the invention encompasses Fc variants with altered
  • Fc ⁇ R affinities and/or altered effector functions such that the Fc variant does not have an amino acid modification at a position at the interface between an Fc region and the Fc ligand.
  • Fc variants in combination with one or more other amino acid modifications which are at the interface between an Fc region and the Fc ligand have a further impact on the particular altered property, e.g. altered Fc ⁇ R affinity.
  • Modifying amino acids at the interface between Fc and an Fc ligand may be done using methods known in the art, for example based on structural analysis of Fc-ligand complexes.
  • var ants can be engineered that sample new interface conformations, some of which may improve binding to the Fc ligand, some of which may reduce Fc ligand binding, and some of which may have other favorable properties.
  • new interface conformations could be the result of, for example, direct interaction with Fc ligand residues that form the interface, or indirect effects caused by the amino acid modifications such as perturbation of side chain or backbone conformations
  • the invention encompasses engineering Fc variants comprising any of the amino acid modifications disclosed herein in combination with other modifications in which the conformation of the Fc carbohydrate at position 297 is altered.
  • the invention encompasses conformational and compositional changes in the N297 carbohydrate that result in a desired property, for example increased or reduced affinity for an Fc ⁇ R. Such modifications may further enhance the phenotype of the original amino acid modification of the Fc variants of the invention.
  • Fc region is reengineered to eliminate the structural and functional dependence on glycosylation.
  • This design strategy involves the optimization of Fc structure, stability, solubility, and/or Fc function (for example affinity of Fc for one or more Fc ligands) in the absence of the N297 carbohydrate.
  • positions that are exposed to solvent in the absence of glycosylation are engineered such that they are stable, structurally consistent with Fc structure, and have no tendency to aggregate.
  • Approaches for optimizing aglycosylated Fc may involve but are not limited to designing amino acid modifications that enhance aglycoslated Fc stability and/or solubility by incorporating polar and/or charged residues that face inward towards the Cg2-Cg2 dimer axis, and by designing amino acid modifications that directly enhance the aglycosylated Fc- Fc ⁇ R interface or the interface of aglycosylated Fc with some other Fc ligand.
  • the Fc variants of the present invention may be combined with other Fc modifications, including but not limited to modifications that alter effector function.
  • the invention encompasses combining an Fc variant of the invention with other Fc modifications to provide additive, synergistic, or novel properties in antibodies or Fc ps ons*, rf .Such «modif ⁇ Gations may e n the CHl 5 CH2, or CH3 domains or a combination thereof.
  • the Fc variants of the invention enhance the property of the modification with which they are combined. For example, if an Fc variant of the invention is combined with a mutant known to bind Fc ⁇ RIIIA with a higher affinity than a comparable molecule comprising a wild type Fc region; the combination with a mutant of the invention results in a greater fold enhancement in Fc ⁇ RIIIA affinity.
  • the Fc variants of the present invention may be combined with other known Fc variants such as those disclosed in Duncan et al, 1988, Nature 332:563-564; Lund et al., 1991, J. Immunol 147:2657-2662; Lund et al, 1992, MoI Immunol 29:53-59; Alegre et al, 1994, Transplantation 57:1537-1543; Hutchins et al. , 1995, Proc Natl. Acad Sci U S A 92: 11980-11984; Jefferis et al, 1995, Immunol Lett.
  • An Fc ⁇ R-Fc binding assay was developed for determining the binding of the molecules of the invention comprising variant Fc regions to Fc ⁇ R, which allowed detection and quantitation of the interaction, despite the inherently weak affinity of the receptor for its ligand, e.g., in the micromolar range for Fc ⁇ RIIB and Fc ⁇ RIIIA.
  • the method involves the formation of an Fc ⁇ R complex that has an improved avidity for an Fc region, relative to an uncomplexed Fc ⁇ R.
  • the preferred molecular complex is a tetrameric immune complex, comprising: (a) the soluble region of Fc ⁇ R (e.g., the soluble region of Fc ⁇ RIIIA, Fc ⁇ RIIA or Fc ⁇ RIIB); (b) a biotinylated 15 amino acid AVITAG sequence (AVITAG) operably linked to the C-terminus of the soluble region of Fc ⁇ R (e.g., the soluble region of Fc ⁇ RIIIA, Fc ⁇ RIIA or Fc ⁇ RIIB); and (c) streptavidin-phycoerythrin (SA-PE); in a molar ratio to form a tetrameric Fc ⁇ R complex (preferably in a 5: 1 molar ratio).
  • AVITAG biotinylated 15 amino acid AVITAG sequence
  • the fusion protein is biotinylated enzymatically, using for example, the E.coli Bir A enzyme, a biotin ligase which specifically biotinylates a lysine residue in the 15 amino acid AVITAG sequence.
  • the E.coli Bir A enzyme a biotin ligase which specifically biotinylates a lysine residue in the 15 amino acid AVITAG sequence.
  • qf the invention 85% of the fusion protein is biotinylated, as determined by standard methods known to those skilled in the art, including but not limited to streptavidin shift assay.
  • the biotinylated soluble Fc ⁇ R proteins are mixed with SA-PE in a IX SA-PE:5X biotinylated soluble Fc ⁇ R molar ratio to form a tetrameric Fc ⁇ R complex.
  • polypeptides comprising Fc regions bind the tetrameric Fc ⁇ R complexes, formed according to the methods of the invention, with at least an 8 -fold higher affinity than the monomeric uncomplexed Fc ⁇ R.
  • the binding of polypeptides comprising Fc regions to the tetrameric Fc ⁇ R complexes may be determined using standard techniques known to those skilled in the art, such as for example, fluorescence activated cell sorting (FACS), radioimmunoassays, ELISA assays, etc.
  • the invention encompasses the use of the immune complexes formed according to the methods described above, for determining the functionality of molecules comprising an Fc region in cell-based or cell-free assays.
  • the reagents may be provided in an assay kit, i.e., a packaged combination of reagents for assaying the ability of molecules comprising variant Fc regions to bind Fc ⁇ R tetrameric complexes.
  • an assay kit i.e., a packaged combination of reagents for assaying the ability of molecules comprising variant Fc regions to bind Fc ⁇ R tetrameric complexes.
  • Other forms of molecular complexes for use in determining Fc-Fc ⁇ R interactions are also contemplated for use in the methods of the invention, e.g., fusion proteins formed as described in U.S. Provisional Application 60/439,709, filed on January 13, 2003 (Attorney Docket No. 11183-005-888); which is incorporated herein by reference in its entirety.
  • P ⁇ ftpiliifif d herein incorporates u ng ndividual libraries that contain mutants testing all 20 amino acid changes at between 3-6 residues in the Fc region.
  • the complete set of mutations will be assembled in all possible combinations of mutations.
  • the number of independent mutations generated is based on the number of sites being saturated during library assembly (Table 9 below). Library size will determine the choice of primary screen and therefore the choice of vector for initial cloning steps.
  • Table 9 Number of Inde endent mutants based on number of tar eted sites.
  • the instant invention encompasses construction of combinatorial libraries, focusing on a limited number of critical residues (e.g., 3-6). Using a library of randomly mutagenized IgGl Fc and the screening assays described and exemplified herein Fc variants will be identified. In the initial rounds, the best 5 mutations, based on both FcR binding profile and functional activity will be selected. It will take 20 5 individual mutants to cover all possible amino acid changes and their combinations at five locations. A library with at least 10-fold coverage for each mutant will be generated. In addition regions will be chosen based on available information, e.g., crystal structure data, Mouse/Human isotype Fc ⁇ R binding differences, genetic data, and additional sites identified by mutagenesis.
  • the biggest disadvantage of current site directed mutagenic protocols is production of bias populations, over-representing variations in some regions and under- representing or completely lacking mutations in others.
  • the present invention overcomes this problem by generating unbiased arrays of desirable Fc mutants using a well-developed gene building technology to eliminate the bias introduced in library construction by PCR based approaches such as overlapping PCR and inverted PCR.
  • the key distinctions of the approach of the present invention are: 1) Employment of equimolar mix of 20 individual oligos for every targeted codon instead of degenerated primers. This way each amino acid is represented by a single, most used codon, whereas degenerated primers over represent those amino acids encoded by more codons over those encoded by fewer codons. 2) Building mutants by a chain replacement approach. This insures unbiased introduction of all desirable changes into the final product.
  • An exemplary protocol comprises of the following steps: 1) phosphorylated oligos, representing desirable changes at one or several locations, all complementary to the same strand, added to the template along with a thermostable, 5'>3' exonuclease deficient, DNA polymerase and ligase (FIG. 27 a). 2) assembled mix undergoes a number of ⁇ IQlSPJi ⁇ iffiatiefli/ljgiaitipqi-ipycles, sufficient to generate desirable amount of product.
  • PCR amplified fragments will be analyzed by electrophoresis to determine the length of the final PCR products. The reaction will be characterized as successful if >99% of the PCR products are of the expected length.
  • the final library will be cloned into an expression vector. A fraction of the mutant library will be sequenced to determine the rate of mutant codon incorporation. The number of fragments sequenced will be based on the number of target sites mutated and library validation will be determined by the observed rate of mutation at targeted sites (Table 10).
  • the rate of vector without inserts should be less than 2 %.
  • the rate of mutation at non-targeted sites should be less than 8%. Libraries containing clones with >90% correct inserts will allow us to maintain screening timelines. TABLE 10 Expected rates of Mutation for Libraries
  • the invention encompasses overlapping or inverted PCR for construction of libraries.
  • individual primers for each codon will be used rather than degenerative primers.
  • a similar validation scheme as disclosed supra will be employed.
  • Robotic liquid handlers will be employed to set up oligos for synthesis of full length Fc mutants and ligation reactions for incorporating the mutant Fes into antibody heavy chain expression vectors will be set up. After ligation it is estimated that it would take 1 FTE ⁇ 10 days to array the library clones and generate -8000 minipreps, equivalent to a combinatorial library saturated at 3 sites. Subsequent to bacterial transformation a Qpix-2 clone picker robot will be used for picking colonies into 96 deep well plates. Culture growth will be done using a magnetic levitation stirrer, capable of incubating 12 plates and resulting in dense growth in 12 -16 hr at 37° C. A Qiagen miniprep robot will be used to perform DNA preps at the rate of 4 96 well plates in 2.5 hrs. By overlapping tasks 5 such libraries could be constructed in 9 months with 1 FTE
  • Affinity maturation requires the assembly of a new set of combinations of mutations, from a preselected mutant pool or members of a gene family, which can be enriched by a selection protocol. The process is repeated several times until the isolation of a mutant with the desired phenotype is achieved.
  • the disadvantage of the current enzymatic approach, DNA shuffling, to accomplish this process is bias which can be introduced due to specific sites within gene that are hot spots for nucleases, dominance of specific mutants in the final reassembled pool and loss of some of the original mutants in the final pool.
  • a build-a-gene (BAG) technology will be used to generate a highly complex library of Fc mutants containing random amino acid changes at all potential locations that may be important for receptor(s) binding.
  • Sets of degenerated oligos covering specific regions of the IgG Fc will be used (See FIG. 28).
  • Oligos will be -30 nt and and degenerate oligos synthesized to change one (4 oligos) or two AAs (8 oligos) will be constructed. The oligos are designed to be overlapping with no gaps. It will take ⁇ 200 oligos to accommodate all single AA changes and -2000 to change two AAs per oligonucleotide.
  • All 2000+ oligos will be used individually and in combinations to generate arrays of Fc mutants using the protocol outlined above (A.20).
  • Large libraries will be cloned into vectors that will allow for screening using yeast surface display. This approach utilizes a magnetic bead selection followed by flow cytometry and has been successfully applied to libraries with a complexity >10 9 (Feldhaus et al., 2003, Nat. ⁇ j2j.(% »163nl'(7Q; which is incorporated herein by reference in its entirety). This limits the number of sites to test at any one pool to 7, resulting in ⁇ 1.3 x 10 9 possible mutations/pool.
  • PCR amplified fragments will be analyzed by electrophoresis to determine the length of the final PCR products. The reaction will be characterized as successful if >99% of the PCR products are of the expected length. A fraction of the mutant library will be sequenced to determine the rate of mutant codon incorporation. The number of fragments sequenced will be based on the number of target sites mutated and library validation will be determined by the observed rate of mutation at targeted sites (Table 10). The rate of vectors without inserts should be less than 2 %. The rate of mutation at non-targeted sites should be less than 8%.
  • Fragments will be religated, PCR amplified with nested primers and cloned into the yeast surface display vector, pYDl. The recombined library will be reselected in the yeast Fc display screen as described and exemplified herein.
  • BAG libraries will utilize most of the same equipment as the combinatorial library. However cloning will be in a vector suitable for yeast surface display and will not require arraying of individual clones as the yeast surface display will initially be employed for enrichment of large libraries. Subsequent to the appropriate level of enrichment individual clones will be arrayed.
  • An initial library of molecules comprising variant Fc regions is produced using any random based mutagenesis techniques known in the art. It will be appreciated by one of skill in the art that amino acid sequence variants of Fc regions may be obtained by any mutagenesis technique known to those skilled in the art. Some of these techniques are briefly described herein, however, it will be recognized that alternative procedures may produce an equivalent result.
  • molecules of the invention comprising variant Fc regions are prepared by error-prone PCR as exemplified in Example 6, infra ⁇ See Leung et al. , 1989, Technique, 1:11). It is especially preferred to have error in the methods of the invention. In one embodiment, using error prone PCR a mutation frequency of 2-3 mutations/kb is obtained.
  • Mutagenesis may be performed in accordance with any of the techniques known in the art including, but not limited to, synthesizing an oligonucleotide having one or more modifications within the sequence of the Fc region of an antibody or a polypeptide comprising an Fc region (e.g., the CH2 or CH3 domain) to be modified.
  • Site-specific mutagenesis allows the production of mutants through the use of specific oligonucleotide sequences which encode the DNA sequence of the desired mutation, as well as a sufficient number of adjacent nucleotides, to provide a primer sequence of sufficient size and sequence complexity to form a stable duplex on both sides of the deletion junction being traversed.
  • a primer of about 30 to about 45 nucleotides or more in length is preferred, with about 10 to about 25 or more residues on both sides of the junction of the sequence being altered.
  • a number of such primers introducing a variety of different mutations at one or more positions may be used to generated a library of mutants.
  • site-directed mutagenesis is performed by first obtaining a single-stranded vector or melting apart of two strands of a double stranded vector which includes within its sequence a DNA sequence which encodes the desired peptide.
  • An oligonucleotide primer bearing the desired mutated sequence is prepared, generally synthetically.
  • This primer is then annealed with the single-stranded vector, and subjected to DNA polymerizing enzymes such as T7 DNA polymerase, in order to complete the synthesis of the mutation-bearing strand.
  • T7 DNA polymerase DNA polymerizing enzymes
  • a heteroduplex is formed wherein one strand encodes the original non-mutated sequence and the second strand bears the desired mutation.
  • This heteroduplex vector is then used to transform or transfect appropriate cells, such as E.
  • coli cells, and clones are selected which include recombinant vectors bearing the mutated sequence arrangement.
  • the technique typically employs a phage vector which exists in both a single stranded and double stranded form.
  • Typical vectors useful in site-directed mutagenesis include vectors such as the Ml 3 phage. These phage are readily commercially available and their use is generally well known to those skilled in the art.
  • Double stranded plasmids are also routinely employed in site directed mutagenesis which eliminates the step of transferring the gene of interest from a plasmid to a phage.
  • PCRTM with commercially available thermostable enzymes such as Taq DNA polymerase may be used to incorporate a mutagenic ⁇ ⁇ ⁇ sr ⁇ eo e-pTOer into an amp ie ragment t at can then be cloned into an appropriate cloning or expression vector.
  • thermostable enzymes such as Taq DNA polymerase
  • thermostable ligase employing a thermostable ligase in addition to a thermostable polymerase may also be used to incorporate a phosphorylated mutagenic oligonucleotide into an amplified DNA fragment that may then be cloned into an appropriate cloning or expression vector (see e.g., Michael, Biotechniques, 16(3):410-2, 1994, which is hereby incorporated by reference in its entirety)
  • Another method for preparing variants for use in the invention is cassette mutagenesis based on the technique described by Wells et al. (1985, Gene, 34: 315).
  • the starting material is the plasmid comprising the desired DNA encoding the protein to be mutated (e.g., the DNA encoding a polypeptide comprising an Fc region).
  • the codon(s) in the DNA sequence to be mutated are identified; there must be a unique restriction endonuclease site on each side of the identified mutations site(s). If no such restriction site exits, it may be generated by oligonucleotide directed mutagenesis. After the restriction sites have been introduced into the plasmid, the plasmid is cut at these sites and linearized.
  • a double-stranded oligonucleotide encoding the sequence of the DNA between the restriction sites but containing the mutation is synthesized using standard procedures known to those skilled in the art.
  • the double stranded oligonucleotide is referred to as the cassette.
  • This cassette is designed to have 3' and 5' ends that are compatible with the ends of the linearized plasmid, such that it can be directly ligated to the plasmid.
  • Other methods known to those of skill in the art for producing sequence variants of the Fc region of an antibody or polypeptides comprising an Fc region can be used. For example, recombinant vectors encoding the amino acid sequence of the constant domain of an antibody or a fragment thereof may be treated with mutagenic agents, such as hydroxylamine, to obtain sequence variants.
  • the mutagenized library is transformed into a yeast strain, preferably EBYlOO (Invitrogen), MATa ura3-52 trpl leu2 ⁇ l his3A200 pep4::HIS3 prbl ⁇ 1.6R canl GAL:: G AL-AG Al using a standard lithium acetate transformation protocol known to those skilled in the art (ref).
  • EBYlOO Invitrogen
  • GAL G AL-AG Al using a standard lithium acetate transformation protocol known to those skilled in the art (ref).
  • yeast surface display technology for review see Boder and Wittrup, 2000, Methods in Enzymology, 328: 430-444, which is incorporated herein by reference in its entirety
  • yeast surface display is a genetic method whereby polypeptides comprising Fc mutants are expressed on the yeast cell wall in a form accessible for interacting with Fc ⁇ R.
  • Yeast surface display of the mutant Fc containing polypeptides of the invention may be performed in accordance with any of the techniques known to those skilled in the art. See U.S. Patent No.'s 6,423,538; 6,114,147; and 6,300,065, all of which are incorporated herein by reference in their entirety. See Boder et al, 1991 Nat. Biotechnol, 15:553-7; Boder et al, 1998 Biotechnol. Prog., 14:55-62; Boder Qt al, 2000 Methods Enzymol, 328:430-44; Boder et al, 2000 Proc. Natl. Acad.
  • Yeast Surface Display will be used to enrich libraries containing >10 7 independent clones. This approach will provide the ability to enrich large libraries >20-fold in single sort. Fc mutant libraries with > 10,000 independent mutants (4 or more sites) will be cloned into the appropriate vectors for yeast surface display and enriched by FACS sorting until ⁇ 8000 mutants are able to be tested by other biochemical and functional assays as described below.
  • the invention provides methods for constructing an Fc mutant library in yeast for displaying molecules comprising Fc regions, which have been mutated as described in Section 5.2.2.
  • the Fc mutant libraries for use in the methods of the invention contain at least 10 7 cells, up to 10 9 cells.
  • One exemplary method for constructing a Fc library for use in the methods of the invention comprises the following: nucleic acids eM ⁇ dingi.moligsGijil f i S iP ⁇ niipr s ng Fc reg ons are cloned into t e mu t ple cloning site of a vector derived from a yeast replicating vector, e.g., pCT302; such that the Fc encoding nucleic acids are expressed under the control of the GALl galactose-inducible promoter and in-frame with a nucleotide sequence encoding Aga2p, the mating agglutinin cell wall protein.
  • nucleic acids encoding molecules comprising Fc regions are cloned C-terminal to the Aga2p coding region, such that a Fc-region Aga2p fusion protein is encoded.
  • a fusion protein comprising the Aga2p protein and polypeptides comprising Fc regions will be secreted extracellularly and displayed on the cell wall via disulfide linkage to the Agalp protein, an integral cell wall protein, using the preferred construct of the invention.
  • the constructs may further comprise nucleotide sequences encoding epitope tags.
  • Any epitope tag nucleotide coding sequence known to those skilled in the art can be used in accordance with the invention, including, but not limited to nucleotide sequences encoding hemagglutinin (HA), c-myc Xpress TAG, His - TAG, or V5TAG.
  • HA hemagglutinin
  • c-myc Xpress TAG His - TAG
  • V5TAG V5TAG.
  • the presence of the fusion protein on the yeast cell surface may be detected using FACS analysis, confocal fluorescence microscopy or standard immunostaining methods, all of which are known to those skilled in the art.
  • the presence of the Fc fusion proteins of the invention on the yeast cell surface are detected using Fc-specific monoclonal antibodies (CH3 specific), including but not limited to IgGl Fc-specific monoclonal antibody, HP6017 (Sigma), JL512 (Immunotech), and any antibody disclosed in Partridge et ah, 1986, Molecular Immunology, 23 (12): 1365- 72, which is incorporated herein by reference in its entirety.
  • the presence of the Fc fusion proteins of the invention are detected by immunofluorescent labeling of epitope tags using techniques known to those skilled in the art.
  • nucleotide sequences encoding epitope tags to flank the nucleic acids encoding the Fc fusion proteins, as an internal control, to detect if the fusion proteins are displayed on the cell wall in a partially proteolyzed form.
  • the invention encompasses screening the yeast display libraries using immunological based assays including but not limited to cell based assays, solution based assays, and solid phase based assays.
  • the invention encompasses identification of Fc mutants with altered Fc ⁇ R affinities using affinity maturation methods which are known to those skilled in the art and encompassed herein. Briefly, affinity maturation creates novel alleles by randomly recombining individual mutations present in a mutant library, see, e.g., ⁇ mkim:,ePuk-l9 ⁇ MoI. Biol. 226: 889-896; Stemmer et al, 1994 Nature, 370: 389-91; both of which are incorporated herein by reference in their entireties. It has been used successfully to increase the affinity of antibodies, T cell receptors and other proteins.
  • the invention encompasses using mutations that show increased Fc ⁇ R binding as a baseline to construct new mutant libraries with enhanced phenotypes.
  • a population of IgGl Fc mutants enriched by yeast surface display for increased binding to an Fc ⁇ R, e.g., Fc ⁇ RIIIA may be selected.
  • Fc regions can be amplified by PCR using flanking primers that selectively amplify the mutated region of the Fc, which is about ⁇ 700 bp using methods known to one skilled in the art and exemplified or disclosed herein.
  • Novel mutants can thus be constructed by reshuffling of mutations in the Fc region for example via DNAseI treatment of the amplified DNA and isolation of fragments using methods such as those disclosed by Stemmer et al. , 1994 Pr oc. Natl. Acad. Sci. USA 91: 10747-51, which is incorporated herein by reference in its entirety. Fragments can then be religated, PCR amplified with nested primers and cloned into the yeast display vector, e.g., pYDl using methods known to one skilled in the art. The recombined library can then be reselected in the yeast Fc display screen.
  • the invention encompasses a kinetic screen of the yeast library.
  • a kinetic screen may be established by labeling of the Fc displaying cells to saturation with a labeled ligand, e.g., a fluorescent ligand followed by incubation with an excess of non-labeled ligand for a predetermined period.
  • the in vitro recombination process can be repeated. In some embodimnets, the in vitro is repeated at least 3 times.
  • Selection of the Fc variants of the invention may be done using any Fc ⁇ R including but not limited to polymorphic variants of Fc ⁇ R.
  • selection of the Fc variants is done using a polymorphic variant of Fc ⁇ RIIIA which contains a phenylalanine at position 158.
  • selection of the Fc variants is done using a polymorphic variant of Fc ⁇ RIIIA which contains a valine at position 158.
  • Fc ⁇ RIIIA 158V displays a higher affinity for IgGl than 158F and an increased ADCC activity ⁇ see, e.g., Koene et al, 1997, Blood, 90:1109-14; Wu et al, 1997, J Clin.
  • humanized anti-CD20 monoclonal antibody Rituximab was therapeutically more effective in Fc ⁇ RIIIA158V homozygous patients compared to Fc ⁇ RIIIA 158F homozygous patients (See, e.g., Cartron et al, 2002 Blood, 99(3): 754-8).
  • selection of Fc variants of the invention with Fc ⁇ RIIIA 158F allotype may provide for variants that once engineered into therapeutic antibodies will be clinically more efficacious for Fc ⁇ RIIIA 158F homozgous patients.
  • the invention encompasses screening yeast libraries based on Fc ⁇ RIIB depletion and Fc ⁇ RIIIA selection so that Fc mutants are selected that not only have an enhanced affinity for Fc ⁇ RIIIIA but also have a reduced affinity for Fc ⁇ RIIB.
  • Yeast libraries may be enriched for clones that have a reduced affinity for Fc ⁇ RIIB by sequential depletion methods, for example, by incubating the yeast library with magnetic beads coated with Fc ⁇ RIIB.
  • Fc ⁇ RIIB depletion is preferrably carried out sequentially so that the library is enriched in clones that have a reduced affmcity for Fc ⁇ RIIB.
  • the Fc ⁇ RIIB depletion step results in a population of cells so that only 30% , preferably only 10%, more preferably only 5%, most preferably less than 1% bind Fc ⁇ RIIB. In some embodiments, Fc ⁇ RIIB depletion is carried out in at least 3 cycles, at least 4 cycles, at least 6 cycles.
  • the Fc ⁇ RIIB depletion step is preferrably combined with an Fc ⁇ RIIIIA selection step, for example using FACS sorting so that Fc variants with an enhanced affinity for Fc ⁇ RIIIIA are selected.
  • the invention encompasses characterization of the mutant Fc fusion proteins that are displayed on the yeast surface cell wall, according to the methods described in Section 5.2.3.
  • One aspect of the invention provides a method for selecting mutant Fc fusion proteins with a desirable binding property, specifically, the ability of the mutant Fc fusion protein to bind Fc ⁇ RIIIA and/or Fc ⁇ RIIA with a greater affinity than a comparable polypeptide comprising a wild-type Fc region binds Fc ⁇ RIIIA and/or Fc ⁇ RIIA.
  • the invention provides a method for selecting mutant Fc fusion proteins with a desirable binding property, specifically, the ability of the mutant Fc fusion protein to bind Ec,mIEA'and/ ⁇ r:i.F ⁇ yimA with a greater affinity than a comparable polypeptide comprising a wild-type Fc region binds Fc ⁇ RIIIA and/or Fc ⁇ RIIA, and further the ability of the mutant Fc fusion protein to bind Fc ⁇ RIIB with a lower affinity than a comparable polypeptide comprising a wild-type Fc region binds Fc ⁇ RIIB.
  • Yeast cells displaying the mutant Fc fusion proteins can be screened and characterized by any biochemical or immunological based assays known to those skilled in the art for assessing binding interactions.
  • FACS fluorescence activated cell sorting
  • Flow sorters are capable of rapidly examining a large number of individual cells that contain library inserts (e.g., 10-100 million cells per hour) (Shapiro et al, Practical Flow Cytometry, 1995).
  • ligand concentration i.e., Fc ⁇ RIIIA tetrameric complex
  • kinetic competition time e.g., FACS stringency
  • FACS stringency may be varied in order to select for the cells which display Fc fusion proteins with specific binding properties, e.g., higher affinity for Fc ⁇ RIIIA compared to a comparable polypeptide comprising a wild-type Fc region.
  • Flow cytometers for sorting and examining biological cells are well known in the art. Known flow cytometers are described, for example, in U.S. Patent Nos.
  • yeast cells are analyzed by fluorescence activated cell sorting (FACS).
  • FACS fluorescence activated cell sorting
  • the FACS analysis of the yeast cells is done in an iterative manner, at least twice, at least three times, or at least 5 times. Between each round of selection cells are regrown and induced so the Fc regions are displayed on the maxinum number of yeast cell surfaces.
  • this iterative process helps enrich the population of the cells with a particular phenotype, e.g. , high binding to Fc ⁇ RIIIA.
  • screening for Fc variants of the invention comprises a selection process that has multiple rounds of screening, e.g., at least two rounds ,
  • screening for Fc variants that have an enhanced affinity for Fc ⁇ RIIIA may comprise the following steps: in the first round of screening, a library of yeast cells, e.g., a na ⁇ ve library of 10 7 cells is enriched by FACS 5 preferably in an iterative manner, using for example labeled tetrameric Fc ⁇ RIIIA to select for Fc variants that have an enhanced affinity for Fc ⁇ RIIIA; the variant Fc region that is selected with the desired phenotype, e.g., enhanced binding to Fc ⁇ RIIIA, is then introduced into an antibody, e.g., a 4-4-20 antibody, and the enginereed antibody is assayed using a secondary screen, e.g., ELISA for binding to an Fc ⁇ R.
  • a secondary screen e.g., ELISA for binding to an Fc ⁇ R.
  • a single mutation library may be generated based on the first screen so that the Fc region harbors the variant displaying the enhanced affinity for Fc ⁇ RIIIA; and enriched by FACS using for example labeled monomeric Fc ⁇ RIIIA in both the presence and absence of unlabeled receptor; and the variant Fc region is then introduced into an antibody, e.g., a, 4-4-20 antibody, and the enginereed antibody is assayed using a secondary screen, e.g., ELISA for binding to an Fc ⁇ R.
  • the secondary screen may further comprise characterizing the antibodies comprising Fc variants in an ADCC or BIAcore based assay using methods disclosed herein
  • the invention encompasses FACS screening of the mutant yeast library under equilibrium or kinetic conditions.
  • Fc ⁇ RIIIA preferably labeled Fc ⁇ RIIIA at a concentration 5-10 fold below the Kd, for at least one hour to allow binding of Fc mutants to Fc ⁇ RIIIA under equilbrium conditions.
  • the mutant yeast library is incubated with labeled Fc ⁇ RIIIA; the cells are then incubated with equimolar unlabeled Fc ⁇ RIIIA for a pre-selected time, bound Fc ⁇ RIIIA is then monitored.
  • One exemplary method of analyzing the yeast cells expressing mutant Fc fusion proteins with FACS is costaining the cells with Fc ⁇ RIIIA-tetrameric complex which has been labeled with a fluorescent label such as, PE and an anti-Fc antibody, such as F(ab) 2 anti-Fc which has been fluorescently labeled.
  • Fluorescence measurements of a yeast library produced according to the methods of the invention preferably involves comparisons with controls; for example, yeast cells that lack the insert encoding molecules comprising an Fc region (negative control).
  • the flow sorter has the ability not only to measure fluorescence signals in cells at a rapid rate, but also to collect cells that have specified fluorescent properties.
  • This feature may be employed in a preferred embodiment of the invention to enrich the initial library population for cells expressing Fc fusion proteins with specific ⁇ hijadinj
  • yeast cells are analyzed by FACS and sort gates established to select for cells that show the highest affinity for Fc ⁇ RIIIA relative to the amount of Fc expression on the yeast cell surface. According to a preferred embodiment, four consecutive sorts are established, wherein the gates for each successive sort is 5.5%, 1%, 0.2%, and 0.1%.
  • the yeast display library formed according to the methods of the invention be over-sampled by at least 10-fold to improve the probability of isolating rare clones (e.g., analyze ⁇ 10 8 cells from a library of 10 7 clones).
  • 2-5 sorts are established to select for cells of the desired phenotype. Sort gates can be established empirically by one skilled in the art.
  • mutant Fc fusion proteins displayed on the yeast cell surface are screened using solid phase based assays, for example assays using magnetic beads, e.g. , supplied by Dynal, preferably in a high through put manner for binding to an Fc ⁇ R, e.g., Fc ⁇ RIIIA.
  • magnetic bead assays may be used to identify mutants with enhanced affinity for Fc ⁇ RIIIA and/or reduced affinity for Fc ⁇ RIIB.
  • An exemplary assay to identify mutants with enhanced affinity for Fc ⁇ RIIIA and reduced affinity for Fc ⁇ RIIB may comprise selecting mutants by a sequential solid phase depletion using magnetic beads coated with Fc ⁇ RIIB followed by selection with magnetic beads coated with Fc ⁇ RIIIA.
  • one assay may comprise the following steps: incubating the library of yeast cells generated in accordance with the methods of the invention with magnetic beads coated with Fc ⁇ RIIB; separating yeast cells bound to beads from the non bound fraction by placing the mixture in a magnetic field, removing the non- bound yeast cells and placing them in a fresh media; binding the yeast cells to beads coated with Fc ⁇ RIIIA, separating yeast cells bound to beads from the non bound fraction by placing the mixture in a magnetic field, removing the non-bound yeast cells; removing the bound cells by rigorous vortexing; growing the recovered cells in glucose containing media; re-inducing in selective media containing galactose. The selection process is repeated at least once. Inserts containing the Fc domain are then amplified using common methodologies known in the art, e.g., PCR, and introduced into an antibody by methods already described for further characterization.
  • a non-yeast based system is used to characterize the binding properties of the molecules of the invention.
  • One exemplary system for characterizing the molecules of the invention comprises a mammalian expression vector containing the heavy chain of the anti-fluorescein monoclonal antibody 4-4-20, into whiehiAeip ⁇ ct ⁇ r ⁇ acids' encoding the molecules of the invention with variant Fc regions are cloned.
  • the resulting recombinant clone is expressed in a mammalian host cell line (i.e., human kidney cell line 293H), and the resulting recombinant immunoglobulin is analyzed for binding to Fc ⁇ R using any standard assay known to those in the art, including but not limited to ELISA and FACS.
  • a mammalian host cell line i.e., human kidney cell line 293H
  • the resulting recombinant immunoglobulin is analyzed for binding to Fc ⁇ R using any standard assay known to those in the art, including but not limited to ELISA and FACS.
  • Molecules of the present invention may be characterized in a variety of ways.
  • molecules of the invention comprising modified Fc regions may be assayed for the ability to immunospecifically bind to a ligand, e.g., Fc ⁇ RIIIA tetrameric complex.
  • a ligand e.g., Fc ⁇ RIIIA tetrameric complex.
  • Such an assay may be performed in solution (e.g., Houghten, Bio/Techniques, 13:412-421, 1992), on beads (Lam, Nature, 354:82-84, 1991, on chips (Fodor, Nature, 364:555-556, 1993), on bacteria (U.S. Patent No. 5,223,409), on spores (U.S. Patent Nos.
  • Molecules that have been identified to immunospecifically bind to an ligand e.g., Fc ⁇ RIIIA can then be assayed for their specificity and affinity for the ligand.
  • Fc regions e.g., therapeutic antibodies
  • have been identified in the yeast display system to have the desired phenotype see Section 5.1
  • an antigen e.g., cancer antigen and cross-reactivity with other antigens (e.g., Fc ⁇ R) by any method known in the art.
  • Immunoassays which can be used to analyze immunospecific binding and cross-reactivity include, but are not limited to, competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, to name but a few.
  • competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays,
  • the binding affinity of the molecules of the present invention comprising modified Fc regions to a ligand, e.g., Fc ⁇ R tetrameric complex and the off-rate of the interaction can be determined by competitive binding assays.
  • a competitive binding assay is ⁇ a radioimmunoassay compr s ng t e ncu ation of labeled ligand, such as tetrameric Fc ⁇ R (e.g., 3 H or 125 I) with a molecule of interest (e.g., molecules of the present invention comprising modified Fc regions) in the presence of increasing amounts of unlabeled ligand, such as tetrameric Fc ⁇ R, and the detection of the molecule bound to the labeled ligand.
  • BIAcore kinetic analysis is used to determine the binding on and off rates of molecules of the present invention to a ligand such as Fc ⁇ R.
  • BIAcore kinetic analysis comprises analyzing the binding and dissociation of a ligand from chips with immobilized molecules (e.g., molecules comprising modified Fc regions) on their surface.
  • any of a variety of sequencing reactions known in the art can be used to directly sequence the molecules of the invention comprising variant Fc regions.
  • Examples of sequencing reactions include those based on techniques developed by Maxim and Gilbert (Proc. Natl. Acad. ScI USA, 74:560, 1977) or Sanger (Proc. Natl. Acad. Sci. USA, 74:5463, 1977).
  • any of a variety of automated sequencing procedures can be utilized (Bio/Techniques, 19:448, 1995), including sequencing by mass spectrometry (see, e.g., PCT Publication No. WO 94/16101, Cohen et ah, Adv. Chromatogr., 36:127-162, 1996, and Griffin et al., Appl. Biochem. Biotechnol. , 38:147-159, 1993).
  • the invention encompasses characterization of the molecules of the invention (e.g., an antibody comprising a variant Fc region identified by the yeast display technology described supra; or therapeutic monoclonal antibodies engineered according to the methods of the invention) using assays known to those skilled in the art for identifying the effector cell function of the molecules.
  • the invention encompasses characterizing the molecules of the invention for Fc ⁇ R-mediated effector cell function. Examples of effector cell functions that can be assayed in accordance with the invention, include but are not limited to, antibody-dependent cell mediated cytotoxicity, phagocytosis, opsonization, opsonophagocytosis, CIq binding, and complement dependent cell mediated cytotoxicity.
  • any cell-based or cell free assay known to those skilled in the art for determining effector cell function activity can be used (For effector cell assays, see Perussia et al, 2000, Methods MoI. Biol. 121: 179-92; Baggiolini et al, 1998 Experientia, 44(10): '84fc maa»eft ⁇ L-a000 j ; Immuno . et o s, - : 229-42; Brown EJ. , Methods Cell Biol, 45: 147-64; Munn et al, 1990 J. Exp. Med, 172: 231-237, Abdul-Majid et al, 2002 Scand J. Immunol. 55: 70-81; Ding et al, 1998, Immunity 8:403-411, each of which is incorporated by reference herein in its entirety).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Oncology (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2006/031201 2005-08-10 2006-08-10 Identification and engineering of antibodies with variant fc regions and methods of using same Ceased WO2007021841A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
JP2008526195A JP5105485B2 (ja) 2005-08-10 2006-08-10 変異型Fc領域を有する抗体の同定および工学的改変およびその使用方法
ES06801146.9T ES2526811T3 (es) 2005-08-10 2006-08-10 Identificación y modificación de anticuerpos con regiones Fc variantes y métodos de uso de estos
DK06801146.9T DK1919503T3 (en) 2005-08-10 2006-08-10 Identification and preparation of antibodies with variant fc regions and methods of use thereof
PL06801146T PL1919503T3 (pl) 2005-08-10 2006-08-10 Identyfikacja i inżynieria przeciwciał ze zmiennymi regionami FC oraz sposoby ich stosowania
AU2006279945A AU2006279945B2 (en) 2005-08-10 2006-08-10 Identification and engineering of antibodies with variant FC regions and methods of using same
EP06801146.9A EP1919503B1 (en) 2005-08-10 2006-08-10 Identification and engineering of antibodies with variant fc regions and methods of using same
CA2618681A CA2618681C (en) 2005-08-10 2006-08-10 Identification and engineering of antibodies with variant fc regions and methods of using same
SI200631873T SI1919503T1 (sl) 2005-08-10 2006-08-10 Identifikacija in inĺ˝eniring protiteles z variantnimi fc regijami in postopki za njih uporabo
IL189263A IL189263B (en) 2005-08-10 2008-02-04 Identification and engineering of antibodies with variant fc regions and methods of using same
CY20141101083T CY1115879T1 (el) 2005-08-10 2014-12-23 ΤΑΥΤΟΠΟΙΗΣΗ ΚΑΙ ΚΑΤΑΣΚΕΥΗ ΑΝΤΙΣΩΜΑΤΩΝ ΜΕ ΠΑΡΑΛΛΑΓΜΕΝΑ ΤΜΗΜΑΤΑ Fc ΚΑΙ ΜΕΘΟΔΟΥΣ ΧΡΗΣΗΣ ΤΟΥΣ

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US70741905P 2005-08-10 2005-08-10
US60/707,419 2005-08-10

Publications (3)

Publication Number Publication Date
WO2007021841A2 true WO2007021841A2 (en) 2007-02-22
WO2007021841A3 WO2007021841A3 (en) 2009-06-18
WO2007021841A9 WO2007021841A9 (en) 2009-08-20

Family

ID=37758158

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2006/031201 Ceased WO2007021841A2 (en) 2005-08-10 2006-08-10 Identification and engineering of antibodies with variant fc regions and methods of using same

Country Status (15)

Country Link
US (2) US8217147B2 (https=)
EP (2) EP2573114B1 (https=)
JP (1) JP5105485B2 (https=)
AU (1) AU2006279945B2 (https=)
CA (1) CA2618681C (https=)
CY (2) CY1115879T1 (https=)
DK (2) DK2573114T3 (https=)
ES (2) ES2526811T3 (https=)
HU (1) HUE029465T2 (https=)
IL (1) IL189263B (https=)
LT (1) LT2573114T (https=)
PL (2) PL2573114T3 (https=)
PT (2) PT1919503E (https=)
SI (2) SI2573114T1 (https=)
WO (1) WO2007021841A2 (https=)

Cited By (93)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008019199A2 (en) 2006-06-26 2008-02-14 Macrogenics, Inc. FCγRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF
WO2008105886A2 (en) 2006-05-26 2008-09-04 Macrogenics, Inc. HUMANIZED FCγRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF
WO2009123894A2 (en) 2008-04-02 2009-10-08 Macrogenics, Inc. Her2/neu-specific antibodies and methods of using same
WO2009151717A2 (en) 2008-04-02 2009-12-17 Macrogenics, Inc. Bcr-complex-specific antibodies and methods of using same
WO2010033279A2 (en) 2008-06-04 2010-03-25 Macrogenics, Inc. Antibodies with altered binding to fcrn and methods of using same
JP2011509675A (ja) * 2008-01-18 2011-03-31 メディミューン,エルエルシー 部位特異的コンジュゲーションのためのシステイン操作抗体
WO2011109400A2 (en) 2010-03-04 2011-09-09 Macrogenics,Inc. Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof
WO2012162067A2 (en) 2011-05-21 2012-11-29 Macrogenics, Inc. Cd3-binding molecules capable of binding to human and non-human cd3
EP2573114A1 (en) 2005-08-10 2013-03-27 MacroGenics, Inc. Identification and engineering of antibodies with variant Fc regions and methods of using same
WO2013047729A1 (ja) 2011-09-30 2013-04-04 中外製薬株式会社 標的抗原に対する免疫応答を誘導する抗原結合分子
WO2013047752A1 (ja) 2011-09-30 2013-04-04 中外製薬株式会社 抗原の消失を促進する抗原結合分子
WO2013047748A1 (ja) 2011-09-30 2013-04-04 中外製薬株式会社 複数の生理活性を有する抗原の消失を促進する抗原結合分子
WO2013081143A1 (ja) 2011-11-30 2013-06-06 中外製薬株式会社 免疫複合体を形成する細胞内への運搬体(キャリア)を含む医薬
WO2013100120A1 (ja) 2011-12-28 2013-07-04 中外製薬株式会社 ヒト化抗Epiregulin抗体および当該抗体を有効成分として含む癌治療剤
WO2013147153A1 (ja) 2012-03-29 2013-10-03 株式会社未来創薬研究所 抗lamp5抗体およびその利用
WO2013163630A1 (en) * 2012-04-27 2013-10-31 Bioatla Llc. Modified antibody regions and uses thereof
WO2013180200A1 (ja) 2012-05-30 2013-12-05 中外製薬株式会社 標的組織特異的抗原結合分子
WO2013180201A1 (ja) 2012-05-30 2013-12-05 中外製薬株式会社 会合化した抗原を消失させる抗原結合分子
WO2014083379A1 (en) 2012-11-30 2014-06-05 Institut Pasteur Use of anti-fcyri and/or anti-fcyriia antibodies for treating arthritis, inflammation, thrombocytopenia and allergic shock
WO2014097648A1 (ja) 2012-12-21 2014-06-26 中外製薬株式会社 Gpc3標的治療剤療法が有効である患者に投与されるgpc3標的治療剤
WO2014125041A1 (en) 2013-02-14 2014-08-21 Innate Pharma Treatment of peripheral t cell lymphoma
WO2014208482A1 (ja) 2013-06-24 2014-12-31 中外製薬株式会社 ヒト化抗Epiregulin抗体を有効成分として含む腺癌以外の非小細胞肺癌の治療剤
US8946387B2 (en) 2002-08-14 2015-02-03 Macrogenics, Inc. FcγRIIB specific antibodies and methods of use thereof
US8968730B2 (en) 2002-08-14 2015-03-03 Macrogenics Inc. FcγRIIB specific antibodies and methods of use thereof
US9028815B2 (en) 2003-01-09 2015-05-12 Macrogenics, Inc. Identification and engineering of antibodies with variant FC regions and methods of using same
WO2015083764A1 (ja) 2013-12-04 2015-06-11 中外製薬株式会社 化合物の濃度に応じて抗原結合能の変化する抗原結合分子及びそのライブラリ
US9096877B2 (en) 2009-10-07 2015-08-04 Macrogenics, Inc. Fc region-containing polypeptides that exhibit improved effector function due to alterations of the extent of fucosylation, and methods for their use
WO2015184203A1 (en) 2014-05-29 2015-12-03 Macrogenics, Inc. Tri-specific binding molecules and methods of use thereof
WO2016030488A1 (en) 2014-08-27 2016-03-03 Innate Pharma Treatment of celiac disease
WO2016062851A1 (en) 2014-10-23 2016-04-28 Innate Pharma Treatment of cancers using anti-nkg2a agents
WO2016125495A1 (en) 2015-02-05 2016-08-11 Chugai Seiyaku Kabushiki Kaisha Antibodies comprising an ion concentration dependent antigen-binding domain, fc region variants, il-8-binding antibodies, and uses therof
EP2364996B1 (en) 2002-09-27 2016-11-09 Xencor Inc. Optimized FC variants and methods for their generation
WO2016207273A2 (en) 2015-06-23 2016-12-29 Innate Pharma Multispecific antigen binding proteins
WO2016207278A1 (en) 2015-06-23 2016-12-29 Innate Pharma Multispecific nk engager proteins
WO2017019846A1 (en) 2015-07-30 2017-02-02 Macrogenics, Inc. Pd-1-binding molecules and methods use thereof
WO2017046994A1 (en) 2015-09-18 2017-03-23 Chugai Seiyaku Kabushiki Kaisha Il-8-binding antibodies and uses thereof
US9708408B2 (en) 2006-12-08 2017-07-18 Macrogenics, Inc. Methods for the treatment of disease using immunoglobulins having Fc Regions with altered affinities for FcγRactivating and FcγRinhibiting
US9737599B2 (en) 2006-06-26 2017-08-22 Macrogenics, Inc. Combination of FcγRIIB-specific antibodies and CD20-specific antibodies and methods of use thereof
WO2017157895A1 (en) 2016-03-15 2017-09-21 Innate Pharma Anti-mica antibodies
WO2017159699A1 (en) 2016-03-15 2017-09-21 Chugai Seiyaku Kabushiki Kaisha Methods of treating cancers using pd-1 axis binding antagonists and anti-gpc3 antibodies
US9828429B2 (en) 2007-09-26 2017-11-28 Chugai Seiyaku Kabushiki Kaisha Method of modifying isoelectric point of antibody via amino acid substitution in CDR
US9868948B2 (en) 2008-04-11 2018-01-16 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly
US9896508B2 (en) 2010-03-04 2018-02-20 Macrogenics, Inc. Antibodies reactive with B7-H3 and uses thereof
WO2018073363A1 (en) 2016-10-21 2018-04-26 Innate Pharma Treatment with anti-kir3dl2 agents
WO2018115262A1 (en) 2016-12-23 2018-06-28 Innate Pharma Heterodimeric antigen binding proteins
US10100115B2 (en) 2014-02-14 2018-10-16 Macrogenics, Inc. Methods for the treatment of vascularizing cancers
US10113001B2 (en) 2003-03-03 2018-10-30 Xencor, Inc. Fc variants with increased affinity for FcyRIIc
US10184000B2 (en) 2002-09-27 2019-01-22 Xencor, Inc. Optimized Fc variants and methods for their generation
WO2019059411A1 (en) 2017-09-20 2019-03-28 Chugai Seiyaku Kabushiki Kaisha DOSAGE FOR POLYTHERAPY USING PD-1 AXIS BINDING ANTAGONISTS AND GPC3 TARGETING AGENT
US10253100B2 (en) 2011-09-30 2019-04-09 Chugai Seiyaku Kabushiki Kaisha Therapeutic antigen-binding molecule with a FcRn-binding domain that promotes antigen clearance
WO2019101695A1 (en) 2017-11-21 2019-05-31 Innate Pharma Multispecific antigen binding proteins
US10336818B2 (en) 2004-11-12 2019-07-02 Xencor, Inc. Fc variants with altered binding to FcRn
EP3521312A1 (en) 2013-02-20 2019-08-07 Innate Pharma, S.A. A compound that specifically binds to kir3dl2 for use in the treatment of peripheral t cell lymphoma
EP3557260A1 (en) 2012-12-21 2019-10-23 Chugai Seiyaku Kabushiki Kaisha Gpc3-targeting drug which is administered to patient responsive to gpc3-targeting drug therapy
EP3572431A1 (en) 2014-03-14 2019-11-27 Innate Pharma Humanized antibodies with stability
WO2019234576A1 (en) 2018-06-03 2019-12-12 Lamkap Bio Beta Ltd. Bispecific antibodies against ceacam5 and cd47
US10519234B2 (en) 2014-06-27 2019-12-31 Innate Pharma NKp46 binding proteins
US10618965B2 (en) 2011-02-25 2020-04-14 Chugai Seiyaku Kabushiki Kaisha Method for altering plasma retention and immunogenicity of antigen-binding molecule
WO2020152081A1 (en) 2019-01-22 2020-07-30 Innate Pharma Treatment of t cell lymphoma
WO2020189748A1 (ja) 2019-03-19 2020-09-24 中外製薬株式会社 Mta依存的に抗原に対する結合活性が変化する抗原結合ドメインを含む抗原結合分子及び当該抗原結合ドメイン取得用ライブラリ
US10919953B2 (en) 2012-08-24 2021-02-16 Chugai Seiyaku Kabushiki Kaisha FcgammaRIIB-specific Fc region variant
US10954301B2 (en) 2015-12-14 2021-03-23 Macrogenics, Inc. Bispecific molecules having immunoreactivity with PD-1 and CTLA-4, and methods of use thereof
US10961311B2 (en) 2016-04-15 2021-03-30 Macrogenics, Inc. B7-H3 binding molecules, antibody drug conjugates thereof and methods of use thereof
EP3831849A1 (en) 2019-12-02 2021-06-09 LamKap Bio beta AG Bispecific antibodies against ceacam5 and cd47
US11046784B2 (en) 2006-03-31 2021-06-29 Chugai Seiyaku Kabushiki Kaisha Methods for controlling blood pharmacokinetics of antibodies
WO2021146383A1 (en) 2020-01-17 2021-07-22 BioLegend, Inc. Anti-tlr7 agents and compositions and methods for making and using the same
US11072653B2 (en) 2015-06-08 2021-07-27 Macrogenics, Inc. LAG-3-binding molecules and methods of use thereof
US11078279B2 (en) 2015-06-12 2021-08-03 Macrogenics, Inc. Combination therapy for the treatment of cancer
US11174315B2 (en) 2015-10-08 2021-11-16 Macrogenics, Inc. Combination therapy for the treatment of cancer
US11198739B2 (en) 2004-11-12 2021-12-14 Xencor, Inc. Fc variants with altered binding to FcRn
US11208480B2 (en) 2014-06-27 2021-12-28 Innate Pharma Multispecific antigen binding proteins
US11267868B2 (en) 2013-04-02 2022-03-08 Chugai Seiyaku Kabushiki Kaisha Fc region variant
WO2022093641A1 (en) 2020-10-30 2022-05-05 BioLegend, Inc. Anti-nkg2a agents and compositions and methods for making and using the same
WO2022093640A1 (en) 2020-10-30 2022-05-05 BioLegend, Inc. Anti-nkg2c agents and compositions and methods for making and using the same
WO2022130348A1 (en) 2020-12-18 2022-06-23 Lamkap Bio Beta Ag Bispecific antibodies against ceacam5 and cd47
US11401348B2 (en) 2009-09-02 2022-08-02 Xencor, Inc. Heterodimeric Fc variants
WO2022200525A1 (en) 2021-03-26 2022-09-29 Innate Pharma Multispecific proteins comprising an nkp46-binding site, a cancer antgienge binding site fused to a cytokine for nk cell engaging
US11459378B2 (en) 2017-01-30 2022-10-04 Ohio State Innovation Foundation Passive antibody dependent cell-mediated activation
WO2022258691A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific proteins binding to nkg2d, a cytokine receptor, a tumour antigen and cd16a
WO2022258662A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific proteins binding to nkp46, a cytokine receptor, a tumour antigen and cd16a
WO2022258673A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific antibodies binding to cd20, nkp46, cd16 and conjugated to il-2
WO2022258678A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific proteins binding to nkp30, a cytokine receptor, a tumour antigen and cd16a
US11760807B2 (en) 2014-05-08 2023-09-19 Chugai Seiyaku Kabushiki Kaisha GPC3-targeting drug which is administered to patient responsive to GPC3-targeting drug therapy
US11820830B2 (en) 2004-07-20 2023-11-21 Xencor, Inc. Optimized Fc variants
WO2023242351A1 (en) 2022-06-16 2023-12-21 Lamkap Bio Beta Ag Combination therapy of bispecific antibodies against ceacam5 and cd47 and bispecific antibodies against ceacam5 and cd3
WO2024020051A1 (en) 2022-07-19 2024-01-25 BioLegend, Inc. Anti-cd157 antibodies, antigen-binding fragments thereof and compositions and methods for making and using the same
US11891434B2 (en) 2010-11-30 2024-02-06 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly
WO2024040114A2 (en) 2022-08-18 2024-02-22 BioLegend, Inc. Anti-axl antibodies, antigen-binding fragments thereof and methods for making and using the same
WO2024243217A1 (en) 2023-05-25 2024-11-28 BioLegend, Inc. Ceacam6 binding antibodies and antigen-binding fragments thereof
WO2024251884A1 (en) 2023-06-09 2024-12-12 Innate Pharma Nk cell engager proteins comprising anti-cd20 and ant-nkp46 antibody, linked to il-2 in treatment of r/r b-nhl
US12269876B2 (en) 2012-02-09 2025-04-08 Chugai Seiyaku Kabushiki Kaisha Modified Fc region of antibody
US12492253B1 (en) 2008-02-25 2025-12-09 Xencor, Inc. Anti-human C5 antibodies
US12617847B2 (en) 2010-11-30 2026-05-05 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly

Families Citing this family (85)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8193318B2 (en) * 2002-08-14 2012-06-05 Macrogenics, Inc. FcγRIIB specific antibodies and methods of use thereof
US8530627B2 (en) * 2002-08-14 2013-09-10 Macrogenics, Inc. FcγRIIB specific antibodies and methods of use thereof
US8044180B2 (en) * 2002-08-14 2011-10-25 Macrogenics, Inc. FcγRIIB specific antibodies and methods of use thereof
US8187593B2 (en) * 2002-08-14 2012-05-29 Macrogenics, Inc. FcγRIIB specific antibodies and methods of use thereof
US7960512B2 (en) 2003-01-09 2011-06-14 Macrogenics, Inc. Identification and engineering of antibodies with variant Fc regions and methods of using same
CA2565874C (en) * 2004-05-10 2017-10-03 Macrogenics, Inc. Humanized fc.gamma.riib-specific antibodies and methods of use thereof
AU2005335714B2 (en) * 2004-11-10 2012-07-26 Macrogenics, Inc. Engineering Fc antibody regions to confer effector function
US20070135620A1 (en) * 2004-11-12 2007-06-14 Xencor, Inc. Fc variants with altered binding to FcRn
US8802820B2 (en) * 2004-11-12 2014-08-12 Xencor, Inc. Fc variants with altered binding to FcRn
US8546543B2 (en) 2004-11-12 2013-10-01 Xencor, Inc. Fc variants that extend antibody half-life
EP1674479A1 (en) * 2004-12-22 2006-06-28 Memorial Sloan-Kettering Cancer Center Modulation of Fc Gamma receptors for optimizing immunotherapy
US20110123440A1 (en) * 2005-03-29 2011-05-26 Genevieve Hansen Altered Antibody FC Regions and Uses Thereof
AU2006232287B2 (en) 2005-03-31 2011-10-06 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
US9963510B2 (en) * 2005-04-15 2018-05-08 Macrogenics, Inc. Covalent diabodies and uses thereof
US9284375B2 (en) 2005-04-15 2016-03-15 Macrogenics, Inc. Covalent diabodies and uses thereof
US11254748B2 (en) 2005-04-15 2022-02-22 Macrogenics, Inc. Covalent diabodies and uses thereof
ES2971647T3 (es) 2005-04-15 2024-06-06 Macrogenics Inc Diacuerpos covalentes y usos de los mismos
EP1999470A4 (en) * 2006-03-10 2009-08-19 Macrogenics Inc IDENTIFICATION AND GENETIC MODIFICATION OF ANTIBODIES WITH HEAVY CHAINS OF VARIANTS AND METHODS OF USE THEREOF
EP2009101B1 (en) 2006-03-31 2017-10-25 Chugai Seiyaku Kabushiki Kaisha Antibody modification method for purifying bispecific antibody
US20080112961A1 (en) * 2006-10-09 2008-05-15 Macrogenics, Inc. Identification and Engineering of Antibodies with Variant Fc Regions and Methods of Using Same
ME00832B (me) 2007-03-22 2012-03-20 Ucb Biopharma Sprl Vezivni proteini uključujući antitjela, derivate antitjela i fragmente antitjela, koji specifično vezuju cd154 i njihova upotreba
WO2008118324A2 (en) 2007-03-26 2008-10-02 Macrogenics, Inc. Composition and method of treating cancer with an anti-uroplakin ib antibody
EP2155789B1 (en) * 2007-05-01 2013-07-24 Research Development Foundation Immunoglobulin fc libraries
AU2008247382B2 (en) 2007-05-07 2014-06-05 Medimmune, Llc Anti-ICOS antibodies and their use in treatment of oncology, transplantation and autoimmune disease
EP2176298B1 (en) 2007-05-30 2017-11-15 Xencor, Inc. Methods and compositions for inhibiting cd32b expressing cells
KR101680906B1 (ko) * 2007-09-26 2016-11-30 추가이 세이야쿠 가부시키가이샤 항체 정상영역 개변체
US8795667B2 (en) * 2007-12-19 2014-08-05 Macrogenics, Inc. Compositions for the prevention and treatment of smallpox
HRP20150279T1 (hr) 2007-12-26 2015-05-08 Xencor, Inc. Fc inaäśice s promijenjenim vezanjem na fcrn
TWI440469B (zh) 2008-09-26 2014-06-11 Chugai Pharmaceutical Co Ltd Improved antibody molecules
WO2010096394A2 (en) 2009-02-17 2010-08-26 Redwood Biosciences, Inc. Aldehyde-tagged protein-based drug carriers and methods of use
JP5717624B2 (ja) 2009-03-19 2015-05-13 中外製薬株式会社 抗体定常領域改変体
EP2826789A1 (en) 2009-03-19 2015-01-21 Chugai Seiyaku Kabushiki Kaisha Antibody constant region variant
EP2411050A4 (en) * 2009-03-25 2013-07-17 Vet Therapeutics Inc ANTIBODY REGIONS WITH A CONSTANT DOMAIN AND THEIR USE
CN102549016B (zh) * 2009-06-30 2015-05-06 研究发展基金会 免疫球蛋白fc多肽
US10150808B2 (en) 2009-09-24 2018-12-11 Chugai Seiyaku Kabushiki Kaisha Modified antibody constant regions
US10053513B2 (en) 2009-11-30 2018-08-21 Janssen Biotech, Inc. Antibody Fc mutants with ablated effector functions
US8961967B2 (en) 2009-11-30 2015-02-24 Janssen Biotech, Inc. Antibody Fc mutants with ablated effector functions
EP2542258A4 (en) * 2010-03-04 2013-08-21 Vet Therapeutics Inc ON CD52 MONOCLONAL ANTIBODIES
US9616120B2 (en) * 2010-03-04 2017-04-11 Vet Therapeutics, Inc. Monoclonal antibodies directed to CD20
WO2011108714A1 (ja) 2010-03-04 2011-09-09 中外製薬株式会社 抗体定常領域改変体
AU2011286024B2 (en) 2010-08-02 2014-08-07 Macrogenics, Inc. Covalent diabodies and uses thereof
WO2012097333A2 (en) 2011-01-14 2012-07-19 Redwood Bioscience, Inc. Aldehyde-tagged immunoglobulin polypeptides and method of use thereof
WO2012106578A1 (en) * 2011-02-04 2012-08-09 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services HIV NEUTRALIZING ANTIBODIES HAVING MUTATIONS IN CONSTANT DOMAIN (Fc)
BR112013029892A2 (pt) 2011-05-21 2016-12-20 Macrogenics Inc polipeptídeo, molécula de ligação a antígeno, diacorpo e uso de uma porção polipeptídica de uma proteína de ligação a soro desimunizada
AU2013218017B2 (en) 2012-02-07 2017-12-07 Innate Pharma MICA binding agents
CN104411338A (zh) 2012-04-02 2015-03-11 现代治疗公司 用于产生与人类疾病相关的生物制剂和蛋白质的修饰多核苷酸
WO2013151665A2 (en) 2012-04-02 2013-10-10 modeRNA Therapeutics Modified polynucleotides for the production of proteins associated with human disease
AU2013359419B2 (en) 2012-12-10 2018-03-15 Biogen Ma Inc. Anti-blood dendritic cell antigen 2 antibodies and uses thereof
US9487587B2 (en) 2013-03-05 2016-11-08 Macrogenics, Inc. Bispecific molecules that are immunoreactive with immune effector cells of a companion animal that express an activating receptor and cells that express B7-H3 and uses thereof
SMT202100464T1 (it) 2013-03-14 2021-11-12 Macrogenics Inc Molecole bispecifiche che sono immunoreattive con cellule effettrici immunitarie che esprimono un recettore di attivazione
WO2014152027A1 (en) 2013-03-15 2014-09-25 Moderna Therapeutics, Inc. Manufacturing methods for production of rna transcripts
WO2014143739A2 (en) 2013-03-15 2014-09-18 Biogen Idec Ma Inc. Anti-alpha v beta 6 antibodies and uses thereof
JP2016515120A (ja) 2013-03-15 2016-05-26 バイオジェン・エムエイ・インコーポレイテッドBiogen MA Inc. 抗アルファvベータ5抗体を用いた急性腎損傷の治療及び予防
WO2014144466A1 (en) 2013-03-15 2014-09-18 Biogen Idec Ma Inc. Anti-alpha v beta 6 antibodies and uses thereof
US11384149B2 (en) 2013-08-09 2022-07-12 Macrogenics, Inc. Bi-specific monovalent Fc diabodies that are capable of binding CD32B and CD79b and uses thereof
UA116479C2 (uk) 2013-08-09 2018-03-26 Макродженікс, Інк. БІСПЕЦИФІЧНЕ МОНОВАЛЕНТНЕ Fc-ДІАТІЛО, ЯКЕ ОДНОЧАСНО ЗВ'ЯЗУЄ CD32B I CD79b, ТА ЙОГО ЗАСТОСУВАННЯ
EP2840091A1 (en) 2013-08-23 2015-02-25 MacroGenics, Inc. Bi-specific diabodies that are capable of binding gpA33 and CD3 and uses thereof
EP2839842A1 (en) 2013-08-23 2015-02-25 MacroGenics, Inc. Bi-specific monovalent diabodies that are capable of binding CD123 and CD3 and uses thereof
WO2015034925A1 (en) 2013-09-03 2015-03-12 Moderna Therapeutics, Inc. Circular polynucleotides
EP3041934A1 (en) 2013-09-03 2016-07-13 Moderna Therapeutics, Inc. Chimeric polynucleotides
ES2881306T3 (es) 2013-09-27 2021-11-29 Chugai Pharmaceutical Co Ltd Método para la producción de heteromultímeros de polipéptidos
WO2015057939A1 (en) 2013-10-18 2015-04-23 Biogen Idec Ma Inc. Anti-s1p4 antibodies and uses thereof
US10526391B2 (en) 2014-07-22 2020-01-07 The University Of Notre Dame Du Lac Molecular constructs and uses thereof
MX386297B (es) 2014-09-29 2025-03-18 Univ Duke Moleculas biespecificas que comprenden un brazo orientado a la envoltura vih-1.
WO2016130516A1 (en) 2015-02-09 2016-08-18 Research Development Foundation Engineered immunoglobulin fc polypeptides displaying improved complement activation
CA2972393A1 (en) 2015-02-27 2016-09-01 Chugai Seiyaku Kabushiki Kaisha Composition for treating il-6-related diseases
JP7082484B2 (ja) 2015-04-01 2022-06-08 中外製薬株式会社 ポリペプチド異種多量体の製造方法
EP3368092B9 (en) 2015-10-29 2020-07-29 Novartis AG Antibody conjugates comprising toll-like receptor agonist
AU2016381992B2 (en) 2015-12-28 2024-01-04 Chugai Seiyaku Kabushiki Kaisha Method for promoting efficiency of purification of Fc region-containing polypeptide
JP2019515677A (ja) 2016-04-26 2019-06-13 アール.ピー.シェーラー テクノロジーズ エルエルシー 抗体複合体ならびにそれを作製および使用する方法
WO2017214452A1 (en) 2016-06-08 2017-12-14 Xencor, Inc. Treatment of igg4-related diseases with anti-cd19 antibodies crossbinding to cd32b
US20190330318A1 (en) 2016-07-25 2019-10-31 Biogen Ma Inc. Anti-hspa5 (grp78) antibodies and uses thereof
SG10201607778XA (en) 2016-09-16 2018-04-27 Chugai Pharmaceutical Co Ltd Anti-Dengue Virus Antibodies, Polypeptides Containing Variant Fc Regions, And Methods Of Use
US10767164B2 (en) 2017-03-30 2020-09-08 The Research Foundation For The State University Of New York Microenvironments for self-assembly of islet organoids from stem cells differentiation
AR111651A1 (es) 2017-04-28 2019-08-07 Novartis Ag Conjugados de anticuerpos que comprenden agonistas del receptor de tipo toll y terapias de combinación
WO2018203545A1 (ja) 2017-05-02 2018-11-08 国立研究開発法人国立精神・神経医療研究センター Il-6及び好中球の関連する疾患の治療効果の予測及び判定方法
EA202090020A1 (ru) 2017-07-10 2020-04-28 Интернэшнл - Драг - Дивелопмент - Байотек Лечение b-клеточных злокачественных новообразований с использованием афукозилированных проапоптотических анти-cd19 антител в сочетании с анти-cd20 антителами или химиотерапевтическими средствами
CN112119090B (zh) 2018-03-15 2023-01-13 中外制药株式会社 对寨卡病毒具有交叉反应性的抗登革热病毒抗体及使用方法
US12331320B2 (en) 2018-10-10 2025-06-17 The Research Foundation For The State University Of New York Genome edited cancer cell vaccines
SG11202108398YA (en) 2019-02-01 2021-08-30 Novarock Biotherapeutics Ltd Anti-claudin 18 antibodies and methods of use thereof
KR20220005471A (ko) 2019-04-08 2022-01-13 바이오젠 엠에이 인코포레이티드 항-인테그린 항체 및 이의 용도
CN114585391A (zh) 2019-08-07 2022-06-03 乐天医药生技股份有限公司 西妥昔单抗-ir700偶联物组合物
CN110433398B (zh) * 2019-09-03 2024-05-03 广西医大开元埌东医院有限责任公司 一种模拟放疗时呼吸运动对肺部肿瘤位置影响的装置
EP4159236A4 (en) 2020-05-29 2024-08-21 Chugai Seiyaku Kabushiki Kaisha Antibody-containing formulation
KR20250122541A (ko) 2022-10-25 2025-08-13 사이즈믹 테라퓨틱, 인코포레이티드. 변이체 IgG FC 폴리펩티드 및 그 용도

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4474893A (en) 1981-07-01 1984-10-02 The University of Texas System Cancer Center Recombinant monoclonal antibodies
US4714681A (en) 1981-07-01 1987-12-22 The Board Of Reagents, The University Of Texas System Cancer Center Quadroma cells and trioma cells and methods for the production of same
US4925648A (en) 1988-07-29 1990-05-15 Immunomedics, Inc. Detection and treatment of infectious and inflammatory lesions
WO1991000360A1 (en) 1989-06-29 1991-01-10 Medarex, Inc. Bispecific reagents for aids therapy
WO1992005793A1 (en) 1990-10-05 1992-04-16 Medarex, Inc. Targeted immunostimulation with bispecific reagents
WO1992008802A1 (en) 1990-10-29 1992-05-29 Cetus Oncology Corporation Bispecific antibodies, method of production, and uses thereof
WO1993017715A1 (en) 1992-03-05 1993-09-16 Board Of Regents, The University Of Texas System Diagnostic and/or therapeutic agents, targeted to neovascular endothelial cells
US5573920A (en) 1991-04-26 1996-11-12 Surface Active Limited Antibodies, and methods for their use
US5601819A (en) 1988-08-11 1997-02-11 The General Hospital Corporation Bispecific antibodies for selective immune regulation and for selective immune cell binding
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin

Family Cites Families (197)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) * 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
FR2413974A1 (fr) 1978-01-06 1979-08-03 David Bernard Sechoir pour feuilles imprimees par serigraphie
US4347935A (en) 1979-05-16 1982-09-07 The United States Of America As Represented By The United States Department Of Energy Method and apparatus for electrostatically sorting biological cells
US4444887A (en) 1979-12-10 1984-04-24 Sloan-Kettering Institute Process for making human antibody producing B-lymphocytes
EP0092918B1 (en) 1982-04-22 1988-10-19 Imperial Chemical Industries Plc Continuous release formulations
US4716111A (en) 1982-08-11 1987-12-29 Trustees Of Boston University Process for producing human antibodies
US4741900A (en) 1982-11-16 1988-05-03 Cytogen Corporation Antibody-metal ion complexes
GB8308235D0 (en) 1983-03-25 1983-05-05 Celltech Ltd Polypeptides
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4752601A (en) * 1983-08-12 1988-06-21 Immunetech Pharmaceuticals Method of blocking immune complex binding to immunoglobulin FC receptors
US5128326A (en) 1984-12-06 1992-07-07 Biomatrix, Inc. Drug delivery systems based on hyaluronans derivatives thereof and their salts and methods of producing same
US4980286A (en) 1985-07-05 1990-12-25 Whitehead Institute For Biomedical Research In vivo introduction and expression of foreign genetic material in epithelial cells
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
GB8607679D0 (en) 1986-03-27 1986-04-30 Winter G P Recombinant dna product
US5225539A (en) * 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
US5985599A (en) * 1986-05-29 1999-11-16 The Austin Research Institute FC receptor for immunoglobulin
US4954617A (en) 1986-07-07 1990-09-04 Trustees Of Dartmouth College Monoclonal antibodies to FC receptors for immunoglobulin G on human mononuclear phagocytes
JP3101690B2 (ja) * 1987-03-18 2000-10-23 エス・ビィ・2・インコーポレイテッド 変性抗体の、または変性抗体に関する改良
US4880078A (en) 1987-06-29 1989-11-14 Honda Giken Kogyo Kabushiki Kaisha Exhaust muffler
WO1989007142A1 (en) 1988-02-05 1989-08-10 Morrison Sherie L Domain-modified constant region antibodies
FR2626882B1 (fr) * 1988-02-08 1991-11-08 Ire Celltarg Sa Conjugues de derives de vinca comportant une chaine detergente en position c-3
US4861579A (en) 1988-03-17 1989-08-29 American Cyanamid Company Suppression of B-lymphocytes in mammals by administration of anti-B-lymphocyte antibodies
DE68929546T4 (de) 1988-05-27 2007-03-08 Applied Research Systems Ars Holding N.V. Menschlicher Fc-gamma-Rezeptor III
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5576184A (en) * 1988-09-06 1996-11-19 Xoma Corporation Production of chimeric mouse-human antibodies with specificity to human tumor antigens
DE68928427T2 (de) 1988-09-15 1998-06-04 Univ Columbia Antikörper mit modifiziertem Kohlenhydratgehalt und Verfahren zur Herstellung und Verwendung
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US20040049014A1 (en) 1988-12-28 2004-03-11 Protein Design Labs, Inc. Humanized immunoglobulins
GB8916400D0 (en) * 1989-07-18 1989-09-06 Dynal As Modified igg3
US5413923A (en) 1989-07-25 1995-05-09 Cell Genesys, Inc. Homologous recombination for universal donor cells and chimeric mammalian hosts
FR2650598B1 (fr) 1989-08-03 1994-06-03 Rhone Poulenc Sante Derives de l'albumine a fonction therapeutique
US5166057A (en) 1989-08-28 1992-11-24 The Mount Sinai School Of Medicine Of The City University Of New York Recombinant negative strand rna virus expression-systems
US5436146A (en) 1989-09-07 1995-07-25 The Trustees Of Princeton University Helper-free stocks of recombinant adeno-associated virus vectors
AU6430190A (en) 1989-10-10 1991-05-16 Pitman-Moore, Inc. Sustained release composition for macromolecular proteins
CA2071867A1 (en) 1989-11-06 1991-05-07 Edith Mathiowitz Method for producing protein microspheres
GB8928874D0 (en) 1989-12-21 1990-02-28 Celltech Ltd Humanised antibodies
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
DE69120146T2 (de) 1990-01-12 1996-12-12 Cell Genesys Inc Erzeugung xenogener antikörper
FI85768C (fi) 1990-07-04 1992-05-25 Valtion Teknillinen Foerfarande foer utfoerning av ytplasmonresonansmaetning samt i foerfarandet anvaendbar givare.
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
ATE158021T1 (de) 1990-08-29 1997-09-15 Genpharm Int Produktion und nützung nicht-menschliche transgentiere zur produktion heterologe antikörper
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
CA2092323A1 (en) 1990-10-01 1992-04-02 George Y. Wu Targeting viruses and cells for selective internalization by cells
US5364930A (en) * 1990-10-16 1994-11-15 Northwestern University Synthetic C1q peptide fragments
GB9105245D0 (en) 1991-03-12 1991-04-24 Lynxvale Ltd Binding molecules
CA2109528A1 (en) 1991-05-01 1992-11-02 Gregory A. Prince A method for treating infectious respiratory diseases
WO1992020373A1 (en) 1991-05-14 1992-11-26 Repligen Corporation Heteroconjugate antibodies for treatment of hiv infection
CA2103064A1 (en) 1991-05-14 1992-11-15 George Y. Wu Targeted delivery of genes encoding immunogenic proteins
EP0519596B1 (en) 1991-05-17 2005-02-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
DK0587738T3 (da) 1991-06-05 2000-12-18 Univ Connecticut Destineret levering af gener, som koder for sekretionsproteiner
DE69110032T2 (de) 1991-06-08 1995-12-21 Hewlett Packard Gmbh Verfahren und Gerät zur Feststellung und/oder Konzentrationsbestimmung von Biomolekülen.
US6800738B1 (en) * 1991-06-14 2004-10-05 Genentech, Inc. Method for making humanized antibodies
US5637481A (en) * 1993-02-01 1997-06-10 Bristol-Myers Squibb Company Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell
US5223408A (en) * 1991-07-11 1993-06-29 Genentech, Inc. Method for making variant secreted proteins with altered properties
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
AU2605592A (en) 1991-10-15 1993-04-22 Atrix Laboratories, Inc. Polymeric compositions useful as controlled release implants
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
PT1024191E (pt) 1991-12-02 2008-12-22 Medical Res Council Produção de auto-anticorpos a partir de reportórios de segmentos de anticorpo e exibidos em fagos
AU3434393A (en) 1992-01-17 1993-08-03 Regents Of The University Of Michigan, The Targeted virus
FR2686901A1 (fr) 1992-01-31 1993-08-06 Rhone Poulenc Rorer Sa Nouveaux polypeptides antithrombotiques, leur preparation et compositions pharmaceutiques les contenant.
FR2686899B1 (fr) 1992-01-31 1995-09-01 Rhone Poulenc Rorer Sa Nouveaux polypeptides biologiquement actifs, leur preparation et compositions pharmaceutiques les contenant.
US5912015A (en) 1992-03-12 1999-06-15 Alkermes Controlled Therapeutics, Inc. Modulated release from biocompatible polymers
EP0633943A4 (en) 1992-04-03 1997-05-02 Alexander T Young GENTHERAPY USING TARGETED VIRAL VECTORS.
CA2118508A1 (en) 1992-04-24 1993-11-11 Elizabeth S. Ward Recombinant production of immunoglobulin-like domains in prokaryotic cells
DK0598877T3 (da) 1992-06-09 2000-02-21 Hoppe Ag Falle og dørlås
CA2140280A1 (en) 1992-08-17 1994-03-03 Avi J. Ashkenazi Bispecific immunoadhesins
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
ES2157225T3 (es) 1992-10-09 2001-08-16 Advanced Tissue Sciences Inc Celulas hepaticas de reserva.
US5736137A (en) * 1992-11-13 1998-04-07 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma
EP1024198A3 (en) 1992-12-03 2002-05-29 Genzyme Corporation Pseudo-adenoviral vectors for the gene therapy of haemophiliae
DE69433811T2 (de) 1993-01-07 2005-06-23 Sequenom, Inc., San Diego Dns - sequenzierung durch massenspektronomie
US5934272A (en) 1993-01-29 1999-08-10 Aradigm Corporation Device and method of creating aerosolized mist of respiratory drug
DK0682710T3 (da) 1993-02-10 2004-03-01 Unilever Nv Isolationsmetode, ved hvilken der anvendes immobiliserede proteiner med specifikke kapaciteter
US5877396A (en) * 1993-04-23 1999-03-02 Sloan Kettering Institute For Cancer Research Mice mutant for functional Fc receptors and method of treating autoimmune diseases
US5885573A (en) 1993-06-01 1999-03-23 Arch Development Corporation Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies
AU691811B2 (en) 1993-06-16 1998-05-28 Celltech Therapeutics Limited Antibodies
US5874239A (en) * 1993-07-30 1999-02-23 Affymax Technologies N.V. Biotinylation of proteins
US5483469A (en) 1993-08-02 1996-01-09 The Regents Of The University Of California Multiple sort flow cytometer
US5464581A (en) 1993-08-02 1995-11-07 The Regents Of The University Of California Flow cytometer
GB9316989D0 (en) 1993-08-16 1993-09-29 Lynxvale Ltd Binding molecules
ATE214940T1 (de) 1993-11-10 2002-04-15 Enzon Inc Verbesserte interferon-polymerkonjugate
US5837458A (en) 1994-02-17 1998-11-17 Maxygen, Inc. Methods and compositions for cellular and metabolic engineering
US5834252A (en) 1995-04-18 1998-11-10 Glaxo Group Limited End-complementary polymerase reaction
US5605793A (en) 1994-02-17 1997-02-25 Affymax Technologies N.V. Methods for in vitro recombination
US6132764A (en) 1994-08-05 2000-10-17 Targesome, Inc. Targeted polymerized liposome diagnostic and treatment agents
US5602039A (en) 1994-10-14 1997-02-11 The University Of Washington Flow cytometer jet monitor system
US5643796A (en) 1994-10-14 1997-07-01 University Of Washington System for sensing droplet formation time delay in a flow cytometer
US5998404A (en) 1994-10-24 1999-12-07 Eli Lilly And Company Heterocyclic compounds and their use
ATE252894T1 (de) 1995-01-05 2003-11-15 Univ Michigan Oberflächen-modifizierte nanopartikel und verfahren für ihre herstellung und verwendung
US6019968A (en) 1995-04-14 2000-02-01 Inhale Therapeutic Systems, Inc. Dispersible antibody compositions and methods for their preparation and use
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6410690B1 (en) 1995-06-07 2002-06-25 Medarex, Inc. Therapeutic compounds comprised of anti-Fc receptor antibodies
WO1997007788A2 (en) 1995-08-31 1997-03-06 Alkermes Controlled Therapeutics, Inc. Composition for sustained release of an agent
US5736152A (en) 1995-10-27 1998-04-07 Atrix Laboratories, Inc. Non-polymeric sustained release delivery system
US6750334B1 (en) 1996-02-02 2004-06-15 Repligen Corporation CTLA4-immunoglobulin fusion proteins having modified effector functions and uses therefor
US5942328A (en) 1996-02-29 1999-08-24 International Business Machines Corporation Low dielectric constant amorphous fluorinated carbon and method of preparation
ATE508733T1 (de) 1996-03-04 2011-05-15 Penn State Res Found Materialien und verfahren zur steigerung der zellulären internalisierung
AU5711196A (en) 1996-03-14 1997-10-01 Human Genome Sciences, Inc. Apoptosis inducing molecule i
JP4046354B2 (ja) 1996-03-18 2008-02-13 ボード オブ リージェンツ,ザ ユニバーシティ オブ テキサス システム 増大した半減期を有する免疫グロブリン様ドメイン
CA2248868A1 (en) 1996-03-22 1997-09-25 Human Genome Sciences, Inc. Apoptosis inducing molecule ii
US5834597A (en) 1996-05-20 1998-11-10 Protein Design Labs, Inc. Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same
US5855913A (en) 1997-01-16 1999-01-05 Massachusetts Instite Of Technology Particles incorporating surfactants for pulmonary drug delivery
US5985309A (en) 1996-05-24 1999-11-16 Massachusetts Institute Of Technology Preparation of particles for inhalation
US5874064A (en) 1996-05-24 1999-02-23 Massachusetts Institute Of Technology Aerodynamically light particles for pulmonary drug delivery
US6699658B1 (en) 1996-05-31 2004-03-02 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US6300065B1 (en) * 1996-05-31 2001-10-09 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
DE69738522T2 (de) 1996-08-02 2009-04-02 Bristol-Myers Squibb Co. Ein verfahren zur inhibierung immunglobulininduzierter toxizität aufgrund von der verwendung von immunoglobinen in therapie und in vivo diagnostik
US6025485A (en) * 1997-02-14 2000-02-15 Arcaris, Inc. Methods and compositions for peptide libraries displayed on light-emitting scaffolds
US5916771A (en) 1996-10-11 1999-06-29 Abgenix, Inc. Production of a multimeric protein by cell fusion method
US6339069B1 (en) 1996-10-15 2002-01-15 Elan Pharmaceuticalstechnologies, Inc. Peptide-lipid conjugates, liposomes and lipsomal drug delivery
GB9623820D0 (en) 1996-11-16 1997-01-08 Secr Defence Surface plasma resonance sensor
WO1998023289A1 (en) 1996-11-27 1998-06-04 The General Hospital Corporation MODULATION OF IgG BINDING TO FcRn
CA2722378C (en) 1996-12-03 2015-02-03 Amgen Fremont Inc. Human antibodies that bind tnf.alpha.
CA2277801C (en) 1997-01-16 2002-10-15 Massachusetts Institute Of Technology Preparation of particles for inhalation
WO1998034957A1 (en) 1997-02-11 1998-08-13 Immunomedics, Inc. STIMULATION OF AN IMMUNE RESPONSE WITH ANTIBODIES LABELED WITH THE α-GALACTOSYL EPITOPE
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
BRPI9809391B8 (pt) 1997-04-14 2021-05-25 Amgen Res Munich Gmbh processo para a produção de um receptor de antígeno anti-humano, anticorpo humano e composição farmacêutica
US20030207346A1 (en) * 1997-05-02 2003-11-06 William R. Arathoon Method for making multispecific antibodies having heteromultimeric and common components
US6235883B1 (en) 1997-05-05 2001-05-22 Abgenix, Inc. Human monoclonal antibodies to epidermal growth factor receptor
DE19721700C1 (de) 1997-05-23 1998-11-19 Deutsches Krebsforsch Mutierter OKT3-Antikörper
US5989463A (en) 1997-09-24 1999-11-23 Alkermes Controlled Therapeutics, Inc. Methods for fabricating polymer-based controlled release devices
SE512663C2 (sv) 1997-10-23 2000-04-17 Biogram Ab Inkapslingsförfarande för aktiv substans i en bionedbrytbar polymer
CA2248971A1 (en) 1997-10-31 1999-04-30 Kyowa Hakko Kogyo Co., Ltd. .beta.1, 3-n-acetylglucosaminyltransferase, dna encoding it and its use
CA2309541C (en) 1997-11-03 2011-01-11 Human Genome Sciences, Inc. Vegi, an inhibitor of angiogenesis and tumor growth
HUP0100813A3 (en) 1998-02-25 2003-08-28 Lexigen Pharmaceuticals Corp L Enhancing the circulating half-life of antibody-based fusion proteins
US6211477B1 (en) 1998-02-26 2001-04-03 Becton Dickinson And Company Electrostatic deceleration system for flow cytometer
US6455263B2 (en) * 1998-03-24 2002-09-24 Rigel Pharmaceuticals, Inc. Small molecule library screening using FACS
US6528624B1 (en) * 1998-04-02 2003-03-04 Genentech, Inc. Polypeptide variants
US6194551B1 (en) * 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
ATE375365T1 (de) 1998-04-02 2007-10-15 Genentech Inc Antikörper varianten und fragmente davon
US6242195B1 (en) * 1998-04-02 2001-06-05 Genentech, Inc. Methods for determining binding of an analyte to a receptor
DK1071700T3 (da) 1998-04-20 2010-06-07 Glycart Biotechnology Ag Glykosylerings-modifikation af antistoffer til forbedring af antistofafhængig cellulær cytotoksicitet
EP0953639A1 (en) 1998-04-30 1999-11-03 Boehringer Ingelheim International GmbH FAPalpha-specific antibody with improved producibility
GB9809951D0 (en) 1998-05-08 1998-07-08 Univ Cambridge Tech Binding molecules
JP2002518663A (ja) 1998-05-20 2002-06-25 グラッフィニティ ファルマシューティカル デザイン ゲーエムベーハー 液体状態で存在する多数の試料を同時に測定するためのsprセンサー
US6289286B1 (en) 1998-05-29 2001-09-11 Biacore Ab Surface regeneration of biosensors and characterization of biomolecules associated therewith
WO1999066903A2 (en) 1998-06-24 1999-12-29 Advanced Inhalation Research, Inc. Large porous particles emitted from an inhaler
US6696550B2 (en) * 1998-07-23 2004-02-24 Millennium Pharmaceuticals, Inc. Humanized anti-CCR2 antibodies and methods of use therefor
EP1105427A2 (en) 1998-08-17 2001-06-13 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US7315786B2 (en) * 1998-10-16 2008-01-01 Xencor Protein design automation for protein libraries
EP1006183A1 (en) 1998-12-03 2000-06-07 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Recombinant soluble Fc receptors
PL209392B1 (pl) 1999-01-15 2011-08-31 Genentech Inc Przeciwciało, komórka gospodarza, sposób wytwarzania przeciwciała oraz zastosowanie przeciwciała
US6737056B1 (en) * 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US6676927B1 (en) 1999-01-20 2004-01-13 The Rockefeller University Animal model and methods for its use in the selection of cytotoxic antibodies
CA2704600C (en) 1999-04-09 2016-10-25 Kyowa Kirin Co., Ltd. A method for producing antibodies with increased adcc activity
EP1229125A4 (en) 1999-10-19 2005-06-01 Kyowa Hakko Kogyo Kk PROCESS FOR PREPARING A POLYPEPTIDE
JP2003531588A (ja) * 2000-04-11 2003-10-28 ジェネンテック・インコーポレーテッド 多価抗体とその用途
EP2213743A1 (en) 2000-04-12 2010-08-04 Human Genome Sciences, Inc. Albumin fusion proteins
JP2003531149A (ja) * 2000-04-13 2003-10-21 ザ・ロツクフエラー・ユニバーシテイ 抗体由来の免疫応答の増強
CA2410551A1 (en) 2000-06-30 2002-01-10 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw (Vib) Heterodimeric fusion proteins
CA2953239A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kirin Co., Ltd. Antibody composition-producing cell
CA2424977C (en) 2000-10-06 2008-03-18 Kyowa Hakko Kogyo Co., Ltd. Process for purifying antibody
US6946292B2 (en) * 2000-10-06 2005-09-20 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions with increased antibody dependent cytotoxic activity
US7083784B2 (en) 2000-12-12 2006-08-01 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
EP1497318A4 (en) 2001-04-18 2006-03-01 Dyax Corp BINDING MOLECULES FOR FC ZONE POLYPEPTIDES
EP2165714B1 (en) * 2001-04-30 2013-10-23 Eli Lilly And Company Humanized antibodies recognizing the beta-amyloid peptide
US6972324B2 (en) * 2001-05-18 2005-12-06 Boehringer Ingelheim Pharmaceuticals, Inc. Antibodies specific for CD44v6
CA2462883A1 (en) * 2001-10-12 2003-04-17 Schering Corporation Use of bispecific antibodies to regulate immune responses
CA2463879C (en) 2001-10-25 2012-12-04 Genentech, Inc. Glycoprotein compositions
US20040002587A1 (en) * 2002-02-20 2004-01-01 Watkins Jeffry D. Fc region variants
US8188231B2 (en) * 2002-09-27 2012-05-29 Xencor, Inc. Optimized FC variants
US7317091B2 (en) * 2002-03-01 2008-01-08 Xencor, Inc. Optimized Fc variants
US20040132101A1 (en) * 2002-09-27 2004-07-08 Xencor Optimized Fc variants and methods for their generation
US7662925B2 (en) * 2002-03-01 2010-02-16 Xencor, Inc. Optimized Fc variants and methods for their generation
AU2003217912A1 (en) 2002-03-01 2003-09-16 Xencor Antibody optimization
JP5138867B2 (ja) * 2002-08-01 2013-02-06 イミューノメディクス、インコーポレイテッド α−フェトタンパク質Immu31抗体および融合タンパク質ならびにその使用方法
DK1534335T4 (en) 2002-08-14 2015-10-05 Macrogenics Inc FCGAMMARIIB-SPECIFIC ANTIBODIES AND PROCEDURES FOR USE THEREOF
US8187593B2 (en) * 2002-08-14 2012-05-29 Macrogenics, Inc. FcγRIIB specific antibodies and methods of use thereof
EP1553975B8 (en) 2002-09-27 2023-04-12 Xencor, Inc. Optimized fc variants and methods for their generation
US7960512B2 (en) 2003-01-09 2011-06-14 Macrogenics, Inc. Identification and engineering of antibodies with variant Fc regions and methods of using same
CA2512729C (en) * 2003-01-09 2014-09-16 Macrogenics, Inc. Identification and engineering of antibodies with variant fc regions and methods of using same
US20090010920A1 (en) * 2003-03-03 2009-01-08 Xencor, Inc. Fc Variants Having Decreased Affinity for FcyRIIb
AR044388A1 (es) * 2003-05-20 2005-09-07 Applied Molecular Evolution Moleculas de union a cd20
AU2003265522A1 (en) 2003-08-18 2005-03-10 Macrogenics, Inc. FCGammaRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF
SI1706424T1 (sl) 2004-01-12 2010-01-29 Applied Molecular Evolution Variante fc regij
JP5367982B2 (ja) * 2004-04-16 2013-12-11 マクロジェニクス,インコーポレーテッド FcγRIIB特異的抗体とその利用法
CA2565874C (en) 2004-05-10 2017-10-03 Macrogenics, Inc. Humanized fc.gamma.riib-specific antibodies and methods of use thereof
DK1771482T3 (da) * 2004-07-22 2014-10-20 Genentech Inc HER2-antistofsammensætning
AU2005274905B2 (en) 2004-08-04 2010-12-23 Mentrik Biotech, Llc Variant Fc regions
US7662926B2 (en) * 2004-09-02 2010-02-16 Genentech, Inc. Anti-Fc-gamma receptor antibodies, bispecific variants and uses therefor
US7655229B2 (en) * 2004-09-02 2010-02-02 Chan Andrew C Anti-FC-gamma RIIB receptor antibody and uses therefor
AU2005282720B2 (en) * 2004-09-02 2011-08-04 Genentech, Inc. Anti-FC-gamma RIIB receptor antibody and uses therefor
AU2005335714B2 (en) * 2004-11-10 2012-07-26 Macrogenics, Inc. Engineering Fc antibody regions to confer effector function
WO2006066078A2 (en) 2004-12-15 2006-06-22 Magrogenics, Inc. Fcϝriib-specific antibodies and methods of use thereof
ES2971647T3 (es) * 2005-04-15 2024-06-06 Macrogenics Inc Diacuerpos covalentes y usos de los mismos
PL2573114T3 (pl) 2005-08-10 2016-10-31 Identyfikacja i inżynieria przeciwciał z wariantami regionów FC oraz sposoby ich stosowania
US20080286819A1 (en) * 2005-11-07 2008-11-20 Ravetch Jeffrey V Reagents, Methods and Systems for Selecting a Cytotoxic Antibody or Variant Thereof
EP1999470A4 (en) 2006-03-10 2009-08-19 Macrogenics Inc IDENTIFICATION AND GENETIC MODIFICATION OF ANTIBODIES WITH HEAVY CHAINS OF VARIANTS AND METHODS OF USE THEREOF
WO2008105886A2 (en) * 2006-05-26 2008-09-04 Macrogenics, Inc. HUMANIZED FCγRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF
CA2696263C (en) 2007-08-15 2017-06-13 Bing Liu Monospecific and multispecific antibodies and method of use
US11392902B2 (en) 2017-06-06 2022-07-19 United Parcel Service Of America, Inc. Systems, methods, apparatuses and computer program products for providing notification of items for pickup and delivery

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4474893A (en) 1981-07-01 1984-10-02 The University of Texas System Cancer Center Recombinant monoclonal antibodies
US4714681A (en) 1981-07-01 1987-12-22 The Board Of Reagents, The University Of Texas System Cancer Center Quadroma cells and trioma cells and methods for the production of same
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US4925648A (en) 1988-07-29 1990-05-15 Immunomedics, Inc. Detection and treatment of infectious and inflammatory lesions
US5601819A (en) 1988-08-11 1997-02-11 The General Hospital Corporation Bispecific antibodies for selective immune regulation and for selective immune cell binding
WO1991000360A1 (en) 1989-06-29 1991-01-10 Medarex, Inc. Bispecific reagents for aids therapy
WO1992005793A1 (en) 1990-10-05 1992-04-16 Medarex, Inc. Targeted immunostimulation with bispecific reagents
WO1992008802A1 (en) 1990-10-29 1992-05-29 Cetus Oncology Corporation Bispecific antibodies, method of production, and uses thereof
US5573920A (en) 1991-04-26 1996-11-12 Surface Active Limited Antibodies, and methods for their use
WO1993017715A1 (en) 1992-03-05 1993-09-16 Board Of Regents, The University Of Texas System Diagnostic and/or therapeutic agents, targeted to neovascular endothelial cells

Non-Patent Citations (58)

* Cited by examiner, † Cited by third party
Title
ALEGRE ET AL., TRANSPLANTATION, vol. 57, 1994, pages 1537 - 1543
ARMOUR ET AL., EUR J IMMUNOL, vol. 29, 1999, pages 2613 - 2624
ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", pages: 243 - 56
BERNHARD ET AL., SCIENCE, vol. 245, 1989, pages 301 - 304
BHATTACHARYA-CHATTERJEE ET AL., J. OF IMMUN., vol. 141, 1988, pages 1398 - 1403
BODER; WITTRUP, METHODS IN ENZYMOLOGY, vol. 328, 2000, pages 430 - 444
BOESEN ET AL., BIOTHERAPY, vol. 6, 1994, pages 291 - 302
BOUT ET AL., HUMAN GENE THERAPY, vol. 5, 1994, pages 3 - 10
CHOTHIA ET AL., MOL. BIOL., vol. 278, 1998, pages 457 - 479
CLOWES ET AL., J CLIN. INVEST., vol. 93, 1994, pages 644 - 651
CLYNES ET AL., PNAS USA, vol. 95, 1998, pages 652 - 656
DECKER ET AL., J. LMMUNOL METHODS, vol. 115, no. 1, 1988, pages 61 - 9
DUNCAN ET AL., NATURE, vol. 332, 1988, pages 563 - 564
EDELSON, THE CANCER JOURNAL, vol. 4, 1998, pages 62
FEIZI, NATURE, vol. 314, 1985, pages 53 - 57
FISHMAN ET AL.: "Medicine", 1985, J.B. LIPPINCOTT CO.
FLEIT ET AL., J. LEUK. BIOL., vol. 49, 1991, pages 556
GROSSMAN; WILSON, CURR. OPIN. IN GENETICS AND DEVEL., vol. 3, 1993, pages 110 - 114
HELLSTROM ET AL., CANCER RES., vol. 46, 1986, pages 3917 - 3923
HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL, article "Antibodies For Drug Delivery", pages: 623 - 53
HILKENS ET AL., TRENDS IN BIO. CHEM. SCI., vol. 17, 1992, pages 359
HUTCHINS ET AL., PROC NATL. ACAD SCI U S A, vol. 92, 1995, pages 11980 - 11984
IDUSOGIE ET AL., J IMMUNOL, 2000, pages 164
IDUSOGIE ET AL., J IMMUNOL, vol. 166, 2001, pages 2571 - 2575
JEFFERIS ET AL., IMMUNOL LETT, vol. 54, 1996, pages 101 - 104
JEFFERIS ET AL., IMMUNOL LETT, vol. 82, 2002, pages 57 - 65
JEFFERIS ET AL., IMMUNOL LETT., vol. 44, 1995, pages 111 - 117
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1990, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KLEIN ET AL., BLOOD, vol. 83, 1994, pages 1467 - 1473
KOENE ET AL., BLOOD, vol. 90, 1997, pages 1109 - 14
KOHLER, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 2197
KOREN, NATURE, vol. 279, 1979, pages 328 - 331
KORZENIEWSLCI ET AL., IMMUNOL. METHODS, vol. 64, no. 3, 1983, pages 313 - 20
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553
KOZARSKY; WILSON, CURRENT OPINION IN GENETICS AND DEVELOPMENT, vol. 3, 1993, pages 499 - 503
LEUNG ET AL., TECHNIQUE, vol. 1, 1989, pages 11
LUND ET AL., FASEB J, vol. 9, 1995, pages 115 - 119
LUND ET AL., J IMMUNOL, vol. 157, 1996, pages 4963 - 4969
LUND ET AL., J. IMMUNOL, vol. 147, 1991, pages 2657 - 2662
LUND ET AL., MOL IMMUNOL, vol. 29, 1992, pages 53 - 59
MASTRANGELI ET AL., J CLIN. INVEST., vol. 91, 1993
MILLER, METH. ENZYMOL., vol. 217, 1993, pages 581 - 599
MURPHY ET AL.: "Informed Decisions: The Complete Book of Cancer Diagnosis, Treatment, and Recovery", 1997, PENGUIN BOOKS U.S.A., INC.
PEARSE, PNAS USA, vol. 90, 1993, pages 4314 - 8
PRICOP ET AL., J. IMMUNOL., vol. 166, 2000, pages 531 - 7
PROUDFOOT, NATURE, vol. 322, 1986, pages 52
REDDY ET AL., J IMMUNOL, vol. 164, 2000, pages 1925 - 1933
ROSENFELD ET AL., CELL, vol. 68, 1992, pages 143 - 155
ROSENFELD ET AL., SCIENCE, vol. 252, 1991, pages 431 - 434
SALMONS; GUNZBERG, HUMAN GENE THERAPY, vol. 4, 1993, pages 129 - 141
See also references of EP1919503A4
SHIELDS ET AL., J BIOL CHEM, vol. 276, 2001, pages 6591 - 6604
STEMMER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 91, 1994, pages 10747 - 51
TRIDANDAPANI ET AL., J. BIOL CHEM., vol. 277, 2002, pages 5082 - 9
TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 - 69
WELLS ET AL., GENE, vol. 34, 1985, pages 315
WU ET AL., J CLIN. INVEST., vol. 100, 1997, pages 1059 - 70
XU ET AL., CELL IMMUNOL, vol. 200, 2000, pages 16 - 26

Cited By (168)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8946387B2 (en) 2002-08-14 2015-02-03 Macrogenics, Inc. FcγRIIB specific antibodies and methods of use thereof
US8968730B2 (en) 2002-08-14 2015-03-03 Macrogenics Inc. FcγRIIB specific antibodies and methods of use thereof
EP2364996B1 (en) 2002-09-27 2016-11-09 Xencor Inc. Optimized FC variants and methods for their generation
US10184000B2 (en) 2002-09-27 2019-01-22 Xencor, Inc. Optimized Fc variants and methods for their generation
US10183999B2 (en) 2002-09-27 2019-01-22 Xencor, Inc. Optimized Fc variants and methods for their generation
US9028815B2 (en) 2003-01-09 2015-05-12 Macrogenics, Inc. Identification and engineering of antibodies with variant FC regions and methods of using same
US10113001B2 (en) 2003-03-03 2018-10-30 Xencor, Inc. Fc variants with increased affinity for FcyRIIc
US10584176B2 (en) 2003-03-03 2020-03-10 Xencor, Inc. Fc variants with increased affinity for FcγRIIc
US11820830B2 (en) 2004-07-20 2023-11-21 Xencor, Inc. Optimized Fc variants
US11198739B2 (en) 2004-11-12 2021-12-14 Xencor, Inc. Fc variants with altered binding to FcRn
US10336818B2 (en) 2004-11-12 2019-07-02 Xencor, Inc. Fc variants with altered binding to FcRn
US12215165B2 (en) 2004-11-12 2025-02-04 Xencor, Inc. Fc variants with altered binding to FcRn
EP2573114A1 (en) 2005-08-10 2013-03-27 MacroGenics, Inc. Identification and engineering of antibodies with variant Fc regions and methods of using same
US8697071B2 (en) 2005-08-10 2014-04-15 Macrogenics, Inc. Identification and engineering of antibodies with variant Fc regions and methods of using same
US12473375B2 (en) 2006-03-31 2025-11-18 Chugai Seiyaku Kabushiki Kaisha Methods for controlling blood pharmacokinetics of antibodies
US11046784B2 (en) 2006-03-31 2021-06-29 Chugai Seiyaku Kabushiki Kaisha Methods for controlling blood pharmacokinetics of antibodies
EP2021029A4 (en) * 2006-05-26 2010-01-06 Macrogenics Inc HUMANIZED FC RIB SPECIFIC ANTIBODIES AND METHOD FOR THEIR USE
WO2008105886A2 (en) 2006-05-26 2008-09-04 Macrogenics, Inc. HUMANIZED FCγRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF
WO2008019199A2 (en) 2006-06-26 2008-02-14 Macrogenics, Inc. FCγRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF
EP2505209A1 (en) * 2006-06-26 2012-10-03 MacroGenics, Inc. Fcgamma-RIIB-specific antibodies and methods of the use thereof
US9737599B2 (en) 2006-06-26 2017-08-22 Macrogenics, Inc. Combination of FcγRIIB-specific antibodies and CD20-specific antibodies and methods of use thereof
US10100116B2 (en) 2006-06-26 2018-10-16 Macrogenics, Inc. FcγRIIB-specific antibodies and methods of use thereof
US11098125B2 (en) 2006-06-26 2021-08-24 Macrogenics, Inc. FcγRIIB-specific antibodies and methods of use thereof
EP2029173A4 (en) * 2006-06-26 2010-01-06 Macrogenics Inc FC-RIIB-SPECIFIC ANTIBODIES AND METHOD FOR THEIR USE
US11787871B2 (en) 2006-12-08 2023-10-17 Macrogenics, Inc. Methods for the treatment of disease using immunoglobulins having fc regions with altered affinities for FcgammaRactivating and FegammaRinhibiting
US9708408B2 (en) 2006-12-08 2017-07-18 Macrogenics, Inc. Methods for the treatment of disease using immunoglobulins having Fc Regions with altered affinities for FcγRactivating and FcγRinhibiting
US10711069B2 (en) 2006-12-08 2020-07-14 Macrogenics, Inc. Methods for the treatment of disease using immunoglobulins having Fc regions with altered affinities for FcγRactivating and FcγRinhibiting
US12116414B2 (en) 2007-09-26 2024-10-15 Chugai Seiyaku Kabushiki Kaisha Method of modifying isoelectric point of antibody via amino acid substitution in CDR
US9828429B2 (en) 2007-09-26 2017-11-28 Chugai Seiyaku Kabushiki Kaisha Method of modifying isoelectric point of antibody via amino acid substitution in CDR
US11248053B2 (en) 2007-09-26 2022-02-15 Chugai Seiyaku Kabushiki Kaisha Method of modifying isoelectric point of antibody via amino acid substitution in CDR
US12122840B2 (en) 2007-09-26 2024-10-22 Chugai Seiyaku Kabushiki Kaisha Method of modifying isoelectric point of antibody via amino acid substitution in CDR
JP2011509675A (ja) * 2008-01-18 2011-03-31 メディミューン,エルエルシー 部位特異的コンジュゲーションのためのシステイン操作抗体
US12492253B1 (en) 2008-02-25 2025-12-09 Xencor, Inc. Anti-human C5 antibodies
US9695236B2 (en) 2008-04-02 2017-07-04 Macrogenics, Inc. BCR-complex-specific antibodies and methods of using same
US8993730B2 (en) 2008-04-02 2015-03-31 Macrogenics, Inc. BCR-complex-specific antibodies and methods of using same
WO2009123894A2 (en) 2008-04-02 2009-10-08 Macrogenics, Inc. Her2/neu-specific antibodies and methods of using same
US12024569B2 (en) 2008-04-02 2024-07-02 Macrogenics, Inc. HER2/neu-specific antibodies and methods of using same
US11028183B2 (en) 2008-04-02 2021-06-08 Macrogenics, Inc. HER2/neu-specific antibodies and methods of using same
EP3045475A1 (en) 2008-04-02 2016-07-20 MacroGenics, Inc. Bcr-complex-specific antibodies and methods of using same
US10131713B2 (en) 2008-04-02 2018-11-20 Macrogenics, Inc. HER2/neu-specific antibodies and methods of using same
EP3067063A1 (en) 2008-04-02 2016-09-14 MacroGenics, Inc. Her2/neu-specific antibodies and methods of using same
US9469692B2 (en) 2008-04-02 2016-10-18 Macrogenics, Inc. HER2/neu-specific antibodies and methods of using same
US10479831B2 (en) 2008-04-02 2019-11-19 Macrogenics, Inc BCR-complex-specific antibodies and methods of using same
WO2009151717A2 (en) 2008-04-02 2009-12-17 Macrogenics, Inc. Bcr-complex-specific antibodies and methods of using same
US11359194B2 (en) 2008-04-11 2022-06-14 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule capable of binding two or more antigen molecules repeatedly
US11371039B2 (en) 2008-04-11 2022-06-28 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly
US9890377B2 (en) 2008-04-11 2018-02-13 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly
US9868948B2 (en) 2008-04-11 2018-01-16 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly
US10472623B2 (en) 2008-04-11 2019-11-12 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule capable of binding two or more antigen molecules repeatedly
WO2010033279A2 (en) 2008-06-04 2010-03-25 Macrogenics, Inc. Antibodies with altered binding to fcrn and methods of using same
US11401348B2 (en) 2009-09-02 2022-08-02 Xencor, Inc. Heterodimeric Fc variants
US9096877B2 (en) 2009-10-07 2015-08-04 Macrogenics, Inc. Fc region-containing polypeptides that exhibit improved effector function due to alterations of the extent of fucosylation, and methods for their use
WO2011109400A2 (en) 2010-03-04 2011-09-09 Macrogenics,Inc. Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof
US9714295B2 (en) 2010-03-04 2017-07-25 Macrogenics, Inc. Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof
US9150656B2 (en) 2010-03-04 2015-10-06 Macrogenics, Inc. Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof
US9714296B2 (en) 2010-03-04 2017-07-25 Macrogenics, Inc. Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof
KR101828570B1 (ko) * 2010-03-04 2018-02-13 마크로제닉스, 인크. B7―h3에 반응성인 항체, 면역학적으로 활성인 이들의 단편 및 이들의 사용법
US9896508B2 (en) 2010-03-04 2018-02-20 Macrogenics, Inc. Antibodies reactive with B7-H3 and uses thereof
EP2542256A4 (en) * 2010-03-04 2014-02-12 Macrogenics Inc ANTIBODIES RESPONSIVE WITH B7-H3, IMMUNOLOGICAL FRAGMENTS THEREOF AND USES THEREOF
US10683364B2 (en) 2010-03-04 2020-06-16 Macrogenics, Inc. Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof
US10730945B2 (en) 2010-03-04 2020-08-04 Macrogenics, Inc. Antibodies reactive with B7-H3 and users thereof
EP2982380A1 (en) 2010-03-04 2016-02-10 MacroGenics, Inc. Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof
US12617847B2 (en) 2010-11-30 2026-05-05 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly
US11891434B2 (en) 2010-11-30 2024-02-06 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly
US10618965B2 (en) 2011-02-25 2020-04-14 Chugai Seiyaku Kabushiki Kaisha Method for altering plasma retention and immunogenicity of antigen-binding molecule
US11718678B2 (en) 2011-02-25 2023-08-08 Chugai Seiyaku Kabushiki Kaisha Method for altering plasma retention and immunogenicity of antigen-binding molecule
WO2012162067A2 (en) 2011-05-21 2012-11-29 Macrogenics, Inc. Cd3-binding molecules capable of binding to human and non-human cd3
EP3492494A1 (en) 2011-05-21 2019-06-05 MacroGenics, Inc. Cd3-binding molecules capable of binding to human and non-human cd3
US11827699B2 (en) 2011-09-30 2023-11-28 Chugai Seiyaku Kabushiki Kaisha Methods for producing antibodies promoting disappearance of antigens having plurality of biological activities
WO2013047729A1 (ja) 2011-09-30 2013-04-04 中外製薬株式会社 標的抗原に対する免疫応答を誘導する抗原結合分子
WO2013047752A1 (ja) 2011-09-30 2013-04-04 中外製薬株式会社 抗原の消失を促進する抗原結合分子
EP3939996A1 (en) 2011-09-30 2022-01-19 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule promoting disappearance of antigens having plurality of biological activities
US10253100B2 (en) 2011-09-30 2019-04-09 Chugai Seiyaku Kabushiki Kaisha Therapeutic antigen-binding molecule with a FcRn-binding domain that promotes antigen clearance
WO2013047748A1 (ja) 2011-09-30 2013-04-04 中外製薬株式会社 複数の生理活性を有する抗原の消失を促進する抗原結合分子
EP3680251A1 (en) 2011-09-30 2020-07-15 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecules for promoting elimination of antigens
US11820793B2 (en) 2011-11-30 2023-11-21 Chugai Seiyaku Kabushiki Kaisha Drug containing carrier into cell for forming immune complex
EP3517550A1 (en) 2011-11-30 2019-07-31 Chugai Seiyaku Kabushiki Kaisha Drug containing carrier into cell for forming immune complex
WO2013081143A1 (ja) 2011-11-30 2013-06-06 中外製薬株式会社 免疫複合体を形成する細胞内への運搬体(キャリア)を含む医薬
WO2013100120A1 (ja) 2011-12-28 2013-07-04 中外製薬株式会社 ヒト化抗Epiregulin抗体および当該抗体を有効成分として含む癌治療剤
US12269876B2 (en) 2012-02-09 2025-04-08 Chugai Seiyaku Kabushiki Kaisha Modified Fc region of antibody
WO2013147153A1 (ja) 2012-03-29 2013-10-03 株式会社未来創薬研究所 抗lamp5抗体およびその利用
WO2013163630A1 (en) * 2012-04-27 2013-10-31 Bioatla Llc. Modified antibody regions and uses thereof
US10954288B2 (en) 2012-04-27 2021-03-23 Bioatla, Inc. Modified antibody regions and uses thereof
WO2013180200A1 (ja) 2012-05-30 2013-12-05 中外製薬株式会社 標的組織特異的抗原結合分子
WO2013180201A1 (ja) 2012-05-30 2013-12-05 中外製薬株式会社 会合化した抗原を消失させる抗原結合分子
EP3795215A1 (en) 2012-05-30 2021-03-24 Chugai Seiyaku Kabushiki Kaisha Target tissue-specific antigen-binding molecule
EP3892638A1 (en) 2012-05-30 2021-10-13 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule for eliminating aggregated antigens
US10919953B2 (en) 2012-08-24 2021-02-16 Chugai Seiyaku Kabushiki Kaisha FcgammaRIIB-specific Fc region variant
WO2014083379A1 (en) 2012-11-30 2014-06-05 Institut Pasteur Use of anti-fcyri and/or anti-fcyriia antibodies for treating arthritis, inflammation, thrombocytopenia and allergic shock
EP4119947A1 (en) 2012-12-21 2023-01-18 Chugai Seiyaku Kabushiki Kaisha Gpc3-targeting drug which is administered to patient responsive to gpc3-targeting drug therapy
WO2014097648A1 (ja) 2012-12-21 2014-06-26 中外製薬株式会社 Gpc3標的治療剤療法が有効である患者に投与されるgpc3標的治療剤
EP3557260A1 (en) 2012-12-21 2019-10-23 Chugai Seiyaku Kabushiki Kaisha Gpc3-targeting drug which is administered to patient responsive to gpc3-targeting drug therapy
EP3255062A1 (en) 2013-02-14 2017-12-13 Innate Pharma Treatment of peripheral t cell lymphoma
WO2014125041A1 (en) 2013-02-14 2014-08-21 Innate Pharma Treatment of peripheral t cell lymphoma
EP3521312A1 (en) 2013-02-20 2019-08-07 Innate Pharma, S.A. A compound that specifically binds to kir3dl2 for use in the treatment of peripheral t cell lymphoma
EP3896088A1 (en) 2013-02-20 2021-10-20 Innate Pharma Treatment of peripheral t cell lymphoma
US11267868B2 (en) 2013-04-02 2022-03-08 Chugai Seiyaku Kabushiki Kaisha Fc region variant
WO2014208482A1 (ja) 2013-06-24 2014-12-31 中外製薬株式会社 ヒト化抗Epiregulin抗体を有効成分として含む腺癌以外の非小細胞肺癌の治療剤
EP3763813A1 (en) 2013-12-04 2021-01-13 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecules, the antigen-binding activity of which varies according to the concentration of compounds, and libraries of said molecules
WO2015083764A1 (ja) 2013-12-04 2015-06-11 中外製薬株式会社 化合物の濃度に応じて抗原結合能の変化する抗原結合分子及びそのライブラリ
US10100115B2 (en) 2014-02-14 2018-10-16 Macrogenics, Inc. Methods for the treatment of vascularizing cancers
EP3572431A1 (en) 2014-03-14 2019-11-27 Innate Pharma Humanized antibodies with stability
US11760807B2 (en) 2014-05-08 2023-09-19 Chugai Seiyaku Kabushiki Kaisha GPC3-targeting drug which is administered to patient responsive to GPC3-targeting drug therapy
EP3954703A2 (en) 2014-05-29 2022-02-16 MacroGenics, Inc. Tri-specific binding molecules and methods of use thereof
US11697684B2 (en) 2014-05-29 2023-07-11 Macrogenics, Inc. Tri-specific binding molecules that specifically bind to multiple cancer antigens
US10647768B2 (en) 2014-05-29 2020-05-12 Macrogenics, Inc. Multi-chain polypeptide-containing tri-specific binding molecules
US10633440B2 (en) 2014-05-29 2020-04-28 Macrogenics, Inc. Multi-chain polypeptide-containing tri-specific binding molecules that specifically bind to multiple cancer antigens
US11820818B2 (en) 2014-05-29 2023-11-21 Macrogenics, Inc. Multi-chain polypeptide-containing tri-specific binding molecules
WO2015184203A1 (en) 2014-05-29 2015-12-03 Macrogenics, Inc. Tri-specific binding molecules and methods of use thereof
US11208480B2 (en) 2014-06-27 2021-12-28 Innate Pharma Multispecific antigen binding proteins
US11845795B2 (en) 2014-06-27 2023-12-19 Innate Pharma NKp46 binding proteins
US10519234B2 (en) 2014-06-27 2019-12-31 Innate Pharma NKp46 binding proteins
WO2016030488A1 (en) 2014-08-27 2016-03-03 Innate Pharma Treatment of celiac disease
WO2016062851A1 (en) 2014-10-23 2016-04-28 Innate Pharma Treatment of cancers using anti-nkg2a agents
EP3659625A1 (en) 2014-10-23 2020-06-03 Innate Pharma Treatment of cancers using anti-nkg2a agents
EP3816179A2 (en) 2015-02-05 2021-05-05 Chugai Seiyaku Kabushiki Kaisha Fc region variant comprising a modified fcrn-binding domain
WO2016125495A1 (en) 2015-02-05 2016-08-11 Chugai Seiyaku Kabushiki Kaisha Antibodies comprising an ion concentration dependent antigen-binding domain, fc region variants, il-8-binding antibodies, and uses therof
EP4303235A2 (en) 2015-06-08 2024-01-10 MacroGenics, Inc. Lag-3-binding moleculkes and methods of use thereof
US11072653B2 (en) 2015-06-08 2021-07-27 Macrogenics, Inc. LAG-3-binding molecules and methods of use thereof
US12600779B2 (en) 2015-06-08 2026-04-14 Macrogenics, Inc. LAG-3-binding molecules and methods of use thereof
US11858991B2 (en) 2015-06-08 2024-01-02 Macrogenics, Inc. LAG-3-binding molecules and methods of use thereof
US11078279B2 (en) 2015-06-12 2021-08-03 Macrogenics, Inc. Combination therapy for the treatment of cancer
US11267897B2 (en) 2015-06-23 2022-03-08 Innate Pharma Multispecific NK engager protein
US12252543B2 (en) 2015-06-23 2025-03-18 Innate Pharma Multispecific NK engager protein
WO2016207278A1 (en) 2015-06-23 2016-12-29 Innate Pharma Multispecific nk engager proteins
WO2016207273A2 (en) 2015-06-23 2016-12-29 Innate Pharma Multispecific antigen binding proteins
EP3981792A1 (en) 2015-07-30 2022-04-13 MacroGenics, Inc. Pd-1-binding molecules and methods of use thereof
EP4450088A2 (en) 2015-07-30 2024-10-23 MacroGenics, Inc. Pd-1-binding molecules and methods of use thereof
US12534531B2 (en) 2015-07-30 2026-01-27 Macrogenics, Inc. PD-1-binding molecules and methods of use thereof
EP3456346A1 (en) 2015-07-30 2019-03-20 MacroGenics, Inc. Pd-1 and lag-3 binding molecules and methods of use thereof
US10577422B2 (en) 2015-07-30 2020-03-03 Macrogenics, Inc. PD-1-binding molecules and methods of use thereof
WO2017019846A1 (en) 2015-07-30 2017-02-02 Macrogenics, Inc. Pd-1-binding molecules and methods use thereof
US11623959B2 (en) 2015-07-30 2023-04-11 Macrogenics, Inc. PD-1-binding molecules and methods of use thereof
WO2017046994A1 (en) 2015-09-18 2017-03-23 Chugai Seiyaku Kabushiki Kaisha Il-8-binding antibodies and uses thereof
US11174315B2 (en) 2015-10-08 2021-11-16 Macrogenics, Inc. Combination therapy for the treatment of cancer
US11840571B2 (en) 2015-12-14 2023-12-12 Macrogenics, Inc. Methods of using bispecific molecules having immunoreactivity with PD-1 and CTLA-4
US10954301B2 (en) 2015-12-14 2021-03-23 Macrogenics, Inc. Bispecific molecules having immunoreactivity with PD-1 and CTLA-4, and methods of use thereof
EP4112641A1 (en) 2016-03-15 2023-01-04 Chugai Seiyaku Kabushiki Kaisha Methods of treating cancers using pd-1 axis binding antagonists and anti-gpc3 antibodies
WO2017159699A1 (en) 2016-03-15 2017-09-21 Chugai Seiyaku Kabushiki Kaisha Methods of treating cancers using pd-1 axis binding antagonists and anti-gpc3 antibodies
WO2017157895A1 (en) 2016-03-15 2017-09-21 Innate Pharma Anti-mica antibodies
US11591400B2 (en) 2016-04-15 2023-02-28 Macrogenics, Inc. B7-H3 directed antibody drug conjugates
US10961311B2 (en) 2016-04-15 2021-03-30 Macrogenics, Inc. B7-H3 binding molecules, antibody drug conjugates thereof and methods of use thereof
WO2018073363A1 (en) 2016-10-21 2018-04-26 Innate Pharma Treatment with anti-kir3dl2 agents
WO2018115262A1 (en) 2016-12-23 2018-06-28 Innate Pharma Heterodimeric antigen binding proteins
US11459378B2 (en) 2017-01-30 2022-10-04 Ohio State Innovation Foundation Passive antibody dependent cell-mediated activation
WO2019059411A1 (en) 2017-09-20 2019-03-28 Chugai Seiyaku Kabushiki Kaisha DOSAGE FOR POLYTHERAPY USING PD-1 AXIS BINDING ANTAGONISTS AND GPC3 TARGETING AGENT
WO2019101695A1 (en) 2017-11-21 2019-05-31 Innate Pharma Multispecific antigen binding proteins
WO2019234576A1 (en) 2018-06-03 2019-12-12 Lamkap Bio Beta Ltd. Bispecific antibodies against ceacam5 and cd47
US11555071B2 (en) 2018-06-03 2023-01-17 Lamkap Bio Beta Ltd. Bispecific antibodies against CEACAM5 and CD47
WO2020152081A1 (en) 2019-01-22 2020-07-30 Innate Pharma Treatment of t cell lymphoma
WO2020189748A1 (ja) 2019-03-19 2020-09-24 中外製薬株式会社 Mta依存的に抗原に対する結合活性が変化する抗原結合ドメインを含む抗原結合分子及び当該抗原結合ドメイン取得用ライブラリ
EP3831849A1 (en) 2019-12-02 2021-06-09 LamKap Bio beta AG Bispecific antibodies against ceacam5 and cd47
WO2021110647A1 (en) 2019-12-02 2021-06-10 Lamkap Bio Beta Ag Bispecific antibodies against ceacam5 and cd47
WO2021146383A1 (en) 2020-01-17 2021-07-22 BioLegend, Inc. Anti-tlr7 agents and compositions and methods for making and using the same
WO2022093641A1 (en) 2020-10-30 2022-05-05 BioLegend, Inc. Anti-nkg2a agents and compositions and methods for making and using the same
WO2022093640A1 (en) 2020-10-30 2022-05-05 BioLegend, Inc. Anti-nkg2c agents and compositions and methods for making and using the same
WO2022130348A1 (en) 2020-12-18 2022-06-23 Lamkap Bio Beta Ag Bispecific antibodies against ceacam5 and cd47
US11753481B2 (en) 2020-12-18 2023-09-12 Lamkap Bio Beta Ltd Bispecific antibodies against CEACAM5 and CD47
WO2022200525A1 (en) 2021-03-26 2022-09-29 Innate Pharma Multispecific proteins comprising an nkp46-binding site, a cancer antgienge binding site fused to a cytokine for nk cell engaging
WO2022258678A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific proteins binding to nkp30, a cytokine receptor, a tumour antigen and cd16a
WO2022258673A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific antibodies binding to cd20, nkp46, cd16 and conjugated to il-2
WO2022258662A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific proteins binding to nkp46, a cytokine receptor, a tumour antigen and cd16a
WO2022258691A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific proteins binding to nkg2d, a cytokine receptor, a tumour antigen and cd16a
WO2023242351A1 (en) 2022-06-16 2023-12-21 Lamkap Bio Beta Ag Combination therapy of bispecific antibodies against ceacam5 and cd47 and bispecific antibodies against ceacam5 and cd3
WO2024020051A1 (en) 2022-07-19 2024-01-25 BioLegend, Inc. Anti-cd157 antibodies, antigen-binding fragments thereof and compositions and methods for making and using the same
WO2024040114A2 (en) 2022-08-18 2024-02-22 BioLegend, Inc. Anti-axl antibodies, antigen-binding fragments thereof and methods for making and using the same
WO2024243217A1 (en) 2023-05-25 2024-11-28 BioLegend, Inc. Ceacam6 binding antibodies and antigen-binding fragments thereof
WO2024251884A1 (en) 2023-06-09 2024-12-12 Innate Pharma Nk cell engager proteins comprising anti-cd20 and ant-nkp46 antibody, linked to il-2 in treatment of r/r b-nhl

Also Published As

Publication number Publication date
WO2007021841A3 (en) 2009-06-18
EP1919503A2 (en) 2008-05-14
IL189263A0 (en) 2008-08-07
LT2573114T (lt) 2016-10-10
SI1919503T1 (sl) 2015-02-27
US20070036799A1 (en) 2007-02-15
JP2009507470A (ja) 2009-02-26
DK1919503T3 (en) 2014-12-15
DK2573114T3 (en) 2016-07-04
WO2007021841A9 (en) 2009-08-20
PL1919503T3 (pl) 2015-04-30
PL2573114T3 (pl) 2016-10-31
AU2006279945B2 (en) 2012-04-12
HUE029465T2 (en) 2017-02-28
EP1919503A4 (en) 2010-11-17
AU2006279945A1 (en) 2007-02-22
CA2618681A1 (en) 2007-02-22
US20120276094A1 (en) 2012-11-01
JP5105485B2 (ja) 2012-12-26
ES2526811T3 (es) 2015-01-15
SI2573114T1 (sl) 2016-08-31
ES2579602T3 (es) 2016-08-12
US8697071B2 (en) 2014-04-15
CY1117754T1 (el) 2017-05-17
PT2573114T (pt) 2016-07-13
CY1115879T1 (el) 2019-07-10
US8217147B2 (en) 2012-07-10
EP2573114B1 (en) 2016-03-30
CA2618681C (en) 2015-10-27
IL189263B (en) 2019-05-30
EP1919503B1 (en) 2014-09-24
EP2573114A1 (en) 2013-03-27
PT1919503E (pt) 2015-01-05

Similar Documents

Publication Publication Date Title
US20240018261A1 (en) METHODS FOR THE TREATMENT OF DISEASE USING IMMUNOGLOBULINS HAVING FC REGIONS ALTERED AFFINITIES FOR FcyRActivating and FcyRInhibiting
US7960512B2 (en) Identification and engineering of antibodies with variant Fc regions and methods of using same
AU2006279945B2 (en) Identification and engineering of antibodies with variant FC regions and methods of using same
US7632497B2 (en) Engineering Fc Antibody regions to confer effector function
EP1587540B1 (en) IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME
US20090098124A1 (en) Identification and engineering of antibodies with variant heavy chains and methods of using same
US20080112961A1 (en) Identification and Engineering of Antibodies with Variant Fc Regions and Methods of Using Same
IL180549A (en) Antibodies with fc and variant region and their use
HK1101645A (en) Identification and engineering of antibodies with variant fc regions and methods of using the same
HK1101645B (en) Identification and engineering of antibodies with variant fc regions and methods of using the same
HK1115822B (en) Identification and engineering of antibodies with variant fc regions and methods of using same
HK1115822A (en) Identification and engineering of antibodies with variant fc regions and methods of using same
HK1085911A (en) Identification and engineering of antibodies with variant fc regions and methods of using same
HK1085911B (en) IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 189263

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2006279945

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2618681

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2008526195

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 2006801146

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2006279945

Country of ref document: AU

Date of ref document: 20060810

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2052/DELNP/2008

Country of ref document: IN