WO2005077072A2 - Hybrid polypeptides with selectable properties - Google Patents

Hybrid polypeptides with selectable properties Download PDF

Info

Publication number
WO2005077072A2
WO2005077072A2 PCT/US2005/004178 US2005004178W WO2005077072A2 WO 2005077072 A2 WO2005077072 A2 WO 2005077072A2 US 2005004178 W US2005004178 W US 2005004178W WO 2005077072 A2 WO2005077072 A2 WO 2005077072A2
Authority
WO
WIPO (PCT)
Prior art keywords
pyy
exendin
amylin
bio
hybrid polypeptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2005/004178
Other languages
English (en)
French (fr)
Other versions
WO2005077072A3 (en
Inventor
Odile Esther Levy
Michael R. Hanley
Carolyn M. Jodka
Diana Y. Lewis
Christopher J. Soares
Soumitra S. Ghosh
Lawrence J. D'souza
David G. Parkes
Christine M. Mack
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Amylin Pharmaceuticals LLC
Original Assignee
Amylin Pharmaceuticals LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2005211755A priority Critical patent/AU2005211755B2/en
Priority to EP05722892.6A priority patent/EP1718665B1/en
Priority to NZ548978A priority patent/NZ548978A/en
Priority to JP2006553217A priority patent/JP2007525495A/ja
Priority to IN3921DEN2012 priority patent/IN2012DN03921A/en
Priority to CN2005800120093A priority patent/CN1961000B/zh
Priority to KR1020147001171A priority patent/KR20140011431A/ko
Priority to CA2555877A priority patent/CA2555877C/en
Application filed by Amylin Pharmaceuticals LLC filed Critical Amylin Pharmaceuticals LLC
Priority to KR1020127032622A priority patent/KR101427024B1/ko
Priority to BRPI0507594-7A priority patent/BRPI0507594A/pt
Publication of WO2005077072A2 publication Critical patent/WO2005077072A2/en
Publication of WO2005077072A3 publication Critical patent/WO2005077072A3/en
Priority to IL177229A priority patent/IL177229A0/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/14Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/48Drugs for disorders of the endocrine system of the pancreatic hormones
    • A61P5/50Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/57563Vasoactive intestinal peptide [VIP]; Related peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/595Gastrins; Cholecystokinins [CCK]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/605Glucagons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1002Tetrapeptides with the first amino acid being neutral
    • C07K5/1005Tetrapeptides with the first amino acid being neutral and aliphatic
    • C07K5/1013Tetrapeptides with the first amino acid being neutral and aliphatic the side chain containing O or S as heteroatoms, e.g. Cys, Ser
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1024Tetrapeptides with the first amino acid being heterocyclic
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/06Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • the present invention relates to peptide chemistry, and more particularly to hybrid polypeptides with selectable properties.
  • BACKGROUND OF THE INVENTION Central to many metabolic diseases and disorders is the regulations of insulin levels and blood glucose levels. Insulin secretion is modulated in part by secretagogue hormones, termed as incretins, which are produced by enteroendocrine cells.
  • the incretin hormone, glucagon-like peptide- 1 (“GLP-1”) is a peptide hormone secreted by intestinal cells that has been shown in multiple studies to produce an enhancing effect on insulin secretion.
  • GLP-1 is processed from proglucagon in the gut and enhances nutrient-induced insulin release (Krcymarm B., et al, Lancet, 2:1300-1303 (1987)).
  • Various truncated forms of GLP-1 are known to stimulate insulin secretion (insulinotropic action) and cAMP formation [see, e.g., Mojsov, S., Int. J. Pep. Pro. Res., 40:333-343 (1992)].
  • a relationship between various in vitro laboratory experiments and mammalian, especially human, insulinotropic responses to exogenous administration of GLP-1, GLP-l(7-36) amide, and GLP-1 (7-37) acid has been established (see, e.g., Nauck, M.
  • GLP-1 (7-36) amide exerts a pronounced antidiabetogenic effect in insulin-dependent diabetics by stimulating insulin sensitivity and by enhancing glucose-induced insulin release at physiological concentrations (Gutniak M., et al., New Eng. J. Med., 326:1316- 1322 (1992)).
  • GLP-l(7-36) amide When administered to non-insulin dependent diabetics, GLP-l(7-36) amide stimulates insulin release, lowers glucagon secretion, inhibits gastric emptying and enhances glucose utilization (Nauck, 1993; Gutniak, 1992; Nauck, 1993).
  • GLP-1 type molecules for prolonged therapy of diabetes has been complicated because the serum half-life of such peptides is quite short. More particularly, GLP-1 is a 30-amino acid peptide derived from proglucagon, a 160- amino acid prohormone.
  • GLP-1 and GLP-2 Actions of different prohormone convertases in the pancreas and intestine result in the production of glucagons and other ill-defined peptides, whereas cleavage of proglucagon results in the production of GLP-1 and GLP-2 as well as two other peptides.
  • the amino acid sequence of GLP-1 is 100% homologous in all mammals studied so far, implying a critical physiological role.
  • GLP-1 (7-37) acid is C-terminally truncated and amidated to form GLP-1 (7-36) NH .
  • the biological effects and metabolic turnover of the free acid GLP-1 (7-37) OH, and the amide, GLP-1 (7-36) NH 2 are indistinguishable.
  • the numbering of the amino acids is based on the processed GLP-1 (1-37) OH from proglucagon.
  • the biologically active GLP-1 is the result of further processing: GLP-1 (7-36) NH 2 .
  • GLP-1 (7-37) OH or GLP-1 (7-36)NH 2 is 7 His.
  • GLP-1 In the gastrointestinal tract, GLP-1 is produced by L-cells of intestinal, colonic and rectal mucosa, in response to stimulation by intraluminal glucose. The plasma half-life of active GLP-1 is ⁇ 5 minutes, and its metabolic clearance rate is around 12-13 minutes (Hoist, 1994).
  • the major protease involved in the metabolism of GLP-1 is dipeptidyl peptidase (DPP) IV (CD26) which cleaves the N-terminal His-Ala dipeptide, thus producing metabolites, GLP-1 (9-37) OH or GLP-1 (9-36) NH 2 which are variously described as inactive, weak agonist or antagonists of GLP-1 receptor.
  • DPP dipeptidyl peptidase
  • CD26 dipeptidyl peptidase
  • GLP-1 (9-37) OH or GLP-1 (9-36) NH 2 which are variously described as inactive, weak agonist or antagonists of GLP-1 receptor.
  • GLP-1 receptor is a G protein coupled receptor of 463 amino acid and is localized in pancreatic beta cells, in the lungs and to a lesser extent in the brain, adipose tissue and kidneys.
  • the stimulation of GLP-1R by GLP-1 (7-37) OH or GLP-1 (7-36)NH 2 results in adenylate cyclase activation, cAMP synthesis, membrane depolarization, rise in intracellular calcium and increase in glucose-induced insulin secretion (Holz et al, 1995).
  • GLP-1 is a potent insulin secretagogue that is secreted from the intestinal mucosa in response to food intake.
  • GLP-1R knockout mice are glucose-intolerant.
  • the incretin response of i.v. infused GLP-1 is preserved in diabetic subjects, though the incretin response to oral glucose in these patients is compromised.
  • GLP-1 administration by infusion or sc injections controls fasting glucose levels in diabetic patients, and maintains the glucose threshold for insulin secretion (Gutniak et al, 1992; Nauck et al, 1986; Nauck et al, 1993).
  • GLP- 1 has shown tremendous potential as a therapeutic agent capable of augmenting insulin secretion in a physiological manner, while avoiding hypoglycemia associated with sulfonylurea drugs.
  • GLP-1 inhibitory actions on pancreatic alpha cell secretion of glucagon leads to decreases in hepatic glucose production via reduction in gluconeogenesis and glycogeno lysis. This antiglucagon effect of GLP-1 is preserved in diabetic patients.
  • GLP-1 gastric motility and gastric secretion are inhibited
  • vagal efferent receptors vagal efferent receptors
  • Reduction of gastric acid secretion by GLP-1 contributes to a lag phase in nutrient availability, thus obviating the need for rapid insulin response.
  • the gastrointestinal effects of GLP-1 contribute significantly to delayed glucose and fatty acid absorption and modulate insulin secretion and glucose homeostasis.
  • GLP-1 has also been shown to induce beta cell specific genes, such as GLUT-1 transporter, insulin (via the interaction of PDX-1 with insulin gene promoter), and hexokinase-1. Thus GLP-1 could potentially reverse glucose intolerance normally associated with aging, as demonstrated by rodent experiments. In addition, GLP-1 may contribute to beta cell neogenesis and increase beta cell mass, in addition to restoring beta cell function during states of beta cell insufficiency.
  • GLP-1 Central effects of GLP-1 include increases in satiety coupled with decreases in food intake, effected via the action of hypothalamic GLP-1R.
  • Exendins are another family of peptides implicated in insulin secretion. Exendins are found in the saliva of the Gila-monster, a lizard endogenous to Arizona, and the Mexican Beaded Lizard. Exendin-3 is present in the saliva of Heloderma horridum, and exendin-4 is present in the saliva of Heloderma suspectum (Eng, J., et al, J. Biol. Chem., 265:20259-62, 1990; Eng., J., et al, J. Biol. Chem., 267:7402-05 (1992)).
  • exendins have some sequence similarity to several members of the glucagon-like peptide family, with the highest homology, 53%, being to GLP-1 (Goke, et al, J. Biol. Chem., 268:19650-55 (1993)).
  • Exendin-4 binds the GLP-1 receptors on insulin-secreting TCI cells, at dispersed acinar cells from guinea pig pancreas, and at parietal cells from stomach; the peptide also stimulates somatostatin release and inhibits gastrin release in isolated stomachs (Goke, et al, J. Biol. Chem., 268:19650-55 (1993); Schepp, et al, Eur. J. Pharmacol, 69:183-91 (1994); Eissele, et al, Life Sci., 55:629-34 (1994)).
  • Exendin-3 and exendin-4 were found to bind the GLP-1 receptors on, to stimulating cAMP production in, and amylase release from, pancreatic acinar cells (Malhotra, R., et al, Rommeatory Peptides, 41:149-56 (1992); Raufman, et al, J. Biol. Chem., 267:21432-37 (1992); Singh, et al, Regul Pept, 53:47- 59 (1994)).
  • the use of the insulinotropic activities of exendin-3 and exendin-4 for the treatment of diabetes mellitus and the prevention of hyperglycemia has been proposed (Eng, U.S. Pat. No. 5,424,286).
  • Truncated exendin peptides such as exendin[9-39], a carboxyamidated molecule, and fragments 3-39 through 9-39 have been reported to be potent and selective antagonists of GLP-1 (Goke, et al, J. Biol. Chem., 268:19650-55 (1993); Raufman, J. P., et al, J. Biol. Chem., 266:2897-902 (1991); Schepp, W., et al, Eur. J. Pharm., 269:183-91 (1994); Montrose-Rafizadeh, et al, Diabetes, 45(Suppl. 2):152A (1996)).
  • Exendin[9-39] blocks endogenous GLP-1 in vivo, resulting in reduced insulin secretion (Wang, et al, J. Clin. Invest, 95:417-21 (1995); D'Alessio, et al, J. Clin. Invest, 97:133-38 (1996)).
  • the receptor apparently responsible for the insulinotropic effect of GLP-1 has been cloned from rat pancreatic islet cells (Thorens, B., Proc. Natl. Acad. Sci. USA 89:8641-8645 (1992)).
  • Exendins and exendin[9-39] bind to the cloned GLP-1 receptor (rat pancreatic - cell GLP-1 receptor: Fehmann HC, et al, Peptides, 15 (3): 453-6 (1994); human GLP-1 receptor: Thorens B, et al, Diabetes, 42 (11): 1678-82 (1993)).
  • exendin-4 is an agonist, i.e., it increases cAMP
  • exendin[9-39] is an antagonist, i.e., it blocks the stimulatory actions of exendin-4 and GLP-1. Id.
  • exendin-4 is a 39 amino acid C-terminal amidated peptide found in the saliva of the Gila Monster (Heloderma horridum), with a 53% amino acid sequence homology to the GLP-1 peptide sequence.
  • Eng, J., et al. "Isolation and Characterization of Exendin-4, and Exendin-3 Analogue from Heloderma suspectum Venom," J. Bio. Chem., 267:11, p. 7402-7405 (1992), Young, A. A., et al, "Glucose- Lowering and Insulin-Sensitizing Actions of Exendin-4," Diabetes, Vol. 48, p. 1026- 1034, May, 1999.
  • exendin-4 is a highly specific agonist for the GLP-1 receptor, and, like GLP-1, is able to stimulate insulin secretion. Therefore, like GLP-1, exendin-4 is regarded as an insulinotropic peptide.
  • exendin-4 has a relatively long half-life in humans, because of its resistance to the dipeptidyl peptidase IV which rapidly degrades the GLP-1 sequence in vivo. Furthermore, it has been shown that, as compared to GLP-1, exendin-4 has a stronger capability to stimulate insulin secretion, and that a lower concentration of exendin-4 may be used to obtain such stimulating activity. See, e.g., U.S. Pat. No. 5,424,286, herein incorporated by reference. Therefore exendin-4 peptides or derivatives thereof (for examples of such derivatives, see, e.g., U.S. Pat. No. 6,528,486, herein incorporated by reference, and its corresponding international application WO 01/04156) have a greater potential utility for the treatment of conditions involving the dysregulation of insulin levels (e.g., conditions such as diabetes) than either insulin or GLP-1.
  • conditions involving the dysregulation of insulin levels e.g., conditions such as diabetes
  • amylin family of peptide hormones, including amylin, calcitonin, calcitonin gene related peptide, adrenomedullin, and intermedin (also known as "AFP-6").
  • Amylin is a 37- amino acid protein hormone. It was isolated, purified and chemically characterized as the major component of amyloid deposits in the islets of pancreases of human Type 2 diabetics (Cooper et al, Proc. Natl. Acad. Sci, USA, 84:8628-8632 (1987)).
  • the amylin molecule has two post-translational modifications: the C-terminus is amidated, and the cysteines in positions 2 and 7 are cross-linked to form an N-terminal loop.
  • the sequence of the open reading frame of the human amylin gene shows the presence of the Lys-Arg dibasic amino acid proteolytic cleavage signal, prior to the N-terminal codon for Lys, and the Gly prior to the Lys-Arg proteolytic signal at the CLAIMS -terminal position, a typical sequence for amidation by protein amidating enzyme, PAM (Cooper et al, Biochem. Biophys. Ada, 1014:247-258 (1989)).
  • Amylin is believed to regulate gastric emptying, and suppress glucagon secretion and food intake, thus regulating the rate of glucose appearance in the circulation. It appears to complement the actions of insulin, which regulates the rate of glucose disappearance from the circulation and its uptake by peripheral tissues. These actions are supported by experimental findings in rodents and humans, which indicate that amylin complements the effects of insulin in postprandial glucose control by at least three independent mechanisms, all of which affect the rate of glucose appearance. First, amylin suppresses postprandial glucagon secretion. Compared to healthy adults, patients with type 1 diabetes have no circulating amylin and patients with type 2 diabetes have diminished postprandial amylin concentrations.
  • Amylin may be beneficial in treating metabolic conditions such as diabetes and obesity. Amylin may also be used to treat pain, bone disorders, gastritis, to modulate lipids, in particular triglycerides, or to affect body composition such as the preferential loss of fat and sparing of lean tissue.
  • CT hormone calcitonin
  • the hormone calcitonin (CT) was named for its secretion in response to induced hypercalcemia and its rapid hypocalcemic effect. It is produced in and secreted from neuroendocrine cells in the thyroid that have since been termed C cells.
  • the best-studied action of CT(l-32) is its effect on the osteoclast. In vitro effects of CT include the rapid loss of ruffled borders and decreased release of lysosomal enzymes. Ultimately, the inhibition of osteoclast functions by CT results in a decrease in bone resorption.
  • CT(l-32) a major function of CT(l-32) is to combat acute hypercalcemia in emergency situations and/or protect the skeleton during periods of "calcium stress” such as growth, pregnancy, and lactation.
  • calcium stress such as growth, pregnancy, and lactation.
  • CT has an effect on plasma calcium levels and inhibits osteoclast function and is widely used for the treatment of osteoporosis.
  • sCT appears to increase bone density and decrease fracture rates with minimal adverse effects.
  • CT has also been successfully used over the past 25 years as a therapy for Paget's disease of bone, which is a chronic skeletal disorder that may result in enlarged or deformed bones in one or more regions of the skeleton.
  • CT is also widely used for its analgesic effect on bone pain experienced during osteoporosis, although the mechanism for this effect is not clearly understood.
  • Calcitonin gene related peptide is a neuropeptide whose receptors are widely distributed in the body, including the nervous system and the cardiovascular system. This peptide seems to modulate sensory neurotransmission and is one of the most potent endogenous vasodilatory peptide discovered to date.
  • Reported biological effects for CGRP include: modulation of substance P in inflammation, nicotinic receptor activity at the neuromuscular junction, stimulation of pancreatic enzyme secretion, a reduction of gastric acid secretion, peripheral vasodilation, cardiac acceleration, neuro-modulation, regulation of calcium metabolism, osteogenic stimulation, insulin secretion, an increase in body temperature and a decrease in food intake.
  • CGRP calcitonin gene-related peptide, calcitonin and ADM: a peptide superfamily. Crit Rev Neurobiol. 1997; 11(2-3): 167-239).
  • An important role of CGRP is to control blood flow to various organs by its potent vasodilatory actions, as evidenced by a decrease of mean arterial pressure following intravenous administration of ⁇ -CGRP.
  • the vasodilatory actions are also supported by recent analysis of homozygous knockout CGRP mice, which demonstrated elevated peripheral vascular resistance and high blood pressure caused by increased peripheral sympathetic activity (Kurihara H, et al, Targeted disruption of ADM and ⁇ CGRP genes reveals their distinct biological roles. Hypertens Res. 2003 Feb; 26 Supp S 105-8).
  • CGRP appears to elicit vasodilatory effects, hypotensive effects and an increase in heart rate among other actions.
  • CGRP Cerebral CGRP
  • Other indications of CGRP use include renal failure, acute and chronic coronary artery ischemia, treatment of cardiac arrhythmia, other peripheral vascular disease such as Raynaud's phenomenon, subarachnoid hemorrhage, hypertension, and pulmonary hypertension.
  • Preeclamptic toxemia of pregnancy and preterm labor is also potentially treatable. (Wimalawansa, 1997).
  • Recent therapeutic uses include the use of CGRP antagonists for the treatment of migraine headaches.
  • Adrenomedullin is almost ubiquitously expressed with many more tissues containing the peptide than not.
  • a published review of ADM (Hinson, J.P. et al, Endocrine Reviews (2000) 21(2): 138-167) details its effects on the cardiovascular system, cellular growth, the central nervous system and the endocrine system, with a range of biological actions including vasodilation, cell growth, regulation of hormone secretion, and natriuresis.
  • Studies in rat, cat, sheep, and man confirm that intravenous infusion of ADM results in potent and sustained hypotension, and is comparable to that of CGRP.
  • hypotensive effect of ADM on mean arterial pressure in the anesthetized rat is not inhibited by the CGRP antagonist CGRP 8 - 37 suggesting that this effect is not mediated via CGRP receptors.
  • Acute or chronic administration of human ADM in rats, anesthetized, conscious or hypertensive results in a significant decrease in total peripheral resistance accompanied by a fall in blood pressure, with a concomitant rise in heart rate, cardiac output and stroke volume.
  • ADM has also been proposed as an important factor in embryogenesis and differentiation and as an apoptosis survival factor for rat endothelial cells. This is supported by recent mouse ADM knockout studies, in which mice homozygous for loss of the ADM gene demonstrated defective vascular formation during embryogenesis and thus died mid- gestation. It was reported that ADM +/- heterozygous mice had high blood pressure along with susceptibility to tissue injury (Kurihara H, et al, Hypertens Res. 2003 Feb; 26 Supp S 105-8).
  • ADM affects such endocrine organs as the pituitary, the adrenal gland, reproductive organs and the pancreas.
  • the peptide appears to have a role in inhibiting ACTH release from the pituitary.
  • the adrenal gland it appears to affect the secretory activity of the adrenal cortex in both rat and human and it increases adrenal blood flow, acting as a vasodilator in the adrenal vascular bed in intact rats.
  • ADM has been shown to be present throughout the female reproductive tract and plasma levels are elevated in normal pregnancy. Studies in a rat model of preeclampsia show that ADM can reverse hypertension and decrease pup mortality when given to rats during late gestation.
  • ADM may play an important regulatory role in the utero-placental cardiovascular system. In the pancreas, ADM most likely plays an inhibitory role since it attenuated and delayed insulin response to an oral glucose challenge, resulting in initial elevated glucose levels. ADM can also affect renal function. A bolus administered peripherally can significantly lower mean arterial pressure and raise renal blood flow, glomerular filtration rate and urine flow. In some cases, there is also an increase in Na+ excretion.
  • ADM also has other peripheral effects on bone and on the lung.
  • studies have supported a role beyond the cardiovascular system and fluid homeostasis and have demonstrated that ADM acts on fetal and adult rodent osteoblasts to increase cell growth comparable to those of known osteoblast growth factors such as transforming growth factor- ⁇ . This is important clinically as one of the major challenges in osteoporosis research is to develop a therapy that increases bone mass via osteoblastic stimulation.
  • ADM In the lung, ADM not only causes pulmonary vasodilation, but also inhibits bronchoconstriction induced by histamine or acetylcholine.
  • ADM In healthy volunteers, i.v. infusion of ADM has been shown to reduce arterial pressure and to stimulate heart rate, cardiac output, plasma levels of cAMP, prolactin, norepinephrine and rennin. In these patients, there was little or no increase in urine volume or sodium excretion observed. In patients with heart failure or chronic renal failure, i.v. ADM had similar effects to those seen in normal subjects, and also induced diuresis and natriuresis, depending on the dose administered (Nicholls, MG et al Peptides.
  • ADM treatment has also been shown to be beneficial in arterial and pulmonary hypertension, septic shock and ischemia/reperfusion injury (Beltowski J., Pol J Pharmacol. 2004;56:5-27).
  • Other indications for ADM treatment include: peripheral vascular disease, subarachnoid hemorrhage, hypertension, preeclamptic toxemia of pregnancy and preterm labor, and osteoporosis.
  • AFP-6 i.e., intermedin
  • a specific receptor for AFP-6 has not been reported; however, binding studies indicate that AFP-6 binds to all the known receptors of the Amylin Family.
  • AFP-6 has been shown to increase cAMP production in SK-N-MC and L6 cells expressing endogenous CGRP receptors and competes with labeled CGRP for binding to its receptors in these cells.
  • AFP-6 administration led to blood pressure reduction in both normal and spontaneously hypertensive rats, most likely via interactions with the CRLR/RAMP receptors.
  • the RAMP family comprises three members (RAMP1, -2, and -3), which share less then 30% sequence identity, but have a common topological organization.
  • Co-expression of CRLR and RAMP1 leads to the formation of a receptor for CGRP.
  • Co-expression of CRLR and RAMP2 leads to the formation of a receptor for ADM.
  • Co-expression of CRLR and RAMP3 leads to the formation of a receptor for ADM and CGRP.
  • Co-expression of hCTR2 and RAMP1 leads to the formation of a receptor for amylin and CGRP.
  • Co-expression of hCTR2 and RAMP3 leads to the formation of a receptor for amylin.
  • leptin Yet another peptide hormone family implicated in metabolic diseases and disorders is the leptin family.
  • the mature form of circulating leptin is a 146-amino acid protein that is normally excluded from the CNS by the blood-brain barrier (BBB) and the blood-CSF barrier.
  • BBB blood-brain barrier
  • Leptin is the afferent signal in a negative feedback loop regulating food intake and body weight.
  • the leptin receptor is a member of the cytokine receptor family.
  • Ob-Rb Leptin' s anorexigenic effect is dependent on binding to homodimer of the Ob-Rb isoform of this receptor which encodes a long intra-cytoplasmic domain that includes several motifs for protein-protein interaction.
  • Ob-Rb is highly expressed in the hypothalamus suggesting that this brain region is an important site of leptin action. Mutation of the mouse ob gene has been demonstrated to result in a syndrome that exhibits-pathophysiology that includes: obesity, increased body fat deposition, hyperglycemia, hyperinsulinemia, hypothermia, and impaired thyroid and reproductive functions in both male and female homozygous ob/ob obese mice (see e.g., Ingalis, et al, 1950. J Hered 41 : 317-318.
  • leptin or leptin receptor include (i) diabetes (see, e.g., PCT Patent Applications W0 98/55139, W0 98/12224, and W0 97/02004); (ii) hematopoiesis (see, e.g., PCT Patent Applications W0 97/27286 and WO 98/18486); (iii) infertility (see, e.g., PCT Patent Applications W0 97/15322 and W0 98/36763); and (iv) tumor suppression (see, e.g., PCT Patent Applications W0 98/48831), each of which are incorporated herein by reference in their entirety.
  • diabetes see, e.g., PCT Patent Applications W0 98/55139, W0 98/12224, and W0 97/02004
  • hematopoiesis see, e.g., PCT Patent Applications W0 97/27286 and WO 98/18486
  • infertility see,
  • the leptin receptor (OB-R) gene has been cloned (GenBank Accession No. AF098792) and mapping to the db locus (see, e.g., Tartaglia, et al, 1995. Cell 83: 1263-1271).
  • OB-R leptin receptor
  • Defects in OB-R produce a syndrome in the mutant diabetic ob/ob mouse that is phenotypically identical to the ob/ob mouse (see, e.g., Ghilardi, et al, 1996. Proc. Natl. Acad. Sci. USA 93: 6231-6235).
  • CCK cholecystokinin
  • CCK Crawley and Corwin, Peptides 15: 731-755 (1994).
  • Other reported effects of CCK include stimulation of pancreatic growth, stimulation of gallbladder contraction, inhibition of gastric acid secretion, pancreatic polypeptide release and a contractile component of peristalsis. Additional reported effects of CCK include vasodilation. Walsh, "Gastrointestinal Hormones,” In Physiology of the Gastrointestinal Tract (3d ed. 1994; Raven Press, New York).
  • estradiol and CCK can have a synergistic effect on satiety.
  • CCK induces satiety in several species.
  • feeding depression was caused by CCK injected intraperitoneally in rats, intraarterially in pigs, intravenously in cats and pigs, into the cerebral ventricles in monkeys, rats, dogs and sheep, and intravenously in obese and non- obese humans.
  • CCK elicits the sequence of behaviors normally observed after meal ingestion (i.e., the postprandial satiety sequence).
  • CCK was characterized in 1966 as a 33-amino acid peptide. Crawley and Corwin, supra. Species-specific molecular variants of the amino acid sequence of CCK have been identified.
  • the 33-amino acid sequence and a truncated peptide, its 8-amino acid C- terminal sequence (CCK-8) have been reportedly identified in pig, rat, chicken, chinchilla, dog and humans.
  • a 39-amino acid sequence was reportedly found in pig, dog and guinea pig.
  • a 58-amino acid sequence was reported to have been found in cat, dog and humans.
  • Frog and turtle reportedly show 47-amino acid sequences homologous to both CCK and gastrin.
  • CCK-83 Very fresh human intestine has been reported to contain small amounts of an even larger molecule, termed CCK-83.
  • CCK-22 a principal intermediate form has been reportedly identified, and is termed CCK-22.
  • Walsh "Gastrointestinal Hormones," In Physiology of the Gastrointestinal Tract (3d ed. 1994; Raven Press, New York).
  • CCK-4 a non-sulfated CCK-8 and a tetrapeptide
  • CCK-4 CCK(30-33)
  • the C-terminal pentapeptide conserves the structural homology of CCK, and also homology with the neuropeptide, gastrin.
  • CCK-8 The C-terminal sulfated octapeptide sequence, CCK-8, is reportedly relatively conserved across species. Cloning and sequence analysis of a cDNA encoding preprocholecystokinin from rat thyroid carcinoma, porcine brain, and porcine intestine reportedly revealed 345 nucleotides coding for a precursor to CCK, which is 115 amino acids and contains all of the CCK sequences previously reported to have been isolated. Crawley and Corwin, supra.
  • CCK is said to be distributed throughout the central nervous system and in endocrine cells and enteric nerves of the upper small intestine.
  • CCK agonists include CCK itself (also referred to as CCK-33), CCK-8 (CCK(26-33)), non-sulfated CCK-8, pentagastrin (CCK-5 or CCK(29-33)), and the tetrapeptide, CCK-4 (CCK(30-33)).
  • CCK-8 reportedly displaced binding with a 1000-5000 greater potency than unsulfated CCK-8 or CCK-4, and CCK-8 has been reported to be approximately 1000-fold more potent than unsulfated CCK-8 or CCK-4 in stimulating pancreatic amylase secretion.
  • CCK receptor binding was said to be displaced by unsulfated CCK-8 and by CCK-4 at concentrations that were equimolar, 10-fold or 100-fold greater than sulfated CCK-8. Id.
  • Receptors for CCK have been reportedly identified in a variety of tissues, and two primary subtypes have been described: type A receptors and type B receptors.
  • Type A receptors have been reported in peripheral tissues including pancreas, gallbladder, pyloric sphincter and afferent vagal fibers, and in discrete areas of the brain.
  • the type A receptor subtype (CCKA) has been reported to be selective for the sulfated octapeptide.
  • the Type B receptor subtype (CCK B ) has been identified throughout the brain and in the stomach, and reportedly does not require sulfation or all eight amino acids. See Reidelberger, J. Nwtr. 124 (8 Suppl.) 1327S-1333S (1994); Crawley and Corwin, supra.
  • pancreatic polypeptide family (“PPF”).
  • Pancreatic polypeptide (“PP”) was discovered as a contaminant of insulin extracts and was named by its organ of origin rather than functional importance (Kimmel et al, Endocrinology 83: 1323-30 (1968)).
  • PP is a 36-amino acid peptide containing distinctive structural motifs.
  • a related peptide was subsequently discovered in extracts of intestine and named Peptide YY ("PYY”) because of the ⁇ - and C-terminal tyrosines (Tatemoto, Proc. Natl. Acad. Sci. USA 79: 2514-8 (1982)).
  • NPY Neuropeptide Y
  • Effects of PP include inhibition of pancreatic secretion and relaxation of the gallbladder.
  • Centrally administered PP produces modest increases in feeding that may be mediated by receptors localized to the hypothalamus and brainstem (reviewed in Gehlert, Proc. Soc. Exp. Biol. Med. 218: 7-22 (1998)).
  • PYY(3-36) An alternate molecular form of PYY is PYY(3-36) (Eberlein et al, Peptides 10: 797-803 (1989); Grandt et al, Regul. Pept 51: 151-9 (1994)).
  • This fragment constitutes approximately 40% of total PYY-like immunoreactivity in human and canine intestinal extracts and about 36% of total plasma PYY immunoreactivity in a fasting state to slightly over 50% following a meal. It is apparently a dipeptidyl peptidase-IV (DPP4) cleavage product of PYY.
  • DPP4 dipeptidyl peptidase-IV
  • PYY(3-36) is reportedly a selective ligand at the Y2 and Y5 receptors, which appear pharmacologically unique in preferring N-terminally truncated (i.e., C-terminal fragments of) NPY analogs.
  • Peripheral administration of PYY reportedly reduces gastric acid secretion, gastric motility, exocrine pancreatic secretion (Yoshinaga et al, Am. J.
  • PhysioL 268: G943-8 (1995); Chen et al, Neurogastroenterol. Motil. 9: 109-16 (1997)), may differ from those effects observed after peripheral injection.
  • centrally administered PYY had some effects opposite to those described herein for peripherally injected PYY(3-36) in that gastric acid secretion was stimulated, not inhibited. Gastric motility was suppressed only in conjunction with TRH stimulation, but not when administered alone, and was indeed stimulatory at higher doses through presumed interaction with PP receptors.
  • PYY has been shown to stimulate food and water intake after central administration (Morley et al, Brain Res. 341 : 200-3 (1985); Corp et al, Am. J. PhysioL 259: R317-23 (1990)).
  • Metabolic diseases and disorders take on may forms, including obesity, diabetes, dyslipidemia, insulin resistance, cellular apoptosis, etc.
  • Obesity and its associated disorders are common and very serious public health problems in the United States and throughout the world.
  • Upper body obesity is the strongest risk factor known for type 2 diabetes mellitus, and is a strong risk factor for cardiovascular disease.
  • Obesity is a recognized risk factor for hypertension, atherosclerosis, congestive heart failure, stroke, gallbladder disease, osteoarthritis, sleep apnea, reproductive disorders such as polycystic ovarian syndrome, cancers of the breast, prostate, and colon, and increased incidence of complications of general anesthesia (see, e.g., Kopelman, Nature 404: 635-43 (2000)).
  • the pathogenesis of obesity is believed to be multifactorial but the basic problem is that in obese subjects nutrient availability and energy expenditure do not come into balance until there is excess adipose tissue. Obesity is currently a poorly treatable, chronic, essentially intractable metabolic disorder. A therapeutic drug useful in weight reduction of obese persons could have a profound beneficial effect on their health.
  • Diabetes is a disorder of carbohydrate metabolism characterized by hyperglycemia and glucosuria resulting from insufficient production or utilization of insulin. Diabetes severely affects the quality of life of large parts of the populations in developed countries. Insufficient production of insulin is characterized as type 1 diabetes and insufficient utilization of insulin is type 2 diabetes.
  • type 1 diabetes Insufficient production of insulin is characterized as type 1 diabetes and insufficient utilization of insulin is type 2 diabetes.
  • type 1 diabetes insufficient production of insulin
  • type 2 diabetes insufficient utilization of insulin
  • Dyslipidemia or abnormal levels of lipoproteins in blood plasma, is a frequent occurrence among diabetics.
  • Dyslipidemia is typically characterized by elevated plasma triglycerides, low HDL (High Density Lipoprotein) cholesterol, normal to elevated levels of LDL (Low Density Lipoprotein) cholesterol and increased levels of small dense, LDL (Low Density Lipoprotein) particles in the blood.
  • Dyslipidemia is one of the main contributors to the increased incidence of coronary events and deaths among diabetic subjects. Epidemiological studies have confirmed this by showing a several-fold increase in coronary deaths among diabetic subjects when compared with non-diabetic subjects. Several lipoprotein abnormalities have been described among diabetic subjects.
  • Insulin resistance is the diminished ability of insulin to exert its biologically action across a broad range of concentrations.
  • the body secretes abnormally high amounts of insulin to compensate for this defect and a state of impaired glucose tolerance develops. Failing to compensate for the defective insulin action, the plasma glucose concentration inevitable rises, resulting in the clinical state of diabetes.
  • insulin resistance and relative hyperinsulinemia have a contributory role in obesity, hypertension, atherosclerosis and type 2 diabetes.
  • the association of insulin resistance with obesity, hypertension and angina has been described as a syndrome, Syndrome X, having insulin resistance as the common pathogenic link.
  • Apoptosis is an active process of cellular self-destruction that is regulated by extrinsic and intrinsic signals occurring during normal development. It is well documented that apoptosis plays a key role in regulation of pancreatic endocrine beta cells. There is increasing evidence that in adult mammals the beta-cell mass is subject to dynamic changes to adapt insulin production for maintaining euglycemia in particular conditions, such as pregnancy and obesity. The control of beta cell mass depends on a subtle balance between cell proliferation, growth and programmed cell death (apoptosis). A disturbance of this balance may lead to impairment of glucose homeostasis.
  • glucose intolerance develops with aging when beta cell replication rates are reduced and human autopsy studies repeatedly showed a 40-60% reduction of beta cell mass in patients with non-insulin-dependent-diabetes mellitus compared with nondiabetic subjects. It is generally agreed that insulin resistance is an invariable accompaniment of obesity but that normoglycemia is maintained by compensatory hyperinsulinemia until the beta cells become unable to meet the increased demand for insulin, at which point type 2 diabetes begins.
  • anti-diabetic medicaments are proteins such as insulin and insulin analogues, and small molecules such as insulin sensitizers, insulin secretagogues and appetite regulating compounds.
  • the present invention relates generally to novel, selectable hybrid polypeptides useful as agents for the treatment and prevention of metabolic diseases and disorders which can be alleviated by control plasma glucose levels, insulin levels, and/or insulin secretion, such as diabetes and diabetes-related conditions.
  • hybrid polypeptides exhibiting at least one hormonal activity are provided.
  • the hybrid polypeptides of the invention comprise at least two bio- active peptide hormone modules covalently linked together, wherein at least one of the bio-active peptide hormone modules exhibits at least one hormonal activity of a component peptide hormone.
  • the bio-active peptide hormone modules are independently selected from: component peptide hormones, fragments of component peptide hormones that exhibit at least one hormonal activity of the component peptide hormones, analogs and derivatives of component peptide hormones that exhibit at least one hormonal activity of the component peptide hormones, fragments of analogs and derivatives of component peptide hormones that exhibit at least one hormonal activity of the component peptide hormones, and peptidic enhancers.
  • Component peptide hormones of the invention include: amylin, adrenomedullin (ADM), calcitonin (CT), calcitonin gene related peptide (CGRP), intermedin, cholecystokinin ("CCK”), leptin, peptide YY (PYY), glucagon-like peptide-1 (GLP-1), glucagon-like peptide 2 (GLP-2), oxyntomodulin (OXM), and exendin-4;
  • Peptidic enhancers of the invention include: structural motifs of component peptide hormones that impart a desired chemical stability, conformational stability, metabolic stability, receptor interaction, protease inhibition, or other pharmacokinetic characteristic to the hybrid polypeptide, and structural motifs of analogs or derivatives of component peptide hormones that impart a desired chemical stability, conformational stability, metabolic stability, receptor interaction, protease inhibition, or other pharmacokinetic characteristic to the hybrid polypeptide.
  • methods for treating or preventing obesity comprising administering a therapeutically or prophylactically effective amount of a hybrid polypeptide of the invention to a subject in need thereof.
  • the subject is an obese or overweight subject.
  • “obesity” is generally defined as a body mass index over 30, for purposes of this disclosure, any subject, including those with a body mass index of less than 30, who needs or wishes to reduce body weight is included in the scope of "obese.”
  • Subjects who are insulin resistant, glucose intolerant, or have any form of diabetes mellitus e.g., type 1, 2 or gestational diabetes
  • methods of reducing food intake, reducing nutrient availability, causing weight loss, treating diabetes mellitus or diabetes-associated conditions, and improving lipid profile comprising administering to a subject an effective amount of a hybrid polypeptide of the invention.
  • the methods of the invention are used to treat or prevent conditions or disorders which can be alleviated by reducing nutrient availability in a subject in need thereof, comprising administering to said subject a therapeutically or prophylactically effective amount of a hybrid polypeptide of the invention.
  • the methods of the invention are used to treat or prevent conditions or disorders which can be alleviated by control plasma glucose levels, insulin levels, and/or insulin secretion. In yet another embodiment, the methods of the invention are used to treat diabetes and/or diabetes-related conditions.
  • Such conditions and disorders include, but are not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, insulin-resistance, obesity, and diabetes mellitus of any kind, including Type I, Type II, and gestational diabetes, diabetes complications (neuropathy (based on, e.g., neurotrophic actions of exendin-4), neuropathic pain (based on, e.g., amylin action), retinopathy, nephropathy, conditions of insufficient pancreatic beta cell mass (based on, e.g., islet neogenesis actions of exendin-4 and GLP-1).
  • diabetes complications neuropathy (based on, e.g., neurotrophic actions of exendin-4), neuropathic pain (based on, e.g., amylin action), retinopathy, nephropathy, conditions of insufficient pancreatic beta cell mass (based on, e.g., islet neogenesis actions of exendin-4 and GLP-1).
  • the present invention also relates to pharmaceutical compositions comprising a therapeutically or prophylactically effective amount of at least one hybrid polypeptide of the invention, or a pharmaceutically acceptable salt thereof, together with pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, adjuvants and/or carriers useful in the delivery of the hybrid polypeptides.
  • Figure 1 demonstrates the effect of exemplary compounds of the invention in DIO mouse assay.
  • Figure 2 demonstrates the effect of exemplary compoimds of the invention in DIO mouse assay.
  • Figures 3 A-3B demonstrates the effect of exemplary compounds of the invention in DIO mouse assay.
  • Figure 4A-4B demonstrates the effects of exemplary compounds of the invention in food intake assay, compared to parent peptide compounds.
  • the present invention relates generally to novel, selectable hybrid polypeptides useful as agents for the treatment and prevention of metabolic diseases and disorders which can be alleviated by control plasma glucose levels, insulin levels, and/or insulin secretion, such as diabetes and diabetes-related conditions.
  • metabolic diseases and disorders include, but are not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, insulin-resistance, obesity, and diabetes mellitus of any kind, including type 1, type 2, and gestational diabetes.
  • the invention involves the modular assembly of physiologically, metabolically, and/or pharmacokinetically active peptidic modules that may be selectable based on "bio-activities", e.g., therapeutic efficacy, scope of function, duration of action, physicochemical properties, and/or other pharmacokinetic properties.
  • bio-activities e.g., therapeutic efficacy, scope of function, duration of action, physicochemical properties, and/or other pharmacokinetic properties.
  • the present invention relates at least in part to a "toolbox" approach, wherein bio-active peptide hormone modules are linked in binary, tertiary or higher order combinations to create novel, efficacious therapeutic agents with selectable properties.
  • bio-active peptide hormone modules may be peptide hormones, peptide fragments with hormonal activity, or structural motifs of peptide hormones that impart chemical, metabolic, and/or other pharmacokinetic stability.
  • the peptide hormones can include native peptide hormones, as well as peptide hormone analogs and derivatives, as known in the art and described herein.
  • the combination of certain physicochemical characteristics of two or more peptide hormones into a single modality can facilitate intervention at several points in a dysfunctional metabolic circuit.
  • rationally-designed hybrid polypeptides are provided that integrate selectable bio-activities into a single polypeptide agent.
  • the selectable hybrid polypeptides of the invention may involve the use of chemically stable linkers to covalently attach the bio-active modules.
  • the selectable hybrid polypeptides of the invention may involve the use of cleavable linkers, which themselves may be or form part of a bio-active module.
  • design of the hybrid polypeptides of the present invention may generally involve: (1) the identification, selection and pairing of bio-active peptide hormone modules for desired efficacy and therapeutic use, and (2) the covalent linking of the bio-active modules (e.g. native peptide hormones, peptide hormone analogs or derivatives with hormonal activity, peptide hormone fragments with hormonal activity, stabilizing motifs, etc.) either directly or via a linker without loss of bio-activity of the component modules.
  • bio-active modules e.g. native peptide hormones, peptide hormone analogs or derivatives with hormonal activity, peptide hormone fragments with hormonal activity, stabilizing motifs, etc.
  • module selection criteria may include, but not be limited to: (a) desired in vivo efficacy for desired therapeutic or prophylactic indication; (b) optional synergism or dual action of the linked modules for multiple therapeutic or prophylactic indications; and/or (c) a desired chemical stability, conformational stability, metabolic stability, receptor interaction, protease inhibition, and/or other pharmacokinetic characteristic.
  • the section headings are used herein for organizational purposes only, and are not to be construed as in any way limiting the subject matter described.
  • the present invention relates in part to hybrid polypeptides comprising at least two bio-active peptide hormone modules selectable from component peptide hormones described herein.
  • the hybrid polypeptides of the present invention will generally be useful in the treatment and prevention of metabolic conditions and disorders.
  • the hybrid polypeptides of the invention will exhibit at least one hormonal activity of a component peptide hormone, and may preferably include at least one additional bio-activity of a second component peptide hormone.
  • the hybrid polypeptides of the invention may comprise at least two bio-active peptide hormone modules, wherein each of said at least two bio-active peptide hormone modules exhibits at least one hormonal activity of a component peptide hormone.
  • the hybrid polypeptides of the invention may comprise at least two bio-active peptide hormone modules, wherein at least one of said bio-active peptide hormone modules exhibits at least one hormonal activity of a component peptide hormone and at least one of said bio-active peptide hormone modules imparts a desired chemical stability, conformational stability, metabolic stability, receptor interaction, protease inhibition, and/or other pharmacokinetic characteristic to the hybrid polypeptide.
  • the hybrid polypeptides of the invention may have comparable or higher potency in the treatment and/or prevention of metabolic conditions and disorders, as compared to the component peptide hormones.
  • the hybrid polypeptides of the invention may have comparable or higher potency in the treatment and/or prevention of diabetes and/or diabetes-related disorders, as compared to the component peptide hormones.
  • preferred hybrid polypeptides of the invention may exhibit improved ease of manufacture, stability, and/or ease of formulation, as compared to the component peptide hormones.
  • the hybrid polypeptides of the present invention will generally comprise a first bio-active peptide hormone module covalently linked to at least one additional bio-active peptide hormone module.
  • the bio-active peptide hormone modules may be covalently linked together in any manner known in the art, including but not limited to direct amide bonds or chemical linker groups, as described in further detail below.
  • chemical linker groups may include peptide mimetics which induce or stabilize polypeptide conformation.
  • the first bio-active peptide hormone module may be selected from a first component peptide hormone, and may be a peptide hormone (including native peptide hormones as well as analogs and derivatives thereof), a peptide fragment with hormonal activity (including fragments of native peptides hormones as well as analogs and derivatives thereof), or a structural motif of a peptide hormone (including native peptide hormones as well as analogs and derivatives thereof) that imparts a desired chemical stability, conformational stability, metabolic stability, receptor interaction, protease inhibition, and/or other pharmacokinetic characteristic to the hybrid polypeptide.
  • the additional bio-active peptide module(s) may be selected from component peptide hormones, and may be a peptide hormone (including native peptide hormones as well as analogs and derivatives thereof), a peptide fragment with hormonal activity (including fragments of native peptides hormones as well as analogs and derivatives thereof), or a structural motif of a hormone peptide (including native peptide hormones as well as analogs and derivatives thereof) that imparts a desired chemical stability, conformational stability, metabolic stability, receptor interaction, protease inhibition, and/or other pharmacokinetic characteristic to the hybrid polypeptide.
  • the first peptide hormone and the additional peptide hormone may be the same peptide hormone, may be from the same family of peptide hormones, or may be different peptide hormones, depending on the desired characteristics of the bio-active peptide hormone modules.
  • bio-active refers to (1) biological activity in at least one in vivo hormonal pathway, or (2) modulation of the therapeutic efficacy, scope of function, duration of action, physicochemical properties, and/or other pharmacokinetic properties of such biological activity.
  • Biological activity may be evaluated through target hormone receptor binding assays, or through metabolic studies that monitor a physiological indication, as known in the art and described herein. Modulation of the therapeutic efficacy, scope of function, duration of action, physicochemical properties, and/or other pharmacokinetic properties of such biological activity may be modified through changed in, e.g., chemical stability, conformational stability, metabolic stability, receptor interaction, protease inhibition, and/or other pharmacokinetic characteristics.
  • the hybrid polypeptides of the invention retain at least about 25%, preferably about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, or 99% percent of the biological activity of a component peptide hormone.
  • Preferred hybrid polypeptides are those having a potency in one of the metabolic-related assays known in the art or described herein (e.g., receptor binding, food intake, gastric emptying, pancreatic secretion, insulin secretion, blood glucose lowering, weight reduction, etc.) which is equal to or greater than the potency of component peptide hormone in that same assay.
  • preferred hybrid polypeptides of the invention may exhibit improved ease of manufacture, stability, and/or ease of formulation, as compared to component peptide hormones.
  • the hybrid polypeptides of the invention retain at least about 25%, preferably about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, or 99% percent of the biological activity of a native component peptide hormone with regard to the reduction of nutrient availability, the reduction of food intake, the effect of body weight gain, and/or the treatment and prevention of metabolic conditions and disorders.
  • the hybrid polypeptides of the invention exhibit at least about 110%, 125%, 130%, 140%, 150%, 200%, or more of the biological activity of a native peptide hormone with regard to the reduction of nutrient availability the reduction of food intake, the effect of body weight gain, and/or the treatment and prevention of metabolic conditions and disorders.
  • the hybrid polypeptides of the invention exhibit improved component peptide hormone receptor agonist activity.
  • Component peptide hormones generally include peptide hormones useful in the treatment or prevention of metabolic diseases and disorders including: (a) the amylin family, including amylin, adrenomedullin (“ADM”), calcitonin (“CT”), calcitonin gene related peptide (“CGRP”), intermedin (also known as "AFP-6") and related peptides; (b) cholecystokinin (“CCK”); (c) the leptin family, including leptin and leptin-like peptides; (d) the pancreatic polypeptide family, including pancreatic polypeptide (“PP”) and peptide YY (“PYY”); and (e) incretins and incretin mimetics, including: peptide hormones derived from the proglucagon gene such as: glucagon, glucagon-like peptide-1 (“GLP-1”), glucagon-like peptide 2 (“GLP-2”), and oxynto
  • amylin is meant the human peptide hormone referred to as amylin and secreted from the beta cells of the pancreas, and species variations thereof, as described in U.S. Pat. No. 5,234,906, issued Aug. 10, 1993, for “Hyperglycemic Compositions,” the contents of which are hereby incorporated by reference. More particularly, amylin is a 37-amino acid polypeptide hormone normally co-secreted with insulin by pancreatic beta cells in response to nutrient intake (see, e.g., Koda et al, Lancet 339:1179-1180, 1992).
  • ADM adrenomedullin
  • ADM the human peptide hormone and species variants thereof. More particularly, ADM is generated from a 185 amino acid preprohormone through consecutive enzymatic cleavage and amidation. This process culminates in the liberation of a 52 amino acid bioactive peptide.
  • CT calcitonin
  • sCT salmon calcitonin
  • CT is a 32 amino acid peptide cleaved from a larger prohormone. It contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring.
  • Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems.
  • the calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein- coupled receptor family.
  • CGRP calcium phosphatidylcholine
  • intermediate or "AFP-6” is meant the human peptide hormone and species variants thereof, in any physiological form.
  • CCK cholecystokinin
  • CCK is a 33-amino acid sequence first identified in humans, and includes a 8-amino acid in vivo C-terminal fragment (“CCK-8") that has been reportedly demonstrated in pig, rat, chicken, chinchilla, dog and humans.
  • CCK-33 will generally refer to human CCK(1 -33), while CCK-8 (CCK(26-33)) will refer to the C-terminal octapeptide generically in both the sulfated and unsulfated unless otherwise specified.
  • CCK-5 will refer to the C-terminal peptide CCK(29-33)
  • CCK-4 will refer to the C-terminal tetrapeptide CCK(30-33).
  • CCK will generally refer to all naturally occurring variations of the hormone, including CCK-33, CCK-8, CCK-5, and CCK-4, in the sulfated and unsulfated form unless otherwise specified.
  • Leptin is meant the naturally occurring leptin from any species, as well as biologically active D-isoforms, or fragments of naturally occurring leptin and variants thereof, and combinations of the preceding.
  • Leptin is the polypeptide product of the ob gene as described in the International Patent Publication No. WO 96/05309, which is incorporated herein by reference in its entirety. Putative analogs and fragments of leptin are reported in US Patent 5,521,283, U. S. Patent 5,532,336, PCT/US96/22308 and PCT/US96/01471, each of which is incorporated herein by reference in its entirety.
  • PP is meant human pancreatic peptide polypeptide or species variants thereof, in any physiological form.
  • PP includes both the human full length, 36 amino acid peptide as set forth in SEQ ID NO: 1, and species variations of PP, including, e.g., murine, hamster, chicken, bovine, rat, and dog PP.
  • species variations of PP including, e.g., murine, hamster, chicken, bovine, rat, and dog PP.
  • PP wild-type PP
  • nonative PP i.e., unmodified PP
  • PYY is meant human peptide YY polypeptide or species variants thereof, in any physiological form.
  • PYY includes both the human full length, 36 amino acid peptide, and species variations of PYY, including e.g., murine, hamster, chicken, bovine, rat, and dog PYY.
  • PYY and wild-type PYY and “native PYY,” i.e., unmodified PYY are used interchangeably.
  • all modifications discussed with reference to the PYY analog polypeptides of the present invention are based on the 36 amino acid sequence of native human PYY.
  • GLP-1 human glucagon like peptide-1 or species variants thereof, in any physiological form.
  • GLP-1 includes human GLP-l(l-37), GLP-l(7-37), and GLP-1 (7-36)amide, with reference to the full length human GLP-l(l-37), and species variations of GLP-1, including, e.g., murine, hamster, chicken, bovine, rat, and dog PP.
  • GLP-1 wild-type GLP-1
  • nonative GLP-1 i.e., unmodified GLP-1
  • GLP-2 is meant human glucagon like peptide-2 or species variants thereof, in any physiological form. More particularly, GLP-2 is a 33 amino acid peptide, co-secreted along with GLP-1 from intestinal endocrine cells in the small and large intestine.
  • OXM human oxyntomodulin or species variants thereof in any physiological form. More particularly, OXM is a 37 amino acid peptide that contains the 29 amino acid sequence of glucagon followed by an 8 amino acid carboxyterminal extension.
  • Exendin is meant a peptide hormone found in the saliva of the Gila-monster, a lizard endogenous to Arizona, and the Mexican Beaded Lizard, as well as species variants thereof. More particularly, Exendin-3 is present in the saliva of Heloderma horridum, and exendin-4 is present in the saliva of Heloderma suspectum (Eng, J., et al, J. Biol. Chem., 265:20259-62, 1990; Eng., J., et al, J. Biol. Chem., 267:7402-05 (1992)).
  • exendins have some sequence similarity to several members of the glucagon-like peptide family, with the highest identity, 53%, being to GLP-1 (Goke, et al, J. Biol. Chem., 268:19650-55 (1993)). In this sense, “exendin,” “wild-type exendin,” and “native exendin,” i.e., unmodified exendin, are used interchangeably.
  • an "analog” refers to a peptide whose sequence was derived from that of a base reference peptide (e.g., PP, PYY, amylin, GLP-1, exendin, etc.), including insertions, substitutions, extensions, and/or deletions of the reference amino acid sequence, preferably having at least 50 or 55% amino acid sequence identity with the base peptide, more preferably having at least 70%, 80%, 90%, or 95% amino acid sequence identity with the base peptide.
  • such analogs may comprise conservative or non-conservative amino acid substitutions (including non-natural amino acids and L and D forms).
  • a “derivative” is defined as a molecule having the amino acid sequence of a native reference peptide or analog, but additionally having chemical modification of one or more of its amino acid side groups, ⁇ -carbon atoms, terminal amino group, or terminal carboxylic acid group.
  • a chemical modification includes, but is not limited to, adding chemical moieties, creating new bonds, and removing chemical moieties. Modifications at amino acid side groups include, without limitation, acylation of lysine ⁇ -amino groups, N-alkylation of arginine, histidine, or lysine, alkylation of glutamic or aspartic carboxylic acid groups, and deamidation of glutamine or asparagine.
  • Modifications of the terminal amino include, without limitation, the desamino, N-lower alkyl, N-di-lower alkyl, constrained alkyls (e.g. branched, cyclic, fused, adamantyl) and N-acyl modifications.
  • Modifications of the terminal carboxy group include, without limitation, the amide, lower alkyl amide, constrained alkyls (e.g. branched, cyclic, fused, adamantyl) alkyl, dialkyl amide, and lower alkyl ester modifications.
  • Lower alkyl is C1-C4 alkyl.
  • one or more side groups, or terminal groups may be protected by protective groups known to the ordinarily-skilled peptide chemist.
  • the ⁇ -carbon of an amino acid may be mono- or dimethylated.
  • agonist is meant a compound which elicits a biological activity of native human reference peptide, preferably having a potency better than the reference peptide, or within five orders of magnitude (plus or minus) of potency compared to the reference peptide, more preferably 4, 3, 2, or 1 order of magnitude, when evaluated by art-known measures such as receptor binding/competition studies.
  • the terms refer to a compound which elicits a biological effect similar to that of native human reference peptide, for example a compound (1) having activity in the food intake, gastric emptying, pancreatic secretion, or weight loss assays similar to native human reference peptide, or (2) which binds specifically in a reference receptor assay or in a competitive binding assay with labeled reference peptide.
  • the agonists will bind in such assays with an affinity of greater than 1 ⁇ M, and more preferably with an affinity of greater than 1-5 nM.
  • the terms refer to a compound which elicits a biological effect in the treatment of diabetes or a diabetes related condition or disorder.
  • Such agonists may comprise a polypeptide comprising an active fragment of a reference peptide or a small chemical molecule.
  • amino acid and “amino acid residue” is meant natural amino acids, unnatural amino acids, and modified amino acid. Unless stated to the contrary, any reference to an amino acid, generally or specifically by name, includes reference to both the D and the L stereoisomers if their structure allow such stereoisomeric forms.
  • Natural amino acids include alanine (Ala), arginine (Arg), asparagine (Asn), aspartic acid (Asp), cysteine (Cys), glutamine (Gin), glutamic acid (Glu), glycine (Gly), histidine (His), isoleucine (He), leucine (Leu), Lysine (Lys), methionine (Met), phenylalanine (Phe), proline (Pro), serine (Ser), threonine (Thr), tryptophan (Trp), tyrosine (Tyr) and valine (Val).
  • Unnatural amino acids include, but are not limited to homo-lysine, homo-arginine, azetidinecarboxylic acid, 2-aminoadipic acid, 3-aminoadipic acid, beta-alanine, aminopropionic acid, 2-aminobutyric acid, 4-aminobutyric acid, 6-aminocaproic acid, 2- aminoheptanoic acid, 2aminoisobutyric acid, 3-aminoisbutyric acid, 2-aminopimelic acid, tertiary-butylglycine, 2,4-diaminoisobutyric acid, desmosine, 2,2'-diaminopimelic acid, 2,3-diaminopropionic acid, N-ethylglycine, N-ethylasparagine, homoproline, hydroxylysine, allo-hydroxylysine, 3-hydroxyproline, 4-hydroxyproline, isodesmosine, allo-isoleucine, N-methylalanine, N
  • Additional unnatural amino acids include modified amino acid residues which are chemically blocked, reversibly or irreversibly, or chemically modified on their N-terminal amino group or their side chain groups, as for example, N-methylated D and L amino acids or residues wherein the side chain functional groups are chemically modified to another functional group.
  • modified amino acids include methionine sulfoxide; methionine sulfone; aspartic acid- (beta-methyl ester), a modified amino acid of aspartic acid; N-ethylglycine, a modified amino acid of glycine; or alanine carboxamide, a modified amino acid of alanine. Additional residues that can be incorporated are described in Sandberg et al, J. Med. Chem. 41 : 2481-91, 1998.
  • 5 Apa means 5 amino-pentanoyl
  • 12 Ado means 12-amino dodecanoyl
  • PEG(8) mean 3,6,-dioxyoctanoyl
  • PEG(13) means l-amino-4,7,10- tioxa-13-tridecanamine succinimoyl.
  • these peptides are generally C-terminally amidated when expressed physiologically, but need not be for the purposes of the instant invention.
  • the C-terminus of these peptides, as well as the hybrid polypeptides of the present invention may have a free -OH or -NH group.
  • These peptides may also have other post-translational modifications.
  • the hybrid polypeptides of the present invention may also be constructed with an N-terminal methionine residue.
  • analogs of the above component peptide hormones are known in the art, but generally include modifications such as substitutions, deletions, and insertions to the amino acid sequence of such component peptide hormones, and any combination thereof.
  • the substitutions, insertions and deletions may be at the N-terminal or C-terminal end, or may be at internal portions of the component peptide hormone.
  • analogs of the component peptide hormones of the invention include one or more modifications of a "non-essential" amino acid residue.
  • a "non-essential" amino acid residue is a residue that can be altered, i.e., deleted or substituted, in the native human amino acid sequence of the fragment, e.g., the component peptide hormone fragment, without abolishing or substantially reducing the component peptide hormone receptor agonist activity of the resulting analog.
  • substitutions include conserved amino acid substitutions.
  • a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain, or physicochemical characteristics (e.g., electrostatic, hydrogen bonding, isosteric, hydrophobic features). Families of amino acid residues having similar side chains are known in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, methionine, cysteine
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, tryptophan
  • ⁇ -branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • the present invention also relates to derivatives of the component peptide hormones.
  • Such derivatives include component peptide hormones and analogs thereof conjugated to one or more water soluble polymer molecules, such as polyethylene glycol (“PEG”) or fatty acid chains of various lengths (e.g., stearyl, palmitoyl, octanoyl, etc.), or by the addition of polyamino acids, such as poly-his, poly-arg, poly-lys, and poly-ala.
  • Modifications to the component peptide hormones or analogs thereof can also include small molecule substituents, such as short alkyls and constrained alkyls (e.g., branched, cyclic, fused, adamantyl), and aromatic groups.
  • the water soluble polymer molecules will preferably have a molecular weight ranging from about 500 to about 20,000 Daltons.
  • Such polymer-conjugations and small molecule substituent modifications may occur singularly at the N- or C-terminus or at the side chains of amino acid residues within the sequence of the hybrid polypeptides.
  • Substitution of one or more amino acids with lysine, aspartic acid, glutamic acid, or cysteine may provide additional sites for derivatization. See, e.g., U.S. Patent Nos. 5,824,784 and 5,824,778.
  • the hybrid polypeptides may be conjugated to one, two, or three polymer molecules.
  • the water soluble polymer molecules are preferably lined to an amino, carboxyl, or thiol group, and may be linked by N or C terminus, or at the side chains of lysine, aspartic acid, glutamic acid, or cysteine. Alternatively, the water soluble polymer molecules may be linked with diamine and dicarboxylic groups.
  • the hybrid polypeptides of the invention are conjugated to one, two, or three PEG molecules through an epsilon amino group on a lysine amino acid. Derivatives of the invention also include component peptide hormones or analogs with chemical alterations to one or more amino acid residues.
  • Such chemical alterations include amidation, glycosylation, acylation, sulfation, phosphorylation, acetylation, and cyclization.
  • the chemical alterations may occur singularly at the N- or C-terminus or at the side chains of amino acid residues within the sequence of the PPF hybrid polypeptides.
  • the C-terminus of these peptides may have a free -OH or -NH 2 group.
  • the N-terminal end may be capped with an isobutyloxycarbonyl group, an isopropyloxycarbonyl group, an n-butyloxycarbonyl group, an ethoxycarbonyl group, an isocaproyl group (isocap), an octanyl group, an octyl glycine group (G(Oct)), or an 8-aminooctanic acid group.
  • cyclization can be through the formation of disulfide bridges.
  • component peptide hormones useful in the present invention include amylin family peptide hormones including amylin, adrenomedullin (“ADM”), calcitonin (“CT”), calcitonin gene related peptide (“CGRP”), intermedin (also known as "AFP-6") and related peptides.
  • Amylin family peptide hormones are known in art, as are functional peptide analogs and derivatives. Certain preferred native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known amylin family peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
  • amylin analogs and derivatives may be used in conjunction with the present invention.
  • the amylin analogs and derivatives have at least one hormonal activity of native amylin.
  • the amylin analogs are agonists of a receptor which native amylin is capable of specifically binding.
  • Preferred amylin analogs and derivatives include those described in US 2003/0026812 Al, which is hereby incorporated by reference.
  • amylin analogs include:
  • amylin analogs are preferably amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
  • the ADM analogs and derivatives have at least one hormonal activity of native ADM.
  • the ADM analogs are agonists of a receptor which native ADM is capable of specifically binding.
  • CT analogs and derivatives have at least one hormonal activity of native CT.
  • the CT analogs are agonists of a receptor which native CT is capable of specifically binding.
  • Preferred CT analogs and derivatives include those described in U.S. Patent Nos. 4,652,627; 4,606,856; 4,604,238; 4,597,900; 4,537,716; 4,497,731; 4,495,097; 4,444,981; 4,414,149; 4,401,593; and 4,397,780, which are hereby incorporated by reference.
  • CT analogs are preferably amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
  • the CGRP analogs and derivatives have at least one hormonal activity of native CGRP.
  • the CGRP analogs are agonists of a receptor which native CGRP is capable of specifically binding.
  • Preferred CGRP analogs and derivatives include those described in U.S. Patent Nos. 4,697,002; and 4,687,839, which are hereby incorporated by reference.
  • Exemplary CGRP analogs include:
  • AFP-6 analogs and derivatives have at least one hormonal activity of native AFP-6.
  • the AFP-6 analogs are agonists of a receptor which native AFP-6 is capable of specifically binding.
  • Preferred AFP-6 analogs and derivatives include those described in WO 2003/022304, which is hereby incorporated by reference.
  • Exemplary AFP-6 analogs include:
  • AFP-6 analogs are preferably amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
  • CCK The CCK Family CCKs, including hCCK and species variants, and various analogs thereof are known in the art.
  • CCK has a 33-amino acid sequence first identified in humans, and includes a 8-amino acid in vivo C-terminal fragment ("CCK-8") that has been reportedly demonstrated in pig, rat, chicken, chinchilla, dog and humans.
  • Other species variants include a 39-amino acid sequence found in pig, dog and guinea pig, and a 58-amino acid found in cat, dog and humans, and a 47-amino acid sequences homologous to both CCK and gastrin.
  • CCK-8 The C-terminal sulfated octapeptide sequence (CCK-8) is relatively conserved across species, and may be the minimum sequence for biological activity in the periphery of rodents.
  • CCK-33 will generally refer to human CCK(l-33)
  • CCK-8 CCK(26-33)
  • pentagastrin or CCK-5 will refer to the C-terminal peptide CCK(29-33)
  • the CCK-4 will refer to the C- terminal tetrapeptide CCK(30-33).
  • the type A receptor subtype (CCK A ) has been reported to be selective for the sulfated octapeptide.
  • the Type B receptor subtype (CCK B ) has been identified tliroughout the brain and in the stomach, and reportedly does not require sulfation or all eight amino acids.
  • CCK analogs are known in the art. Examples include in vivo assays involving the contraction of the dog or guinea pig gallbladder after rapid intravenous injection of the compound to be tested for CCK-like activity, and in vitro assays measuring using strips of rabbit gallbladder. See Walsh, "Gastrointestinal Hormones", In Physiology of the Gastrointestinal Tract (3d ed. 1994; Raven Press, New York).
  • Certain preferred CCKs and CCK analogs with CCK activity include:
  • CCK peptides are preferably amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
  • Component peptide hormones useful in the present invention also include leptin family peptide hormones.
  • Native leptin family peptide hormones are known in art, as are functional peptide analogs and derivatives. Certain preferred native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known amylin family peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention. Any leptin analog or derivative known in the art may be used in conjunction with the present invention.
  • the leptin analogs and derivatives have at least one hormonal activity of native leptin.
  • the leptin analogs are agonists of a receptor which native leptin is capable of specifically binding.
  • Preferred leptin analogs and derivatives include those described in, e.g., WO 2004/039832, WO 98/55139, WO 98/12224, and WO 97/02004, all of which is hereby incorporated by reference.
  • Exemplary leptin analogs include those where the amino acid at position 43 is substituted with Asp or Glu; position 48 is substituted Ala; position 49 is substituted with Glu, or absent; position 75 is substituted with Ala; position 89 is substituted with Leu; position 93 is substituted with Asp or Glu; position 98 is substituted with Ala; position 117 is substituted with Ser, position 139 is substituted with Leu, position 167 is substituted with Ser, and any combination thereof.
  • Certain preferred CCKs and CCK analogs with CCK activity include:
  • Component peptide hormones useful in the present invention also include PPF peptide hormones, including PP and PYY.
  • PPF peptide hormones are known in art, as are functional peptide analogs and derivatives. Certain preferred native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known amylin family peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
  • the PPF analogs and derivatives have at least one hormonal activity of a native PPF polypeptide.
  • the PPF analogs are agonists of a receptor which native PPF polypeptide is capable of specifically binding.
  • Preferred PPF analogs and derivatives include those described in WO 03/026591 and WO 03/057235, which are herein incorporated by reference in their entirety.
  • preferred PPF analogs and derivatives that exhibit at least one PPF hormonal activity generally comprise at least two PYY motifs including a polyproline motif and C-terminal tail motif. Such analogs are generally described in U.S. Provisional Application No.
  • Native porcine PYY has been characterized as including two C-terminal helical segments from residues 17 to 22 and 25 to 33 separated by a kink at residues 23, 24, and 25, a turn centered around residues 12-14, and the N-terminus folded near residues 30 and 31. Further, full-length porcine PYY has been characterized as including the PP fold, stabilized by hydrophobic interactions among residues in the N- and C- termini. See id.
  • PYY motif is generally a structural component, primary, secondary, or tertiary, of a native PP family polypeptide that is critical to biological activity, i.e., biological activity is substantially decreased in the absence or disturbance of the motif.
  • Preferred PYY motifs include the N-terminal polyproline type II motif of a native PP family polypeptide, the type II ⁇ -turn motif of native PP family polypeptide, the ⁇ -helical motif at the C- terminal end of native PP family polypeptide, and the C-terminal tail motif of native PP family polypeptide. More particularly, in the N-terminal polyproline region, amino acids corresponding to residues 5 and 8 of a native PP family polypeptide are generally conserved as a proline.
  • the type II ⁇ -turn motif will generally include amino acids con-esponding to residues 12-14 of a native PP family polypeptide.
  • the ⁇ -helical motif can generally extend from amino acids corresponding to approximately residue 14 of a native PP family polypeptide to any point up to and including the C-terminal end, so long as the ⁇ -helical motif includes a sufficient number of amino acid residues such that an ⁇ - helical turn is formed in solution.
  • the ⁇ -helical motif can also include amino acid substitutions, insertions and deletions to the native PP family sequence, so long as the ⁇ - helical turn is still formed in solution.
  • the C-terminal tail motif generally includes amino acids corresponding to approximately the last 10 residues of a native PP family polypeptide, more preferably the last 7, 6, or 5 residues of a native PP family polypeptide, and more preferably amino acid residues 32-35.
  • Preferred PYY analogs include those with internal deletions, insertions, and substitutions in areas of the PYY molecule not corresponding to the polyproline motif and/or the C- terminal tail motif. For instance, internal deletions at positions 4, 6, 7, 9, or 10 are envisioned. Incretins and Incretin Mimetics
  • Component peptide hormones useful in the present invention also include GLP-1 peptide hormones.
  • Native GLP-1 peptide hormones including GLP-l(l-37), GLP-l(7-37), and GLP-1 (7-36)amide, are known in art, as are functional peptide analogs and derivatives.
  • GLP-1 refers to all native forms of GLP-1 peptide hormones. Certain preferred native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known GLP-1 peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
  • GLP-1 peptide analogs and derivatives have at least one hormonal activity of a native GLP-1 peptide.
  • the GLP-1 peptide analogs are agonists of a receptor which a native GLP-1 peptide is capable of specifically binding.
  • Preferred GLP-1 peptide analogs and derivatives include those described in, e.g., WO 91/11457, which is hereby incorporated by reference.
  • GLP-1 analogs known in the art include:
  • GLP-1 analogs may preferably be amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
  • Other GLP-1 analogs and derivatives are disclosed in U.S. Pat. No. 5,545,618 which is incorporated herein by reference.
  • a preferred group of GLP-1 analogs and derivatives include those disclosed in U.S. Patent No. 6,747,006, which is herein incorporated by reference in its entirety.
  • the use in the present invention of a molecule described in U.S. Pat. No. 5,188,666, which is expressly incorporated by reference, is also contemplated.
  • Another group of molecules for use in the present invention includes compounds described in U.S. Pat. No. 5,512,549, which is expressly incorporated herein by reference.
  • Another preferred group of GLP-1 compounds for use in the present invention is disclosed in WO 91/11457, which is herein incorporated by reference.
  • Component peptide hormones useful in the present invention also include GLP-2 peptide hormones.
  • GLP-2 peptide hormones e.g., rat GLP-2 and its homologous including ox GLP-2, porcine GLP-2, degu GLP-2, bovine GLP-2, guinea pig GLP-2, hamster GLP-2, human GLP-2, rainbow trout GLP-2, and chicken GLP-2, are known in art, as are functional peptide analogs and derivatives. Certain preferred native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known GLP-2 peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
  • GLP-2 peptide analogs and derivatives have at least one hormonal activity of a native GLP-2 peptide.
  • the GLP-2 peptide analogs are agonists of a receptor which a native GLP-2 peptide is capable of specifically binding.
  • Preferred GLP-2 peptide analogs and derivatives include those described in, e.g., U.S. Ser. No. 08/669,791 and PCT Application PCT/CA97/00252, both of which are hereby incorporated by reference.
  • Specific GLP-2 analogs known in the art include: rat or human GLP-2 altered at position 2 to confer DPP-IV resistance by substituting a Gly for an Ala.
  • Component peptide hormones useful in the present invention also include oxyntomodulin (OXM) peptide hormones.
  • OXM oxyntomodulin
  • Native OXM peptide hormones are known in art, as are functional peptide analogs and derivatives. Certain preferred native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known OXM peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
  • any OXM peptide analog or derivative known in the art may be used in conjunction with the present invention.
  • the OXM peptide analogs and derivatives have at least one hormonal activity of a native OXM peptide.
  • the OXM peptide analogs are agonists of a receptor which a native OXM peptide is capable of specifically binding.
  • Component peptide hormones useful in the present invention also include exendin peptide hormones.
  • Native exendin peptide hormones are known in art, as are functional peptide analogs and derivatives. Certain preferred native peptides, peptide analogs and derivatives are described herein, however it should be recognized that any known exendin peptides that exhibit hormonal activity known in the art may be used in conjunction with the present invention.
  • exendin peptide analogs and derivatives have at least one hormonal activity of a native exendin peptide.
  • the exendin peptide analogs are agonists of a receptor which a native exendin peptide is capable of specifically binding.
  • Preferred exendin analogs include: SEQ ID: 185 ' 4 Leu, 23 Phe-exendin-4 186 3 Ala, 14 Leu 25 Phe-exendin-4 187 Leu, Ala, Phe-exendin-4
  • exendin analogs are preferably amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
  • the hybrid polypeptides of the present invention generally comprise at least two bio-active peptide hormone modules covalently linked together.
  • the bio- active peptide hormone modules may be: (a) native component peptide hormones, (b) analogs or derivatives of native component peptide hormones that retain hormonal activity, (c) fragments of native component peptide hormones that retain hormonal activity, (d) fragments of analogs or derivatives of native component peptide hormones that retain hormonal activity, (e) structural motifs of native component peptide hormones that impart a desired chemical stability, conformational stability, metabolic stability, receptor interaction, protease inhibition, and/or other pharmacokinetic characteristic to the hybrid polypeptide; or (f) structural motifs of analogs or derivatives of native component peptide hormones that impart a desired chemical stability, conformational stability, metabolic stability, receptor interaction, protease inhibition, and/or other pharmacokinetic characteristic to the hybrid polypeptide.
  • the structural motifs of (e) and (f) will collectively be referred
  • Preferred bio-active peptide hormone modules include native peptide hormones selected from: amylin, ADM, CT, CGRP, intermedin, CCK(l-33), CCK-8, leptin, PYY(l-36), PYY(3-36), GLP-l(l-37), GLP-l(7-37), GLP-l(7-36), GLP-2, OXM, exendin-3, and exendin-4.
  • bio-active peptide hormone modules include analogs and derivatives of a component peptide hormone selected from: amylin, ADM, CT, CGRP, intermedin, CCK, leptin, PYY(l-36), PYY(3-36), GLP-l(l-37), GLP-l(7-37), GLP-l(7-36), GLP-2, OXM, exendin-3, and exendin-4, wherein the analog or derivative exhibits at least one hormonal activity of the component peptide hormone.
  • a component peptide hormone selected from: amylin, ADM, CT, CGRP, intermedin, CCK, leptin, PYY(l-36), PYY(3-36), GLP-l(l-37), GLP-l(7-37), GLP-l(7-36), GLP-2, OXM, exendin-3, and exendin-4, wherein the analog or derivative exhibits at least one hormonal activity of the component peptide hormone
  • the analog may comprise one or more insertions, deletions, or substitutions of the amino acid sequence of the component peptide hormone
  • the derivative may comprise one or more chemical modifications of an amino acid residue of an analog or component peptide hormone, as described more fully herein and known in the art. More specifically, analogs and derivatives may be selected from any described above and/or known in the art. Particularly preferred analogs and derivatives that exhibit at least one hormonal activity useful as bio-active peptide hormone modules of the invention include the following: 7 7 R ⁇ R
  • Amylin Ala-h-amylin, ' Ala-h-amylin, Pro-h-amylin, ' Pro-h-amylin, 25,28,29 'P ⁇ ro-h-amylin, 5 Pro, 2b Val, 2S ' y Pro-h-amylin, liS Arg, 23 ' 2!i Pro-h-amylin, 18 Arg, 25 - 28 - 29 Pro-h-amylin, 25 Pro, 26 Val, 28 ' 29 Pro-h-amylin, 18 A A -r.g--,2 2 3 3 Leu, 25 ' 28 ' 29 Pro-h-amylin. 18 Arg 23 Leu, 25,28 Pro-h-amylin, and 2,7- Cyclo- [ 2 Asp, 7 Lys] -h-amylin
  • CT 14 Gln-sCT, 18 Arg-sCT, 1 U8 Arg-sCT, 14 Gln, 18 Arg-sCT, 14 Gln, n ' 18 Arg-sCT
  • CGRP 36 D-Ser-CGRP, 36 D-Thr-CGRP, 36 D-Asp-CGRP, 36 D-Asn-CGRP, 36 Ser- CGRP, 36 Hse-CGRP, 36 Asp-CGRP, 36 Thr-CGRP, 36 Asn-CGRP
  • AFP-6 TQAQLLRVGCGNLSTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY, TQAQLLRVGCDTATCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY, TQAQLLRVGMVLGTMQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY, TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVEPSSPHSY, TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQESAPVEPSSPHSY,
  • Leptin 43 Asp-leptin, 43 Glu-leptin, 48 A, la-leptin. 49/ Glu-leptin, 49 Des-AA-leptin, 75 A, la-leptin, 89 ⁇ Leu-leptin, 93 Asp-leptin, 9 "3Glu-leptin, 98 Ala-leptin, 139 y ⁇ Leu- leptin,
  • PYY 3 Leu-PYY, 3 Val-PYY, 4 Arg-PYY, 4 Gln-PYY, 4 Asn-PYY, 25 Lys-PYY, 34 Pro-PYY, 34 His-PYY, 1 ' 3 ⁇ Tyr-PYY, 13 Pro 14 Ala-PYY, 31 Leu 34 Pro-PYY, des-AA-4-PYY
  • GLP-1 9 Gln-GLP- 1(7-37), D- 9 Gln -GLP-l(7-37), 16 Thr- 18 Lys " GLP-l(7-37), 18 Lys-GLP-l(7-37), 8 Gly-GLP-l (7-36), 9 Gln-GLP-l (7-37), D- 9 Gln- GLP-1 (7-37), acetyl- 9 Lys-GLP- 1(7-37), 9 Thr-GLP- 1(7-37), D- 9 Thr- GLP-1 (7-37), 9 Asn-GLP-l (7-37), D- 9 Asn-GLP-l (7-37), 22 Ser 23 Arg 24 Arg 26 Gln-GLP-l(7-37), 16 Thr 18 Lys-GLP- 1(7-37), 18 Lys-GLP- 1(7-37), 2 ⁇ Arg-GLP- 1(7-37), 24 Arg-GLP-l(7-37)
  • such peptide compounds may preferably be amidated, but within the context of the present invention, may optionally be in the acid form unless otherwise specified.
  • bioactive peptide hormone modules include fragments of a component peptide hormone selected from: amylin, ADM, CT, CGRP, intermedin, CCK, leptin, PYY(l-36), PYY(3-36), GLP-l(l-37), GLP-l(7-37), GLP-l(7-36), GLP-2, OXM, exendin-3, and exendin-4, wherein the fragment exhibits at least one hormonal activity of the component peptide hormone.
  • a component peptide hormone selected from: amylin, ADM, CT, CGRP, intermedin, CCK, leptin, PYY(l-36), PYY(3-36), GLP-l(l-37), GLP-l(7-37), GLP-l(7-36), GLP-2, OXM, exendin-3, and exendin-4, wherein the fragment exhibits at least one hormonal activity of the component peptide hormone.
  • bioactive peptide hormone modules include fragments of analogs or derivatives of a component peptide hormone selected from: amylin, ADM, CT, CGRP, intermedin, CCK, leptin, PYY(l-36), PYY(3-36),GLP-l(l-37), GLP-l(7-37), GLP-1(7- 36), GLP-2, OXM, exendin-3, and exendin-4, wherein the fragment exhibits at least one hormonal activity of the component peptide hormone.
  • a component peptide hormone selected from: amylin, ADM, CT, CGRP, intermedin, CCK, leptin, PYY(l-36), PYY(3-36),GLP-l(l-37), GLP-l(7-37), GLP-1(7- 36), GLP-2, OXM, exendin-3, and exendin-4, wherein the fragment exhibits at least one hormonal activity of the component peptide hormone.
  • the analog may comprise one or more insertions, deletions, or substitutions of the amino acid sequence of the component peptide hormone
  • the derivative may comprise one or more chemical modifications of an amino acid residue of an analog or component peptide hormone, as described more fully herein and known in the art.
  • Certain preferred fragments that exhibit at least one hormonal activity include the following. However, it should be understood that combinations of the above-described analogs and derivatives taken with fragments known in the art, including the preferred fragments described below, are contemplated.
  • preferred analog fragments may include 5 Ala, 14 Leu, 25 Phe-exendin-4(l-28), 14 Leu, 25 Phe-exendin- 4(1-27), 5 Ala, 14 Leu, 25 Phe-exendin-4(l-28), 14 Leu, 25 Phe-exendin-4(l-27), or any other combinations of the disclosed fragments, analogs, and derivatives.
  • bio-active peptide modules include "peptidic enhancer", t.e., structural motifs of component peptide hormones (including analogs and derivatives thereof) that impart a desired chemical stability, conformational stability, metabolic stability, receptor interaction, protease inhibition, and/or other pharmacokinetic characteristic to the hybrid polypeptide.
  • exemplary peptidic enhancers include the following. Again, it should be understood that combinations of the above-described analogs and derivatives taken together with the following bio-active peptide modules are contemplated. For example, the last six amino acid residues of amylin family peptide hormone analogs and derivatives known in the art and/or described above are also contemplated as preferred bio-active peptide modules.
  • the hybrid polypeptides of the present invention generally comprise at least two bio- active peptide hormone modules of the invention, wherein at least one of the bio-active peptide hormone modules exhibits at least one hormonal activity.
  • the bio-active peptide hormone module that exhibits the at least one hormonal activity may be located at the N- terminal end of the hybrid polypeptide, the C-terminal end of the hybrid polypeptide, or in the event that the hybrid polypeptide comprises more than two bio-active peptide hormone modules, may be located in the internal portion of the hybrid polypeptide.
  • bio-active peptide hormone module exhibiting the at least one hormonal activity such that the C-terminal end of the bio-active peptide hormone module is amidated.
  • Amidation of the C-terminal end of the bio-active peptide hormone module may be accomplished by locating the module at the C-terminal end of the hybrid peptide, or by configuring the module in the C-terminal-to- N-terminal direction at the N-terminal end of the hybrid polypeptide. In both configurations, the C-terminal end of the bio-active peptide hormone module is available for amidation.
  • Specific component peptide hormones where C-terminal amidation may be preferably include amylin family peptide hormones, CCK, PYY, hGLP- 1(7-36) and hGLP-2.
  • Specific component peptide hormones where C-terminal amidation is not necessarily preferred include exendin-4, exendin-4(l-28), GLP-l(7-37), frog GLP- 1(7-36), and frog GLP-2.
  • these component peptide hormones are located at the C-terminal end of the hybrid polypeptide, they may still be optionally amidated, and in fact may preferably be optionally amidated.
  • bio-active peptide hormone modules may be covalently linked in any manner known in the art.
  • Stable linkages may be used, or cleavable linkage may be used.
  • the carboxy of a first module may be directly linked to the amino of a second module.
  • linking groups may be used to attached modules.
  • spacers or turn inducers known in the art may be employed to stabilize the linkage.
  • the module may be attached to a second module directly, or using any appropriate linking group known in the art, such as, an alkyl; PEG; amino acid, e.g., Lys, Glu, ⁇ -Ala; polyaminoacids, e.g., poly-his, poly-arg, poly-lys, poly-ala, Gly-Lys-Arg (GKR) etc.; bifunctional linker (see, e.g., Pierce catalog, Rockford, II); aminocaproyl ("Aca”), ⁇ - alanyl, 8-amino-3,6-dioxaoctanoyl, or other cleavable and non-cleavable linker known in the art.
  • any appropriate linking group known in the art such as, an alkyl; PEG; amino acid, e.g., Lys, Glu, ⁇ -Ala; polyaminoacids, e.g., poly-his, poly-arg, poly-lys, poly-
  • the module may again be attached to a second module using any appropriate linking group known in the art. More specifically, in the event that a bio- active peptide hormone module exhibiting at least one hormonal activity has been configured in the C-terminal-to-N-terminal orientation, resulting in an amino to amino linkage, preferred linking groups include dicarboxylic acids, alkyls, PEGs, and amino acids such as Lys, Cys, and Glu. As mentioned above, the hybrid polypeptides may also preferably include spacer to further stablize the linkage of the bio-active peptide hormone modules. Any spacer or turn inducer known in the art may be used. By way of example, referred ⁇ -turn mimetics include mimic A and mimic B illustrated below, also Ala-Aib and Ala-Pro dipeptides.
  • Exemplary combinations of bio-active peptide hormone modules to form the hybrid polypeptides of the invention include combinations of two or more bio-active peptide hormone modules selected from: native peptide hormones, analogs and derivatives of peptide hormones that exhibit at least one hormonal activity, fragments of native peptide hormones that exhibit at least one hormonal activity, fragments of analogs and derivatives of peptides hormones that exhibit at least one hormonal activity, and peptidic enhancers, with the proviso that at least one module exhibit at least one hormonal activity.
  • the hybrid polypeptides of the invention will include at least two bio-active peptide hormone modules, wherein each module is comprised from component peptide hormones.
  • the component peptide hormones of the hybrid polypeptide may be the same or different, with the proviso that at least two of the component peptide hormones are different.
  • at least two of the component peptide hormones are from different peptide hormone families, e.g., the amylin family, CCK, the leptin family, PPF, the proglucagon family, and the exendin family.
  • the hybrid polypeptides of the invention may comprise two or more modules that exhibit at least one hormonal activity.
  • the hybrid polypeptide may comprise a fragment of a first peptide hormone or analog that exhibits at least one hormonal activity covalently, linked to a fragment of at least one additional peptide hormone analog.
  • the additional fragment(s) may optionally exhibit at least one hormonal activity.
  • the first peptide hormone may be the same or different from the additional peptide hormone(s), with the proviso that at least one of the additional peptide hormones are different from the first peptide hormone, and the first hormonal activity may be the same or different from the optional additional hormonal activity.
  • the hybrid polypeptides of the invention may comprise one or more modules that exhibit at least one hormonal activity in combination with one or more peptidic enhancer modules.
  • a fragment of a first peptide hormone that exhibits a at least one hormonal activity may be covalently linked to a peptidic enhancer, or a fragment of a first peptide hormone that exhibits at least one hormonal activity may be covalently linked to a second peptide hormone that exhibits at least one hormonal activity, which is in turn linked to a peptidic enhancer.
  • a peptidic enhancer may be located between two peptide hormone modules as a stabilizing spacer.
  • the first peptide hormone may be the same or different from the second peptide hormone
  • the first hormonal activity may be the same or different from the second hormonal activity.
  • the hybrid polypeptides of the invention may comprise two, three, four, or more bio-active peptide hormone modules.
  • Exemplary combinations include a module with a hormonal activity in combination with one, two, or three peptidic enhancers; two modules with a hormonal activity in combination with one or two peptidic enhancers; three modules with a hormonal activity in combination with one peptidic enhancer, etc.
  • the component peptide hormones are preferably selected from amylin, adrenomedullin, calcitonin, calcitonin gene related peptide, intermedin, cholecystokinin, leptin peptide YY, glucagon-like peptide-1 , glucagon-like peptide 2, oxyntomodulin, or exendin-4.
  • preferred module combinations include those involving combinations of exendin, amylin, and PYY as the component peptide hormones.
  • Particular combinations include exendin-4/PYY and PYY/exendin-4 combinations, with and without spacers or linking groups.
  • Other combinations include exendin/amylin and amylin exendin combinations, with and without spacers or linking groups.
  • Yet other combinations include amylin/PYY and PYY/amylin combinations, with and without spacers or linking groups.
  • preferred module combinations include those involving a first module comprising exendin-4, a fragment of exendin-4 that exhibits at least one hormonal activity, an exendin-4 analog or derivative that exhibits at least one hormonal activity, or a fragment of an exendin-4 analog that exhibits at least one hormonal activity in combination with at least one additional bio-active peptide hormone module.
  • the first module is linked to one, two, or three additional bio-active peptide hormone modules.
  • a first module comprising an exendin-4 peptide is linked to a second bio-active peptide hormone module comprising an amylin peptide that exhibits at least one hormonal activity.
  • the second module is further linked to a third bio-active peptide hormone module comprising a calcitonin peptide that exhibits at least one hormonal activity.
  • the third module may be further linked to a fourth bio-active peptide hormone module comprising a peptidic enhancer selected from amylin peptides.
  • the first module may be located at the C-terminal end of the hybrid polypeptide.
  • the first module may be located at the N-terminal end of the hybrid polypeptide.
  • spacers or linkers such as ⁇ Ala may be inserted if desired to link the modules.
  • exendin-4 peptides include: exendin-4, exendin-4(l-27), exendin-4(l-28),
  • amylin peptides that exhibit at least one hormonal activity include amylin, amylin fragments such as amylin(l-17), amylin (1-16), amylin(l-15), and amylin(l-7), and amylin analogs 9 9 7 such as pramlintide, Ala-h-amylin, ' Ala-h-amylin, and fragments thereof.
  • Preferred calcitonin peptides that exhibit at least one hormonal activity sCT, sCT fragments such as sCT(8-10), sCT(8-27), and, and calcitonin analogs such as 18 Arg-sCT, 14 Gln, 18 Arg-sCT, 14 Gln, n ' 18 Arg-sCT, and fragments thereof.
  • Preferred amylin peptidic enhancers include amylin(32-37), amylin(33-37), and amylin(34-37), and analogs thereof.
  • Amylin/sCT combinations useful in connection with the present invention inlcude those disclosed in PCT/US05/[XXXX], Amylin Family Agonist, Attorney Docket 18528.835, filed concurrently herewith, which is herein incorporated by reference.
  • preferred module combinations include those involving a first module comprising exendin-4, a fragment of exendin-4 that exhibits at least one hormonal activity, an exendin-4 analog or derivative that exhibits at least one hormonal activity, or a fragment of an exendin-4 analog that exhibits at least one hormonal activity in combination with a peptidic enhancer.
  • Preferred exendin-4 compounds include: exendin- 4, exendin-4(l-27), exendin-4(l-28), 14 Leu, 25 Phe-exendin-4(l-28), and 5 Ala, 14 Leu, 25 Phe- exendin-4(l-28).
  • Preferred peptidic enhancers include: PYY(25-36), PYY(30-36) and PYY(31-36).
  • the first module is located at the C-terminal end of the hybrid polypeptide and the peptidic enhancer is located at the N-terminal end of the hybrid polypeptide.
  • the first module may be located at the N-terminal end of the hybrid polypeptide and the peptidic enhance may be located at the C-terminal end of the hybrid polypeptide.
  • spacers or linkers such as ⁇ Ala may be inserted if desired to attach the modules.
  • preferred module combinations include those involving a first module comprising exendin-4, a fragment of exendin-4 that exhibits at least one hormonal activity, an exendin-4 analog or derivative that exhibits at least one hormonal activity, or a fragment of an exendin-4 analog that exhibits at least one hormonal activity in combination with a second module comprising CCK, a fragment of CCK that exhibits at least one hormonal activity, a CCK analog or derivative that exhibits at least one hormonal activity, or a fragment of a CCK analog that exhibits at least one hormonal activity.
  • exendin-4 compounds include: exendin-4, exendin-4(l-27), exendin-4(l-28), 14 Leu, 25 Phe-exendin-4(l-28), 5 Ala, 14 Leu, 25 Phe-exendin-4(l-28), and 14 Leu-exendin-4(l-28).
  • Preferred CCK compounds include: CCK-8, and CCK- 8(Phe(CH 2 SO 3 )).
  • the first module is located at the C-terminal end of the hybrid polypeptide and the second module is located at the N-terminal end of the hybrid polypeptide.
  • the first module may be located at the N-terminal end of the hybrid polypeptide and the peptidic enhance may be located at the C-terminal end of the hybrid polypeptide.
  • spacers or linkers such as ⁇ Ala may be inserted if desired to attach the modules.
  • preferred module combinations include those involving a first module comprising amylin, a fragment of amylin that exhibits at least one hormonal activity, an amylin analog or derivative that exhibits at least one hormonal activity, or a fragment of an amylin analog that exhibits at least one hormonal activity in combination with a second module comprising with a peptidic enhancer, such as PYY(25-36) or PYY(30- 36).
  • a peptidic enhancer such as PYY(25-36) or PYY(30- 36.
  • the first module is located at the C-terminal end of the hybrid polypeptide and the peptidic enhancer is located at the N-terminal end of the hybrid polypeptide.
  • the first module may be located at the N-terminal end of the hybrid polypeptide and the peptidic enhance may be located at the C-terminal end of the hybrid polypeptide.
  • spacers or linkers such as ⁇ Ala may be inserted if desired to attach the modules.
  • Other preferred module combinations include those involving combinations of exendin and CCK or amylin, calcitonin, and CCK as a tertiary combination. Particular combinations include exendin/CCK and CCK exendin, with and without spacers or linkers and linking groups. Other combinations include CCK/amylin/calcitonin and CCK/amylin/calcitonin amylin, with and without spacers or linking groups.
  • Each module may independently be a peptidic enhancer or may exhibit a hormonal activity, depending on the desired properties of the hybrid polypeptide.
  • modules combinations include those involving combinations of exendin, amylin and calcitonin as tertiary and tetra-hybrid molecules.
  • Exemplary combinations include exendin/amylin/calcitonin; exendin/amylin/calcitonin/amylin; amylin/calcitonin/exendin; and amylin/calcitonin/amylin/exendin combinations, with and without spacers or linking groups.
  • Each module may independently be a peptidic enhancer or may exhibit a hormonal activity, depending on the desired properties of the hybrid polypeptide.
  • the hybrid polypeptide should preferably comprise a third bio-active peptide hormone module selected from a different component peptide hormone.
  • exemplary third bio-active peptide hormone modules include calcitonins, more preferably salmon calcitonin, analogs or fragments thereof.
  • the hybrid polypeptide should preferably comprise a third bio-active peptide hormone module selected from a different component peptide hormone.
  • exemplary third bio-active peptide hormone modules include exendin-4, analogs or fragments thereof.
  • the hybrid polypeptide should preferably comprise a third bio-active peptide hormone module.
  • exemplary third bio-active peptide hormone modules include PYY (including analogs, derivatives and fragments thereof) and CCK (including analogs, derivatives and fragments thereof).
  • reference to a component peptide hormone includes reference to analogs, derivatives, fragments, as well as peptidic enhancers related thereto.
  • hybrid polypeptides include:
  • hybrid polypeptides of the present invention may also comprise further modifications including, but are not limited to, substitution, deletion, and insertion to the amino acid sequence of such hybrid polypeptides and any combination thereof.
  • the hybrid polypeptides of the invention include one or more modifications of a "non- essential" amino acid residue.
  • a "non-essential" amino acid residue is a residue that can be altered, i.e., deleted or substituted, in the native human amino acid sequence of the fragment, e.g., the component peptide hormone fragment, without abolishing or substantially reducing the component peptide hormone receptor agonist activity of the hybrid polypeptide.
  • substitutions include conserved amino acid substitutions.
  • a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain, or physicochemical characteristics (e.g., electrostatic, hydrogen bonding, isosteric, hydrophobic features). Families of amino acid residues having similar side chains are known in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, methionine, cysteine
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, tryptophan
  • ⁇ -branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • the present invention also relates to derivatives of the hybrid polypeptides.
  • Such derivatives include hybrid polypeptides conjugated to one or more water soluble polymer molecules, such as polyethylene glycol (“PEG”) or fatty acid chains of various lengths (e.g., stearyl, palmitoyl, octanoyl, etc.), or by the addition of polyamino acids, such as poly-his, poly-arg, poly-lys, and poly-ala.
  • Modifications to the hybrid polypeptides can also include small molecule substituents, such as short alkyls and constrained alkyls (e.g., branched, cyclic, fused, adamantyl), and aromatic groups.
  • the water soluble polymer molecules will preferably have a molecular weight ranging from about 500 to about 20,000 Daltons.
  • Such polymer-conjugations and small molecule substituent modifications may occur singularly at the N- or C-terminus or at the side chains of amino acid residues within the sequence of the hybrid polypeptides.
  • Substitution of one or more amino acids with lysine, aspartic acid, glutamic acid, or cysteine may provide additional sites for derivatization. See, e.g., U.S. Patent Nos. 5,824,784 and 5,824,778.
  • the hybrid polypeptides may be conjugated to one, two, or three polymer molecules.
  • the water soluble polymer molecules are preferably lined to an amino, carboxyl, or thiol group, and may be linked by N or C terminus, or at the side chains of lysine, aspartic acid, glutamic acid, or cysteine. Alternatively, the water soluble polymer molecules may be linked with diamine and dicarboxylic groups.
  • the hybrid polypeptides of the invention are conjugated to one, two, or three PEG molecules through an epsilon amino group on a lysine amino acid.
  • Hybrid polypeptide derivatives of the invention also include hybrid polypeptides with chemical alterations to one or more amino acid residues.
  • Such chemical alterations include amidation, glycosylation, acylation, sulfation, phosphorylation, acetylation, and cyclization.
  • the chemical alterations may occur singularly at the N- or C-terminus or at the side chains of amino acid residues within the sequence of the PPF hybrid polypeptides.
  • the C-tenninus of these peptides may have a free -OH or -NH 2 group.
  • the N-terminal end may be capped with an isobutyloxycarbonyl group, an isopropyloxycarbonyl group, an n-butyloxycarbonyl group, an ethoxycarbonyl group, an isocaproyl group (isocap), an octanyl group, an octyl glycine group (G(Oct)), or an 8-aminooctanic acid group.
  • cyclization can be through the formation of disulfide bridges.
  • hybrid polypeptides of the present invention are provided in the Sequence Listing and further discussed in the Examples section below. Use of Hybrid Polypeptides in the Treatment or Prevention of Metabolic Conditions or Disorders
  • methods for treating or preventing obesity comprising administering a therapeutically or prophylactically effective amount of a hybrid polypeptide to a subject in need thereof.
  • the subject is an obese or overweight subject.
  • “obesity” is generally defined as a body mass index over 30, for purposes of this disclosure, any subject, including those with a body mass index of less than 30, who needs or wishes to reduce body weight is included in the scope of "obese.”
  • Subjects who are insulin resistant, glucose intolerant, or have any form of diabetes mellitus (e.g., type 1, 2 or gestational diabetes) can benefit from this method.
  • methods of reducing food intake, reducing nutrient availability, causing weight loss, affecting body composition, and altering body energy content or increasing energy expenditure, treating diabetes mellitus, and improving lipid profile (including reducing LDL cholesterol and triglyceride levels and/or changing HDL cholesterol levels) are provided, wherein the methods comprise administering to a subject an effective amount of a hybrid polypeptide of the invention.
  • the methods of the invention are used to treat or prevent conditions or disorders which can be alleviated by reducing nutrient availability in a subject in need thereof, comprising administering to said subject a therapeutically or prophylactically effective amount of a hybrid polypeptide of the invention.
  • Such conditions and disorders include, but are not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, insulin- resistance, obesity, and diabetes mellitus of any kind.
  • peripherally- administered hybrid polypeptides of the present invention in the reduction of food intake, in the delay of gastric emptying, in the reduction of nutrient availability, and in the causation of weight loss are determined by interactions with one or more unique receptor classes in, or similar to, those in the PP family. More particularly, it appears that a receptor or receptors similar to the PYY-preferring (or Y7) receptors are involved. Additional assays useful to the invention include those that can determine the effect of PPF compounds on body composition.
  • An exemplary assay can be one that involves utilization of a diet-induced obese (DIO) mouse model for metabolic disease.
  • DIO diet-induced obese
  • mice Prior to the treatment period, male C57BL/6J mice can be fed a high-fat diet (#D12331, 58% of calories from fat; Research Diets, Inc.,) for 6 weeks beginning at 4 weeks of age. During the study, the mice can continue to eat their high-fat diet. Water can be provided ad libitum throughout the study.
  • One group of similarly-aged non-obese mice can be fed a low-fat diet (#D12329, 11% of calories from fat) for purposes of comparing metabolic parameters to DIO groups.
  • DIO mice can be implanted with subcutaneous (SC) intrascapular osmotic pumps to deliver either vehicle (50% dimethylsulfoxide (DMSO) in water) or a compound of the invention.
  • SC subcutaneous
  • DMSO dimethylsulfoxide
  • the pumps of the latter group can be set to deliver any amount, e.g., 1000 ⁇ g/kg/d of a compound of the invention for 7-28 days.
  • Body weights and food intake can be measured over regular intervals throughout the study periods. Respiratory quotient (RQ, defined as CO 2 production ⁇ O 2 consumption) and metabolic rate can be determined using whole-animal indirect calorimetry (Oxymax, Columbus Instruments, Columbus, OH). The mice can be euthanized by isoflurane overdose, and an index of adiposity (bilateral epididymal fat pad weight) measured. Moreover, prior to determination of epididymal weight, body composition (lean mass, fat mass) for each mouse can be analyzed using a Dual Energy X-ray Absorptiometry (DEXA) instrument per manufacturer's instructions (Lunar Piximus, GE Imaging System).
  • DEXA Dual Energy X-ray Absorptiometry
  • preferred PPF polypeptide of the invention are those having a potency in one of the assays described herein (preferably food intake, gastric emptying, pancreatic secretion, weight reduction or body composition assays) which is greater than the potency of a component peptide hormone in that same assay.
  • compounds of the invention may be used to treat hypotension.
  • Compounds of the invention may also be useful for potentiating, inducing, enhancing or restoring glucose responsivity in pancreatic islets or cells. These actions may be useful for treating or preventing conditions associated with metabolic disorders such as those described above and in U.S. patent application no. US20040228846. Assays for determining such activity are known in the art. For example, in published U.S. patent application no. US20040228846 (inco ⁇ orated by reference in its entirety), assays are described for islet isolation and culture as well as determining fetal islet maturation.
  • intestine-derived hormone peptides including pancreatic polypeptide (PP), neuropeptide Y (NPY), neuropeptide K (NPK), PYY, secretin, glucagon-like peptide-1 (GLP-1) and bombesin were purchased from Sigma.
  • Collagenase type XI was obtained from Sigma.
  • RPMI 1640 culture medium and fetal bovine serum were obtained from Gibco.
  • a radioimmunoassay kit containing anti- insulin antibody [ 125 I]-RIA kit) was purchased from Linco, St Louis.
  • Post-partem rat islets were obtained from P-02 year old rats.
  • Adult rat islets were obtained from 6-8 week old rats.
  • Fetal rat islets were obtained as follows. Pregnant female rats were sacrificed on pregnancy day e21. Fetuses were removed from the uterus. 10-14 pancreata were dissected from each litter and washed twice in Hanks buffer. The pancreas were pooled, suspended in 6 ml 1 mg/ml collagenase (Type XI, Sigma) and incubated at 37° C for 8-10 minutes with constant shaking. The digestion was stopped by adding 10 volumes of ice-cold Hanks buffer followed by three washes with Hanks buffer.
  • the islets were then purified by Ficoll gradient and cultured in 10%) fetal bovine serum (FBS)/RPMI medium with or without addition of 1 ⁇ M IBMX. At the end of five days, 20 islets were hand picked into each tube and assayed for static insulin release. Generally, islets were first washed with KRP buffer and then incubated with 1 ml of KRP buffer containing 3 mM (low) glucose for 30 minutes at 37° C. with constant shaking. After collecting the supernatant, the islets were then incubated with 17 mM (high) glucose for one hour at 37° C. The insulin released from low or high glucose stimulation were 191 assayed by radioimmunoassay (RIA) using the [ I] -RIA kit.
  • RIA radioimmunoassay
  • E21 fetal islets were cultured for 5 days in the presence of 200 ng/ml PYY, PP, CCK, NPK, NPY, Secretin, GLP-1 or Bombesin.
  • An exemplary in vivo assays is also provided using the Zucker Diabetic Fatty (ZDF) male rat, an inbred (>F30 Generations) rat model that spontaneously expresses diabetes in all fa/fa males fed a standard rodent diet Purina 5008.
  • ZDF fa-fa males hyperglycemia begins to develop at about seven weeks of age and glucose levels (fed) typically reach 500 mg/DL by 10 to 11 weeks of age. Insulin levels (fed) are high during the development of diabetes.
  • hybrid polypeptides include methods for reducing aluminum (Al) concentrations in the central nervous system (see U.S. Pat. 6,734,166, inco ⁇ orated by reference in its entirety) for treating, preventing, or delay the onset of Alzheimer's disease.
  • Assays for determining effects on Al are known in the art and can be found in US Pat 6,734,166 using diploid and Ts mice. These mice were individually housed in Nalgene® brand metabolism or polypropylene cages and given three days to adjust to the cages before experimentation. Mice had free access to food (LabDiet® NIH Rat and Moust/Auto 6F5K52, St.
  • mice were given daily subcutaneous injections of either active compound or saline. Mice were sacrificed at the end of day 13 for one experiment and day 3 for another, and samples were collected. Mice brain samples were weighted in clean teflon liners and prepared for analysis by microwave digestion in low trace element grade nitric acid. Sample were then analyzed for Al content using Inductively Coupled Plasma Mass Spectrometry (Nuttall et al, Annals of Clinical and Laboratory Science 25, 3, 264-271 (1995)). All tissue handling during analysis took place in a clean room environment utilizing HEPA air filtration systems to minimize background contamination.
  • the compounds of the invention exhibit a broad range of biological activities, some related to their antisecretory and antimotility properties.
  • the compounds may suppress gastrointestinal secretions by direct interaction with epithelial cells or, perhaps, by inhibiting secretion of hormones or neurotransmitters which stimulate intestinal secretion.
  • Anti-secretory properties include inhibition of gastric and/or pancreatic secretions and can be useful in the treatment or prevention of diseases and disorders including gastritis, pancreatitis, Barrett's esophagus, and Gastroesophageal Reflux Disease.
  • Compounds of the invention are useful in the treatment of any number of gastrointestinal disorders (see e.g., Harrison's Principles of Internal Medicine, McGraw-Hill Inco, New York, 12th Ed.) that are associated with excess intestinal electrolyte and water secretion as well as decreased absorption, e.g., infectious diarrhea, inflammatory diarrhea, short bowel syndrome, or the diarrhea which typically occurs following surgical procedures, e.g., ileostomy.
  • infectious diarrhea include, without limitation, acute viral diarrhea, acute bacterial diarrhea (e.g., salmonella, campylobacter, and clostridium or due to protozoal infections), or traveller's diarrhea (e.g., Norwalk virus or rotavirus).
  • inflammatory diarrhea examples include, without limitation, malabso ⁇ tion syndrome, tropical sprue, chronic pancreatitis, Crohn's disease, diarrhea, and irritable bowel syndrome. It has also been discovered that the peptides of the invention can be used to treat an emergency or life-threatening situation involving a gastrointestinal disorder, e.g., after surgery or due to cholera.
  • Compounds of the invention may also be useful for treating or preventing intestinal damage as opposed to merely treating the symptoms associated with the intestinal damage (for example, diarrhea).
  • Such damage to the intestine may be, or a result of, ulcerative colitis, inflammatory bowel disease, bowel atrophy, loss bowel mucosa, and/or loss of bowel mucosal function (see WO 03/105763, inco ⁇ orated herein by reference in its entirety).
  • Assays for such activity include 11 week old male HSD rats, ranging 250- 300 grams housed in a 12:12 lightidark cycle, and allowed ad libitum access to a standard rodent diet (Teklad LM 485, Madison, WI) and water.
  • Rats were anesthetized with 3% isofluorane and placed on a regulated heating pad set at 37°C.
  • a gavage needle was inserted rectally into the colon 7 cm.
  • the hapten trinitrobenzenesulfonic acid (TNBS) dissolved in 50% ethanol (v/v) was delivered into the lumen of the colon through the gavage needle at a dose of 30 mg/kg, in a total volume of 0 0.4-0.6 mL, as described in Mazelin, et al, Juton Nerv Syst 1998;73:38 45.
  • Control groups received saline solution (NaCl 0.9%) intracolonically.
  • Hybrid polypeptides of the invention may also be used to treat or prevent pancreatic tumors (e.g., inhibit the proliferation of pancreatic tumors).
  • Methods of the invention include reducing the proliferation of tumor cells.
  • the types of benign pancreatic tumor cells which may be treated in accordance with the present invention include serous cyst adenomas, microcystic tumors, and solid-cystic tumors.
  • the method is also effective in reducing the proliferation of malignant pancreatic tumor cells such as carcinomas arising from the ducts, acini, or islets of the pancreas.
  • U.S. Pat. 5,574,010 (inco ⁇ orated by reference in its entirety) provides exemplary assays for testing anti-proliferative properties.
  • PANC-1 and MiaPaCa-2 are two human pancreatic adenocarcinoma cancer cell lines which are available commercially from suppliers such as American Type Culture Collection, ATCC (Rockville, Md.).
  • the two tumor cells were grown in RPMI- 1640 culture media supplemented with 10%) fetal bovine serum, 29.2 mg/L of glutamine, 25 ⁇ g gentamicin, 5 ml penicillin, streptomycin, and fungizone solution (JRH Biosciences, Lenexa, Kans.) at 37 degrees Celcius in a NAPCO water jacketed 5 % CO 2 incubator.
  • Control wells received 2 ul of 0.9%) saline to mimic the volume and physical disturbance upon adhered tumor cells.
  • Each 96 well plate contained 18 control wells to allow for comparison within each plate during experimentation.
  • Ninety-six (96) well plates were repeated 6 times with varying concentrations of PYY and test compound in both the PANC-1 and MiaPaCa-2 cells.
  • 3-(4,5-dimethylthiazolyl-2-yl)-2,5- diphenyltetrazolium Bromide, MTr tetrazolium bromide (Sigma, St. Louis, Mo.) was added to fresh culture media at 0.5 mg/ml. Culture media was exchanged and tumor cells were incubated for 4 hours with MTT tetrazolium bromide at 37°C. At the end of incubation, culture media was aspirated. Formazon crystal precipitates were dissolved in 200 ⁇ l of dimethyl sulfoxide (Sigma, St. Louis, Mo.).
  • the hybrid polypeptide of the invention is administered peripherally at a dose of about 0.5 ⁇ g to about 5 mg per day in single or divided doses or controlled continual release, or at about 0.01 ⁇ g/kg to about 500 ⁇ g/kg per dose, more preferably about 0.05 ⁇ g/kg to about 250 ⁇ g/kg, most preferably below about 50 ⁇ g/kg. Dosages in these ranges will vary with the potency of each analog or derivative, of course, and may be determined by one of skill in the art.
  • hybrid polypeptides of the invention may be administered separately or together with one or more other compounds and compositions that exhibit a long term or short-term action to reduce nutrient availability, including, but not limited to other compounds and compositions that comprise an amylin or amylin analog agonist, salmon calcitonin, a cholecystokinin (CCK) or CCK agonist, a leptin (OB protein) or leptin agonist, an exendin or exendin analog agonist, or a GLP-1 or GLP-1 91 8 90 analog agonist.
  • CCK cholecystokinin
  • OB protein leptin
  • agonist an exendin or exendin analog agonist
  • GLP-1 or GLP-1 91 8 90 analog agonist a GLP-1 or GLP-1 91 8 90 analog agonist.
  • Suitable amylin agonists include, for example, [ ' ' Pro-] human amylin (also known as "pramlintide,” and described in U.S. Pat. Nos. 5,686,511 and 5,998,367).
  • the CCK used is preferably CCK octapeptide (CCK-8). Leptin is discussed in, for example, (Pelleymounter et al., Science 269: 540-3 (1995); Halaas et al., Science 269: 543-6 (1995); Campfield et al., Science 269: 546-9 (1995)).
  • exendins include exendin-3 and exendin-4, and exendin agonist compounds include, for example, those described in PCT Publications WO 99/07404, WO 99/25727, and WO 99/25728.
  • hybrid polypeptides described herein may be prepared using standard recombinant techniques or chemical peptide synthesis techniques known in the art, e.g., using an automated or semi-automated peptide synthesizer, or both.
  • the hybrid polypeptides of the invention can be synthesized in solution or on a solid support in accordance with conventional techniques.
  • Various automatic synthesizers are commercially available and can be used in accordance with known protocols. See, e.g., Stewart and Young, Solid Phase Peptide Synthesis, 2d. ed., Pierce Chemical Co. (1984); Tarn et al, J. Am. Chem. Soc. 105: 6442 (1983); Merrifield, Science 232: 341-7 (1986); and Barany and Merrifield, The Peptides, Gross and Meienhofer, eds., Academic Press, New York, 1-284 (1979).
  • Solid phase peptide synthesis may be carried out with an automatic peptide synthesizer (e.g., Model 430A, Applied Biosystems Inc., Foster City, California) using the NMP/HOBt (Option 1) system and tBoc or Fmoc chemistry (see, Applied Biosystems User's Manual for the ABI 430A Peptide Synthesizer, Version 1.3B July 1, 1988, section 6, pp. 49-70, Applied Biosystems, Inc., Foster City, California) with capping. Peptides may also be assembled using an Advanced Chem Tech Synthesizer (Model MPS 350, Louisville, Kentucky).
  • an automatic peptide synthesizer e.g., Model 430A, Applied Biosystems Inc., Foster City, California
  • NMP/HOBt Option 1
  • tBoc or Fmoc chemistry see, Applied Biosystems User's Manual for the ABI 430A Peptide Synthesizer, Version 1.3B July 1, 1988,
  • Peptides may be purified by RP-HPLC (preparative and analytical) using, e.g., a Waters Delta Prep 3000 system and a C4, C8, or C18 preparative column (10 ⁇ , 2.2x25 cm; Vydac, Hesperia, California).
  • the active peptide can be readily synthesized and then screened in screening assays designed to identify reactive peptides.
  • hybrid polypeptides of the present invention may alternatively be produced by recombinant techniques well known in the art. See, e.g., Sambrook et al, Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring Harbor (1989). These hybrid polypeptides produced by recombinant technologies may be expressed from a polynucleotide.
  • polynucleotides, including DNA and RNA, that encode such the various fragments of the hybrid polypeptides may be obtained from the wild-type cDNA, taking into consideration the degeneracy of codon usage, or may be engineered as desired.
  • polynucleotide sequences may inco ⁇ orate codons facilitating transcription and translation of mRNA in microbial hosts. Such manufacturing sequences may readily be constructed according to the methods well known in the art. See, e.g., WO 83/04053.
  • the polynucleotides above may also optionally encode an N-terminal methionyl residue.
  • Non-peptide compounds useful in the present invention may be prepared by art-known methods. For example, phosphate- containing amino acids and peptides containing such amino acids may be prepared using methods known in the art. See, e.g., Bartlett and Landen, Bioorg. Chem. 14: 356-77 (1986).
  • a variety of expression vector/host systems may be utilized to contain and express a hybrid polypeptide coding sequence. These include but are not limited to microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transfected with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with bacterial expression vectors (e.g., Ti or pBR322 plasmid); or animal cell systems.
  • microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transfected with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus,
  • Mammalian cells that are useful in recombinant protein productions include but are not limited to VERO cells, HeLa cells, Chinese hamster ovary (CHO) cell lines, COS cells (such as COS-7), WI 38, BHK, HepG2, 3T3, RIN, MDCK, A549, PC 12, K562 and 293 cells. Exemplary protocols for the recombinant expression of the protein are described herein below.
  • polynucleotide sequences provided by the invention are useful in generating new and useful viral and plasmid DNA vectors, new and useful transformed and transfected procaryotic and eucaryotic host cells (including bacterial, yeast, and mammalian cells grown in culture), and new and useful methods for cultured growth of such host cells capable of expression of the present hybrid polypeptides.
  • the polynucleotide sequences encoding hybrid polypeptides herein may be useful for gene therapy in instances where unde ⁇ roduction of the component peptide hormone(s) of the chimera would be alleviated, or the need for increased levels of such would be met.
  • the present invention also provides for processes for recombinant DNA production of the present hybrid polypeptides.
  • a process for producing the hybrid polypeptides from a host cell containing nucleic acids encoding such hybrid polypeptides comprising: (a) culturing said host cell containing polynucleotides encoding such hybrid polypeptides under conditions facilitating the expression of such DNA molecule; and (b) obtaining such hybrid polypeptides.
  • Host cells may be prokaryotic or eukaryotic and include bacteria, mammalian cells (such as Chinese Hamster Ovary (CHO) cells, monkey cells, baby hamster kidney cells, cancer cells or other cells), yeast cells, and insect cells.
  • mammalian cells such as Chinese Hamster Ovary (CHO) cells, monkey cells, baby hamster kidney cells, cancer cells or other cells
  • yeast cells such as yeast cells, and insect cells.
  • Mammalian host systems for the expression of the recombinant protein also are well known to those of skill in the art. Host cell strains may be chosen for a particular ability to process the expressed protein or produce certain post-translation modifications that will be useful in providing protein activity. Such modifications of the polypeptide include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation and acylation. Post-translational processing, which cleaves a "prepro" form of the protein, may also be important for correct insertion, folding and/or function. Different host cells, such as CHO, HeLa, MDCK, 293, WI38, and the like, have specific cellular machinery and characteristic mechanisms for such post-translational activities, and may be chosen to ensure the correct modification and processing of the introduced foreign protein.
  • a yeast system may be employed to generate the hybrid polypeptides of the present invention.
  • the coding region of the hybrid polypeptide cDNA is amplified by PCR.
  • a DNA encoding the yeast pre-pro-alpha leader sequence is amplified from yeast genomic DNA in a PCR reaction using one primer containing nucleotides 1-20 of the alpha mating factor gene and another primer complementary to nucleotides 255-235 of this gene (Kurjan and Herskowitz, Cell, 30: 933-43 (1982)).
  • the pre-pro-alpha leader coding sequence and hybrid polypeptide coding sequence fragments are ligated into a plasmid containing the yeast alcohol dehydrogenase (ADH2) promoter, such that the promoter directs expression of a fusion protein consisting of the pre-pro-alpha factor fused to the mature hybrid polypeptide.
  • ADH2 yeast alcohol dehydrogenase
  • the vector further includes an ADH2 transcription terminator downstream of the cloning site, the yeast "2 -micron" replication origin, the yeast leu-2d gene, the yeast REPl and REP2 genes, the E.
  • the coli ⁇ -lactamase gene and an E. coli origin of replication.
  • the ⁇ -lactamase and leu-2d genes provide for selection in bacteria and yeast, respectively.
  • the leu-2d gene also facilitates increased copy number of the plasmid in yeast to induce higher levels of expression.
  • the REPl and REP2 genes encode proteins involved in regulation of the plasmid copy number.
  • the DNA construct described in the preceding paragraph is transformed into yeast cells using a known method, e.g., lithium acetate treatment (Steams et al, Meth. Enz. 185:
  • the ADH2 promoter is induced upon exhaustion of glucose in the growth media (Price et al, Gene 55: 287 (1987)).
  • the pre-pro-alpha sequence effects secretion of the fusion protein from the cells.
  • the yeast KEX2 protein cleaves the pre-pro sequence from the mature PYY analog polypeptides (Bitter et al, Proc. Natl. Acad. Sci. USA 81: 5330-4 (1984)).
  • Hybrid polypeptides of the invention may also be recombinantly expressed in yeast using a commercially available expression system, e.g., the Pichia Expression System (Invitrogen, San Diego, California), following the manufacturer's instructions. This system also relies on the pre-pro-alpha sequence to direct secretion, but transcription of the insert is driven by the alcohol oxidase (AOX1) promoter upon induction by methanol.
  • AOX1 alcohol oxidase
  • the secreted hybrid polypeptide is purified from the yeast growth medium by, e.g., the methods used to purify hybrid polypeptide from bacterial and mammalian cell supernatants.
  • the cDNA encoding hybrid polypeptides may be cloned into the baculovirus expression vector pVL1393 (PharMingen, San Diego, California).
  • This hybrid polypeptide-containing vector is then used according to the manufacturer's directions (PharMingen) to infect Spodoptera frugiperda cells in sF9 protein-free media and to produce recombinant protein.
  • the protein is purified and concentrated from the media using a heparin-Sepharose column (Pharmacia, Piscataway, New Jersey) and sequential molecular sizing columns (Amicon, Beverly, Massachusetts), and resuspended in PBS.
  • SDS-PAGE analysis shows a single band and confirms the size of the protein, and Edman sequencing on a Proton 2090 Peptide Sequencer confirms its N-terminal sequence.
  • the DNA sequence encoding the hybrid polypeptide may be cloned into a plasmid containing a desired promoter and, optionally, a leader sequence (see, e.g., Better et al., Science 240: 1041-3 (1988)). The sequence of this construct may be confirmed by automated sequencing.
  • the plasmid is then transformed into E. coli, strain MCI 061, using standard procedures employing CaC12 incubation and heat shock treatment of the bacteria (Sambrook et al, supra).
  • the transformed bacteria are grown in LB medium supplemented with carbenicillin, and production of the expressed protein is induced by growth in a suitable medium.
  • the leader sequence will affect secretion of the hybrid polypeptide and be cleaved during secretion.
  • the secreted recombinant protein is purified from the bacterial culture media by the method described herein below.
  • the hybrid polypeptides of the invention may be expressed in an insect system.
  • Insect systems for protein expression are well known to those of skill in the art.
  • Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes in Spodoptera frugiperda cells or in Trichoplusia larvae.
  • the hybrid polypeptide coding sequence is cloned into a nonessential region of the virus, such as the polyhedrin gene, and placed under control of the polyhedrin promoter. Successful insertion of hybrid polypeptide will render the polyhedrin gene inactive and produce recombinant virus lacking coat protein coat. The recombinant viruses are then used to infect S.
  • the DNA sequence encoding the hybrid polypeptide may be amplified by PCR and cloned into an appropriate vector, for example, pGEX-3X (Pharmacia, Piscataway, New Jersey).
  • the pGEX vector is designed to produce a fusion protein comprising glutathione-S-transferase (GST), encoded by the vector, and a protein encoded by a DNA fragment inserted into the vector's cloning site.
  • the primers for the PCR may be generated to include, for example, an appropriate cleavage site.
  • the recombinant fusion protein may then be cleaved from the GST portion of the fusion protein.
  • the pGEX-3X/PYY analog polypeptide construct is transformed into E.
  • coli XL-1 Blue cells (Stratagene, La Jolla, California), and individual transformants are isolated and grown at 37°C in LB medium (supplemented with carbenicillin) to an optical density at wavelength 600 nm of 0.4, followed by further incubation for 4 hours in the presence of 0.5 mM Isopropyl ⁇ -D-Thiogalactopyranoside (Sigma Chemical Co., St. Louis, Missouri). Plasmid DNA from individual transformants is purified and partially sequenced using an automated sequencer to confirm the presence of the desired PPF hybrid polypeptide-encoding gene insert in the proper orientation.
  • the fusion protein expected to be produced as an insoluble inclusion body in the bacteria, may be purified as follows.
  • Cells are harvested by centrifugation; washed in 0.15 M NaCl, 10 mM Tris, pH 8, 1 mM EDTA; and treated with 0.1 mg/mL lysozyme (Sigma Chemical Co.) for 15 min. at room temperature. The lysate is cleared by sonication, and cell debris is pelleted by centrifugation for 10 min. at 12,000xg. The fusion protein-containing pellet is resuspended in 50 mM Tris, pH 8, and 10 mM EDTA, layered over 50% glycerol, and centrifuged for 30 min. at 6000xg.
  • the pellet is resuspended in standard phosphate buffered saline solution (PBS) free of Mg 4"4" and Ca ++ .
  • PBS phosphate buffered saline solution
  • the fusion protein is further purified by fractionating the resuspended pellet in a denaturing SDS polyacrylamide gel (Sambrook et al, supra). The gel is soaked in 0.4 M KC1 to visualize the protein, which is excised and electroeluted in gel-running buffer lacking SDS. If the GST/PYY analog polypeptide fusion protein is produced in bacteria as a soluble protein, it may be purified using the GST Purification Module (Pharmacia Biotech). The fusion protein may be subjected to digestion to cleave the GST from the PPF hybrid polypeptide.
  • the digestion reaction (20-40 ⁇ g fusion protein, 20-30 units human thrombin (4000 U/mg (Sigma) in 0.5 mL PBS) is incubated 16-48 hrs. at room temperature and loaded on a denaturing SDS-PAGE gel to fractionate the reaction products. The gel is soaked in 0.4 M KC1 to visualize the protein bands. The identity of the protein band corresponding to the expected molecular weight of the hybrid polypeptide may be confirmed by partial amino acid sequence analysis using an automated sequencer (Applied Biosystems Model 473A, Foster City, California).
  • 293 cells may be co-transfected with plasmids containing the hybrid polypeptide cDNA in the pCMV vector (5' CMV promoter, 3' HGH poly A sequence) and pSV2neo (containing the neo resistance gene) by the calcium phosphate method.
  • the vectors should be linearized with Seal prior to transfection.
  • an alternative construct using a similar pCMV vector with the neo gene inco ⁇ orated can be used.
  • Stable cell lines are selected from single cell clones by limiting dilution in growth media containing 0.5 mg/mL G418 (neomycin-like antibiotic) for 10- 14 days. Cell lines are screened for hybrid polypeptide expression by ELISA or Western blot, and high-expressing cell lines are expanded for large scale growth.
  • G418 neomycin-like antibiotic
  • the transformed cells are used for long-term, high-yield protein production and as such stable expression is desirable.
  • the cells may be allowed to grow for 1-2 days in an enriched media before they are switched to selective media.
  • the selectable marker is designed to confer resistance to selection, and its presence allows growth and recovery of cells that successfully express the introduced sequences. Resistant clumps of stably transformed cells can be proliferated using tissue culture techniques appropriate to the cell.
  • selection systems may be used to recover the cells that have been transformed for recombinant protein production.
  • selection systems include, but are not limited to, HSV thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase and adenine phosphoribosyltransferase genes, in tk-, hgprt- or aprt- cells, respectively.
  • anti-metabolite resistance can be used as the basis of selection for dhfr, that confers resistance to methotrexate; gpt, that confers resistance to mycophenolic acid; neo, that confers resistance to the aminoglycoside, G418; also, that confers resistance to chlorsulfuron; and hygro, that confers resistance to hygromycin.
  • Additional selectable genes that may be useful include tipB, which allows cells to utilize indole in place of tryptophan, or hisD, which allows cells to utilize histinol in place of histidine.
  • Markers that give a visual indication for identification of transformants include anthocyanins, ⁇ - glucuronidase and its substrate, GUS, and luciferase and its substrate, luciferin.
  • hybrid polypeptides of the present invention may be produced using a combination of both automated peptide synthesis and recombinant techniques.
  • a hybrid polypeptide of the present invention may contain a combination of modifications including deletion, substitution, and insertion by PEGylation.
  • Such a hybrid polypeptide may be produced in stages. In the first stage, an intermediate polypeptide containing the modifications of deletion, substitution, insertion, and any combination thereof, may be produced by recombinant techniques as described. Then after an optional purification step as described below, the intermediate polypeptide is PEGylated through chemical modification with an appropriate PEGylating reagent (e.g., from Nectar Transforming Therapeutics, San Carlos, California) to yield the desired hybrid polypeptide.
  • an appropriate PEGylating reagent e.g., from Nectar Transforming Therapeutics, San Carlos, California
  • Peptide purification techniques are well known to those of skill in the art. These techniques involve, at one level, the crude fractionation of the cellular milieu to polypeptide and non-polypeptide fractions. Having separated the polypeptide from other proteins, the polypeptide of interest may be further purified using chromatographic and electrophoretic techniques to achieve partial or complete purification (or purification to homogeneity). Analytical methods particularly suited to the preparation of a pure peptide are ion-exchange chromatography, exclusion chromatography, polyacrylamide gel electrophoresis, and isoelectric focusing.
  • a particularly efficient method of purifying peptides is reverse phase HPLC, followed by characterization of purified product by liquid chromatography/mass spectrometry (LC/MS) and Matrix-Assisted Laser Deso ⁇ tion Ionization (MALDI) mass spectrometry. Additional confirmation of purity is obtained by determining amino acid analysis.
  • LC/MS liquid chromatography/mass spectrometry
  • MALDI Matrix-Assisted Laser Deso ⁇ tion Ionization
  • purification and in particular embodiments, the substantial purification, of an encoded protein or peptide.
  • purified peptide as used herein, is intended to refer to a composition, isolatable from other components, wherein the peptide is purified to any degree relative to its naturally obtainable state.
  • a purified peptide therefore also refers to a peptide, free from the environment in which it may naturally occur.
  • purified will refer to a peptide composition that has been subjected to fractionation to remove various other components, and which composition substantially retains its expressed biological activity. Where the term “substantially purified” is used, this designation will refer to a composition in which the peptide forms the major component of the composition, such as constituting about 50%, about 60%, about 70%, about 80%), about 90%, about 95% or more of the peptides in the composition.
  • Partial purification may be accomplished by using fewer purification steps in combination, or by utilizing different forms of the same general purification scheme. For example, it is appreciated that a cation-exchange column chromatography performed, utilizing an HPLC apparatus, will generally result in a greater "-fold" purification than the same technique utilizing a low pressure chromatography system. Methods exhibiting a lower degree of relative purification may have advantages in total recovery of protein product, or in maintaining the activity of an expressed protein.
  • Methods for purifying a polypeptide can be found in U.S. Patent No. 5,849,883. These documents describe specific exemplary methods for the isolation and purification of G-CSF compositions that may be useful in isolating and purifying the hybrid polypeptides of the present invention. Given the disclosure of these patents, it is evident that one of skill in the art would be well aware of numerous purification techniques that may be used to purify hybrid polypeptides from a given source. Also it is contemplated that a combination of anion exchange and immunoaffinity chromatography may be employed to produce purified hybrid polypeptide compositions of the present invention.
  • compositions comprising a therapeutically or prophylactically effective amount of at least one hybrid polypeptide of the invention, or a pharmaceutically acceptable salt thereof, together with pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, adjuvants and/or carriers useful in the delivery of the hybrid polypeptides.
  • compositions may include diluents of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength; additives such as detergents and solubilizing agents (e.g., Tween 80, Polysorbate 80), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite), preservatives (e.g., thimersol, benzyl alcohol), and bulking substances (e.g., lactose, mannitol); inco ⁇ oration of the material into particulate preparations of polymeric compounds, such as polylactic acid, polyglycolic acid, etc., or in association with liposomes.
  • buffer content e.g., Tris-HCl, acetate, phosphate
  • additives e.g., Tween 80, Polysorbate 80
  • anti-oxidants e.g., ascorbic acid, sodium metabisulfite
  • preservatives e.g.,
  • compositions will influence the physical state, stability, rate of in vivo release, and rate of in vivo clearance of the present hybrid polypeptides. See, e.g., Remington's Pharmaceutical Sciences 1435-712, 18th ed., Mack Publishing Co., Easton, Pennsylvania (1990).
  • the present hybrid polypeptides will be useful in the same way that the individual component polypeptides are useful in view of their pharmacological properties.
  • One preferred use is to peripherally administer such hybrid polypeptides for the treatment or prevention of metabolic conditions and disorders.
  • the compounds of the invention possess activity as agents to reduce nutrient availability, reduce of food intake, and effect weight loss.
  • a preferred use is to administer such hybrid polypeptides for the treatment of diabetes or diabetes related conditions and disorders.
  • the present hybrid polypeptides may be formulated for peripheral administration, including formulation for injection, oral administration, nasal administration, pulmonary administration, topical administration, or other types of administration as one skilled in the art will recognize. More particularly, administration of the pharmaceutical compositions according to the present invention may be via any common route so long as the target tissue is available via that route.
  • the pharmaceutical compositions may be introduced into the subject by any conventional peripheral method, e.g., by intravenous, intradermal, intramusclar, intramammary, intraperitoneal, intrathecal, retrobulbar, intrapulmonary (e.g., term release); by oral, sublingual, nasal, anal, vaginal, or transdermal delivery, or by surgical implantation at a particular site.
  • the treatment may consist of a single dose or a plurality of doses over a period of time. Controlled continual release of the compositions of the present invention is also contemplated.
  • compositions of the present invention comprise an effective amount of the hybrid polypeptide, dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium.
  • pharmaceutically acceptable carrier refers to molecular entities and compositions that do not produce adverse, allergic, or other untoward reactions when administered to an animal or a human.
  • pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and abso ⁇ tion delaying agents and the like. The use of such media and agents for pharmaceutically active substances is well known in the art.
  • any conventional media or agent is incompatible with the active ingredient, its use in therapeutic compositions is contemplated.
  • Supplementary active ingredients also can be inco ⁇ orated into the compositions.
  • the hybrid polypeptide of the invention may be prepared for administration as solutions of free base, or pharmacologically acceptable salts in water suitably mixed with a surfactant, such as hydroxypropylcellulose.
  • Pharmaceutically-acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like.
  • Salts formed with the free carboxyl groups also can be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like. Such products are readily prepared by procedures well known to those skilled in the art. Dispersions also can be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
  • inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
  • Dispersions also can be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorgan
  • the pharmaceutical compositions of the present invention are formulated so as to be suitable for parenteral administration, e.g., via injection or infusion.
  • the hybrid polypeptide is suspended in an aqueous carrier, for example, in an isotonic buffer solution at a pH of about 3.0 to about 8.0, preferably at a pH of about 3.5 to about 7.4, 3.5 to 6.0, or 3.5 to about 5.0.
  • useful buffers include sodium citrate-citric acid and sodium phosphate-phosphoric acid, and sodium acetate/acetic acid buffers.
  • a form of repository or "depot" slow release preparation may be used so that therapeutically effective amounts of the preparation are delivered into the bloodstream over many hours or days following transdermal injection or delivery.
  • compositions suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
  • the form should be sterile and should be fluid to the extent that easy syringability exists.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils.
  • the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • a coating such as lecithin
  • surfactants for example, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium stearate, and gelatin.
  • Sterile injectable solutions may be prepared by inco ⁇ orating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by inco ⁇ orating the various sterilized active ingredients into a sterile vehicle that contains the basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum-drying and freeze- drying techniques that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • a therapeutically or prophylactically effective amount of the present hybrid polypeptides will be determined by the age, weight, and condition or severity of the diseases, conditions or disorders of the recipient. See, e.g., Remington's Pharmaceutical Sciences 697-773. See also Wang and Hanson, Parenteral Formulations of Proteins and Peptides: Stability and Stabilizers, Journal of Parenteral Science and Technology, Technical Report No. 10, Supp. 42:2S (1988). Typically, a dosage of between about 0.001 ⁇ g/kg body weight/day to about 1000 ⁇ g/kg body weight/day, may be used, but more or less, as a skilled practitioner will recognize, may be used.
  • Dosing may be one or more times daily, or less frequently, and may be in conjunction with other compositions as described herein. It should be noted that the present invention is not limited to the dosages recited herein. Appropriate dosages may be ascertained through the use of established assays for determining level of metabolic conditions or disorders in conjunction with relevant dose- response data. The final dosage regimen will be determined by the attending physician, considering factors that modify the action of drugs, e.g., the drug's specific activity, severity of the damage and the responsiveness of the patient, the age, condition, body weight, sex and diet of the patient, the severity of any infection, time of administration and other clinical factors. As studies are conducted, further information will emerge regarding appropriate dosage levels and duration of treatment for specific diseases and conditions.
  • An effective dose will typically be in the range of about 1 to 30 ⁇ g to about 5 mg/day, preferably about 10 to 30 ⁇ g to about 2 mg/day and more preferably about 5 to 100 ⁇ g to about 1 mg/day, most preferably about 5 ⁇ g to about 500 ⁇ g/day, for a 50 kg patient, administered in a single or divided doses.
  • dosages are between about 0.01 to about 100 ⁇ g/kg/dose.
  • the exact dose to be administered may be determined by one of skill in the art and is dependent upon the potency of the particular compound, as well as upon the age, weight and condition of the individual.
  • Administration should begin whenever, e.g., suppression of nutrient availability, food intake, weight, blood glucose or plasma lipid modulation is desired, for example, at the first sign of symptoms or shortly after diagnosis of obesity, diabetes mellitus, or insulin-resistance syndrome.
  • Administration may be by any route, e.g., injection, preferably subcutaneous or intramuscular, oral, nasal, transdermal, etc. Dosages for certain routes, for example oral administration, may be increased to account for decreased bioavailablity, for example, by about 5-100 fold.
  • the composition is formulation so as to deliver a dose of hybrid polypeptide ranging from 1 ⁇ g/kg to 100 mg/kg body weight/day, preferably at doses ranging from 0.1 mg/kg to about 50 mg/kg body weight/day.
  • Parenteral administration may be carried out with an initial bolus followed by continuous infusion to maintain therapeutic circulating levels of drug product.
  • the frequency of dosing will depend on the pharmacokinetic parameters of the agents and the routes of administration.
  • the optimal pharmaceutical formulation will be determined by one of skill in the art depending on the route of administration and the desired dosage. See, e.g., Remington's Pharmaceutical Sciences, supra, pages 1435- 1712. Such formulations may influence the physical state, stability, rate of in vivo release and rate of in vivo clearance of the administered agents.
  • a suitable dose may be calculated according to body weight, body surface areas or organ size.
  • compositions and treatment methods of the invention may be useful in fields of human medicine and veterinary medicine.
  • the subject to be treated may be a mammal, preferably human or other animal.
  • subjects include for example, farm animals including cows, sheep, pigs, horses and goats, companion animals such as dogs and cats, exotic and/or zoo animals, laboratory animals including mice, rats, rabbits, guinea pigs and hamsters; and poultry such as chickens, turkeys, ducks and geese.
  • the present invention contemplates a kit comprising a hybrid polypeptide of the invention, components suitable for preparing said hybrid polypeptide of the invention for pharmaceutical application, and instructions for using said hybrid polypeptide and components for pharmaceutical application.
  • Peptides of the invention may be assembled on a Symphony peptide synthesizer (Protein Technologies, Inc.) using Rink amide resin (Novabiochem) with a loading of 0.43-0.49 mmol/g at 0.050-0.100 mmol or a pre-loaded Wang Resin (Fmoc-Tyr(tBu)-Wang resin) 0.63 mmol/g (Novabiochem).
  • Fmoc amino acid (5.0 eq, 0.250-.500 mmol) residues are dissolved at a concentration of 0.10 M in l-methyl-2-pyrrolidinone.
  • HBTU HBTU
  • 1-Hydroxybenzotriazole hydrate 1.8 eq, 0.090-0.18 mmol
  • N,N-Diisopropylethylamine 2.4 eq, 0.120-0.240 mmol
  • the Symphony peptide synthesizer is programmed to cleave the resin.
  • Trifluoroacetic acid (TFA) cleavage of the peptide from resin is carried out using 93% TFA, 3% phenol, 3%> water and 1% triisopropylsilane for 1 hour.
  • the cleaved peptide is precipitated using tert-butyl methyl ether, pelleted by centrifugation and lyophilized. The pellet is re-dissolved in water (10-15 mL), filtered and purified via reverse phase HPLC using a C18 column and an acetonitrile/water gradient containing 0.1% TFA.
  • a general procedure for N-capping the peptides of the invention with fatty acids is as follows: Peptide on rink amide resin (0.1 mmol) is suspended in NMP (5 mL). In a separate vial, HBTU (0.3 mmol), HOBt (0.3 mmol) is dissolved in DMF (5 mL) followed by the addition of DIEA (0.6 mmol). This solution is added to the resin and this suspension is shaken for 2 hrs. The solvent is filtered and washed thoroughly with NMP (5 mLx4) and CH C1 2 (20 mL), dried and is subjected to the TFA cleavage for 1 hr. The yield of the desired peptide is ca. 40 mg after cleavage and purification.
  • PEG modification may be carried out in solution on a free epsilon-amino group of lysine or a terminal amino group of a purified peptide using commercially available activated PEG esters.
  • the resulting PEGylated derivatives are purified to homogeneity by reverse phase HPLC and the purity is confirmed by LC/MS and MALDI-MS.
  • hybrid polypeptides of the invention are shown below in Table 1-1.
  • modifications to the embodied compounds are envisioned, such as chemical modifications such as glycosylation, PEG modifications, etc.; amino acid modifications such as substitutions, insertions and deletions, etc.
  • amino acid modifications such as substitutions, insertions and deletions, etc.
  • the hybrid polypeptides of the invention may alternatively be in the free acid form.
  • Table 1-1 Certain Exemplary Hybrid Compounds of the Invention SEQ ID: 1 HGEGTFTSDLSKQMEEEANRLFIEWLKNGGPSSGAPPPS-ASLRHYLNLNTRQRY HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-RHYLNLVTRQRY-NH HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NRYYASLRHYLNLV HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS- ⁇ Ala- ⁇ Ala-ASLRHYLN HGEGTFTSDLSKQMEEEANRLFIEWLKNGGPSSGAPPPS- ⁇ Ala- ⁇ Ala-RHYLNLVT oe oe HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS- ⁇ Ala- ⁇ Ala-VTRQRY-N HGEGTFTSDLSKQMEEEAVRLFIEWLKN-ASLRHY
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKN-4,7,10-trioxa-13-tridecanamine succinimidyl- KCNTATCVLGRLHRLQTYPRTNTGSNTY-NH 2
  • KCNTATCATQRLANFLVR-RYYASLRHYLNLVTRQRY-NH2 isocaproyl-STAVL-(Aib)-K(for yl)-LSQEL-(Aib)-K(formyl)-LQT-NRYYASLRHYLNLVTRQRY-NH 2 isocaproyl-STAVL-(Aib)-K(formyl)-LSQEL-(Aib)-K(formyl)-L-ELNRYYASLRHYLNLVTRQRY-NH 2
  • the hybrid polypeptides of the invention may be tested in a variety of receptor binding assays using binding assay methodologies generally known to those skilled in the art. Such assays include those described below.
  • Amylin binding assay Evaluation of the binding of some exemplary compounds of the invention to amylin receptors may be carried out as follows in nuclueus accumbens membranes prepared from rat brain. Male Sprague-Dawley® rats (200-250) grams are sacrificed by decapitation. Brains are removed and place in cold phosphate-buffered saline (PBS).
  • PBS cold phosphate-buffered saline
  • membranes from 4 mg original wet weight of tissue are incubated with 125 I -amylin at 12-16 pM in 20 mM HEPES buffer containing 0.5 mg/ml bacitracin, 0.5 mg/ml bovine serum albumin, and 0.2 mM PMSF. Solutions are incubated for 60 minutes at 2°C. Incubations are terminated by filtration through GF/B glass fiber filters (Whatman Inc., Clifton, NJ.) that are presoaked for 4 hours in 0.3% poylethyleneimine in order to reduce nonspecific binding of radiolabeled peptides.
  • CGRP receptor binding assay Evaluation of the binding of compounds of the invention to CGRP receptors are essentially as described for amylin except using membranes prepared from SK-N-MC cells, known to express CGRP receptors (Muff, R. et.al, Ann NY Acad. Sci. 1992: 657, 106-16). Binding assays are performed as described for amylin except using 13,500 cpm 1251-hCGRP /well or 21.7 pM/well (Amersham).
  • Adrenomedullin binding assay Binding to the adrenomedullin receptor may be investigated using HUVECs that contain the adrenomedullin receptor (Kato J et.al, Eur J Pharmacol. 1995, 289:383-5) using the Perkin Elmer AlphaScreenTM assay for cyclic AMP using an optimum of 25-30,000 cells per well. Elevation of cAMP levels is not large for HUVEC compared to CHO cells. As such, CHO cells may be chosen as a negative control since they do not express the adrenomedullin receptor if desired.
  • Calcitonin receptor binding assay Binding to the calcitonin receptor may be investigated using CHO cells or T47D cells, which also express the calcitonin receptor (Muff R. et.al, Ann N Y Acad Sci. 1992, 657:106-16 and Kuestner R.E. et. al. Mol Pharmacol. 1994, 46:246-55), as known in the art
  • Leptin binding assay Two in vitro bioassays are routinely used to assess leptin binding and receptor activation (see e.g., White, et al, 1997. Proc.Natl Acad. Sci. U. S. A. 94: 10657-10662).
  • An alkaline phosphatase("AP")-leptin (“OB”) fusion protein (“AP-OB”) may be used to measure inhibition of leptin binding in the absence or presence of recombinant mouse leptin (positive control) or peptide, by COS-7 cells transfected with the long (signaling) form of the mouse OB receptor ("OB-RL").
  • Signal transduction assays may be done in GT1-7' cells cotransfected with AP reporter and OB-RL constructs.
  • Secreted alkaline phosphatase("SEAP") activity in response to stimulation with mouse leptin or peptide may be measured by chemiluminescence.
  • Yl receptor binding assay Membranes are prepared from confluent cultures of SK-N- MC cells that endogenously expresses the neuropeptide Yl receptors. Membranes are incubated with 60 pM [ 125 I]- human Peptide YY (2200 Ci/mmol, PerkinElmer Life Sciences), and with unlabeled PPF polypeptide for 60 minutes at ambient temperature in a 96 well polystyrene plate. Then well contents are harvested onto a 96 well glass fiber plate using a Perkin Elmer plate harvester. Dried glass fiber plates are combined with scintillant and counted on a Perkin Elmer scintillation counter.
  • Y2 receptor binding assay Membranes are prepared from confluent cultures of SK-N- BE cells that endogenously expresses the neuropeptide Y2 receptors. Membranes are incubated with 30 pM [ 125 I]- human Peptide YY (2200 Ci/mmol, PerkinElmer Life Sciences), and with unlabeled PPF polypeptide for 60 minutes at ambient temperature in a 96 well polystyrene plate. Then well contents are harvested onto a 96 well glass fiber plate using a Perkin Elmer plate harvester. Dried glass fiber plates are combined with scintillant and counted on a Perkin Elmer scintillation counter.
  • Y4 receptor binding assay CHO-Kl cells are transiently transfected with cDNA encoding neuropeptide Y4 gene, and then forty-eight hours later membranes are prepared from confluent cell cultures. Membranes are incubated with 18 pM [ 125 I]- human Pancreatic Polypeptide (2200 Ci/mmol, PerkinElmer Life Sciences), and with unlabeled PPF polypeptide for 60 minutes at ambient temperature in a 96 well polystyrene plate. Then well contents are harvested onto a 96 well glass fiber plate using a Perkin Elmer plate harvester. Dried glass fiber plates are combined with scintillant and counted on a Perkin Elmer scintillation counter.
  • Y5 receptor binding assay CHO-Kl cells are transiently transfected with cDNA encoding neuropeptide Y5 gene, and then forty-eight hours later membranes are prepared from confluent cell cultures. Membranes are incubated with 44 pM [ 125 I]- human Peptide YY (2200 Ci/mmol, PerkinElmer Life Sciences), and with unlabeled PPF polypeptide for 60 minutes at ambient temperature in a 96 well polystyrene plate. Then well contents are harvested onto a 96 well glass fiber plate using a Perkin Elmer plate harvester. Dried glass fiber plates are combined with scintillant and counted on a Perkin Elmer scintillation counter.
  • GLP-1 receptor binding activity and affinity may be measured using a binding displacement assay in which the receptor source is RINm5F cell membranes, and the ligand is [ 125 I]GLP-1.
  • the receptor source is RINm5F cell membranes
  • the ligand is [ 125 I]GLP-1.
  • Homogenized RINm5F cell membranes are incubated in 20 mM HEPES buffer with 40,000 cpm [ 125 I]GLP-1 tracer, and varying concentrations of test compound for 2 hours at 23° C with constant mixing. Reaction mixtures are filtered through glass filter pads presoaked with 0.3% PEI solution and rinsed with ice-cold phosphate buffered saline. Bound counts are determined using a scintillation counter. Binding affinities are calculated using GraphPad Prism software (GraphPad Software, Inc., San Diego, CA).
  • the hybrid polypeptides of the invention may be tested for appetite suppression in the mouse food intake assay and for their effect on body weight gain in diet-induced obesity (DIO) mice.
  • DIO diet-induced obesity mice.
  • the experimental protocols for the screens are described below.
  • mice Male C57BL/6 mice (4 weeks old at start of study) are fed high fat (HF, 58%) of dietary kcal as fat) or low fat (LF, 11% of dietary kcal as fat) chow. After 4 weeks on chow, each mouse is implanted with an osmotic pump (Alzet # 2002) that subcutaneously delivers a predetermined dose of hybrid polypeptide continuously for two weeks. Body weight and food intake are measured weekly (Surwit et al, Metabolism — Clinical and Experimental, 44: 645-51, 1995).
  • HF high fat
  • LF low fat
  • Test compound Effects of the test compound are expressed as the mean +/- sd of % body weight change (i.e., % change from starting weight) of at least 14 mice per treatment group (p ⁇ 0.05 ANOVA, Dunnett' s test, Prism v. 2.01, GraphPad Software Inc., San Diego, California).
  • Exemplary hybrid polypeptides of the invention were synthesized using a C-terminally truncated exendins (e.g., exendin-4(l-28) or 5 Ala, 14 Leu, 25 Phe-exendin-4(l-28)) and an N- terminally truncated PYY spanning the 18-36 to 31-36 regions.
  • the exemplary hybrid polypeptides generally comprise two modules, wherein the first module is a fragment of an exendin-4 analog and the second module is a peptidic enhancer selected from PYY truncations.
  • a ⁇ -alanine dipeptide spacers were also inco ⁇ orated between the peptide building blocks in several variants (see Table 4-1).
  • Table 4-1 Exendin/PYY Hybrids and Their Effects in the Food Intake Assay
  • hybrid polypeptides of the invention were prepared from C-terminally truncated exendin (1-27), C-terminally truncated amylin peptides (e.g., amylin(l-7), 2 ' 7 Ala-Amylin(l-7), and Amylin(33-27)), and optional sCT fragments (e.g., sCT(8-10) and 14 Gln, 11,18 Arg-sCT(8-27)). Whereas both hybrid polypeptides were very active in appetite suppression (see Table 4-2), the onset of action differed from the activity profiles of the parent molecules (data not shown). Table 4-2: Exendin/ Amylin Hybrids and Their Effect in the FI Assay
  • hybrid polypeptides of the invention were prepared from full length or C-terminally truncated exendin-4 attached to the N-terminus of CCK-8 either directly or via a linker, preserving the N-terminal amide of the CCK-8. (Table 4-3). Further, certain hybrids were prepared inco ⁇ orating the naturally occurring Tyr(SO 3 ), while another hybrid inco ⁇ orating the more stable Phe(CH 2 SO 3 ) group was prepared. All the prepared hybrid polypeptides were active in inhibiting food intake (Table 4-3). Table 4-3: Exendin/CCK-8 H brids and Their Effect in the Food Intake Assa
  • Amylin/PYY hybrid polypeptide was synthesized that contained truncated segments of each peptide. In-vivo activity in the food intake assay is shown in Table 4-4. Table 4-4: Amylin PYY Phvbrid

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Endocrinology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Diabetes (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Vascular Medicine (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Cardiology (AREA)
  • Emergency Medicine (AREA)
  • Urology & Nephrology (AREA)
  • Child & Adolescent Psychology (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2005/004178 2004-02-11 2005-02-11 Hybrid polypeptides with selectable properties Ceased WO2005077072A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
KR1020147001171A KR20140011431A (ko) 2004-02-11 2005-02-11 선택가능한 특성을 갖는 하이브리드 폴리펩티드
NZ548978A NZ548978A (en) 2004-02-11 2005-02-11 Hybrid polypeptides with selectable properties
JP2006553217A JP2007525495A (ja) 2004-02-11 2005-02-11 選択可能な特性を有するハイブリッドポリペプチド
IN3921DEN2012 IN2012DN03921A (https=) 2004-02-11 2005-02-11
CN2005800120093A CN1961000B (zh) 2004-02-11 2005-02-11 具有可选择特性的杂合多肽
CA2555877A CA2555877C (en) 2004-02-11 2005-02-11 Hybrid polypeptides with selectable properties
KR1020127032622A KR101427024B1 (ko) 2004-02-11 2005-02-11 선택가능한 특성을 갖는 하이브리드 폴리펩티드
AU2005211755A AU2005211755B2 (en) 2004-02-11 2005-02-11 Hybrid polypeptides with selectable properties
EP05722892.6A EP1718665B1 (en) 2004-02-11 2005-02-11 Hybrid polypeptides with selectable properties
BRPI0507594-7A BRPI0507594A (pt) 2004-02-11 2005-02-11 polipetìdeos hìbridos com propriedades selecionáveis
IL177229A IL177229A0 (en) 2004-02-11 2006-08-02 Hybrid polypeptides with selectable properties

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US54340704P 2004-02-11 2004-02-11
US60/543,407 2004-02-11

Publications (2)

Publication Number Publication Date
WO2005077072A2 true WO2005077072A2 (en) 2005-08-25
WO2005077072A3 WO2005077072A3 (en) 2006-03-02

Family

ID=34860419

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2005/004178 Ceased WO2005077072A2 (en) 2004-02-11 2005-02-11 Hybrid polypeptides with selectable properties

Country Status (14)

Country Link
US (1) US20060094652A1 (https=)
EP (4) EP1718665B1 (https=)
JP (2) JP2007525495A (https=)
KR (3) KR101427024B1 (https=)
CN (3) CN103897066A (https=)
AU (1) AU2005211755B2 (https=)
BR (1) BRPI0507594A (https=)
CA (2) CA2555877C (https=)
IL (1) IL177229A0 (https=)
IN (1) IN2012DN03921A (https=)
NZ (2) NZ548978A (https=)
RU (1) RU2378285C2 (https=)
WO (1) WO2005077072A2 (https=)
ZA (1) ZA200607190B (https=)

Cited By (68)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006049681A3 (en) * 2004-08-30 2006-07-27 Bayer Pharmaceuticals Corp Selective neuropeptide y2 receptor agonists
WO2007055728A1 (en) * 2005-11-01 2007-05-18 Amylin Pharmaceuticals, Inc. Treatment of obesity and related disorders
WO2007055743A3 (en) * 2005-11-01 2007-08-02 Amylin Pharmaceuticals Inc Treatment of obesity and related disorders
WO2007017892A3 (en) * 2005-05-05 2007-09-20 Cadila Healthcare Ltd Novel compounds as glp-i agonists
WO2007022123A3 (en) * 2005-08-11 2007-12-13 Amylin Pharmaceuticals Inc Hybrid polypeptides with selectable properties
WO2007014051A3 (en) * 2005-07-22 2008-01-17 Amylin Pharmaceuticals Inc Use of amylin and amylin agonists as cardioprotective or myoprotective agents
WO2007104789A3 (en) * 2006-03-15 2008-03-13 Novo Nordisk As Amylin derivatives
WO2008005527A3 (en) * 2006-07-06 2008-05-15 Amylin Pharmaceuticals Inc Glucagon-like peptides and uses thereof
WO2008021560A3 (en) * 2006-08-17 2008-07-10 Amylin Pharmaceuticals Inc Dpp-iv resistant gip hybrid polypeptides with selectable properties
EP1972349A1 (en) * 2007-03-21 2008-09-24 Biocompatibles UK Limited GLP-1 fusion peptides conjugated to polymer(s), their production and use
EP2004238A2 (en) * 2006-03-21 2008-12-24 Amylin Pharmaceuticals, Inc. Peptide-peptidase inhibitor conjugates and methods of using same
JP2009527558A (ja) * 2006-02-22 2009-07-30 メルク エンド カムパニー インコーポレーテッド オキシントモジュリン誘導体
WO2010009872A1 (en) * 2008-07-22 2010-01-28 University Of Ulster Modified cck peptides
WO2010118384A2 (en) 2009-04-10 2010-10-14 Amylin Pharmaceuticals, Inc. Amylin agonist compounds for estrogen-deficient mammals
US7875587B2 (en) 1999-03-29 2011-01-25 Uutech Limited Peptide analogues of GIP for treatment of diabetes, insulin resistance and obesity
WO2011063414A1 (en) 2009-11-23 2011-05-26 Amylin Pharmaceuticals, Inc. Polypeptide conjugate
EP2330125A2 (en) 2005-08-11 2011-06-08 Amylin Pharmaceuticals, Inc. Hybrid polypeptides with selectable properties
EP2390264A1 (en) 2005-02-11 2011-11-30 Amylin Pharmaceuticals Inc. GIP analog and hybrid polypeptides with selectable propperties
US8076288B2 (en) 2004-02-11 2011-12-13 Amylin Pharmaceuticals, Inc. Hybrid polypeptides having glucose lowering activity
US8114958B2 (en) 2004-02-11 2012-02-14 Amylin Pharmaceuticals, Inc. Amylin family peptides
US8263545B2 (en) 2005-02-11 2012-09-11 Amylin Pharmaceuticals, Inc. GIP analog and hybrid polypeptides with selectable properties
WO2012162547A2 (en) 2011-05-25 2012-11-29 Amylin Pharmaceuticals, Inc. Long duration dual hormone conjugates
US8431533B2 (en) 2005-09-22 2013-04-30 Biocompatibles Uk Ltd. GLP-1 fusion peptides, their production and use
US8790705B2 (en) 2006-05-10 2014-07-29 Biocompatibles Uk Ltd. Spherical microcapsules comprising GLP-1 peptides, their production and use
US8822413B2 (en) 2007-07-06 2014-09-02 Theratechnologies Inc. Bifunctional hormone having alpha-MSH activity and natriuretic peptide activity and uses thereof
US8895504B2 (en) 2008-10-21 2014-11-25 Novo Nordisk A/S Amylin derivatives
US8901073B2 (en) 2011-01-27 2014-12-02 Imperial Innovations Limited Compounds and their effects on feeding behaviour
US9018160B2 (en) 2010-01-27 2015-04-28 Imperial Innovations Limited Peptide tyrosine tyrosine analogues
US9193730B2 (en) 2006-07-10 2015-11-24 Paion Uk Limited Short-acting benzodiazepine salts and their polymorphic forms
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
US9694053B2 (en) 2013-12-13 2017-07-04 Sanofi Dual GLP-1/glucagon receptor agonists
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
US9751926B2 (en) 2013-12-13 2017-09-05 Sanofi Dual GLP-1/GIP receptor agonists
US9758561B2 (en) 2014-04-07 2017-09-12 Sanofi Dual GLP-1/glucagon receptor agonists derived from exendin-4
US9771406B2 (en) 2014-04-07 2017-09-26 Sanofi Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4
US9775904B2 (en) 2014-04-07 2017-10-03 Sanofi Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
US9861706B2 (en) 2011-11-03 2018-01-09 Zealand Pharma A/S GLP-1 receptor agonist peptide gastrin conjugates
US9862771B2 (en) 2008-12-23 2018-01-09 Amgen Inc. Human CGRP receptor binding proteins
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
US9982029B2 (en) 2015-07-10 2018-05-29 Sanofi Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists
US10005824B2 (en) 2015-06-12 2018-06-26 Novo Nordisk A/S Selective PYY compounds and uses thereof
US10071140B2 (en) 2016-09-09 2018-09-11 Zealand Pharma A/S Amylin analogues
US10093713B2 (en) 2013-11-06 2018-10-09 Zealand Pharma A/S GIP-GLP-1 dual agonist compounds and methods
US10131702B2 (en) 2013-11-06 2018-11-20 Zealand Pharma A/S Glucagon-GLP-1-GIP triple agonist compounds
US10195210B2 (en) 2010-11-08 2019-02-05 Paion Uk Ltd. Dosing regimen for sedation with CNS 7056 (Remimazolam)
US10246497B2 (en) 2013-11-15 2019-04-02 Novo Nordisk A/S Selective PYY compounds and uses thereof
US10253078B2 (en) 2014-10-29 2019-04-09 Zealand Pharma A/S GIP agonist compounds and methods
US10259877B2 (en) 2015-04-24 2019-04-16 Amgen Inc. Methods for treating or preventing migraine headache
US10406207B2 (en) 2010-04-27 2019-09-10 Zealand Pharma A/S Peptide conjugates of GLP-1 receptor agonists and gastrin and their use
US10414749B2 (en) 2013-03-04 2019-09-17 Paion Uk Limited Process for preparing 3-[(S)-7-bromo-2-((2-oxopropyl)amino)-5-pyridin-2-yl-3H-1,4-benzodiazepin-3-yl]propionic acid methyl ester
US10583172B2 (en) 2013-11-15 2020-03-10 Novo Nordisk A/S HPYY(1-36) having a beta-homoarginine substitution at position 35
US10696726B2 (en) 2013-03-14 2020-06-30 Indiana University Research And Technology Corporation Insulin-incretin conjugates
US10758592B2 (en) 2012-10-09 2020-09-01 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
US10766939B2 (en) 2015-03-18 2020-09-08 Zealand Pharma A/S Amylin analogues
US10806797B2 (en) 2015-06-05 2020-10-20 Sanofi Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate
US10905745B2 (en) 2016-12-09 2021-02-02 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
US10934362B2 (en) 2014-09-15 2021-03-02 Amgen Inc. Bi-specific anti-CGRP receptor/PAC1 receptor antigen binding proteins and uses thereof
WO2021094259A1 (en) 2019-11-11 2021-05-20 Boehringer Ingelheim International Gmbh Npy2 receptor agonists
WO2020205909A3 (en) * 2019-04-01 2021-05-20 Doyle Robert P Monomeric peptide multi-agonist targeting the glp1 receptor and npy receptors
WO2022029231A1 (en) 2020-08-07 2022-02-10 Boehringer Ingelheim International Gmbh Soluble npy2 receptor agonists
US11382957B2 (en) 2010-12-16 2022-07-12 Novo Nordisk A/S Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid
US11407838B2 (en) 2018-04-02 2022-08-09 Amgen Inc. Erenumab compositions and uses thereof
US11759501B2 (en) 2012-03-22 2023-09-19 Novo Nordisk A/S Compositions of GLP-1 peptides and preparation thereof
US11780900B2 (en) 2018-04-25 2023-10-10 Janssen Sciences Ireland Unlimited Company Glucagon like peptide 1 (GLP-1) fusion peptide coupled cyclic peptide tyrosine tyrosine conjugates and uses thereof
US11833248B2 (en) 2018-02-02 2023-12-05 Novo Nordisk A/S Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid
US20250025533A1 (en) * 2021-03-03 2025-01-23 Eli Lilly And Company Long-acting amylin receptor agonists and uses thereof
US12239739B2 (en) 2013-05-02 2025-03-04 Novo Nordisk A/S Oral dosing of GLP-1 compounds

Families Citing this family (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7138486B2 (en) * 1986-05-05 2006-11-21 The General Hospital Corporation Insulinotropic hormone derivatives and uses thereof
US7731947B2 (en) 2003-11-17 2010-06-08 Intarcia Therapeutics, Inc. Composition and dosage form comprising an interferon particle formulation and suspending vehicle
US7399744B2 (en) * 2004-03-04 2008-07-15 Amylin Pharmaceuticals, Inc. Methods for affecting body composition
EP2631244A1 (en) * 2004-10-08 2013-08-28 Amylin Pharmaceuticals, Inc. Amylin family polypeptide-6 (AFP-6) analogs and methods of making and using them
US11246913B2 (en) 2005-02-03 2022-02-15 Intarcia Therapeutics, Inc. Suspension formulation comprising an insulinotropic peptide
WO2006083761A2 (en) 2005-02-03 2006-08-10 Alza Corporation Solvent/polymer solutions as suspension vehicles
CN101296942A (zh) * 2005-08-11 2008-10-29 安米林药品公司 具有可选择特性的杂合多肽
MX2008014870A (es) 2006-05-30 2009-02-12 Intarcia Therapeutics Inc Modulador de flujo para sistema de suministro osmotico con canal interno de dos piezas.
EP2049081B1 (en) 2006-08-09 2012-11-14 Intarcia Therapeutics, Inc. Osmotic delivery systems and piston assemblies
HRP20130259T1 (hr) 2007-04-23 2013-04-30 Intarcia Therapeutics, Inc. Suspenzijske formulacije inzulinotropnih peptida i njihove uporabe
DK2240155T3 (da) 2008-02-13 2012-09-17 Intarcia Therapeutics Inc Indretninger, formuleringer og fremgangsmåder til levering af flere gavnlige midler
EP2303313B1 (en) 2008-05-21 2015-10-28 Amylin Pharmaceuticals, LLC Exendins to lower cholestrol and triglycerides
EP2435061A4 (en) 2009-05-28 2013-03-27 Amylin Pharmaceuticals Inc DAMPING GLP-1 RECEPTOR AGONIST COMPOUNDS
SMT201700583T1 (it) 2009-09-28 2018-01-11 Intarcia Therapeutics Inc Instaurazione e/o terminazione rapida di erogazione di farmaci in modo sostanzialmente stazionario
JP2014504588A (ja) 2010-12-22 2014-02-24 アミリン・ファーマシューティカルズ,リミテッド・ライアビリティ・カンパニー 膵島細胞移植のためのglp−1受容体アゴニスト
US20120208755A1 (en) 2011-02-16 2012-08-16 Intarcia Therapeutics, Inc. Compositions, Devices and Methods of Use Thereof for the Treatment of Cancers
CN103665148B (zh) * 2013-12-17 2016-05-11 中国药科大学 一种可口服给药的降糖多肽及其制法和用途
US9889085B1 (en) 2014-09-30 2018-02-13 Intarcia Therapeutics, Inc. Therapeutic methods for the treatment of diabetes and related conditions for patients with high baseline HbA1c
US10925639B2 (en) 2015-06-03 2021-02-23 Intarcia Therapeutics, Inc. Implant placement and removal systems
KR102844773B1 (ko) 2015-12-23 2025-08-13 암젠 인크 위 억제 펩티드 수용체 (gipr)에 대한 결합 단백질을 glp-1 효능제와 조합하여 사용하여 대사 장애를 치료하거나 개선시키는 방법
RU2760007C2 (ru) 2016-05-16 2021-11-22 Интарсия Терапьютикс, Инк. Полипептиды, селективные к рецепторам глюкагона, и способы их применения
USD860451S1 (en) 2016-06-02 2019-09-17 Intarcia Therapeutics, Inc. Implant removal tool
USD840030S1 (en) 2016-06-02 2019-02-05 Intarcia Therapeutics, Inc. Implant placement guide
EP4316595A3 (en) * 2016-09-02 2024-04-17 Christopher J. Soares Use of cgrp receptor antagonists in treating glaucoma
US11285180B2 (en) 2016-12-06 2022-03-29 Inserm (Institut National De La Sante Et De La Recherche Medicale) Methods of enhancing the potency of incretin-based drugs in subjects in need thereof
CN110225762A (zh) 2017-01-03 2019-09-10 因塔西亚制药公司 包括glp-1受体激动剂的连续施用和药物的共同施用的方法
BR112019014588A2 (pt) 2017-01-17 2020-02-18 Amgen Inc. Método de tratamento ou amenização de distúrbios metabólicos usando agonistas do receptor de glp-1 conjugados a antagonistas para receptor do peptídeo inibidor gástrico (gipr)
CN110831969B (zh) 2017-06-20 2024-06-21 安进公司 使用抑胃肽受体(gipr)结合蛋白与glp-1激动剂的组合治疗或改善代谢障碍的方法
MX2019015544A (es) 2017-06-21 2020-07-28 Amgen Inc Metodo para tratar o mejorar trastornos metabolicos con proteinas de fusion de agonistas del receptor de glp-1/proteinas de union antagonistas para el receptor peptidico inhibidor gastrico (gipr).
TWI847981B (zh) * 2018-04-25 2024-07-11 比利時商健生藥品公司 類升糖素肽1 (glp-1)融合肽偶合環狀酪酪肽接合物及其用途
US11970523B2 (en) * 2018-07-25 2024-04-30 China Pharmaceutical University Long-acting oxyntomodulin hybrid peptide, preparation method therefor, and application thereof
AR116632A1 (es) 2018-10-11 2021-05-26 Intarcia Therapeutics Inc Polipéptidos análogos de la amilina humana y sus métodos de uso
EP3934679A1 (en) 2019-03-08 2022-01-12 Amgen Inc. Growth differentiation factor 15 combination therapy
KR102288716B1 (ko) * 2019-10-30 2021-08-12 경상남도 항비만 효능을 갖는 펩타이드 및 이의 용도
IL300620B2 (en) * 2020-09-24 2025-12-01 Gubra As Ham15-52 analogues with improved amylin receptor (hamy3r) potency
TWI850611B (zh) * 2020-12-18 2024-08-01 丹麥商諾佛 儂迪克股份有限公司 Glp-1及澱粉素受體之共促效劑
CN113929737B (zh) * 2021-10-20 2024-07-23 中国科学院香港创新研究院再生医学与健康创新中心 一种多肽及其作为cck受体激动剂/拮抗剂的应用
WO2024123812A1 (en) 2022-12-05 2024-06-13 Shattuck Labs, Inc. Fusion proteins for the treatment of cardiometabolic diseases
US12533394B2 (en) * 2023-11-15 2026-01-27 Glycomantra Inc. Compositions and methods for treating metabolic disorders

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
US5824778A (en) 1988-12-22 1998-10-20 Kirin-Amgen, Inc. Chemically-modified G-CSF
US6734166B1 (en) 2000-02-08 2004-05-11 North Carolina State University Method of reducing aluminum levels in the central nervous system

Family Cites Families (70)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3490597A (en) 1966-07-22 1970-01-20 Purolator Products Inc Cover plate for spin-on-filter
DE3065460D1 (en) 1979-07-28 1983-12-08 Beecham Group Plc Benzocycloheptapyrrolealkanoic acids and their derivatives, processes for their preparation and pharmaceutical compositions containing them
US4397780A (en) 1982-02-12 1983-08-09 Armour Pharmaceutical Company Leucine22 -calcitonin
US4401593A (en) 1982-02-12 1983-08-30 Armour Pharmaceutical Company Glycine - 8 calcitonin
US6936694B1 (en) 1982-05-06 2005-08-30 Intermune, Inc. Manufacture and expression of large structural genes
US4414149A (en) 1983-03-04 1983-11-08 Armour Pharmaceutical Company Glycine8 -D-arginine24 calcitonin
US4495097A (en) 1983-04-04 1985-01-22 Armour Pharmaceutical Company Des-serine2 -glycine8 calcitonin
US4497731A (en) 1983-04-04 1985-02-05 Armour Pharmaceutical Company Glycine 8-des-tyrosine 22 calcitonin
US5188666A (en) 1983-06-30 1993-02-23 Boccardo Victor N Paint removing compositions and methods for the manufacture and use thereof
US4597900A (en) * 1983-08-22 1986-07-01 Armour Pharmaceutical Co. Des2 -glycine8 -des22 -calcitonin
US4537716A (en) 1983-12-05 1985-08-27 Armour Pharmaceutical Co. Des-serine2 or des-glycine2 -leucine22 calcitonin
US4604238A (en) 1984-12-10 1986-08-05 Armour Pharmaceutical Company Analogs of calcitonin
US4606856A (en) * 1985-03-18 1986-08-19 Seyler Jay K [Des-1-amino, 8-glycine]calcitonin
US4652627A (en) 1985-08-16 1987-03-24 Kempe Tomas G Calcitonin analogs with C-terminal D-amino acid substituents
US4697002A (en) 1985-12-23 1987-09-29 Kempe Tomas G Calcitonin gene related peptide analogs with amino acid subdstituents at the penultimate position 36
US4687839A (en) 1985-12-23 1987-08-18 Kempe Tomas G Calcitonin gene related peptide analogs with C-terminal D-amino acid substituents
JP2796388B2 (ja) 1988-05-13 1998-09-10 アムジエン・インコーポレーテツド G−csfの精製方法
US5545618A (en) * 1990-01-24 1996-08-13 Buckley; Douglas I. GLP-1 analogs useful for diabetes treatment
ATE164852T1 (de) 1990-01-24 1998-04-15 Douglas I Buckley Glp-1-analoga verwendbar in der diabetesbehandlung
US5234906A (en) * 1991-01-10 1993-08-10 Amylin Pharmaceuticals, Inc. Hyperglycemic compositions
HU222249B1 (hu) 1991-03-08 2003-05-28 Amylin Pharmaceuticals Inc. Eljárás amilin agonista peptidszármazékok és ezeket tartalmazó gyógyszerkészítmények előállítására
US5445781A (en) 1991-08-28 1995-08-29 Centro Sviluppo Settori Impiego S.R.L. Process for the injection molding of non-precatalyzed polymerizable resins at high-pressure and flow
SK121895A3 (en) * 1993-03-29 1996-10-02 Univ Cincinnati Analogues of peptide yy and uses thereof
US5424286A (en) 1993-05-24 1995-06-13 Eng; John Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same
US5814316A (en) * 1994-08-05 1998-09-29 Wisconsin Alumni Research Foundation Compound to mimick a naturally occurring peptide's effect
US6309853B1 (en) 1994-08-17 2001-10-30 The Rockfeller University Modulators of body weight, corresponding nucleic acids and proteins, and diagnostic and therapeutic uses thereof
US5512549A (en) 1994-10-18 1996-04-30 Eli Lilly And Company Glucagon-like insulinotropic peptide analogs, compositions, and methods of use
US5574010A (en) 1994-11-14 1996-11-12 The Regents Of The University Of California Treatment of pancreatic tumors with peptide YY and analogs thereof
US5521283A (en) 1995-01-31 1996-05-28 Eli Lilly And Company Anti-obesity proteins
US5532336A (en) * 1995-01-31 1996-07-02 Eli Lilly And Company Anti-obesity proteins
US5739106A (en) * 1995-06-07 1998-04-14 Rink; Timothy J. Appetite regulating compositions
JPH11508895A (ja) 1995-06-30 1999-08-03 イーライ・リリー・アンド・カンパニー 糖尿病を処置する方法
WO1997015322A1 (en) 1995-10-25 1997-05-01 The Regents Of The University Of California Methods for restoring or enhancing reproductive function in reproductively impaired hosts
EP0910578A2 (en) * 1996-01-19 1999-04-28 The Board Of Regents, The University Of Texas System Recombinant expression of proteins from secretory cell lines
DK0892849T3 (da) 1996-01-23 2006-07-24 Indevus Pharmaceuticals Inc Fremgangsmåde til anvendelse af obese-genet og dets genprodukt til stimulering af hæmatopoietisk udvikling
EP0912609A2 (en) 1996-06-06 1999-05-06 Smithkline Beecham Plc Fragments of leptin (ob protein)
US5686511A (en) 1996-06-28 1997-11-11 The Valspar Corporation Esterifying epoxy resin with carboxyl polymer and quenching
US6277819B1 (en) * 1996-08-30 2001-08-21 Eli Lilly And Company Use of GLP-1 or analogs in treatment of myocardial infarction
CZ90999A3 (cs) 1996-09-20 1999-06-16 Hoechst Aktiengesellschaft Farmaceutický přípravek obsahující antagonistu leptinu vhodný pro léčení inzulínové rezistence u diabetes mellitus II. typu
WO1998018486A1 (en) 1996-10-25 1998-05-07 Icogen Corporation Use of leptin to stimulate hematopoiesis
EP0996459B1 (en) * 1997-01-07 2005-09-21 Amylin Pharmaceuticals, Inc. Use of exendins and agonists thereof for the reduction of food intake
CA2281888A1 (en) 1997-02-25 1998-08-27 Eli Lilly And Company Treatment of infertility with leptin receptor ligands
IL120733A0 (en) 1997-04-29 1997-08-14 Yeda Res & Dev Leptin as an inhibitor of cell proliferation
KR20010013414A (ko) 1997-06-06 2001-02-26 피터 기딩스 당뇨병의 치료를 위한 렙틴 길항제의 용도
US7910548B2 (en) 1997-06-06 2011-03-22 Amylin Pharmaceuticals, Inc. Methods for treating obesity
CA2299425A1 (en) 1997-08-08 1999-02-18 Amylin Pharmaceuticals, Inc. Novel exendin agonist compounds
WO1999025727A2 (en) 1997-11-14 1999-05-27 Amylin Pharmaceuticals, Inc. Novel exendin agonist compounds
ATE383867T1 (de) 1997-11-14 2008-02-15 Amylin Pharmaceuticals Inc Neuartige exendin agonisten
US7745216B2 (en) 1999-02-10 2010-06-29 Curis, Inc. Methods and reagents for treating glucose metabolic disorders
DE60045030D1 (de) * 1999-02-10 2010-11-11 Curis Inc Peptid yy (pyy) zur behandlung von glukose stoffwechselkrankheiten
US6162260A (en) 1999-05-24 2000-12-19 Novo Nordisk Biochem North America, Inc. Single-bath biopreparation and dyeing of textiles
EP1076066A1 (en) 1999-07-12 2001-02-14 Zealand Pharmaceuticals A/S Peptides for lowering blood glucose levels
US6528486B1 (en) * 1999-07-12 2003-03-04 Zealand Pharma A/S Peptide agonists of GLP-1 activity
US6602997B2 (en) 2000-04-27 2003-08-05 Shin-Etsu Bio, Inc. Whole cell and cell-debris polysaccharide
BR0116024A (pt) * 2000-12-07 2005-12-13 Lilly Co Eli Proteìna de fusão heteróloga e uso da mesma
US8273713B2 (en) * 2000-12-14 2012-09-25 Amylin Pharmaceuticals, Llc Methods of treating obesity using PYY[3-36]
GB0121709D0 (en) 2001-09-07 2001-10-31 Imp College Innovations Ltd Food inhibition agent
KR100989647B1 (ko) 2001-09-24 2010-10-26 오레곤 헬스 앤드 사이언스 유니버시티 식습관의 변화
EP1474163A2 (en) 2002-01-10 2004-11-10 Imperial College Innovations Limited Modification of feeding behavior
ATE494002T1 (de) 2002-06-14 2011-01-15 Amylin Pharmaceuticals Inc Prävention und/oder behandlung von colitis ulcerosa mit pyy oder pyyä3-36ü
WO2004039832A2 (en) 2002-10-31 2004-05-13 Albany Medical College Leptin-related peptides
US20040209803A1 (en) * 2002-12-19 2004-10-21 Alain Baron Compositions for the treatment and prevention of nephropathy
BRPI0411165A (pt) * 2003-05-14 2006-07-11 Emisphere Tech Inc composição farmacêutica, forma de unidade de dosagem e métodos para preparar seu uso
JP6226510B2 (ja) 2012-01-27 2017-11-08 キヤノン株式会社 画像処理システム、処理方法及びプログラム
ITMI20130325A1 (it) 2013-03-05 2014-09-06 Telecom Italia Spa Metodo per misurare e monitorare il livello di accesso a dati personali generati da risorse di un dispositivo d'utente
US9602308B2 (en) 2014-06-23 2017-03-21 International Business Machines Corporation Servicing packets in a virtual network and a software-defined network (SDN)
US9816387B2 (en) 2014-09-09 2017-11-14 United Technologies Corporation Attachment faces for clamped turbine stator of a gas turbine engine
CA2914090C (en) 2015-03-31 2023-08-01 Allen-Vanguard Corporation Frequency and time domain streaming receiver
US9601471B2 (en) 2015-04-23 2017-03-21 Apple Inc. Three layer stack structure
US9714199B2 (en) 2015-09-17 2017-07-25 I P Creations Limited Concealed amalgamated explosive neutralizer and method of manufacture

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5824778A (en) 1988-12-22 1998-10-20 Kirin-Amgen, Inc. Chemically-modified G-CSF
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
US6734166B1 (en) 2000-02-08 2004-05-11 North Carolina State University Method of reducing aluminum levels in the central nervous system

Non-Patent Citations (21)

* Cited by examiner, † Cited by third party
Title
BARASH ET AL., J CLIN INVEST, vol. 137, 1996, pages 3144 - 3147
ENG, J. ET AL.: "Isolation and Characterization of Exendin-4, and Exendin-3 Analogue from Helodenna suspectum Venom", J. BIO. CHEM., vol. 267, no. 11, 1992, pages 7402 - 7405
FEHMANN HC ET AL., PEPTIDES, vol. 15, no. 3, 1994, pages 453 - 6
GHILARDI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 6231 - 6235
GRASSO ET AL., ENDOCRINOLOGY, vol. 138, 1997, pages 1413 - 1418
KATO J, EUR J PHARMACOL., vol. 289, 1995, pages 383 - 5
KUESTNER R.E., MOL PHARMACOL., vol. 46, 1994, pages 246 - 55
MAZELIN ET AL., JUTON NERV SYST., vol. 73, 1998, pages 38 45
MERRIFIELD, SCIENCE, vol. 232, 1986, pages 341 - 7
MERRIFIELD: "The Peptides", ACADEMIC PRESS
MUFF R., ANN N Y ACAD SCI., vol. 657, 1992, pages 106 - 16
ROBERTS; GREENGERG, NUTRITION REV., vol. 54, 1996, pages 41 - 49
See also references of EP1718665A4
STEWART; YOUNG: "Solid Phase Peptide Synthesis", 1984, PIERCE CHEMICAL CO.
TAM ET AL., J. AM. CHEM. SOC., vol. 105, 1983, pages 6442
TARTAGLIA ET AL., CELL, vol. 83, 1995, pages 1263 - 1271
THORENS B ET AL., DIABETES, vol. 42, no. 11, 1993, pages 1678 - 82
THORENS, B., PROC. NATL. ACAD. SCI, USA, vol. 89, 1992, pages 8641 - 8645
WEIGLE ET AL., J CLIN INVEST, vol. 96, 1995, pages 2065 - 2070
WHITE ET AL., PROC.NATL. ACAD SCI. U. S. A., vol. 94, 1997, pages 10657 - 10662
YOUNG, A. A. ET AL.: "Glucose-Lowering and Insulin-Sensitizing Actions of Exendin-4", DIABETES, vol. 48, May 1999 (1999-05-01), pages 1026 - 1034

Cited By (112)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7875587B2 (en) 1999-03-29 2011-01-25 Uutech Limited Peptide analogues of GIP for treatment of diabetes, insulin resistance and obesity
US8697647B2 (en) 2004-02-11 2014-04-15 Odile Esther Levy Hybrid polypeptides with selectable properties
US8076288B2 (en) 2004-02-11 2011-12-13 Amylin Pharmaceuticals, Inc. Hybrid polypeptides having glucose lowering activity
US9453063B2 (en) 2004-02-11 2016-09-27 Amylin Pharmaceuticals, Llc. Hybrid polypeptides with selectable properties
US8114958B2 (en) 2004-02-11 2012-02-14 Amylin Pharmaceuticals, Inc. Amylin family peptides
US8598120B2 (en) 2004-02-11 2013-12-03 Amylin Pharmaceuticals, Llc Methods for treatment using amylin family peptides
WO2006049681A3 (en) * 2004-08-30 2006-07-27 Bayer Pharmaceuticals Corp Selective neuropeptide y2 receptor agonists
US8404637B2 (en) 2005-02-11 2013-03-26 Amylin Pharmaceuticals, Llc GIP analog and hybrid polypeptides with selectable properties
US8895498B2 (en) 2005-02-11 2014-11-25 Astrazeneca Pharmaceuticals, Lp GIP and exendin hybrid polypeptides
EP2390264A1 (en) 2005-02-11 2011-11-30 Amylin Pharmaceuticals Inc. GIP analog and hybrid polypeptides with selectable propperties
EP2392595A1 (en) 2005-02-11 2011-12-07 Amylin Pharmaceuticals Inc. GIP analog and hybrid polypeptides with selectable properties
US8263545B2 (en) 2005-02-11 2012-09-11 Amylin Pharmaceuticals, Inc. GIP analog and hybrid polypeptides with selectable properties
US9133260B2 (en) 2005-02-11 2015-09-15 Amylin Pharmaceuticals, Llc GIP analog and hybrid polypeptides with selectable properties
WO2007017892A3 (en) * 2005-05-05 2007-09-20 Cadila Healthcare Ltd Novel compounds as glp-i agonists
WO2007014051A3 (en) * 2005-07-22 2008-01-17 Amylin Pharmaceuticals Inc Use of amylin and amylin agonists as cardioprotective or myoprotective agents
EP2330124A3 (en) * 2005-08-11 2012-08-29 Amylin Pharmaceuticals Inc. Hybrid polypeptides with selectable properties
EP2330125A3 (en) * 2005-08-11 2012-12-12 Amylin Pharmaceuticals, Inc. Hybrid polypeptides with selectable properties
EP2330124A2 (en) 2005-08-11 2011-06-08 Amylin Pharmaceuticals Inc. Hybrid polypeptides with selectable properties
WO2007022123A3 (en) * 2005-08-11 2007-12-13 Amylin Pharmaceuticals Inc Hybrid polypeptides with selectable properties
EP2330125A2 (en) 2005-08-11 2011-06-08 Amylin Pharmaceuticals, Inc. Hybrid polypeptides with selectable properties
US8431533B2 (en) 2005-09-22 2013-04-30 Biocompatibles Uk Ltd. GLP-1 fusion peptides, their production and use
US8853159B2 (en) 2005-09-22 2014-10-07 Biocompatibles Uk Ltd GLP-1 Fusion Peptides
WO2007055728A1 (en) * 2005-11-01 2007-05-18 Amylin Pharmaceuticals, Inc. Treatment of obesity and related disorders
WO2007055743A3 (en) * 2005-11-01 2007-08-02 Amylin Pharmaceuticals Inc Treatment of obesity and related disorders
JP2009527558A (ja) * 2006-02-22 2009-07-30 メルク エンド カムパニー インコーポレーテッド オキシントモジュリン誘導体
US8486890B2 (en) 2006-03-15 2013-07-16 Novo Nordisk A/S Amylin derivatives
WO2007104789A3 (en) * 2006-03-15 2008-03-13 Novo Nordisk As Amylin derivatives
JP2009530250A (ja) * 2006-03-15 2009-08-27 ノボ・ノルデイスク・エー/エス アミリン誘導体
EP2004238A2 (en) * 2006-03-21 2008-12-24 Amylin Pharmaceuticals, Inc. Peptide-peptidase inhibitor conjugates and methods of using same
US8790705B2 (en) 2006-05-10 2014-07-29 Biocompatibles Uk Ltd. Spherical microcapsules comprising GLP-1 peptides, their production and use
WO2008005527A3 (en) * 2006-07-06 2008-05-15 Amylin Pharmaceuticals Inc Glucagon-like peptides and uses thereof
US9193730B2 (en) 2006-07-10 2015-11-24 Paion Uk Limited Short-acting benzodiazepine salts and their polymorphic forms
US9914738B2 (en) 2006-07-10 2018-03-13 Paion Uk Limited Short-acting benzodiazepine salts and their polymorphic forms
US9777007B2 (en) 2006-07-10 2017-10-03 Paion Uk Limited Short-acting benzodiazepine salts and their polymorphic forms
US10961250B2 (en) 2006-07-10 2021-03-30 Paion Uk Limited Short-acting benzodiazepine salts and their polymorphic forms
WO2008021560A3 (en) * 2006-08-17 2008-07-10 Amylin Pharmaceuticals Inc Dpp-iv resistant gip hybrid polypeptides with selectable properties
JP2014058528A (ja) * 2006-08-17 2014-04-03 Amylin Pharmaceuticals Llc 選択可能な特性を持つdpp−iv耐性gipハイブリッドポリペプチド
JP2010500996A (ja) * 2006-08-17 2010-01-14 アミリン・ファーマシューティカルズ,インコーポレイテッド 選択可能な特性を持つdpp−iv耐性gipハイブリッドポリペプチド
EP1972349A1 (en) * 2007-03-21 2008-09-24 Biocompatibles UK Limited GLP-1 fusion peptides conjugated to polymer(s), their production and use
WO2008113601A1 (en) * 2007-03-21 2008-09-25 Biocompatibles Uk Ltd. Glp-1 fusion peptides conjugated to polymer(s), their production and use
US8822413B2 (en) 2007-07-06 2014-09-02 Theratechnologies Inc. Bifunctional hormone having alpha-MSH activity and natriuretic peptide activity and uses thereof
WO2010009872A1 (en) * 2008-07-22 2010-01-28 University Of Ulster Modified cck peptides
US8895504B2 (en) 2008-10-21 2014-11-25 Novo Nordisk A/S Amylin derivatives
US9862771B2 (en) 2008-12-23 2018-01-09 Amgen Inc. Human CGRP receptor binding proteins
US12122841B2 (en) 2008-12-23 2024-10-22 Amgen Inc. Human CGRP receptor binding proteins
US12134652B2 (en) 2008-12-23 2024-11-05 Amgen Inc. Human CGRP receptor binding proteins
WO2010118384A2 (en) 2009-04-10 2010-10-14 Amylin Pharmaceuticals, Inc. Amylin agonist compounds for estrogen-deficient mammals
WO2011063414A1 (en) 2009-11-23 2011-05-26 Amylin Pharmaceuticals, Inc. Polypeptide conjugate
US9018160B2 (en) 2010-01-27 2015-04-28 Imperial Innovations Limited Peptide tyrosine tyrosine analogues
US10406207B2 (en) 2010-04-27 2019-09-10 Zealand Pharma A/S Peptide conjugates of GLP-1 receptor agonists and gastrin and their use
US10342800B2 (en) 2010-11-08 2019-07-09 Paion Uk Ltd. Dosing regimen for sedation with CNS 7056 (Remimazolam)
US10195210B2 (en) 2010-11-08 2019-02-05 Paion Uk Ltd. Dosing regimen for sedation with CNS 7056 (Remimazolam)
US12201637B2 (en) 2010-11-08 2025-01-21 Paion Uk Ltd. Dosing regimen for sedation with CNS 7056 (Remimazolam)
US11382957B2 (en) 2010-12-16 2022-07-12 Novo Nordisk A/S Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid
US8901073B2 (en) 2011-01-27 2014-12-02 Imperial Innovations Limited Compounds and their effects on feeding behaviour
WO2012162547A2 (en) 2011-05-25 2012-11-29 Amylin Pharmaceuticals, Inc. Long duration dual hormone conjugates
US9861706B2 (en) 2011-11-03 2018-01-09 Zealand Pharma A/S GLP-1 receptor agonist peptide gastrin conjugates
US11759502B2 (en) 2012-03-22 2023-09-19 Novo Nordisk A/S Compositions of GLP-1 peptides and preparation thereof
US11759503B2 (en) 2012-03-22 2023-09-19 Novo Nordisk A/S Compositions of GLP-1 peptides and preparation thereof
US11759501B2 (en) 2012-03-22 2023-09-19 Novo Nordisk A/S Compositions of GLP-1 peptides and preparation thereof
US12594326B2 (en) 2012-03-22 2026-04-07 Novo Nordisk A/S Compositions of GLP-1 peptides and preparation thereof
US10758592B2 (en) 2012-10-09 2020-09-01 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
US10253079B2 (en) 2012-12-21 2019-04-09 Sanofi Functionalized Exendin-4 derivatives
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
US9745360B2 (en) 2012-12-21 2017-08-29 Sanofi Dual GLP1/GIP or trigonal GLP1/GIP/glucagon agonists
US10414749B2 (en) 2013-03-04 2019-09-17 Paion Uk Limited Process for preparing 3-[(S)-7-bromo-2-((2-oxopropyl)amino)-5-pyridin-2-yl-3H-1,4-benzodiazepin-3-yl]propionic acid methyl ester
US10696726B2 (en) 2013-03-14 2020-06-30 Indiana University Research And Technology Corporation Insulin-incretin conjugates
US12239739B2 (en) 2013-05-02 2025-03-04 Novo Nordisk A/S Oral dosing of GLP-1 compounds
US12514822B2 (en) 2013-05-02 2026-01-06 Novo Nordisk A/S Oral dosing of GLP-1 compounds
US10093713B2 (en) 2013-11-06 2018-10-09 Zealand Pharma A/S GIP-GLP-1 dual agonist compounds and methods
US11111285B2 (en) 2013-11-06 2021-09-07 Zealand Pharma A/S Glucagon-GLP-1-GIP triple agonist compounds
US10131702B2 (en) 2013-11-06 2018-11-20 Zealand Pharma A/S Glucagon-GLP-1-GIP triple agonist compounds
US11008375B2 (en) 2013-11-06 2021-05-18 Zealand Pharma A/S GIP-GLP-1 dual agonist compounds and methods
US10583172B2 (en) 2013-11-15 2020-03-10 Novo Nordisk A/S HPYY(1-36) having a beta-homoarginine substitution at position 35
US10246497B2 (en) 2013-11-15 2019-04-02 Novo Nordisk A/S Selective PYY compounds and uses thereof
US9751926B2 (en) 2013-12-13 2017-09-05 Sanofi Dual GLP-1/GIP receptor agonists
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
US9694053B2 (en) 2013-12-13 2017-07-04 Sanofi Dual GLP-1/glucagon receptor agonists
US9758561B2 (en) 2014-04-07 2017-09-12 Sanofi Dual GLP-1/glucagon receptor agonists derived from exendin-4
US9771406B2 (en) 2014-04-07 2017-09-26 Sanofi Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4
US9775904B2 (en) 2014-04-07 2017-10-03 Sanofi Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
US11919964B2 (en) 2014-09-15 2024-03-05 Amgen Inc. Bi-specific anti-CGRP receptor/PAC1 receptor antigen binding proteins and uses thereof
US10934362B2 (en) 2014-09-15 2021-03-02 Amgen Inc. Bi-specific anti-CGRP receptor/PAC1 receptor antigen binding proteins and uses thereof
US11001619B2 (en) 2014-10-29 2021-05-11 Zealand Pharma A/S GIP agonist compounds and methods
US11814417B2 (en) 2014-10-29 2023-11-14 Zealand Pharma A/S GIP agonist compounds and methods
US10253078B2 (en) 2014-10-29 2019-04-09 Zealand Pharma A/S GIP agonist compounds and methods
US10766939B2 (en) 2015-03-18 2020-09-08 Zealand Pharma A/S Amylin analogues
US10259877B2 (en) 2015-04-24 2019-04-16 Amgen Inc. Methods for treating or preventing migraine headache
US11466090B2 (en) 2015-04-24 2022-10-11 Amgen Inc. Methods for treating or preventing migraine headache
US10806797B2 (en) 2015-06-05 2020-10-20 Sanofi Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate
US10005824B2 (en) 2015-06-12 2018-06-26 Novo Nordisk A/S Selective PYY compounds and uses thereof
US9982029B2 (en) 2015-07-10 2018-05-29 Sanofi Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists
US11382956B2 (en) 2016-09-09 2022-07-12 Zealand Pharma A/S Amylin analogues
US12083164B2 (en) 2016-09-09 2024-09-10 Zealand Pharma A/S Amylin analogues
US10071140B2 (en) 2016-09-09 2018-09-11 Zealand Pharma A/S Amylin analogues
US10905745B2 (en) 2016-12-09 2021-02-02 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
US11395847B2 (en) 2016-12-09 2022-07-26 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
US11833248B2 (en) 2018-02-02 2023-12-05 Novo Nordisk A/S Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid
US12396953B2 (en) 2018-02-02 2025-08-26 Novo Nordisk A/S Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid
US11407838B2 (en) 2018-04-02 2022-08-09 Amgen Inc. Erenumab compositions and uses thereof
US11780900B2 (en) 2018-04-25 2023-10-10 Janssen Sciences Ireland Unlimited Company Glucagon like peptide 1 (GLP-1) fusion peptide coupled cyclic peptide tyrosine tyrosine conjugates and uses thereof
WO2020205909A3 (en) * 2019-04-01 2021-05-20 Doyle Robert P Monomeric peptide multi-agonist targeting the glp1 receptor and npy receptors
US12384825B2 (en) 2019-04-01 2025-08-12 Syracuse University Monomeric peptide multi-agonist targeting the GLP1 receptor and NPY receptors
WO2021094259A1 (en) 2019-11-11 2021-05-20 Boehringer Ingelheim International Gmbh Npy2 receptor agonists
US12559529B2 (en) 2019-11-11 2026-02-24 Boehringer Ingelheim International Gmbh NPY2 receptor agonists
US12054525B2 (en) 2019-11-11 2024-08-06 Boehringer Ingelheim Internatioal Gmbh NPY2 receptor agonists
US12391737B2 (en) 2020-08-07 2025-08-19 Boehringer Ingelheim International Gmbh Soluble NPY2 receptor agonists
WO2022029231A1 (en) 2020-08-07 2022-02-10 Boehringer Ingelheim International Gmbh Soluble npy2 receptor agonists
US20250025533A1 (en) * 2021-03-03 2025-01-23 Eli Lilly And Company Long-acting amylin receptor agonists and uses thereof
US12551532B2 (en) 2021-03-03 2026-02-17 Eli Lilly And Company Long-acting amylin receptor agonists and uses thereof

Also Published As

Publication number Publication date
CN1961000A (zh) 2007-05-09
EP1718665B1 (en) 2013-04-10
CN102174115A (zh) 2011-09-07
EP1718665A4 (en) 2008-05-14
WO2005077072A3 (en) 2006-03-02
BRPI0507594A (pt) 2007-07-03
EP1718665A2 (en) 2006-11-08
JP2007525495A (ja) 2007-09-06
EP2417980A1 (en) 2012-02-15
NZ548978A (en) 2009-10-30
CN102174115B (zh) 2014-05-14
ZA200607190B (en) 2007-11-28
AU2005211755B2 (en) 2012-03-15
IL177229A0 (en) 2006-12-10
CA2849552A1 (en) 2005-08-25
KR101427024B1 (ko) 2014-08-05
CN1961000B (zh) 2011-05-04
IN2012DN03921A (https=) 2015-09-04
AU2005211755A1 (en) 2005-08-25
KR20120034237A (ko) 2012-04-10
NZ579621A (en) 2011-03-31
EP2422807A2 (en) 2012-02-29
RU2378285C2 (ru) 2010-01-10
JP5580784B2 (ja) 2014-08-27
CN103897066A (zh) 2014-07-02
US20060094652A1 (en) 2006-05-04
EP2422806A3 (en) 2012-06-13
CA2555877C (en) 2015-11-24
JP2011219488A (ja) 2011-11-04
CA2555877A1 (en) 2005-08-25
RU2006132294A (ru) 2008-03-20
KR20140011431A (ko) 2014-01-28
KR20130010086A (ko) 2013-01-25
EP2422806A2 (en) 2012-02-29
EP2422807A3 (en) 2012-05-30

Similar Documents

Publication Publication Date Title
EP1718665B1 (en) Hybrid polypeptides with selectable properties
US9453063B2 (en) Hybrid polypeptides with selectable properties
EP1922336B1 (en) Hybrid polypeptides with selectable properties
US8404637B2 (en) GIP analog and hybrid polypeptides with selectable properties
EP2330125A2 (en) Hybrid polypeptides with selectable properties
MXPA06009239A (en) Hybrid polypeptides with selectable properties
KR20070016117A (ko) 선택가능한 특성을 갖는 하이브리드 폴리펩티드

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

WWE Wipo information: entry into national phase

Ref document number: 2005211755

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 177229

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 4531/DELNP/2006

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 548978

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2555877

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2006553217

Country of ref document: JP

Ref document number: PA/a/2006/009239

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWW Wipo information: withdrawn in national office

Ref document number: DE

ENP Entry into the national phase

Ref document number: 2005211755

Country of ref document: AU

Date of ref document: 20050211

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2005211755

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2006/07190

Country of ref document: ZA

Ref document number: 200607190

Country of ref document: ZA

WWE Wipo information: entry into national phase

Ref document number: 2005722892

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 1020067018391

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2006132294

Country of ref document: RU

WWE Wipo information: entry into national phase

Ref document number: 200580012009.3

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 2005722892

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 1020067018391

Country of ref document: KR

ENP Entry into the national phase

Ref document number: PI0507594

Country of ref document: BR