WO2006113528A2 - Expressing hepatitis b virus surface antigen for vaccine preparation - Google Patents
Expressing hepatitis b virus surface antigen for vaccine preparation Download PDFInfo
- Publication number
- WO2006113528A2 WO2006113528A2 PCT/US2006/014240 US2006014240W WO2006113528A2 WO 2006113528 A2 WO2006113528 A2 WO 2006113528A2 US 2006014240 W US2006014240 W US 2006014240W WO 2006113528 A2 WO2006113528 A2 WO 2006113528A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- composition
- hbsag
- hbv
- coding sequence
- plasmid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0016—Combination vaccines based on diphtheria-tetanus-pertussis
- A61K39/0017—Combination vaccines based on whole cell diphtheria-tetanus-pertussis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/05—Actinobacteria, e.g. Actinomyces, Streptomyces, Nocardia, Bifidobacterium, Gardnerella, Corynebacterium; Propionibacterium
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/08—Clostridium, e.g. Clostridium tetani
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/095—Neisseria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/099—Bordetella
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/102—Pasteurellales, e.g. Actinobacillus, Pasteurella; Haemophilus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/8509—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/01—Animal expressing industrially exogenous proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55572—Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2730/00—Reverse transcribing DNA viruses
- C12N2730/00011—Details
- C12N2730/10011—Hepadnaviridae
- C12N2730/10111—Orthohepadnavirus, e.g. hepatitis B virus
- C12N2730/10134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- This invention is in the field of protein expression, in particular for expressing hepatitis B virus surface antigen (HBsAg) for use in preparing vaccines.
- HBsAg hepatitis B virus surface antigen
- Hepatitis B vaccines have been available for many years (e.g. see chapter 16 of reference 1), and their active ingredient is the surface antigen (HBsAg) from hepatitis B virus (HBV).
- HBV vaccines used HBsAg that had been purified from human blood, but vaccines based on recombinantly-expressed HBsAg became widely available in the 1990s. Since then, HBsAg has also been incorporated as a component in multivalent vaccines i.e. vaccines containing a mixture of immunogens from more than one pathogen, such that administration of the vaccine can simultaneously immunize a subject against more than one pathogen.
- multivalent vaccines typically include HBsAg plus at least 'DTP' (diphtheria, tetanus and pertussis) antigens.
- ENGERIX BTM includes an aluminum hydroxide adjuvant. More recently, monovalent HBV vaccines based on more modern adjuvants have become available e.g. using the 'AS04' adjuvant [2] in the FENDRIXTM product from GSK, the RC-529 adjuvant in the SUPERV AXTM product from Berna Biotech, or CpG oligonucleotide adjuvants such as CPG7909 [3] from Coley Pharmaceuticals.
- Expression hosts that have been used include bacteria, yeasts (including Saccharomyces, Hanensula and Pichia species), mammalian cell culture (including CHO cells, COS cells, Bu3 cells), insect cells (using baculovirus vectors), and plant cells (e.g. for 'edible vaccines').
- HBsAg is expressed in a Saccharomyces cerevisiae host.
- Various options are available for yeast-based expression of HBsAg, including choices of yeast species and strain, culture conditions, the promoter used to control expression, gene termination sequences, codon usage, etc.
- HBsAg is expressed in a Saccharomyces cerevisiae host carrying a plasmid having a HBsAg coding sequence, wherein the plasmid includes: (1) an upstream promoter from a glyceraldehyde-3- phosphate dehydrogenase gene, for controlling expression of the HBsAg coding sequence; and (2) an ARG3 transcription terminator downstream of the HBsAg coding sequence.
- the plasmids will also typically include: (3) a LEU2 selection marker; (4) a 2 ⁇ plasmid sequence; and (5) an origin of replication functional in Escherichia coli.
- HBsAg can be expressed in this Saccharomyces cerevisiae host, and can be purified for use in the manufacture of vaccines, and in particular for the manufacture of combination vaccines and in new monovalent HBV vaccines.
- This yeast-expressed material is suitable for use in these complex vaccines despite the reports in reference 29 that S.cerevisiae-expressed HBsAg can have immunosuppressive potential.
- the invention provides a process for preparing a multivalent immunogenic composition, comprising the steps of: (a) preparing a HBV component by purifying HBsAg after expression in a S. cerevisiae host of the invention; (b) preparing at least one non-HBV component; and (c) mixing the HBV and non-HBV components to give the multivalent composition.
- the invention also provides a multivalent immunogenic composition
- a multivalent immunogenic composition comprising: (a) a HBV component comprising HBsAg expressed in a S.cerevisiae host of the invention; and (b) at least one non-HBV component.
- the composition typically also includes one or more adjuvant(s).
- These multivalent compositions are particularly useful for simultaneously protecting against infection by HBV and non-HBV pathogens in children.
- a typical patient will be in the first year of life, and will receive a first dose of the composition between 6 and 9 weeks after birth. Two or three further doses will typically be administered, given at intervals of about 6 to 8 weeks.
- the composition may also be used to complete the primary immunization schedule of a different vaccine.
- the composition may also be used as a booster e.g. in children aged 1-16 years.
- the invention also provides a process for preparing a monovalent immunogenic composition, comprising the steps of: (a) preparing a HBV component by purifying HBsAg after expression in a S.cerevisiae host of the invention; (b) combining the HBsAg with an adjuvant to give the immunogenic composition.
- the adjuvant is preferably not an aluminum hydroxide adjuvant, and is more preferably not solely an aluminum salt adjuvant.
- the invention also provides a monovalent immunogenic composition
- a monovalent immunogenic composition comprising: (a) a HBV component comprising HBsAg expressed in a S.cerevisiae host of the invention; and (b) an adjuvant.
- compositions are particularly useful for protecting against and/or treating hepatitis B virus infections in patients for whom existing adjuvanted vaccines (such as the ENGERIX BTM product) are ineffective.
- Sub-groups of patients for whom the compositions are particularly suitable include: immunocompromised patients; hemodialysis patients; pre-hemodialysis patients; patients with renal insufficiency; patients with renal failure; patients with early renal failure before they require hemodialysis; patients awaiting liver transplantation e.g. on waiting lists; patients with end-stage renal failure; patients who have received an organ transplant (particularly a liver transplant) e.g. in the 6 month period preceding a first dose of the vaccine of the invention; patients who are receiving (or have been receiving e.g.
- HBIg hepatitis B immunoglobulin
- patients may have a creatinine clearance rate of less than 30ml/min (the normal healthy range being -100-140 ml/min in males and 90-130 ml/min in females).
- Patients are preferably at least 15 years old e.g. between 15-40 years, between 15-60 years, between 40-60 years, or even over 60. Patients aged over 55 can usefully be treated regardless of any underlying illness.
- the HBV virion consists of an inner core surrounded by an outer protein coat or capsid.
- the major component of the capsid is a protein referred to as 'HBsAg'.
- All existing hepatitis B vaccines contain HBsAg, and when this antigen is administered to a normal vaccinee it stimulates the production of anti-HBsAg antibodies which protect against HBV infection.
- HBsAg can be made in two ways.
- the first method involves purifying the antigen in particulate form from the plasma of chronic hepatitis B carriers, as large quantities of HBsAg are synthesized in the liver and released into the blood stream during an HBV infection.
- the second way involves expressing the protein by recombinant DNA methods.
- HBsAg for use with the present invention is recombinantly expressed in a Saccharomyces cerevisiae yeast.
- HBsAg used with the invention is non-glycosylated.
- This form of HBsAg is preferred because it is highly immunogenic and can be prepared without the risk of blood product contamination.
- the yeast-expressed HBsAg is advantageously in the form of substantially-spherical particles (average diameter of about 20nm), including a lipid matrix comprising phospholipids.
- the yeast-expressed particles may include phosphatidylinositol.
- the lipid matrix may include a non-ionic surfactant, such as polysorbate 20, which may be incorporated into the matrix during purification of the antigen from a yeast expression host.
- a non-ionic surfactant such as polysorbate 20
- polysorbate 20 during disruption of recombinant yeast cells at the start of HBsAg purification is one way in which it can be introduced into the HBsAg particles.
- the polysorbate 20 will typically be present at a weight ratio of at least 5 ⁇ g per lOO ⁇ g of HBsAg.
- HBV subtypes contain the common determinant 'a'. Combined with other determinants and subdeterminants, nine subtypes have been identified: aywl, ayw2, ayw3, ayw4, ayr, adw2, adw4, adrq- and adrq+. Besides these subtypes, other variants have emerged, such as HBV mutants that have been detected in immunised individuals ("escape mutants"). Whereas some studies have found that the majority of sera in non-responders (e.g. in hemodialysis patients) are infected with adw4 or ayw3 subtypes (e.g.
- HBV subtype adw2 the most preferred HBV subtype for use with the invention is subtype adw2. This subtype was found in a single hemodialysis patient in reference 32, and in only a small number of outbreaks of HBV infection among hemodialysis patients in California & Kansas during 1994 [34] and later in Brazil [35,36], but it highly immunogenic and effective in more than 98% of hemodialysis patients.
- a preferred HBsAg has the following 226-mer amino acid sequence (SEQ ID NO: 3): M ⁇ NITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYR WMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTNTGPCKTCTTPAQGNSMFPSCCCTKPTDGN CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIF FCLWVYI
- the invention can use SEQ ID NO: 3, or a sequence differing from SEQ ID NO: 3 by up to 10 (i.e. 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10) single amino acid substitutions.
- the HBsAg-coding sequence can be the following 678-mer nucleotide sequence (SEQ DD NO: 4): atggagaacatcacatcaggattcctaggacccctgctcgtgttacaggcggggtttttcttgttgacaagaa tcctcacaataccgcagagtctagactcgtggtggacttctctcaattttctagggggatcacccgtgtgtct tggccaaaattcgcagtccccaacctccaatcactcaccaacctcctgtcctccaattttgtcctggttatcgc tggatttgctggttatcgc tggatgtttatcgc tggatgtgtctggttatcgc tggatgtttatcgc tggatgtgtctggtt
- a surface antigen may include all or part of a pre-S sequence, such as all or part of a pre-S 1 and/or pre-S2 sequence. It is preferred, however, to use only the S sequence, as shown above.
- HBsAg is expressed in a Saccharomyces cerevisiae host carrying a plasmid having an upstream promoter from a glyceraldehyde-3-phosphate dehydrogenase (GAPDH) gene, and in particular from a yeast GAPDH [37-40.
- GPDH glyceraldehyde-3-phosphate dehydrogenase
- the promoter is linked to the HBsAg-coding sequence in order toregulate its transcription.
- Glyceraldehyde-3-phosphate dehydrogenase is a glycolytic enzyme, and its promoter has been found to be particularly suitable for controlling expression of HBsAg in S.cerevisiae [41].
- the GAPDH promoter disclosedinreference 41 has the following 1061-mer sequence (SEQ ID NO: 5): aagcttaccagttctcacacggaacaccactaatggacacaaattcgaaatactttgaccctatttttcgagga ccttgtcaccttgagcccaagagagccaagatttaaattttcctatgacttgatgcaaattcccaaagctaat aacatgcaagacacgtacggtcaagaagacatatttgacctcttaactggttcagacgcgactgcctcatcag taagacccgttgaa
- This sequence differs from SEQ ID NO: 5 as follows: (1) A/C substitution at nucleotide 42; (2) T/A substitution at nucleotide 194; (3) C/A mutation at nucleotide 301; (4) A insertion at nucleotide 471; (5) C /T substitution at residue 569; (6) T/C substitution at residue 597; (7) T insertion at nucleotide 604 (penta-T instead of tetra-T); and (8) replacement of 3' GCTT sequence with a single A:
- the invention can use the SEQ ID NO: 1 promoter sequence, or a sequence differing from SEQ ID NO: 1 by up to 20 ⁇ i.e. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20) point mutations, each point mutation being the deletion, substitution or insertion of a single nucleotide.
- the 1060-mer sequence is preferably immediately upstream of the ATG start codon encoding the N-terminus ofthe HBsAg (SEQ ID NO: 2) e.g.: aagcttaccagttctcacacggaacaccactaatggacacacattcgaaatactttgaccctattttcgagga ccttgtcaccttgagcccaagagagccaagatttaaattttcctatgacttgatgcaaattcccaaagctaat aacatgcaagacacgtacggtcaagaagacatatttgacctcttaacaggttcagacgcgactgcctcatcag taagacccgttgaaaagaacttacctgaaaaaacgaatatatactagcgttgaatgttagcgtcaacaacaa ga
- HBsAg is expressed in a Saccharomyces cerevisiae host carrying a plasmid having an downstream transcription terminator from ARG3.
- the terminator is linked to the HBsAg-coding sequence in orderto regulate its transcription.
- the ARG3 gene in yeast encodes the ornithine carbamoyltransferase enzyme [42] and its transcription termination sequence has been used in several yeast recombinant expression systems [43-45]. It is useful for controlling HBsAg expression in yeast, particularly in combination with a GAPDHpromoter.
- sequence immediately downstream of the ARG3 stop codon is the following 450-mer (SEQID NO: 6): tccttctttcgtgttcttaataactaatatataaatacagatatagatgcatgaataatgatatacattgatt attttgcaatgtcaattaaaaaaaaaatgttagtaaaactatgttacattccaagcaaataaagcacttgg ttaaacgaaattaacgtttttaagacagccagaccgcggtctaaaaatttaaatatacactgccaacaaattc cttcgagttgtccaatttcaccactttttatattttcatcaacttcagcagattcaaccttctcacatagaaca tggaataaacagccttta
- the ARG3 gene includes the following 700-mer sequence (SEQID NO: 7): agaatttgcgaaacaggccaagctgaaacaattcaaaggttttcaaatcaatcaagaacttgtctctgtggct gatccaaactacaaatttatgcattgtctgccaagacatcaagaagaagttagtgatgatgtcttttatggag agcattccatagtctttgaagaagcagaaaacagattatatgcagctatgtctgccattgatatcttttgttaa taataaaggtaatttcaaggacttgaaaTAAtccttctttcgtgtttttaataactaatacagat atagatgcatgaataatgatatgatatatatatatatatatatatatatatatatatatat ata
- a preferred terminator for use with the invention includes a portion of both the coding and downstream sequences from this ARG3 region, and in particular comprises the following 689-mer nucleotide sequence (SEQ ID NO: 8), which has the same 3' terminus as SEQ ID NO: 7: cgaattccaagctgaaacaattcaaaggttttcaaatcaatcaagaacttgtctctgtggctgatccaaacta caaatttatgcattgtctgccaagacatcaagaagaagttagtgatgatgtcttttatggagagcattccata gtctttgaagaagcagaaaacagattatatgcagctatgtctgccattgatatctttgttaataataaaggta atttcaaggacttgaaa
- Further downstream terminator sequence from ARG3 can also be present. Up to 1500 nucleotides from ARG3 can be included (i.e. up to a further 800 nucleotides downstream of SEQ ID NO: 7) e.g. up to 1200 nucleotides, or about 1150 nucleotides.
- the invention can use the SEQ ID NO: 8 terminator sequence, or a sequence differing from SEQ ID NO: 8 by up to 30 (i.e. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40) point mutations, each point mutation being the deletion, substitution or insertion of a single nucleotide.
- the 689-mer sequence is preferably immediately downstream of the stop codon at the C-terminus of the HBsAg (SEQ ID NO: 9) e.g. :
- Plasmids of the invention will also typically include 1, 2 or (preferably) all 3 of the following elements: a LEU2 selection marker; a 2 ⁇ plasmid sequence; and an origin of replication functional in E.coli. These three components have previously been described in plasmids used for HBsAg expression [45].
- the LEU2 selection marker is frequently used in yeast genetics.
- LEU2 encodes 3-isopropylmalate dehydrogenase, which is the third enzyme in the leucine biosynthesis pathway.
- the LEU2 marker on the plasmid confers the ability to synthesize leucine from metabolic precursors, and is used in host cells that are leucine auxotrophs e.g. LEU2 null mutants.
- leucine auxotrophs e.g. LEU2 null mutants.
- the LEU2 marker permits a leucine auxotroph, which cannot normally grow without a leucine supply, to grow in the absence of leucine.
- the 2 ⁇ plasmid sequence is also familiar in yeast genetics [46] and has been used to increase plasmid copy number. Any suitable 2 ⁇ plasmid sequence can be used in the plasmids of the invention.
- the plasmid includes a yeast origin of replication, and this is typically provided by the 2 ⁇ sequence.
- plasmids can act as shuttle vectors between yeast and E.coli, thereby permitting manipulation of the plasmid in the convenience of E.coli systems.
- a plasmid comprising the following elements: (1) a HBsAg coding sequence; (2) a promoter from a glyceraldehyde-3-phosphate dehydrogenase gene, upstream of and for controlling expression of the HBsAg coding sequence; and (3) an ARG3 transcription terminator downstream of the HBsAg coding sequence.
- the plasmid may also include the following elements: (4) a LEU2 selection marker; (5) a 2 ⁇ plasmid sequence; and (6) an origin of replication functional in E.coli.
- the HBsAg coding sequence preferably encodes HBsAg with amino acid sequence SEQ ID NO: 3, or a sequence differing from SEQ ID NO: 3 by up to 10 (i.e. 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10) single amino acid substitutions.
- the GAPDH promoter sequence preferably comprises SEQ ID NO: 1, or a sequence differing from SEQ ID NO: 1 by up to 20 (i.e. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20) point mutations.
- the ARG3 terminator preferably comprises SEQ ID NO: 8, or a sequence differing from SEQ ID NO: 8 by up to 20 (i.e. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20) point mutations.
- the plasmid can be maintained in a S.cerevisiae host and can be used for expression of HBsAg.
- Plasmids with between 14500 and 15000 bp are preferred e.g. between 14600 and 14700 bp.
- the S.cerevisiae host Saccharomyces cerevisiae is a widely-used yeast host for recombinant expression. Any suitable S.cerevisiae host can be used with the invention. It is preferred, however, to use a host that is auxotrophic for leucine, such that a LEU2 selection marker can be used in the plasmid.
- the host cell may be a leu2-3 Ieu2-112 mutant.
- yeast hosts are his3 and/or canl-11.
- a most preferred yeast host is leu2-3 Ieu2-112 his3 canl-11, such as the DC5 strain.
- the invention provides a yeast carrying a plasmid of the invention.
- the invention also provides the use of this yeast in the manufacture of a composition of the invention.
- yeast culture for recombinant protein expression are well known in the art.
- Yeast may be cultured in a synthetic medium e.g. containing purified amino acids (typically omitting leucine where a LEU2 marker is being used), vitamins, salts, etc.
- HBsAg can then be purified by a process involving steps such as precipitation, ion exchange chromatography, and ultrafiltration. Other steps that may be used during its purification include gel permeation chromatography, and cesium chloride ultracentrifugation .
- a particularly preferred step for inclusion in the overall purification process is a step of cell disruption in the presence of a non-ionic detergent, such as Triton-XlOO or a fatty acid esters of polyoxyethylene sorbitan, such as polyoxyethylene sorbitan monooleate (also known as polysorbate 80) or, more preferably, polyoxyethylene sorbitan monolaurate (also known as polysorbate 20).
- a non-ionic detergent such as Triton-XlOO or a fatty acid esters of polyoxyethylene sorbitan, such as polyoxyethylene sorbitan monooleate (also known as polysorbate 80) or, more preferably, polyoxyethylene sorbitan monolaurate (also known as polysorbate 20).
- the disrupted cells can then be centrifuged to give a supernatant in which the HBsAg is found.
- the protein can then be purified from the supernatant e.g. using the process disclosed in reference 47.
- HBsAg may be subjected to dialysis ⁇ e.g. with cysteine), which can be used to remove any mercurial preservatives such as thimerosal that may have been used during HBsAg preparation [48].
- HBsAg expressed and purified according to the invention can be combined with further non-HBV antigens to prepare multivalent vaccines, or can be combined with new adjuvants to prepare improved monovalent vaccines.
- HBsAg expressed and purified according to the invention can be combined with new adjuvants to prepare improved monovalent vaccines.
- Three specific adjuvants of interest for use in monovalent HBV vaccines are: CpG oligonucleotides; aminoalkyl glucosaminide phosphate derivatives; and mixtures of 3d-MPL with aluminum salts.
- CpG oligonucleotide adjuvants are immunostimulatory oligonucleotides that include nucleotide sequences containing a CpG motif (a dinucleotide sequence containing an unmethylated cytosine followed by guanosine).
- Bacterial double stranded RNA or oligonucleotides containing palindromic or poly(dG) sequences have also been shown to be immunostimulatory.
- the CpG' s can include nucleotide modifications/analogs such as phosphorothioate modifications and can be double-stranded or single-stranded.
- the guanosine may be replaced with an analog such as 2'-deoxy-7- deazaguanosine.
- References 49-51 give examples of possible analog substitutions.
- the adjuvant effect of CpG oligonucleotides is further discussed in references 52-57 ' .
- the CpG sequence may be directed to TLR9, such as the motif GTCGTT (SEQ E) NO: 11) or TTCGTT (SEQ ID NO: 12) [58].
- the CpG sequence may be specific for inducing a ThI immune response, such as a CpG-A ODN, or it may be more specific for inducing a B cell response, such a CpG-B ODN.
- CpG-A and CpG-B ODNs are discussed in refs. 59-61.
- the CpG is a CpG- A ODN.
- the CpG oligonucleotide is constructed so that the 5' end is accessible for receptor
- the CpG oligonucleotide is constructed so that the 5' end is accessible for receptor recognition.
- two CpG oligonucleotide sequences may be attached at their 3' ends to form "immunomers". See, for example, refs. 58 & 62-64.
- Aminoalkyl glucosaminide phosphate (AGP) derivatives include RC-529 [65-68], which is an aminoalkyl glucosaminide 4-phosphate sold by Corixa Corporation.
- AS04 is a mixture of an aluminum salt adjuvant and a 3D-MPL adjuvant [69].
- the HBsAg is preferably adsorbed onto the aluminum salt e.g. as described in ref. 70.
- the aluminum salt is a phosphate, and that at least 50% (by weight) of the total HBsAg is adsorbed to the aluminum phosphate e.g. >60%, >70%, >80%, >90%, >95%, >98% or more.
- the percentage that is adsorbed can conveniently be measured by separating the adsorbed material from the non-adsorbed material e.g.
- HBsAg in the supernatant e.g. measured by anti-HBsAg ELISA
- the adsorbed percentage can be calculated. It is preferred that the HBsAg is totally adsorbed i.e. none is detectable in supernatant.
- the 3D-MPL adjuvant can also be adsorbed onto the aluminum phosphate.
- the percentage that is adsorbed can be measured in the same way as for HBsAg.
- concentration of unadsorbed 3D-MPL should be less than 25 ⁇ g/ml e.g. ⁇ 20 ⁇ g/ml, ⁇ 15 ⁇ g/ml, ⁇ 10 ⁇ g/ml, ⁇ 5 ⁇ g/ml, ⁇ 20 ⁇ g/ml, ⁇ l ⁇ g/ml,etc.
- Aluminum phosphate adjuvants are described below in more detail.
- 3-O-deacylated monophosphoryl lipid A has also been referred to as 3 de-O-acylated monophosphoryl lipid A or as 3-O-desacyl-4'-monophosphoryl lipid A.
- the name indicates that position 3 of the reducing end glucosamine in monophosphoryl lipid A is de-acylated. It has been prepared from a heptoseless mutant of Salmonella minnesota, and is chemically similar to lipid A but lacks an acid-labile phosphoryl group and a base-labile acyl group.
- 3D-MPL activates cells of the monocyte/macrophage lineage and stimulates release of several cytokines, including IL-I, IL- 12, TNF- ⁇ and GM-CSF.
- cytokines including IL-I, IL- 12, TNF- ⁇ and GM-CSF.
- MPLTM Preparation of 3D-MPL was originally described in reference 71, and the product has been manufactured and sold by Corixa Corporation under the trade name MPLTM. Further details can be found in references 72 to 75.
- the 3D-MPL can be included in combination with a triethanolamine, triethylammonium or triethylamine ion.
- 3D-MPL can take the form of a mixture of related molecules, varying by their acylation ⁇ e.g. having
- the two 2-deoxy-2-amino-glucose monosaccharides are N-acylated at their 2-position carbons (i.e. at positions 2 and 2'), and there is also O-acylation at the 3' position.
- the group attached to carbon 2 has formula -NH-CO-CH 2 -CR 1 R 1 .
- the group attached to carbon 2' has formula -NH-CO-CH 2 -CR 2 R 2 .
- the group attached to carbon 3' has formula -0-CO-CH 2 -CR 3 R 3' .
- a representative structure is shown below:
- Groups R 1 , R 2 and R 3 are each independently -(CH 2 ) n -CH 3 .
- the value of n is preferably between 8 and 16, more preferably between 9 and 12, and is most preferably 10.
- Groups R 1' , R 2' and R 3' can each independently be: (a) -H; (b) -OH; or (c) -O-CO-R 4 ,where R 4 is either -H or -(CH 2 ) In -CH 3 , wherein the value of m is preferably between 8 and 16, and is more preferably 10, 12 or 14. At the 2 position, m is preferably 14. At the 2' position, m is preferably 10. At the 3' position, m is preferably 12.
- Groups R 1 , R 2 and R 3 are thus preferably -O-acyl groups from dodecanoic acid, tetradecanoic acid or hexadecanoic acid.
- the 3D-MPL has only 3 acyl chains (one on each of positions 2, 2 1 and 3').
- the 3D-MPL can have 4 acyl chains.
- the 3D-MPL can have 5 acyl chains.
- the 3D-MPL can have 6 acyl chains.
- the 3D-MPL adjuvant used according to the invention can be a mixture of these forms, with from 3 to 6 acyl chains, but it is preferred to include 3D-MPL with 6 acyl chains in the mixture, and in particular to ensure that the 6 acyl chain form makes up at least 10% by weight of the total 3D-MPL e.g. >20%, >30%, >40%, >50% or more. 3D-MPL with 6 acyl chains has been found to be the most adjuvant-active form.
- 3D-MPL can form micellar aggregates or particles with different sizes e.g. with a diameter ⁇ 150nm or >500nm. Either or both of these can be used with the invention, and the better particles can be selected by routine assay. Smaller particles (e.g. small enough to give a clear aqueous suspension of 3D-MPL) have been reported to be superior [76] and are preferred for use according to the invention. Preferred particles have a mean diameter less than 220nm, more preferably less than 200nm, less than 150nm, or less than 120nm. They can even have a mean diameter less than lOOnm. In most cases, however, the mean diameter will not be lower than 50nm. Where 3D-MPL is adsorbed to aluminum phosphate then it may not be possible to measure the 3D-MPL particle size directly, but particle size can be measured before adsorption takes place.
- Particle diameter can be assessed by the routine technique of dynamic light scattering, which reveals a mean particle diameter. Where a particle is said to have a mean diameter of x nm, there will generally be a distribution of particles about this mean, but at least 50% by number ⁇ e.g. >60%, >70%, >80%, >90%, or more) of the particles will have a diameter within the range x+20%.
- HBsAg expressed and purified according to the invention can be combined with one or more non-HBV antigens to prepare multivalent vaccines.
- the non-HBV antigens can include bacterial and/or viral antigens.
- Typical non-HBV components for use according to the invention include, but are not limited to:
- T' tetanus toxoid
- T' pertussis antigen
- HAV hepatitis A virus
- IPV inactivated polio virus
- 'MenC' conjugated Neisseria meningitidis serogroup C capsular saccharide
- influenza virus antigen More than one of these non-HBV antigens can be used.
- the following combinations of antigens are particularly preferred:
- Tetravalent vaccines HBV-D-T-P.
- Pentavalent vaccines HBV-D-T-P-Hib; HBV-D-T-P-IPV.
- Hexavalent vaccines HBV-D-T-P-Hib-IPV.
- Heptavalent vaccines HBV-D-T-P-Hib-MenA-MenC; HBV-D-T-P-Hib-IPV-MenC.
- diphtheria toxoid ('D') is disclosed in more detail in chapter 13 of reference 1.
- Preferred diphtheria toxoids are those prepared by formaldehyde treatment.
- the diphtheria toxoid can be obtained by growing C.diphtheriae in growth medium (e.g. Fenton medium, or Linggoud & Fenton medium), which may be supplemented with bovine extract, followed by formaldehyde treatment, ultrafiltration and precipitation.
- the toxoided material may then be treated by a process comprising sterile filtration and/or dialysis. Quantities of diphtheria toxoid can be expressed in international units (IU).
- IU international units
- the NIBSC supplies the 'Diphtheria Toxoid Adsorbed Third International Standard 1999' [77,78], which contains 160 IU per ampoule.
- the 'Lf unit (“flocculating units” or the “limes flocculating dose”) is defined as the amount of toxoid which, when mixed with one International Unit of antitoxin, produces an optimally flocculating mixture [79].
- the NIBSC supplies 'Diphtheria Toxoid, Plain' [80], which contains 300 LF per ampoule, and also supplies 'The 1st International Reference Reagent For Diphtheria Toxoid For Flocculation Test' [81] which contains 900 Lf per ampoule.
- Tetanus toxoid (T') is disclosed in more detail in chapter 27 of reference 1.
- Preferred tetanus toxoids are those prepared by formaldehyde treatment.
- the tetanus toxoid can be obtained by growing C.tetani in growth medium ⁇ e.g. a Latham medium derived from bovine casein), followed by formaldehyde treatment, ultrafiltration and precipitation.
- the material may then be treated by a process comprising sterile filtration and/or dialysis.
- Quantities of tetanus toxoid can be expressed in international units (IU).
- the NIBSC supplies the 'Tetanus Toxoid Adsorbed Third International Standard 2000' [82,83], which contains 469 IU per ampoule.
- the 'Lf unit (“flocculating units” or the "limes flocculating dose") is defined as the amount of toxoid which, when mixed with one International Unit of antitoxin, produces an optimally flocculating mixture [79].
- the NIBSC supplies 'The 1st International Reference Reagent for Tetanus Toxoid For Flocculation Test' [84] which contains 1000 Lf per ampoule.
- Pertussis antigen can be either cellular ('wP') or acellular ('aP').
- Cellular pertussis antigens typically take the form of inactivated B.pertussis cells. Preparation of cellular pertussis antigens is well documented ⁇ e.g. see chapter 21 of reference 1) e.g. it may be obtained by heat inactivation of phase I culture of B.pertussis.
- Quantities of wP antigens can be expressed in international units (IU). For example, the NIBSC supplies the 'Third International Standard For Pertussis Vaccine' [85], which contains 46 IU per ampoule.
- Each ampoule contains the freeze-dried residue of 2.0 ml aliquots of an aqueous solution which contained 10 liters of bacterial suspension (equivalent to 180 opacity units in terms of the U.S. Opacity Standard) diluted with eight litres of M/15 Sorensen's buffer pH 7.0.
- the 'OU' unit (“opacity units") is also used ⁇ e.g. 4 OU may be about 1 IU).
- Acellular pertussis antigens currently used in vaccines include pertussis toxoid (PT), filamentous haemagglutinin (FHA), pertactin (also known as the '69 kiloDalton outer membrane protein'), and fimbriae ⁇ e.g. agglutinogens 2 and 3).
- the invention preferably uses at least two of, and preferably all three of, PT, FHA and pertactin ⁇ i.e. without using fimbriae).
- These three antigens are preferably prepared by isolation from B.pertussis culture grown in modified Stainer-Scholte liquid medium. PT and FHA can be isolated from the fermentation broth ⁇ e.g.
- PT and FHA can be purified by hydrophobic chromatography, affinity chromatography and size exclusion chromatography.
- Pertactin can be purified by ion exchange chromatography, hydrophobic chromatography and size exclusion chromatography.
- FHA and pertactin may be treated with formaldehyde prior to use according to the invention.
- PT is preferably detoxified by treatment with formaldehyde and/or glutaraldehyde.
- the PT may be a mutant PT in which enzymatic activity has been reduced by mutagenesis [86], but detoxification by chemical treatment is preferred.
- Quantities of acellular pertussis antigens are typically expressed in micrograms.
- Hepatitis A virus (HAV) vaccines are disclosed in chapter 15 of reference 1.
- a preferred HAV component is based on inactivated virus, and inactivation can be achieved by formalin treatment.
- Virus can be grown on human embryonic lung diploid fibroblasts, such as MRC-5 cells.
- a preferred HAV strain is HM175, although CR326F can also be used.
- the cells can be grown under conditions that permit viral growth.
- the cells are lysed, and the resulting suspension can be purified by ultrafiltration and gel permeation chromatography.
- H.influenzae type b capsular saccharide ('Hib') conjugates are disclosed in more detail in chapter 14 of reference 1.
- the Hib capsular saccharide is conjugated to a carrier protein in order to enhance its immunogenicity, especially in children.
- carrier proteins can be used, including diphtheria toxoid, CRM 197, an outer membrane protein complex from serogroup B meningococcus, H.influenzae protein D or tetanus toxoid.
- Tetanus toxoid is the preferred carrier, as used in the product commonly referred to as 'PRP-T'.
- PRP-T can be made by activating a Hib capsular polysaccharide using cyanogen bromide, coupling the activated saccharide to an adipic acid linker (such as (l-ethyl-3-(3-dimethylaminopropyl)carbodiimide), typically the hydrochloride salt), and then reacting the linker-saccharide entity with a tetanus toxoid carrier protein.
- the saccharide moiety of a Hib conjugate may comprise full-length polyribosylribitol phosphate (PRP) as prepared from Hib bacteria, and/or it may comprise fragments of full-length PRP.
- PRP polyribosylribitol phosphate
- Conjugates with a saccharide ⁇ rotein ratio (w/w) of between 1:5 (i.e. excess protein) and 5:1 (i.e. excess saccharide) may be used e.g. ratios between 1:2 and 5:1 and ratios between 1:1.25 and 1:2.5.
- the weight ratio of saccharide to carrier protein is between 1:2.5 and 1:3.5.
- the weight ratio of saccharide to carrier protein in the conjugate may be between 1:0.3 and 1:2 [87] .
- administering of the Hib conjugate preferably results in an anti-PRP antibody concentration of >0.15jUg/ml, and more preferably >l ⁇ g/ml, and these are the standard acceptable response thresholds.
- Polioviruses may be grown in cell culture, and a preferred culture uses a Vero cell line, derived from monkey kidney. Vero cells can conveniently be cultured microcarriers. After growth, virions may be purified using techniques such as ultrafiltration, diafiltration, and chromatography. Prior to administration to patients, polioviruses must be inactivated, and this can be achieved by treatment with formaldehyde. Poliomyelitis can be caused by one of three types of poliovirus. The three types are similar and cause identical symptoms, but they are antigenically very different and infection by one type does not protect against infection by others.
- poliovirus Type 1 e.g. Mahoney strain
- poliovirus Type 2 e.g. MEF-I strain
- poliovirus Type 3 e.g. Saukett strain
- the viruses are preferably grown, purified and inactivated individually, and are then combined to give a bulk bivalent mixture for use with the invention. Quantities of IPV are typically expressed in the 'DU' unit (the "D-antigen unit" [88]).
- Conjugated meningococcal antigens comprise capsular saccharide antigens from N. meningitidis conjugated to carrier proteins.
- Conjugate vaccines against serogroup C have been approved for human use, and include MENJUGATETM [89], MENINGITECTM and NEISVAC-CTM. Mixtures of conjugates from serogroups A+C are known [90, 91] and mixtures of conjugates from serogroups A+C+W135+Y have been reported [92-95] and were approved in 2005 as the MENACTRATM product.
- the meningococcal saccharide(s) used in the invention can be from one or more of serogroups A, C, W135 and Y e.g.
- the MENJUGATETM and MENINGITECTM products use a CRM197 carrier protein, and this carrier can also be used according to the invention.
- the NEISV AC-CTM product uses a tetanus toxoid carrier protein, and this carrier can also be used according to the invention, as can diphtheria toxoid.
- a particularly preferred carrier protein for the meningococcal conjugates is protein D from H.influenzae, which is not present in any existing approved conjugate vaccines.
- the saccharide moiety of the conjugate may comprise full-length saccharides as prepared from meningococci, and/or it may comprise fragments of full-length saccharides.
- Serogroup C saccharides may be prepared from either OAc+ or O Ac- strains.
- serogroup A saccharides preferably at least 50% (e.g. at least 60%, 70%, 80%, 90%, 95% or more) of the mannosamine residues are O-acetylated at the C-3 position.
- Meningococcal conjugates with a saccharide :protein ratio (w/w) of between 1:10 (i.e. excess protein) and 10:1 (i.e. excess saccharide) may be used e.g. ratios between 1:5 and 5:1, between 1:2.5 and 2.5:1, or between 1:1.25 and 1.25:1.
- Administration of a conjugate preferably results in an increase in serum bactericidal assay (SBA) titre for the relevant serogroup of at least 4-fold, and preferably at least 8-fold.
- SBA titres can be measured using baby rabbit complement or human complement [96].
- Conjugated pneumococcal antigens comprise capsular saccharide antigens from S.pneumoniae conjugated to carrier proteins [e.g. refs.
- PrevNarTM [101] contains antigens from seven serotypes (4, 6B, 9V, 14, 18C, 19F, and 23F) with each saccharide individually conjugated to CRM 1 Q 7 by reductive amination, with 2 ⁇ g of each saccharide per 0.5ml dose (4 ⁇ g of serotype 6B), and with conjugates adsorbed on an aluminum phosphate adjuvant.
- compositions of the invention preferably include at least serotypes 6B, 14, 19F and 23F. Further serotypes are preferably selected from: 1, 3, 4, 5, 7F, 9V and 18C.
- Antigens for protecting against measles, mumps and rubella viruses are typically live viruses, as found in known monovalent and trivalent ('MMR') vaccines. Measles virus vaccines are described in more detail in chapter 19 of reference 1. Mumps virus vaccines are described in more detail in chapter 20 of reference 1. Rubella virus vaccines are described in more detail in chapter 26 of reference 1.
- Typical measles virus strains include: Moraten; Connaught; Schwarz; Edmonston- Zagreb; CAM-70; AIK-C; TD97; Leningrad-16; Shanghai-191; etc.
- the Schwarz and Moraten strains are most common for use in USA and Europe.
- Typical mumps virus strains include: Jeryl Lynn; RIT 4385; Urabe; Hoshino; Rubini; Leningrad-3; Leningrad-Zagreb; Miyahara; Torii; NK M-46; S-12; etc.
- the Jeryl Lynn, RIT 4385, Urabe and Leningrad-Zagreb strains are the most common worldwide strains.
- Typical rubella virus strains include: RA27/3; Matsuba; TCRB 19; Takahashi; Matsuura; TP-336; etc.
- the RA27/3 strain is the most common strain used in the western world.
- VZV antigens for protecting against chickenpox are typically live viruses, based on the Oka strain of the virus. VZV vaccines are described in more detail in chapter 28 of reference 1.
- influenza virus vaccines can be based on live virus or inactivated virus, and inactivated vaccines can be based on whole virus, 'split' virus or on purified surface antigens (including hemagglutinin and neuraminidase).
- the viruses used to prepare the vaccines can be grown either on eggs or on cell culture.
- Vaccine strains for influenza virus change from season to season. In the current inter-pandemic period, vaccines typically include two influenza A strains (HlNl and H3N2) and one influenza B strain, and trivalent vaccines are typical.
- the invention may also use viruses from pandemic strains ⁇ i.e.
- influenza virus may be a reassortant strain, and may have been obtained by reverse genetics techniques.
- the virus may be attenuated.
- the virus may be temperature-sensitive.
- the virus may be cold-adapted.
- a 4-valent DTP-HBsAg vaccine can be made by a process involving serial addition of HBsAg, D, T and P antigens to a vessel, or by pre-mixing D, T and P antigens and then combining the HBsAg and the DTP mixture.
- Antigenic components can be combined in any suitable order. Where diphtheria and tetanus toxoids are included in a composition of the invention, they are preferably pre-mixed before being combined with HBsAg. Thus the process of the invention involves combining a first component comprising HBsAg with a second component comprising both D and T antigens. Thus it is preferred to use a pre-mixed D-T component.
- This bivalent component can be used in the processes of the invention e.g. it can be combined with HBsAg to make a trivalent D-T-HBV component.
- the pre-mixed D-T component can be combined with further non-HBV antigens ⁇ e.g. with acellular pertussis antigens), and that component can then be combined with HBsAg, etc.
- diphtheria toxoid, tetanus toxoid and whole cell pertussis antigens are included in a composition, they are preferably pre-mixed, and so the process of the invention involves combining a first component comprising HBsAg with a second component comprising D, T and Pw antigens.
- a pre-mixed D-T-Pw component it is preferred to use a pre-mixed D-T-Pw component, and then to use this component during the processes of the invention.
- an adjuvant when included in the compositions of the invention, this also can be added at various stages.
- antigens will have been combined with adjuvants before being used in the processes of the invention ⁇ e.g. a bivalent D-T mixture will have been adsorbed to aluminum salt adjuvant(s) before being used in the processes of the invention), but it is also possible to add adjuvant after the antigens have been mixed, or to add the antigens to an adjuvant ⁇ e.g. to start with an aqueous adjuvant, then to add antigens, either individually or pre-mixed).
- adjuvant e.g. a bivalent D-T mixture will have been adsorbed to aluminum salt adjuvant(s) before being used in the processes of the invention
- HBsAg component is preferably adsorbed to an aluminum phosphate adjuvant before being combined with the non-HBV antigenic components.
- the invention can be used to express hybrid antigens that include a HBsAg sequence and a non-HBsAg sequence within the same polypeptide.
- the non- HBsAg sequence may be inserted into the HBsAg sequence, or may be fused to the N-terminus or C-terminus of the HBsAg sequence.
- reference 102 reports fusions of HIV-I gpl20 to HBsAg to give a protein that spontaneously assembled into particles that resemble native HBsAg particles in size and density, consistent with a lipid composition of about 25% and a gpl20 content of about 100 per particle.
- the gpl20 was able to folds into its native conformation in the fusion, and retained its biological activity.
- HIV gp41 epitopes have been improved by making internal fusions with HBsAg, and the fusion protein self-assembled in yeast into 22nm lipoprotein particles [103].
- Reference 104 reports that epitopes of up to 61aa from the malaria gpl90 antigen were inserted into the HBsAg sequence, and that the expressed hybrid particles could elicit an anti-gpl90 immune response in animals.
- Reference 105 report an protein having 16 repeats of a 4-mer sequence of the circumsporozoite protein expressed as a fusion protein with HBsAg.
- Reference 106 reports the production in yeast of virus-like particles composed of Pfsl6 fused to HBsAg.
- Reference 107 discloses a hybrid antigen in which the circumsporozoite protein is fused to HBsAg.
- Reference 108 discloses a fusion of the C-terminal region of the merozoite surface 1 protein of P.vivax, which formed immunogenic particles of 20-45 nm size.
- the use of HBsAg for presenting malarial antigens in self-assembling particulate form is therefore well known in the art.
- This approach is particularly suitable for fusing HBsAg sequences with antigens from HIV,
- Suitable HIV antigens for making HBsAg hybrids include envelope glycoprotein gpl20 or antigenic fragments thereof [102].
- Suitable P.falciparum antigens for making HBsAg hybrids may be based on a subunit of the circumsporozoite surface antigen ("CSP") e.g. they may include between 3 and 20 repeats of its NANP motif (SEQ ID NO: 14), and/or they may include the C-terminal region of CSP (but typically not including the final 12 amino acids from the C-terminal).
- CSP circumsporozoite surface antigen
- the invention may use the antigen known as "RTS", which contains a large portion of the C-terminal of CSP from the NF54 or 7G8 isolate of P. falciparum (amino acids 210 to 398, which includes 19 NANP repeats and the T cell epitope region at amino acids 367 to 390), fused to the N-terminus of HBsAg by four amino acids of the preS2 portion of HBsAg.
- RTS forms particles that include lipids (primarily phospholipid) in addition to protein.
- RTS can thus, as in SEQ ID NO: 15 herein, contain: (i) a N-terminus methionine residue; (ii) Met-Ala-Pro; (iii) 189 amino acids corresponding either to amino acids 210-398 of CS protein from P. falciparum 7G8 or to amino acids 207-395 of CS protein from P .falciparum NF54; (iv) Arg or GIy; (v) Pro-Val-Thr-Asn from hepatitis B Pre-S2 protein; and (vi) HBsAg. From the 7G8 isolate, full-length RTS has the sequence given as SEQ ID NO: 1 in reference 109 (see also Figure 5 of reference 110):
- This hybrid antigen can be expressed in yeast, using a sequence encoding SEQ ID NO:15. It is preferred to co-express the hybrid protein in yeast with normal HBsAg. This approach has previously been used with RTS, and the product of co-expression is referred to as "RTS,S". A RTS:S ratio of about 1:4 is useful. Thus a useful aspect of the present invention is to co-express (i) HBsAg and (ii) RTS. One or both of these antigens may be expressed using the plasmids described hereinabove. The co-expressed proteins form a particulate antigen that can be used as an active ingredient in a malaria vaccine.
- 'Modern' adjuvants including CpG, AGPs and AS04 are described above. While these can be used in multivalent compositions of the invention, it is preferred instead to use aluminum salts. These include the adjuvants known as aluminum hydroxide and aluminum phosphate. These names are conventional, but are used for convenience only, as neither is a precise description of the actual chemical compound which is present [e.g. see chapter 9 of reference 111].
- the invention can use any of the "hydroxide” or "phosphate” adjuvants that are in general use as adjuvants.
- the adjuvants known as "aluminum hydroxide” are typically aluminum oxyhydroxide salts, which are usually at least partially crystalline.
- Aluminum oxyhydroxide which can be represented by the formula AlO(OH), can be distinguished from other aluminum compounds, such as aluminum hydroxide Al(OH) 3 , by infrared (IR) spectroscopy, in particular by the presence of an adsorption band at 1070cm “1 and a strong shoulder at 3090-3100Cm “1 [chapter 9 of ref. 111].
- the adjuvants known as "aluminum phosphate” are typically aluminum hydroxyphosphates, often also containing a small amount of sulfate (i.e. aluminum hydroxyphosphate sulfate). They may be obtained by precipitation, and the reaction conditions and concentrations during precipitation influence the degree of substitution of phosphate for hydroxyl in the salt.
- Hydroxyphosphates generally have a PO 4 / Al molar ratio between 0.3 and 1.2. Hydroxyphosphates can be distinguished from strict AlPO 4 by the presence of hydroxyl groups. For example, an IR spectrum band at 3164cm "1 (e.g. when heated to 200 0 C) indicates the presence of structural hydroxyls [ch. 9 of ref. 111].
- the PO 4 ZAl 3+ molar ratio of an aluminum phosphate adjuvant will generally be between 0.3 and 1.2, preferably between 0.8 and 1.2, and more preferably 0.95+0.1.
- the aluminum phosphate will generally be amorphous, particularly for hydroxyphosphate salts.
- a typical adjuvant is amorphous aluminum hydroxyphosphate with PO 4 ZAl molar ratio between 0.84 and 0.92, included at 0.6mg Al 3+ /ml.
- the aluminum phosphate will generally be particulate. Typical diameters of the particles are in the range 0.5-20 ⁇ m (e.g. about 5-10 ⁇ m) after any antigen adsorption.
- Aluminum phosphates used according to the invention will generally have a PZC of between 4.0 and 7.0, more preferably between 5.0 and 6.5 e.g. about 5.7.
- An aluminum phosphate solution used to prepare a composition of the invention may contain a buffer (e.g. a phosphate or a histidine or a Tris buffer), but this is not always necessary.
- the aluminum phosphate solution is preferably sterile and pyrogen-free.
- the aluminum phosphate solution may include free aqueous phosphate ions e.g. present at a concentration between 1.0 and 20 mM, preferably between 5 and 15 mM, and more preferably about 10 mM.
- the aluminum phosphate solution may also comprise sodium chloride.
- the concentration of sodium chloride is preferably in the range of 0.1 to 100 mgZml (e.g. 0.5-50 mgZml, 1-20 mgZml, 2-10 mgZml) and is more preferably about 3+1 mgZml.
- the presence of NaCl facilitates the correct measurement of pH prior to adsorption of antigens.
- Aluminum salts can be used for adsorption of any of the HBV and non-HBV antigens.
- HBsAg is preferably adsorbed to an aluminum phosphate adjuvant [70].
- Diphtheria toxoid is preferably adsorbed to an aluminum hydroxide adjuvant.
- Tetanus toxoid is preferably adsorbed to an aluminum hydroxide adjuvant, but this is not necessary (e.g. adsorption of between 0-10% of tetanus toxoid can be used).
- Acellular pertussis antigens, and particularly the 69kDa antigen, are preferably adsorbed to an aluminum hydroxide adjuvant.
- Conjugated Hib antigens can be adsorbed to aluminum phosphate [112,113] or can be unadsorbed. Hib adsorption in this way is particularly useful in vaccines comprising D-T-Pw-Hib-HBsAg antigens
- Other conjugated antigens e.g. meningococcus, pneumococcus
- IPV antigens are typically not adsorbed to any adjuvant before being used in a process of the invention, but they can become adsorbed onto aluminum adjuvant(s) originating with other components.
- an aluminum phosphate adjuvant is preferably used in the form of an aqueous solution to which HBsAg is added (NB: it is standard to refer to aqueous aluminum phosphate as a "solution” although, on a strict physicochemical view, the salt is insoluble and forms a suspension). It is preferred to dilute the aluminum phosphate to the required concentration and to ensure a homogenous solution before the addition of the HBsAg.
- concentration of Al 3+ prior to addition of HBsAg is generally between 0 and 10 mg/ml.
- a preferred Al 3+ concentration is between 2 and 6 mg/ml.
- Two preferred components for use in the processes of the invention are: (1) a bivalent D-T component, comprising an aluminum hydroxide adjuvant; and (2) a trivalent D-T-Pw component, comprising both aluminum hydroxide and aluminum phosphate adjuvants.
- compositions of the invention may include further components. These components may have various sources. For example, they may be present in one of the antigen or adjuvant components that is used during manufacture or may be added separately from the antigenic components.
- compositions of the invention include one or more pharmaceutical carrier(s) and/or excipient(s).
- compositions will generally have an osmolality of between 200 mOsm/kg and 400 mOsm/kg, preferably between 240-360 mOsm/kg, and will more preferably fall within the range of 290-300 mOsm/kg. Osmolality has previously been reported not to have an impact on pain caused by vaccination [115], but keeping osmolality in this range is nevertheless preferred.
- Compositions of the invention may include one or more buffers.
- Typical buffers include: a phosphate buffer; a Tris buffer; a borate buffer; a succinate buffer; a histidine buffer; or a citrate buffer. Buffers will typically be included in the 5-2OmM range.
- compositions of the invention will generally be between 5.0 and 7.5, and more typically between 5.0 and 6.0 for optimum stability, or between 6.0 and 7.0.
- the process of the invention may therefore include a step of adjusting the pH of the bulk vaccine prior to packaging.
- Compositions of the invention are preferably sterile.
- Compositions of the invention are preferably non-pyrogenic e.g. containing ⁇ 1 EU (endotoxin unit, a standard measure) per dose, and preferably ⁇ 0.1 EU per dose.
- compositions of the invention are preferably gluten free.
- the pH of any aqueous packaged vaccine materials is preferably between 5 and 8 e.g. between 5.5 and 6.5.
- the final vaccine product may be a suspension with a cloudy appearance. This appearance means that microbial contamination is not readily visible, and so the vaccine preferably contains an antimicrobial agent. This is particularly important when the vaccine is packaged in multidose containers.
- Preferred antimicrobials for inclusion are 2-phenoxyethanol and thimerosal. It is preferred, however, not to use mercurial preservatives ⁇ e.g. thimerosal) during the process of the invention. However, the presence of trace amounts may be unavoidable if the HBsAg was treated with such a preservative before being used to prepare the composition of the invention. For safety, however, it is preferred that the final composition contains less than about 25 ng/ml mercury.
- the final vaccine product contains no detectable thimerosal. This will generally be achieved by removing the mercurial preservative from an antigen preparation prior to its addition in the process of the invention or by avoiding the use of thimerosal during the preparation of the components used to make the composition.
- a bivalent D-T mixture is used during a process of the invention, it should be free from thimerosal.
- the D-T mixture may include 2-phenoxyethanol, but in others it is free from both thimerosal and 2-phenoxyethanol.
- a trivalent D-T-Pw mixture is used during a process of the invention, it can be free from 2-phenoxyethanol, but may include thimerosal.
- the concentration of aluminum phosphate in a composition of the invention is preferably less than 5 mg/ml e.g. ⁇ 4 mg/ml, ⁇ 3 mg/ml, ⁇ 2 mg/ml, ⁇ 1 mg/ml, etc.
- the concentration of any 3D-MPL in a composition of the invention is preferably less than 200 ⁇ g/ml e.g. ⁇ 150 ⁇ g/ml, ⁇ 125 ⁇ g/ml, ⁇ 110 ⁇ g/ml, ⁇ 100 ⁇ g/ml, etc.
- the concentration of HBsAg in a composition of the invention is preferably less than 60 ⁇ g/ml e.g. ⁇ 55 ⁇ g/ml, ⁇ 50 ⁇ g/ml, ⁇ 45 ⁇ g/ml, ⁇ 40 ⁇ g/ml, etc. A concentration of about 20 ⁇ g/ml is typical.
- the concentration of diphtheria toxoid in a composition of invention is typically at least 50 IU/ml.
- the concentration of tetanus toxoid in a composition of the invention is typically at least 100 IU/ml.
- the ratio of diphtheria toxoid to tetanus toxoid in compositions of the invention is usually between 2:1 and 3:1 (measured in Lf units), preferably between 2.4:1 and 2.6:1, and is more preferably 2.5:1.
- cellular pertussis antigen there will typically be at least 8 IU/ml; where acellular antigens are used, there will typically be between 25-75 ⁇ g PT, about 25 ⁇ 75 ⁇ g FHA and about 10-20 ⁇ g pertactin per dose.
- the amount of Hib conjugate, measured as saccharide, in compositions of the invention is typically between 10 and 30 /xg/ml.
- the amount of HAV antigen, measured in EU (Elisa Units), is typically at least 600EU/ml.
- IPV antigen depends on the strain serotype. For a type 1 virus, a composition typically contains about 80 DU/ml. For a type 2 virus, a composition typically contains about 16 DU/ml. For a type 3 virus, a composition typically contains about 65 DU/ml.
- the amount of a meningococcal conjugate, measured as saccharide, in compositions of the invention is typically between 5 and 25 /xg/ml for each serogroup.
- the amount of a pneumococcal conjugate, measured as saccharide, in compositions of the invention is typically between 2 and 20 ⁇ g/ml for each serotype.
- compositions of the invention are preferably administered to patients in 0.5ml doses.
- References to 0.5ml doses will be understood to include normal variance e.g. 0.5ml+0.05ml.
- the invention can provide bulk material which is suitable for packaging into individual doses, which can then be distributed for administration to patients. Concentrations mentioned above are typically concentrations in final packaged dose, and so concentrations in bulk vaccine may be higher (e.g. to be reduced to final concentrations by dilution). Compositions of the invention will generally be in aqueous form.
- the processes of the invention may comprise a step of extracting and packaging a 0.5ml sample of the mixture into a container. For multidose situations, multiple dose amounts will be extracted and packaged together in a single container.
- the processes of the invention may comprise the further step of packaging the vaccine into containers for use. Suitable containers include vials and disposable syringes (preferably sterile ones).
- vials are preferably made of a glass or plastic material.
- the vial is preferably sterilized before the composition is added to it.
- vials are preferably sealed with a latex-free stopper.
- the vial may include a single dose of vaccine, or it may include more than one dose (a 'multidose' vial) e.g. 10 doses.
- a 'multidose' vial e.g. 10 doses.
- each dose should be withdrawn with a sterile needle and syringe under strict aseptic conditions, taking care to avoid contaminating the vial contents.
- Preferred vials are made of colorless glass.
- a vial can have a cap (e.g. a Luer lock) adapted such that a pre-f ⁇ lled syringe can be inserted into the cap, the contents of the syringe can be expelled into the vial (e.g. to reconstitute lyophilised material
- the cap is preferably located inside a seal or cover, such that the seal or cover has to be removed before the cap can be accessed.
- the syringe will not normally have a needle attached to it, although a separate needle may be supplied with the syringe for assembly and use.
- Safety needles are preferred.
- 1-inch 23-gauge, 1-inch 25-gauge and 5/8-inch 25-gauge needles are typical.
- Syringes may be provided with peel-off labels on which the lot number and expiration date of the contents may be printed, to facilitate record keeping.
- the plunger in the syringe preferably has a stopper to prevent the plunger from being accidentally removed during aspiration.
- the syringes may have a latex rubber cap and/or plunger. Disposable syringes contain a single dose of vaccine.
- the syringe will generally have a tip cap to seal the tip prior to attachment of a needle, and the tip cap is preferably made of butyl rubber. If the syringe and needle are packaged separately then the needle is preferably fitted with a butyl rubber shield. Grey butyl rubber is preferred. Preferred syringes are those marketed under the trade name "Tip-Lok"TM.
- a glass container e.g. a syringe or a vial
- a container made from a borosilicate glass rather than from a soda lime glass.
- the container can then be enclosed within a box for distribution e.g. inside a cardboard box, and the box will be labeled with details of the vaccine e.g. its trade name, a list of the antigens in the vaccine (e.g. 'hepatitis B recombinant', etc.), the presentation container (e.g.
- Each box might contain more than one packaged vaccine e.g. five or ten packaged vaccines (particularly for vials). If the vaccine is contained in a syringe then the package may show a picture of the syringe.
- the vaccine may be packaged together (e.g. in the same box) with a leaflet including details of the vaccine e.g. instructions for administration, details of the antigens within the vaccine, etc.
- the instructions may also contain warnings e.g. to keep a solution of adrenaline readily available in case of anaphylactic reaction following vaccination, etc.
- the packaged vaccine is preferably stored at between 2°C and 8 0 C. It should not be frozen.
- Vaccines can be provided in full-liquid form (i.e. where all antigenic components are in aqueous solution or suspension) during manufacture, or they can be prepared in a form where some components are in liquid form and others are in a lyophilized form.
- a final vaccine can be prepared extemporaneously at the time of use by mixing together two components: (a) a first component comprising aqueous antigens; and (b) a second component comprising lyophilized antigens.
- the two components are preferably in separate containers (e.g. vials and/or syringes), and the invention provides a kit comprising components (a) and (b).
- This format is particularly useful for vaccines that include a conjugate component, particularly Hib and/or meningococcal conjugates, as these may be more stable in lyophilized form.
- conjugates may be lyophilised prior to their use with the invention. Further components may also be added prior to freeze-drying e.g. as stabilizers.
- Preferred stabilizers for inclusion are lactose, sucrose and mannitol, as well as mixtures thereof e.g. lactose/sucrose mixtures, sucrose/mannitol mixtures, etc.
- the final vaccine may thus contain lactose and/or sucrose. Using a sucrose/mannitol mixture can speed up the drying process.
- the invention provides a process for preparing a two-container combination vaccine, comprising the following steps:
- a first container e.g. a syringe
- a conjugated capsular saccharide antigen in lyophilised form - packaging said lyophilised antigen in a second container (e.g. a vial);
- kits packaging the first container and second container together in a kit.
- the kit can then be distributed to physicians.
- D, T, P and HBsAg components are preferably in liquid form.
- Methods of treatment and Administration of the vaccine Compositions of the invention are suitable for administration to human patients, and the invention provides a method of raising an immune response in a patient, comprising the step of administering a composition of the invention to the patient.
- the invention also provides a composition of the invention for use in medicine.
- the invention also provides the use of (i) HBsAg expressed according to the invention and (ii) one or more non-HBV antigens, in the manufacture of a medicament for administering to a patient.
- the invention also provides the use of (i) HBsAg expressed according to the invention and (ii) an adjuvant other than an aluminum hydroxide, in the manufacture of a medicament for administering to a patient.
- the medicament is preferably a monovalent vaccine.
- Preferred patient groups for receiving this vaccine are mentioned above.
- Immunogenic compositions of the invention are preferably vaccines, for use in the prevention and/or treatment of at least hepatitis B virus infection.
- Patients who have received compositions of the invention preferably have a serum anti-HBsAg GM titer of >500mIU/ml, measured 6 weeks after the first immunisation. More preferably, the titer is >500mIU/ml, when measured after 12 months.
- a typical immunization schedule for a child may involve administering more than one dose.
- doses may be at: 0 & 6 months (time 0 being the first dose); at 0, 1, 2 & 6 months; at day 0, day 21 and then a third dose between 6 & 12 months; or at 0, 1, 2, 6 & 12 months.
- compositions of the invention can be administered by intramuscular injection e.g. into the arm or leg
- Vaccines produced by the invention may be administered to patients at the same time as a separate pneumococcal conjugate vaccine, such as PrevnarTM.
- compositions of the invention include an aluminum-based adjuvant
- settling of components may occur during storage.
- the composition should therefore be shaken prior to administration to a patient.
- the shaken composition will be a turbid white suspension.
- compositions of the invention include:
- a bivalent composition comprising HBsAg and HAV.
- the vaccine is in aqueous form. It includes both aluminum hydroxide and aluminum phosphate adjuvants.
- HBsAg is adsorbed to aluminum phosphate.
- HAV is adsorbed to aluminum hydroxide. Amounts per ml: about 720 ELISA units HAV; about 20 ⁇ g HBsAg. Dose: about 1 ml. May be presented in pre-filled syringe.
- a pentavalent composition comprising HBsAg, D, T, Pa and IPV.
- the vaccine is in aqueous form. It includes both aluminum hydroxide and aluminum phosphate adjuvants.
- HBsAg is adsorbed to aluminum phosphate.
- D, T and Pa are adsorbed to aluminum hydroxide.
- Amounts per ml about 50 Lf diphtheria toxoid; about 20 Lf tetanus toxoid; about 50/Ag PT; about 50 ⁇ g FHA; about 16 ⁇ g pertactin; about 20 ⁇ g HBsAg; about 80 DU type 1 poliovirus; about 16 DU type 2 poliovirus; about 64 DU type 3 poliovirus.
- Dose about 0.5ml. May be presented in pre-filled syringe.
- a pentavalent composition comprising HBsAg, D, T, Pa and IPV.
- the vaccine is in aqueous form. It includes both aluminum hydroxide and aluminum phosphate adjuvants.
- HBsAg is adsorbed to aluminum phosphate.
- D, T and Pa are adsorbed to aluminum hydroxide.
- Amounts per ml at least 60 IU diphtheria toxoid; at least 80 IU tetanus toxoid; about 50 ⁇ g PT; about 50 ⁇ g FHA; about 16 ⁇ g pertactin; about 20 ⁇ g HBsAg; about 80 DU type 1 poliovirus; about 16 DU type 2 poliovirus; about 64 DU type 3 poliovirus.
- a tetravalent composition comprising HBsAg, D, T and Pw.
- the components are in aqueous form. It includes both aluminum hydroxide and aluminum phosphate adjuvants.
- HBsAg is adsorbed to aluminum phosphate.
- D and T are adsorbed to aluminum hydroxide.
- the composition includes thimerosal, but preferably does not contain 2-penoxyethanol. Amounts per ml: at least 60 IU diphtheria toxoid; at least 120 IU tetanus toxoid; at least 8 IU Pw; about
- a pentavalent composition comprising HBsAg, D, T, Pw and a Hib-T conjugate.
- the HBsAg, D, T and Pw components are in aqueous form; the Hib-T is lyophilised. It includes both aluminum hydroxide and aluminum phosphate adjuvants. D and T are adsorbed to aluminum hydroxide.
- HBsAg and Hib-T are adsorbed to aluminum phosphate.
- the lyophilized Hib-T includes lactose.
- the aqueous component may include thimerosal.
- Amounts per ml at least 60 IU diphtheria toxoid; at least 120 IU tetanus toxoid (plus between 5-25 ⁇ g tetanus toxoid as carrier in Hib-T); at least 8 IU Pw; about 20 ⁇ g HBsAg; about 5 ⁇ g Hib-T, measured as saccharide. Dose: about 0.5ml.
- These compositions can be used separately, or as components of further vaccines.
- the invention provides a hexavalent composition comprising the pentavalent HBsAg-D-T-Pa-IPV composition described above, plus a lyophilized Hib-T conjugate.
- the lyophilized Hib-T is preferably not adsorbed to an aluminum salt.
- the invention also provides a pentavalent composition comprising the tetravalent HBsAg-D-T-Pw composition described above, plus a lyophilized Hib-T conjugate.
- the invention also provides a heptavalent composition comprising the tetravalent HBsAg-D-T-Pw composition described above, plus a lyophilized mixture of Hib-T conjugate, MenA conjugate and MenC conjugate.
- the final vaccines can be prepared by reconstituting the lyophilized materials with the aqueous HBsAg-containing materials at the time of use, and the lyophilized and aqueous components are preferably packaged together in a kit, as described above.
- a specific monovalent immunogenic composition of the invention is:
- HBsAg in combination with an aluminum phosphate adjuvant and a 3D-MPL adjuvant, where the HBsAg and 3D-MPL are both adsorbed to the aluminum phosphate.
- Amounts per dose about 20 ⁇ g HBsAg, about 50 ⁇ g 3D-MPL, about 0.5mg Al 3+ .
- Specific processes of the invention include those comprising the following steps: • Purify HBsAg after expression according to invention; adsorb HBsAg to aluminum phosphate adjuvant; obtain thimerosal-free bivalent D-T mixture with aluminum hydroxide adjuvant; obtain PT, FHA and pertactin for Pa component; obtain IPV antigens, as pooled types 1, 2 and 3, preferably without aluminum salt adjuvant; combine D-T, Pa, IPV and HBsAg, in any order, to give final pentavalent combination; optionally, package into syringe.
- HBsAg after expression according to invention adsorb HBsAg to aluminum phosphate adjuvant; obtain 2-phenoxyethanol-free, thimerosal-containing trivalent D-T-Pw mixture with aluminum hydroxide and aluminum phosphate adjuvants; obtain lyophilized Hib-T conjugate; combine D-T-Pw and HBsAg to give aqueous tetravalent component; package aqueous tetravalent component into glass vial; package lyophilized Hib-T into glass vial; combine the two vials to be presented in a single kit for reconstitution to give a pentavalent combination vaccine.
- the glass vials can be type I glass and have rubber butyl stoppers.
- Further components may be added at any stage e.g. sodium chloride, adjuvants, preservatives, etc. These processes can be used e.g. to prepare the vaccines described above.
- the different process steps may be performed at substantially the same time, or may be performed separately. They can be performed in the same location or in different locations, even in different countries e.g. HBsAg expression may take place in a different place from lyophilisation of Hib-T conjugate.
- Carrier proteins for conjugates may be performed at substantially the same time, or may be performed separately. They can be performed in the same location or in different locations, even in different countries e.g. HBsAg expression may take place in a different place from lyophilisation of Hib-T conjugate.
- Conjugated saccharide antigens include a carrier protein, to which the saccharide is covalently attached, either directly or via a linker.
- General information on conjugation techniques can be found in reference 116.
- carrier proteins are known for use as carriers, and preferred carrier proteins are bacterial toxins or toxoids, such as diphtheria toxoid or tetanus toxoid.
- suitable carrier proteins include, but are not limited to, the CRM197 mutant of diphtheria toxin [117-119], the N. meningitidis outer membrane protein [120], synthetic peptides [121, 122], heat shock proteins [123,124], pertussis proteins
- cytokines [127] cytokines [127], lymphokines [127], hormones [127], growth factors [127], artificial proteins comprising multiple human CD4 + T cell epitopes from various pathogen-derived antigens [128] such as N19 [129], protein D from H.influenzae [130,131], pneumococcal surface protein PspA [132], pneumolysin [133], iron-uptake proteins [134], toxin A or B from C.difficile [135], S.agalactiae proteins [136], etc.
- pathogen-derived antigens [128] such as N19 [129], protein D from H.influenzae [130,131], pneumococcal surface protein PspA [132], pneumolysin [133], iron-uptake proteins [134], toxin A or B from C.difficile [135], S.agalactiae proteins [136], etc.
- Attachment of a saccharide to a carrier is preferably via a -NH 2 group e.g. in the side chain of a lysine residue in a carrier protein, or of an arginine residue. Attachment to -SH groups (e.g. in the side chain of a cysteine) is also possible.
- Conjugates with a saccharide :protein ratio (w/w) of between 1:5 (i.e. excess protein) and 5:1 (i.e. excess saccharide) are preferred.
- Compositions may include a small amount of free carrier. Ignoring any carrier included as a separate antigen, unconjugated carrier is preferably no more than 5% of the total amount of the carrier protein in the composition as a whole, and more preferably present at less than 2% by weight.
- composition e.g. to reduce the risk of carrier suppression.
- the carrier protein used for N. meningitidis conjugates may be protein D from H.influenzae. This protein is described in detail in references 137 & 138, and its use as a carrier protein in conjugates is described in reference 139.
- the term "protein D” includes fragments of the native full-length protein, as disclosed in reference 139, and also fusion proteins comprising either full-length protein D or these fragments (e.g. a fusion of a fragment of influenza virus NSl protein and a fragment of protein D). The fragments will retain the ability to convert a T-independent saccharide antigens into a T-dependent antigen when conjugated thereto. Typical fragments will include at least the N-terminal 1/3 of protein D.
- the protein can conveniently be expressed in E.coli [138], and this recombinant material is preferred for use with the invention [139].
- composition comprising
- X may consist exclusively of X or may include something additional e.g. X + Y.
- the word “substantially” does not exclude “completely” e.g. a composition which is “substantially free” from Y may be completely free from Y. Where necessary, the word “substantially” may be omitted from the definition of the invention.
- a process comprising a step of mixing two or more components does not require any specific order of mixing.
- components can be mixed in any order. Where there are three components then two components can be combined with each other, and then the combination may be combined with the third component, etc.
- an antigen is described as being "adsorbed" to an adjuvant, it is preferred that at least 50% (by weight) of that antigen is adsorbed e.g. 50%, 60%, 70%, 80%, 90%, 95%, 98% or more. It is preferred that diphtheria toxoid and tetanus toxoid are both totally adsorbed i.e. none is detectable in supernatant. Total adsorption of HBsAg is also preferred.
- ionisable groups may exist in the neutral form shown in formulae herein, or may exist in charged form e.g. depending on pH.
- a phosphate group may be shown as -P-O-(OH) 2 , this formula is merely representative of the neutral phosphate group, and other charged forms are encompassed by the invention.
- sugar rings can exist in open and closed form and, while closed forms are shown in structural formulae herein, open forms are also encompassed by the invention.
- TSEs transmissible spongiform encaphalopathies
- BSE bovine spongiform encephalopathy
- a plasmid is constructed comprising various elements in the following order: a yeast GAPDH promoter; a HBsAg-coding sequence; a region including a yeast ARG3 transcription terminator; DNA from E.coli vector pBR327; yeast DNA with a LEU2 marker; DNA from E.coli vector pBR327; yeast 2 ⁇ plasmid sequence; DNA from E.coli vector pBR327.
- the pBR327 sequences include an ori functional in E.coli.
- the plasmid is between 14600 and 14700 bp long in total.
- the GAPDH promoter sequence includes the following 1060-mer (SEQ ID NO: 1): aagcttaccagttctcacacggaacaccactaatggacacacattcgaaatactttgaccctattttcgagga ccttgtcaccttgagcccaagagagccaagatttaaattttcctatgacttgatgcaaattcccaaagctaat aacatgcaagacacgtacggtcaagaagacatatttgacctcttaacaggttcagacgcgactgcctcatcag taagacccgttgaaaagaacttacctgaaaaaacgaatatatactagcgttgaatgttagcgtcaacaacaa gaagtttactgacgcggaggccaaggcaaagattc
- the HBsAg-coding sequence is as follows (SEQ ID NO: 4), followedby an ochre stop codon: atggagaacatcacatcaggattcctaggacccctgctcgtgttacaggcggggtttttcttgttgacaagaa tcctcacaataccgcagagtctagactcgtggtggacttctctcaattttctagggggatcacccgtgtgtct tggccaaaattcgcagtccccaacctccaatcactcaccaacctcctgtcctccaattttgtcctggttatcgc tggatttgctggttatcgc tggatgtgctggttatcgc tggatgtgctggttatcgc tggatgtgctggatctggttatcgc tggatg
- the ARG3 sequence includes the following 689-mer sequence (SEQ ED NO: 8), together with additional sequence from the region downstream orARG3: cgaattccaagctgaaacaattcaaaggttttcaaatcaatcaagaacttgtctctgtggctgatccaaacta caaatttatgcattgtctgccaagacatcaagaagaagttagtgatgatgtcttttatggagagcattccata gtctttgaagaagcagaaaacagattatatgcagctatgtctgccattgatatcttttgtttaataataaaggta atttcaaggacttgaaataatccttttcgttttaataactaatatataaatacagatatagatgcatg aataatgatatacattgattattttgcaatta
- theplasmidin cludes the following 2430-merin an expression cassette (SEQ ID NO: 13): aagcttaccagttctcacacggaacaccactaatggacacacattcgaaatactttgaccctattttcgagga ccttgtcaccttgagcccaagagagccaagatttaaattttcctatgacttgatgcaaattcccaaagctaat aacatgcaagacacgtacggtcaagaagacatatttgacctcttaacaggttcagacgcgactgcctcatcag taagacccgttgaaaagaacttacctgaaaaaacgaatatatactagcgttgaatgttagcgtcaacaacaa gaagtttactgacgcggaggccaaggcaaaaa
- the GAPDH promoter sequence (SEQ ID NO: 1) was differs from the GAPDH promoter sequence disclosed in reference 41 (SEQ ID NO: 5) at several positions:
- SEQ BD NO: 1 was queried against "All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS, GSS, environmental samples or phase 0, 1 or 2 HTGS sequences)" on 7th April 2005, with no filtering.
- the top hit in this search aligns with SEQ ID NO: 1 as follows:
- JU Sb]Ct 820 tacctgaaaaaaacgaatatatactagcgttgaatgttagcgtcaacaacaagaagttta 761 Query: 301
- Sbjct 340 aggcaaaaaacgggcacaacctcaatggagtgatgcaacctgcctggagtaaatgatgac 281 Query 781 acaaggcaattgacccacgcatgtatctatctcattttcttacaccttctattaccttct 840
- SEQ ID NO: 1 differs at two nucleotides compared to the reverse complement of the nearest match.
- the HBsAg coding sequence (SEQ ID NO: 4) was analyzed agamst GenBank sequences in the same 40 way SEQ ID NO: 4 differs from the closest database match (AY576426.1) only at nucleotide 350 (A/ G) This difference results in a Ser/Asn codon change.
- the encoded sequence (SEQ ID NO: 3) was analyzed by BLASTP on 4th April 2005, using the "non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples" database with no filtering. SEQ ID NO: 3 differs from the closest database matches at 45 ammo acid 117, having an Asn residue rather than Ser. The top hit was entry CAA84792.1 (SEQ ID NO: 10)
- HBsAg expression and adsorption The plasmid is used to transform a leu2-3 Ieu2-112 his3 canl-11 strain of S.cerevisiae yeast (DC5).
- the yeast are grown in a synthetic medium containing purified amino acids (but omitting leucine), vitamins, and suitable salts.
- Expressed HBsAg is purified by a process involving cell recovery, precipitation, ultrafiltration, gel permeation, ion exchange, ultracentrifugation and desalting.
- the purified antigen is non-glycosylated and can be seen in the form of substantially-spherical particles (average diameter ⁇ 20nm).
- a suspension of aluminum phosphate in isotonic saline is mixed with the purified HBsAg concentrate. After adjusting the pH to between 5.2 and 6.0, the mixture is left at room temperature for a day, with stirring. Adsorption of antigen to adjuvant takes place over this time.
- Monovalent vaccine For making a monovalent vaccine, 3D-MPL is added to the adsorbed HBsAg, and dilution to give a final HBsAg concentration of 20 ⁇ g/ml is achieved using water for injection and sterile saline. This bulk vaccine is then packaged into individual doses, either in vials or into disposable syringes.
- a DTPw antigen mixture is obtained from Chiron Behring in Marburg, Germany. This mixture is mixed with adsorbed HBsAg to give a tetravalent vaccine product.
- the tetravalent product can be used on its own, or can be used to reconstitute either (a) a lyophilized Hib-T conjugate that is adsorbed to an aluminum phosphate adjuvant, or (b) a trivalent mixture of lyophilized conjugates from Hib, MenA and MenC.
- Module 1 of WHO' The immunological basis for immunization series (Galazka).
- NBBSC code DJPT.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Virology (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Molecular Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Communicable Diseases (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Oncology (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US11/918,864 US8119146B2 (en) | 2005-04-18 | 2006-04-14 | Expressing hepatitis B virus surface antigen for vaccine preparation |
| BRPI0610297-2A BRPI0610297A2 (pt) | 2005-04-18 | 2006-04-14 | expressão de antìgeno de superfìcie de vìrus da hepatite b para a preparação de vacina |
| JP2008507760A JP2008536515A (ja) | 2005-04-18 | 2006-04-14 | ワクチンの調製のためのb型肝炎ウイルス表面抗原の発現 |
| EP06750309A EP1871411A4 (en) | 2005-04-18 | 2006-04-14 | EXPRESSION OF HEPATITIS B VIRUS SURFACE ANTIGEN FOR VACCINE MANUFACTURE |
| CA002605179A CA2605179A1 (en) | 2005-04-18 | 2006-04-14 | Expressing hepatitis b virus surface antigen for vaccine preparation |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US67283805P | 2005-04-18 | 2005-04-18 | |
| US60/672,838 | 2005-04-18 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2006113528A2 true WO2006113528A2 (en) | 2006-10-26 |
| WO2006113528A3 WO2006113528A3 (en) | 2009-04-16 |
Family
ID=37115773
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2006/014240 Ceased WO2006113528A2 (en) | 2005-04-18 | 2006-04-14 | Expressing hepatitis b virus surface antigen for vaccine preparation |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US8119146B2 (cg-RX-API-DMAC7.html) |
| EP (2) | EP2329843A3 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2008536515A (cg-RX-API-DMAC7.html) |
| CN (1) | CN101500601A (cg-RX-API-DMAC7.html) |
| BR (1) | BRPI0610297A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA2605179A1 (cg-RX-API-DMAC7.html) |
| RU (1) | RU2442825C2 (cg-RX-API-DMAC7.html) |
| SG (1) | SG175456A1 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2006113528A2 (cg-RX-API-DMAC7.html) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007026249A3 (en) * | 2005-09-01 | 2007-10-04 | Novartis Vaccines & Diagnostic | Multiple vaccination including serogroup c meningococcus |
| CN103333938A (zh) * | 2013-07-19 | 2013-10-02 | 深圳康泰生物制品股份有限公司 | 重组酿酒酵母表达的乙肝表面抗原及其生产方法、乙肝疫苗及其生产方法 |
| US9040058B2 (en) | 2011-11-11 | 2015-05-26 | Glaxosmithkline Biologicals Sa | Fermentation media free of animal-derived components for production of diphtheria toxoids suitable for human vaccine use |
| EP2974740A4 (en) * | 2013-03-13 | 2016-08-24 | Jiangsu Theravac Bio Pharmaceutical Co Ltd | HEPATITIS B VACCINE |
| US12458689B2 (en) | 2020-02-23 | 2025-11-04 | Pfizer Inc. | Escherichia coli compositions and methods thereof |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DK1909830T3 (da) * | 2005-08-02 | 2011-12-19 | Novartis Vaccines & Diagnostic | Formindskelse af interferens mellem olieholdige adjuvanser og antigener indeholdende overfladeaktivt middel |
| GB0522765D0 (en) * | 2005-11-08 | 2005-12-14 | Chiron Srl | Combination vaccine manufacture |
| CN104004671A (zh) * | 2014-05-13 | 2014-08-27 | 江南大学 | 一种表达乙肝表面抗原的酿酒酵母工程菌及其构建方法和应用 |
| CN104873969B (zh) * | 2015-04-16 | 2018-06-19 | 南京赛威信生物医药有限公司 | 基于HBV PreS-S、C抗原及新型佐剂CpG的治疗性乙型肝炎疫苗 |
| EA201792470A1 (ru) * | 2015-06-08 | 2018-10-31 | Серум Инститьют Оф Индия Прайват Лтд. | Способы улучшения адсорбции полисахарид-белковых конъюгатов и полученная из них композиция поливалентной вакцины |
| MY191163A (en) * | 2016-08-26 | 2022-06-03 | The Centers For Disease Control And Prevention Cdc | Multivalent vaccine composition |
Family Cites Families (44)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA1341302C (en) | 1983-02-22 | 2001-10-09 | Rae Lyn Burke | Yeast expression systems with vectors having gapdh or pyk promoters and synthesis of foreign protein |
| US4876197A (en) | 1983-02-22 | 1989-10-24 | Chiron Corporation | Eukaryotic regulatable transcription |
| US4683294A (en) | 1985-04-03 | 1987-07-28 | Smith Kline Rit, S.A. | Process for the extraction and purification of proteins from culture media producing them |
| US4912094B1 (en) | 1988-06-29 | 1994-02-15 | Ribi Immunochem Research Inc. | Modified lipopolysaccharides and process of preparation |
| DE3841091A1 (de) | 1988-12-07 | 1990-06-13 | Behringwerke Ag | Synthetische antigene, verfahren zu ihrer herstellung und ihre verwendung |
| US6306625B1 (en) * | 1988-12-30 | 2001-10-23 | Smithkline Beecham Biologicals, Sa | Method for obtaining expression of mixed polypeptide particles in yeast |
| CA2006700A1 (en) | 1989-01-17 | 1990-07-17 | Antonello Pessi | Synthetic peptides and their use as universal carriers for the preparation of immunogenic conjugates suitable for the development of synthetic vaccines |
| KR920703114A (ko) | 1989-07-14 | 1992-12-17 | 원본미기재 | 접합체 백신을 위한 시토킨 및 호르몬 운반체 |
| EP0414374B1 (en) * | 1989-07-25 | 1997-10-08 | Smithkline Biologicals S.A. | Novel antigens and methods for their preparation |
| PL168787B1 (pl) * | 1989-08-03 | 1996-04-30 | Smithkline Beecham Biolog | Sposób wytwarzania czastki kompozytowej PL |
| IT1237764B (it) | 1989-11-10 | 1993-06-17 | Eniricerche Spa | Peptidi sintetici utili come carriers universali per la preparazione di coniugati immunogenici e loro impiego per lo sviluppo di vaccini sintetici. |
| GB9007024D0 (en) * | 1990-03-29 | 1990-05-30 | Imperial College | Novel vaccine |
| US5639637A (en) * | 1990-03-29 | 1997-06-17 | Imperial College Of Science, Technology & Medicine | Hepatitis B vaccine |
| SE466259B (sv) | 1990-05-31 | 1992-01-20 | Arne Forsgren | Protein d - ett igd-bindande protein fraan haemophilus influenzae, samt anvaendning av detta foer analys, vacciner och uppreningsaendamaal |
| ATE128628T1 (de) | 1990-08-13 | 1995-10-15 | American Cyanamid Co | Faser-hemagglutinin von bordetella pertussis als träger für konjugierten impfstoff. |
| AU2927892A (en) * | 1991-11-16 | 1993-06-15 | Smithkline Beecham Biologicals (Sa) | Hybrid protein between cs from plasmodium and hbsag |
| US6169171B1 (en) * | 1992-02-27 | 2001-01-02 | Smithkline Beecham Biologicals (S.A.) | Hybrid protein between CS from plasmodium and HBSAG |
| US5928902A (en) * | 1992-02-27 | 1999-07-27 | Smithkline Beecham Biologicals (S.A.) | Hybrid protein between CS from plasmodium and HBsAg |
| IT1262896B (it) | 1992-03-06 | 1996-07-22 | Composti coniugati formati da proteine heat shock (hsp) e oligo-poli- saccaridi, loro uso per la produzione di vaccini. | |
| SG48365A1 (en) | 1992-05-23 | 1998-04-17 | Smithkline Beecham Biolog | Combined vaccines comprising hepatitis b surface antigen and other antigens |
| IL102687A (en) | 1992-07-30 | 1997-06-10 | Yeda Res & Dev | Conjugates of poorly immunogenic antigens and synthetic pepide carriers and vaccines comprising them |
| US5776468A (en) | 1993-03-23 | 1998-07-07 | Smithkline Beecham Biologicals (S.A.) | Vaccine compositions containing 3-0 deacylated monophosphoryl lipid A |
| US6429199B1 (en) | 1994-07-15 | 2002-08-06 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules for activating dendritic cells |
| US6239116B1 (en) | 1994-07-15 | 2001-05-29 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| US6207646B1 (en) | 1994-07-15 | 2001-03-27 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| TR199701547T1 (xx) | 1995-06-07 | 1998-03-21 | Smithkline Beecham Biologicals S.A. | Polisakarit antijen protein e�leni�i i�eren a��. |
| US20020054884A1 (en) | 1995-06-23 | 2002-05-09 | Smithkline Beecham Biologicals, Sa | Vaccine composition comprising a polysaccharide conjugate antigen adsorbed onto aluminium phosphate |
| PL184872B1 (pl) | 1995-06-23 | 2003-01-31 | Smithkline Beecham Biolog | Kombinowana szczepionkaĆ zestaw do przygotowania kombinowanej szczepionkiĆ sposób wytwarzania kombinowanej szczepionki i jej zastosowanie |
| RU2088664C1 (ru) * | 1996-01-26 | 1997-08-27 | Акционерное общество закрытого типа Научно-производственная компания "Комбиотех Лтд." | Рекомбинантная плазмидная днк pdes20, кодирующая поверхностный антиген вируса гепатита в (hbsag/ayw), штамм дрожжей saccharomyces cerevisiae, содержащий рекомбинантную плазмидную днк pdes20 - продуцент поверхностного антигена вируса гепатита в (hbsag/ayw) |
| DK1005368T3 (da) | 1997-03-10 | 2010-01-04 | Ottawa Hospital Res Inst | Anvendelse af nukleinsyrer, der indeholder ikke-metyleret CpG dinukleotid i kombination med alun som hjælpestoffer |
| GB9713156D0 (en) | 1997-06-20 | 1997-08-27 | Microbiological Res Authority | Vaccines |
| US6562798B1 (en) | 1998-06-05 | 2003-05-13 | Dynavax Technologies Corp. | Immunostimulatory oligonucleotides with modified bases and methods of use thereof |
| ATE459373T1 (de) | 1999-03-19 | 2010-03-15 | Glaxosmithkline Biolog Sa | Impfstoff gegen kapsulare polysaccharide von streptococcus pneumoniae |
| JP2002541808A (ja) | 1999-04-09 | 2002-12-10 | テクラブ, インコーポレイテッド | ポリサッカリド結合体ワクチンのための組換えトキシンaタンパク質キャリア |
| US20010044416A1 (en) | 2000-01-20 | 2001-11-22 | Mccluskie Michael J. | Immunostimulatory nucleic acids for inducing a Th2 immune response |
| GB0007432D0 (en) | 2000-03-27 | 2000-05-17 | Microbiological Res Authority | Proteins for use as carriers in conjugate vaccines |
| CZ20024224A3 (cs) | 2000-06-29 | 2003-05-14 | Glaxosmithkline Biologicals S. A. | Farmaceutický prostředek |
| AU2001294750C1 (en) | 2000-09-26 | 2008-09-18 | Idera Pharmaceuticals, Inc. | Modulation of immunostimulatory activity of immunostimulatory oligonucleotide analogs by positional chemical changes |
| SI21352A (sl) | 2001-01-23 | 2004-06-30 | Aventis Pasteur | Multivalentno meningokokno cepivo iz konjugata polisaharida-proteina |
| WO2002091998A2 (en) | 2001-05-11 | 2002-11-21 | Aventis Pasteur, Inc. | Novel meningitis conjugate vaccine |
| GB0115176D0 (en) | 2001-06-20 | 2001-08-15 | Chiron Spa | Capular polysaccharide solubilisation and combination vaccines |
| WO2003035836A2 (en) | 2001-10-24 | 2003-05-01 | Hybridon Inc. | Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5' ends |
| GB0202901D0 (en) | 2002-02-07 | 2002-03-27 | Glaxosmithkline Biolog Sa | Novel vaccine |
| ES2504166T3 (es) | 2002-09-13 | 2014-10-08 | Novartis Vaccines And Diagnostics, Inc. | Vacuna de estreptococo del grupo B |
-
2006
- 2006-04-14 CA CA002605179A patent/CA2605179A1/en not_active Abandoned
- 2006-04-14 WO PCT/US2006/014240 patent/WO2006113528A2/en not_active Ceased
- 2006-04-14 EP EP10189543A patent/EP2329843A3/en not_active Ceased
- 2006-04-14 RU RU2007142383/10A patent/RU2442825C2/ru not_active IP Right Cessation
- 2006-04-14 US US11/918,864 patent/US8119146B2/en active Active
- 2006-04-14 CN CNA2006800218132A patent/CN101500601A/zh active Pending
- 2006-04-14 SG SG2010026235A patent/SG175456A1/en unknown
- 2006-04-14 JP JP2008507760A patent/JP2008536515A/ja active Pending
- 2006-04-14 EP EP06750309A patent/EP1871411A4/en not_active Withdrawn
- 2006-04-14 BR BRPI0610297-2A patent/BRPI0610297A2/pt not_active IP Right Cessation
Non-Patent Citations (1)
| Title |
|---|
| See references of EP1871411A4 * |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007026249A3 (en) * | 2005-09-01 | 2007-10-04 | Novartis Vaccines & Diagnostic | Multiple vaccination including serogroup c meningococcus |
| US8007807B2 (en) | 2005-09-01 | 2011-08-30 | Novartis Vaccines And Diagnostics Gmbh | Multiple vaccination including serogroup C meningococcus |
| US8361477B2 (en) | 2005-09-01 | 2013-01-29 | Novartis Vaccines And Diagnostics Gmbh | Multiple vaccination including serogroup C Meningococcus |
| US8444992B2 (en) | 2005-09-01 | 2013-05-21 | Novartis Vaccines And Diagnostics Gmbh | Multiple vaccination including serogroup C meningococcus |
| US8784826B2 (en) | 2005-09-01 | 2014-07-22 | Novartis Ag | Multiple vaccination including serogroup C meningococcus |
| US9040058B2 (en) | 2011-11-11 | 2015-05-26 | Glaxosmithkline Biologicals Sa | Fermentation media free of animal-derived components for production of diphtheria toxoids suitable for human vaccine use |
| EP2974740A4 (en) * | 2013-03-13 | 2016-08-24 | Jiangsu Theravac Bio Pharmaceutical Co Ltd | HEPATITIS B VACCINE |
| US9878035B2 (en) | 2013-03-13 | 2018-01-30 | Jiangsu Theravac Bio-Pharmaceutical Co., Ltd. | Hepatitis B vaccine |
| CN103333938A (zh) * | 2013-07-19 | 2013-10-02 | 深圳康泰生物制品股份有限公司 | 重组酿酒酵母表达的乙肝表面抗原及其生产方法、乙肝疫苗及其生产方法 |
| US12458689B2 (en) | 2020-02-23 | 2025-11-04 | Pfizer Inc. | Escherichia coli compositions and methods thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| SG175456A1 (en) | 2011-11-28 |
| CN101500601A (zh) | 2009-08-05 |
| RU2442825C2 (ru) | 2012-02-20 |
| EP2329843A3 (en) | 2011-09-14 |
| RU2007142383A (ru) | 2009-05-27 |
| JP2008536515A (ja) | 2008-09-11 |
| CA2605179A1 (en) | 2006-10-26 |
| US8119146B2 (en) | 2012-02-21 |
| WO2006113528A3 (en) | 2009-04-16 |
| EP2329843A2 (en) | 2011-06-08 |
| EP1871411A4 (en) | 2010-07-21 |
| EP1871411A2 (en) | 2008-01-02 |
| US20090175904A1 (en) | 2009-07-09 |
| BRPI0610297A2 (pt) | 2010-06-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8802111B2 (en) | Manufacture of vaccines that contain both hepatitis B virus surface antigens and surfactant | |
| EP2097102B1 (en) | Combination vaccine having reduced polio virus antigen quantities | |
| RU2641969C2 (ru) | Множественная вакцинация, включающая менингококки серогруппы с | |
| CN1313152C (zh) | 疫苗 | |
| US20100226937A1 (en) | Combination vaccines with 1-hydroxy-2-phenoxyethane preservative | |
| TW201919690A (zh) | 具有改善之安定性、增強之免疫原性及降低之反應原性的免疫原性組成物和其製備方法 | |
| US8119146B2 (en) | Expressing hepatitis B virus surface antigen for vaccine preparation | |
| JP2022502469A (ja) | 低減用量の不活化ポリオウイルスを含む混合ワクチン組成物およびそれを調製するための方法 | |
| US20120121714A1 (en) | Compositions with antigens adsorbed to calcium phosphate | |
| HK1157645A (en) | Expressing hepatitis b virus surface antigen for vaccine preparation | |
| PL174077B1 (pl) | Szczepionka do ochrony przed zakażeniem lub leczeniem zakażeń Hepatitis B i heterologicznych chorób, zawierająca antygen powierzchniowy Hepatitis B (HBsAg) | |
| HK1129563B (en) | Inactivated poliovirus combination vaccine |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200680021813.2 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| ENP | Entry into the national phase |
Ref document number: 2605179 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2008507760 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006750309 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2007142383 Country of ref document: RU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11918864 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: PI0610297 Country of ref document: BR Kind code of ref document: A2 |