WO2005063252A1 - Cdk2 antagonists as short form c-maf transcription factor antagonists for treatment of glaucoma - Google Patents
Cdk2 antagonists as short form c-maf transcription factor antagonists for treatment of glaucoma Download PDFInfo
- Publication number
- WO2005063252A1 WO2005063252A1 PCT/US2004/042930 US2004042930W WO2005063252A1 WO 2005063252 A1 WO2005063252 A1 WO 2005063252A1 US 2004042930 W US2004042930 W US 2004042930W WO 2005063252 A1 WO2005063252 A1 WO 2005063252A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- maf
- antagonist
- glaucoma
- purvalanol
- composition
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
- A61K31/52—Purines, e.g. adenine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/06—Antiglaucoma agents or miotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
Definitions
- CDK2 ANTAGONISTS AS SHORT FORM C-MAF TRANSCRIPTION FACTOR ANTAGONISTS FOR TREATMENT OF GLAUCOMA
- the present invention relates to the field of prophylactic agents and therapeutics for glaucoma, particularly for primary open angle glaucoma and steroid-induced glaucoma.
- the trabecular meshwork is a complex tissue including endothelial cells, connective tissue, and extracellular matrix located at the angle between the cornea and iris that provides the normal resistance required to maintain an intraocular pressure (IOP).
- IOP intraocular pressure
- An adequate intraocular pressure is needed to maintain the shape of the eye and to provide a pressure gradient to allow for the flow of aqueous humor to the avascular cornea and lens.
- Excessive IOP commonly present in glaucoma, has deleterious effects on the optic nerve, leads to loss of retinal ganglion cells and axons, and results in progressive visual loss and blindness if not treated. Glaucoma is one of the leading causes of blindness worldwide.
- POAG Primary open angle glaucoma
- IOP Intraocular pressure
- Certain drugs such as prednisone, dexamethasone, and hydrocortisone are known to induce glaucoma by increasing IOP. Further, the mode of administration appears to affect IOP. For example, ophthalmic administration of dexamethasone leads to greater increases in IOP than does systemic administration. Glaucoma that results from the administration of steroids is termed steroid-induced glaucoma.
- Ourent anti-glaucoma therapies include lowering IOP by the use of suppressants of aqueous humor formation or agents that enhance uveoscleral outflow, laser trabeculoplasty, or trabeculectomy which is a filtration surgery to improve drainage.
- Pharmaceutical anti-glaucoma approaches have exhibited various undesirable side effects. For example, miotics such as pilocarpine can cause blurring of vision and other negative visual side effects.
- Systemically administered carbonic anhydrase inhibitors can also cause nausea, dyspepsia, fatigue, and metabolic acidosis.
- certain beta-blockers have increasingly become associated with serious pulmonary side effects attributable to their effects on beta-2 receptors in pulmonary tissue.
- Glaucoma causes tachycardia, aixhythmia and hypertension. Such negative side effects may lead to decreased patient compliance or to termination of therapy.
- the current anti-glaucoma therapies do not directly address the pathological damage to the trabecular meshwork, the optic nerve, and loss of retinal ganglion cells and axons, which continues unabated.
- the present invention relates to a method of treatment for primary open angle glaucoma or steroid-induced glaucoma in a subject at risk for developing primary open angle glaucoma or steroid- induced glaucoma or having symptoms thereof.
- the method comprises administering to the subject an effective amount of a composition comprising an antagonist of short-form c-Maf transcription factor and an acceptable carrier.
- the short form version of c-Maf transcription factor has been identified as up-regulated in steroid-treated and transforming growth factor- ⁇ 2 (TGF ⁇ 2)-treated trabecular meshwork (TM) cells, as present at elevated levels in glaucomatous versus normal optic nerve head tissue, and as present at elevated levels in glaucomatous versus normal TM cells.
- TGF ⁇ 2 transforming growth factor- ⁇ 2
- TM trabecular meshwork
- the methods of the present invention involve antagonism of short form c-Maf transcription factor transcription, expression and/or activity in the trabecular meshwork or other ocular tissue, such as optic nerve head tissue, so as to inhibit or alleviate glaucoma pathogenesis.
- the antagonist of the present invention interferes with short-form c-Maf transcription factor transcription or expression.
- the antagonist of short-form c-Maf transcription factor comprises a purine analog having inhibitory activity for cdk2 cyclin-dependent kinase.
- the antagonist may comprise purvalanol A, purvalanol B, amino-purvalanol, olomoucine, N9-isopropylolomoucine, roscovitine, methoxy-roscovitine, combinations thereof, or salts thereof, for example.
- the antagonist having inhibitory activity for cdk2 cyclin- dependent kinase is non-purine based and is an indirubin, oxindole, indenopyrazole, pyridopyrimidine, anilinoquinazoline, aminothiazole, flavopiridol, staurosporine, paullone, hymenialdisine, combinations thereof and salts thereof, for example.
- QPCR analysis of short-form c-Maf expression in SGTM2697 pooled cells demonstrates TGF ⁇ 2-induced gene expression upregulated 16-fold as compared to the control.
- FIG. 2. QPCR analysis of short-form c-Maf expression in TM70A cells demonstrates dexamethasone-induced gene expression upregulated 2.1-fold on day one and 3.2-fold on day 14 as compared to the control.
- FIG. 3 QPCR analysis of short-form c-Maf expression in SGTM2697 (P6) cells in the presence and absence of purvalanolA for basal and TGF ⁇ 2-induced cells.
- the present invention relates to the use of agents to antagonize short form c-Maf transcription factor expression and/or activity for the treatment of glaucoma.
- Human genome microarrays were hybridized to normal and glaucomatous RNA and the short form c-Maf transcription factor gene was upregulated in the glaucoma cells as compared to the normal cells.
- c-Maf has been shown to activate crystallin gene expression, is activated by the glaucoma gene product Pax6 (Sakai, et al. (2001), Nucleic Acids Res 29(5): 1228-37; Yoshida, et al. (2001) Curr Eye Res 23(2): 116-9), and is positively autoregulated by its own gene product.
- Mice lacking c-Maf are microphthalmic with defective lens formation whereas heterozygous null mutants undergo relatively normal ocular development (Kim, e al. (1999), Proc Natl Acad Sci USA 96(7): 3781-5).
- c-Maf is a basic region leucine zipper (bZIP) transcription factor. Maf family members have ⁇ 40% homology in the basic domain of their bZIP motifs. Short, single-exon (373 amino acids) and long, two-exon (403 amino acids) forms of c-Maf exist, but their functional distinction remains unknown. The short form of c-Maf ends with a methionine at the C-terminus. The additional carboxy terminal amino acid sequence for the long form is ITEPTRKLEPSVGYATFWKPQHRVLTSVFTK, SEQ ID NO: 4.
- short-form c-Maf transcription factor means the gene that encodes short-form c- Maf transcription factor or the protein product of 373 amino acids of the protein sequence deposited under Gen Bank accession no. AF055376.
- U.S. Patent No. 6,274,338, to Glimcher et al discloses nucleic acid sequence and protein sequence information for human c-Maf, as well as antisense molecules and anti-cMaf antibodies.
- the sequence of the cMaf of U.S. 6,274,338 is located in GenPept as accession # AAE79064. This sequence matches the long-form c-Maf with the exception of several amino acid mismatches, including a 3 amino acid deletion at amino acids 241-243 when compared with the protein sequence contained in GenBank numbers AF055376 (short form sequence) and AF055377 (long form sequence).
- Antagonists of short form c-Maf transcription factor include agents that decrease transcription of the short form gene, inliibit short fonn expression, or inhibit short form activity, for example.
- Antagonists of short form c-Maf transcription factor include agents that decrease transcription of the short form gene, inliibit short fonn expression, or inhibit short form activity, for example.
- cdk2 cyclin- dependent kinase inhibitors particularly purine analogs, downregulate transcription of the short form c- Maf transcription factor.
- Table 1 provides a listing of antagonists of short fonn c-Maf transcription factor having inhibitory activity for cdk2.
- An assay for an antagonist of short-form c-Maf transcription factor comprises combining a candidate antagonist with the c-Maf transcription factor gene in a background that allows transcription and expression to occur. An amount of c-Maf transcription factor present or activity less than that in the absence of the candidate antagonist indicates that the candidate antagonist is, in fact, an antagonist of c- Maf.
- the antagonist may be delivered directly to the eye (for example: topical ocular drops or ointments; slow release devices in the cul-de-sac or implanted adjacent to the sclera or within the eye; periocular, conjunctival, sub-Tenons, intracameral, intravitreal, or intracanalicular injections) or systemically (for example: orally; intravenous, subcutaneous or intramuscular injections; parenterally, dermal delivery) using techniques well known by those skilled in the art. It is further contemplated that the antagonists of the invention may be formulated in intraocular insert or implant devices. Intracameral injection may be through the cornea into the anterior chamber to allow the agent to reach the trabecular meshwork. Intracanalicular injection may be into the venous collector channels draining Schlemm's canal or into Schlemm's canal.
- a subject treated for primary open angle glaucoma or for steroid-induced glaucoma as described herein may be a human or another animal at risk of developing primary open angle glaucoma or steroid-induced glaucoma or having symptoms of primary open angle glaucoma or steroid-induced glaucoma.
- the antagonists of the present invention can be administered as solutions, suspensions, or emulsions (dispersions) in a suitable ophthalmic carrier.
- suitable ophthalmic carrier emulsions embodied by this invention.
- the ophthalmic compositions are formulated to provide for an intraocular concentration of about 0.1-100 nanomolar (nM) or, in a further embodiment, 1-10 nM of the antagonist.
- Topical compositions are delivered to the surface of the eye one to four times per day according to the routine discretion of a skilled clinician.
- the pH of the formulation should be 4-9, or 4.5 to 7.4.
- Systemic formulations may contain about 10 to 1000 mg of the antagonist.
- An "effective amount" refers to that amount of c-Maf antagonist that is able to disrupt short form c-Maf expression or activity.
- Such disruption leads to lowered intraocular pressure, and lessening of symptoms of glaucoma in a subject exhibiting symptoms of primary open angle glaucoma or steroid- induced glaucoma.
- Such disruption delays or prevents the onset of symptoms in a subject at risk for developing glaucoma.
- the effective amount of a formulation may depend on factors such as the age, race, and sex of the subject, or the severity of the glaucoma, for example.
- the antagonist is delivered topically to the eye and reaches the trabecular meshwork, retina or optic nerve head at a therapeutic dose thereby ameliorating the glaucoma disease process.
- the resulting solution or solutions are preferably administered by placing one drop of each solution(s) in each eye one to four times a day, or as directed by the clinician.
- An ophthalmically acceptable carrier refers to those carriers that cause at most, little to no ocular irritation, provide suitable preservation if needed, and deliver one or more c-Maf antagonists of the present invention in a homogenous dosage.
- a c-Maf transcription inhibitor may be combined with ophthalmologically acceptable preservatives, co-solvents, surfactants, viscosity enhancers, penetration enhancers, buffers, sodium chloride, or water to form an aqueous, sterile ophthalmic suspension or solution.
- Ophthalmic solution formulations may be prepared by dissolving the inhibitor in a physiologically acceptable isotonic aqueous buffer.
- the ophthalmic solution may include an ophthalmologically acceptable surfactant to assist in dissolving the inhibitor.
- Viscosity building agents such as hydroxymethyl cellulose, hydroxyethyl cellulose, methylcellulose, polyvinylpyrrolidone, or the like, may be added to the compositions of the present invention to improve the retention of the compound.
- the c-Maf antagonist is combined with a preservative in an appropriate vehicle, such as mineral oil, liquid lanolin, or white petrolatum.
- an appropriate vehicle such as mineral oil, liquid lanolin, or white petrolatum.
- Sterile ophthalmic gel formulations may be prepared by suspending the c-Maf antagonist in a hydrophilic base prepared from the combination of, for example, CARBOPOL ® -940 (BF Goodrich, Charlotte, NC), or the like, according to methods known in the art for other ophthalmic formulations.
- VISCOAT ® Alcon Laboratories, Inc., Fort Worth, TX
- intraocular injection for example.
- compositions of the present invention may contain penetration enhancing agents such as cremephor and TWEEN ® 80 (polyoxyethylene sorbitan monolaureate, Sigma Aldrich, St. Louis, MO), in the event the c-Maf antagonists are less penetrating in the eye.
- penetration enhancing agents such as cremephor and TWEEN ® 80 (polyoxyethylene sorbitan monolaureate, Sigma Aldrich, St. Louis, MO), in the event the c-Maf antagonists are less penetrating in the eye.
- TM cells Human trabecular meshwork (TM) cells were derived from donor eyes (Central Florida Lions).
- TM cells were derived from pools of four each of either nonnal or glaucoma cell lines. Total RNA was isolated from TM cells from each pool using TRIZOL ® reagent according to the manufacturer's instructions (Invitrogen, Carlsbad, CA).
- GENECHIPS ® (Affymetrix, Santa Clara, CA) were hybridized, washed and scanned according to standard Affymetrix protocols. Hybridized GENECHIP ® arrays were scanned with a GENEARRAY ® scanner (Agilent Technologies, Palo Alto, CA). Raw data were collected and analyzed using Affymetrix
- First strand cDNA was generated from l ⁇ g of total RNA using random hexamers and
- the 100 ⁇ l reaction was subsequently diluted 20-fold to achieve an effective cDNA concentration of 0.5 ng/ ⁇ l.
- RT-PCR (QPCR) using an ABI PRISM ® 7700 Sequence Detection System (Applied Biosystems) essentially as described Shepard, et al. (2001) Invest Ophthalmol Vis Sci 42(13): 3173-81.
- Primers for short form-specific c-Maf amplification (Genbank accession #AF055376) were designed using PRIMER
- GCGTTCTAAACAGTTTTGCAATTTT SEQ ID NO:2
- the minor groove binding probe sequence was CTGCAAGCATATAATACA, SEQ ID NO:3, (nucleotides 3801-3818).
- 6FAM was bound to the 5' end of the minor groove binding probe and refers to the type of fluorophore attached to the TAQMAN ® probe.
- Other choices for the fluorophore are the JOE TM Fluorophore (Applied
- Quencher was bound to the 3' end of the probe and is used to quench the fluorescence from 6FAM.
- the present example demonstrates that the short form of c-Maf was differentially upregulated in transfonning growth factor beta 2-induced glaucomatous cells using quantitative PCR analysis.
- SGTM2697 The glaucomatous cells were treated for 16 hours with 5ng ml transfonning growth factor beta 2 (TGF ⁇ 2) for induction of gene expression.
- TGF ⁇ 2 transfonning growth factor beta 2
- Gene expression of the short form of c-Maf was identified as upregulated. Verification of c-Maf upregulation was performed by QPCR as described in
- Example 3 using cDNA derived from the pooled ⁇ TGF ⁇ 2-treated SGTM2697 cell RNA used for the
- the present example demonstrates that the short fo ⁇ n of c-Maf was differentially upregulated in dexamethasone-induced glaumomatous cells using quantitative PCR analysis.
- Short form c-Maf gene expression was analyzed using the Affymetrix U133A GENECHIP ® analysis described in Example 2 for trabecular meshwork cells designated TM70A. The cells were treated 1 day or 14 days with 10 "7 M dexamethasone (Dex). Gene expression of the short form of c-Maf was identified as upregulated. Verification of c-Maf upregulation was performed by QPCR as described in Example 3 using cDNA derived from the ⁇ Dex-treated TM70A cell RNA used for the Affymetrix GENECHIP ® analysis. Short form c-Maf was upregulated 2.1 -fold at day one and 3.2-fold by day 14 of
- a cdk2 inhibitor is an antagonist of short-form c-Maf gene expression.
- FIG. 3 Data of FIG. 3 are presented as the normalized ratio of c-Maf to ribosomal 18S mRNA levels
- the y-axis of FIG. 3 has a lower scale from 0.00 to 0.03 and an upper scale from
- the present invention provides further cyclin-dependent kinase 2 inhibitors as described herein for use as antagonists of expression of the short form of c-Maf.
- Such antagonists are useful as prophylactic or therapeutic agents to protect from or treat damage caused by the glaucoma disease process.
- Example 7 Short Form c-Maf Transcription Factor in Glaucomatous Optic Nerve Head Tissue
- the short form version of c-Maf transcription factor is present at elevated levels in glaucomatous versus normal optic nerve head tissue using the Affymetrix GENECHIP ® microarray analysis.
- Optic nerve head tissue was derived from pools of either four normal or five glaucomatous donor eyes.
- Total RNA was isolated from optic nerve head tissue using TRIZOL ® reagent according to the manufacture's instructions (Invitrogen).
- Expression of short form c-Maf in these conditions further indicates a causal or effector role on the part of the factor in glaucoma pathogenesis.
- Antagonism of short fo ⁇ n c-Maf transcription factor expression and or activity within ocular tissue is provided for inhibiting or alleviating glaucoma pathogenesis and for providing neuroprotection for the retina and optic nerve.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- General Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Ophthalmology & Optometry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA002548035A CA2548035A1 (en) | 2003-12-22 | 2004-12-21 | Cdk2 antagonists as short form c-maf transcription factor antagonists for treatment of glaucoma |
| JP2006545577A JP2007515426A (ja) | 2003-12-22 | 2004-12-21 | 緑内障の処置のための短い形態のc−Maf転写因子アンタゴニストとしてのcdk2アンタゴニスト |
| AU2004308938A AU2004308938B2 (en) | 2003-12-22 | 2004-12-21 | CDK2 antagonists as short form c-Maf transcription factor antagonists for treatment of glaucoma |
| EP04815051A EP1696928A1 (en) | 2003-12-22 | 2004-12-21 | Cdk2 antagonists as short form c-maf transcription factor antagonists for treatment of glaucoma |
| MXPA06007062A MXPA06007062A (es) | 2003-12-22 | 2004-12-21 | Antagonistas cdk2 como antagonistas del factor de transcripcion c-maf de forma corta para el tratamiento de glaucoma. |
| BRPI0418033-0A BRPI0418033A (pt) | 2003-12-22 | 2004-12-21 | antagonistas de cdk-2 como antagonistas da forma curta do fator de transcrição c-maf para o tratamento de glaucoma |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US53180103P | 2003-12-22 | 2003-12-22 | |
| US60/531,801 | 2003-12-22 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2005063252A1 true WO2005063252A1 (en) | 2005-07-14 |
Family
ID=34738702
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2004/042930 Ceased WO2005063252A1 (en) | 2003-12-22 | 2004-12-21 | Cdk2 antagonists as short form c-maf transcription factor antagonists for treatment of glaucoma |
Country Status (15)
| Country | Link |
|---|---|
| US (1) | US20050159432A1 (https=) |
| EP (1) | EP1696928A1 (https=) |
| JP (1) | JP2007515426A (https=) |
| KR (1) | KR20060110301A (https=) |
| CN (1) | CN1886138A (https=) |
| AR (1) | AR046728A1 (https=) |
| AU (1) | AU2004308938B2 (https=) |
| BR (1) | BRPI0418033A (https=) |
| CA (1) | CA2548035A1 (https=) |
| MX (1) | MXPA06007062A (https=) |
| RU (1) | RU2370267C2 (https=) |
| TW (1) | TW200526224A (https=) |
| UY (1) | UY28660A1 (https=) |
| WO (1) | WO2005063252A1 (https=) |
| ZA (1) | ZA200604576B (https=) |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008079980A1 (en) * | 2006-12-22 | 2008-07-03 | Alcon Research, Ltd. | Inhibitors of protein kinase c-delta for the treatment of glaucoma |
| WO2012045905A2 (es) | 2010-10-06 | 2012-04-12 | Fundació Privada Institut De Recerca Biomèdica | Método para el diagnóstico, pronóstico y tratamiento de la metástasis de cáncer de mama |
| WO2013153458A2 (en) | 2012-04-09 | 2013-10-17 | Inbiomotion S.L. | Method for the prognosis and treatment of cancer metastasis |
| WO2013182912A2 (en) | 2012-06-06 | 2013-12-12 | Fundacio Privada Institut De Recerca Biomedica | Method for the diagnosis, prognosis and treatment of lung cancer metastasis |
| WO2014140933A2 (en) | 2013-03-15 | 2014-09-18 | Fundacio Privada Institut De Recerca Biomedica | Method for the prognosis and treatment of cancer metastasis |
| WO2014184679A2 (en) | 2013-03-15 | 2014-11-20 | Inbiomotion S.L. | Method for the prognosis and treatment of renal cell carcinoma metastasis |
| WO2015052583A2 (en) | 2013-10-09 | 2015-04-16 | Fundacio Institut De Recerca Biomedica (Irb Barcelona) | Method for the prognosis and treatment of cancer metastasis |
| EP3272880A2 (en) | 2013-03-15 | 2018-01-24 | Fundació Institut de Recerca Biomèdica IRB (Barcelona) | Method for the diagnosis, prognosis and treatment of metastatic cancer |
| US10114022B2 (en) | 2012-10-12 | 2018-10-30 | Inbiomotion S.L. | Method for the diagnosis, prognosis and treatment of prostate cancer metastasis |
| US10119171B2 (en) | 2012-10-12 | 2018-11-06 | Inbiomotion S.L. | Method for the diagnosis, prognosis and treatment of prostate cancer metastasis |
| US11596642B2 (en) | 2016-05-25 | 2023-03-07 | Inbiomotion S.L. | Therapeutic treatment of breast cancer based on c-MAF status |
| US11654153B2 (en) | 2017-11-22 | 2023-05-23 | Inbiomotion S.L. | Therapeutic treatment of breast cancer based on c-MAF status |
Families Citing this family (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2548146A1 (en) * | 2003-12-22 | 2005-07-14 | Alcon, Inc. | Agents for treatment of diabetic retinopathy and drusen formation in macular degeneration |
| MXPA06006980A (es) * | 2003-12-22 | 2006-12-14 | Alcon Inc | Agentes para tratamiento de retinopatia glaucomatosa y neuropatia optica. |
| US20050222127A1 (en) * | 2004-03-30 | 2005-10-06 | Alcon, Inc. | Use of Rho kinase inhibitors in the treatment of hearing loss, tinnitus and improving body balance |
| US20060115870A1 (en) * | 2004-03-30 | 2006-06-01 | Alcon, Inc. | High throughput assay for human Rho kinase activity |
| US20080096238A1 (en) * | 2004-03-30 | 2008-04-24 | Alcon, Inc. | High throughput assay for human rho kinase activity with enhanced signal-to-noise ratio |
| DK2444807T3 (da) * | 2006-11-01 | 2014-08-11 | Ventana Med Syst Inc | Mono- og dinitropyrazolhaptenkonjugater |
| US7682789B2 (en) * | 2007-05-04 | 2010-03-23 | Ventana Medical Systems, Inc. | Method for quantifying biomolecules conjugated to a nanoparticle |
| EP2167963B1 (en) | 2007-05-23 | 2019-04-17 | Ventana Medical Systems, Inc. | Polymeric carriers for immunohistochemistry and in situ hybridization |
| WO2009149013A2 (en) | 2008-06-05 | 2009-12-10 | Ventana Medical Systems, Inc. | Compositions comprising nanomaterials and method for using such compositions for histochemical processes |
| USPP22463P3 (en) * | 2010-02-16 | 2012-01-17 | Menachem Bornstein | Gypsophila plant named ‘Pearl Blossom’ |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1997030701A2 (en) * | 1996-02-21 | 1997-08-28 | Wisconsin Alumni Research Foundation | Pharmaceutical compositions for the treatment of glaucoma |
| WO1999007705A1 (en) * | 1997-08-07 | 1999-02-18 | The Regents Of The University Of California | Purine inhibitor of protein kinases, g proteins and polymerases |
| WO2002012250A2 (en) * | 2000-08-09 | 2002-02-14 | Agouron Pharmaceuticals, Inc. | Pyrazole-thiazole compounds, pharmaceutical compositions containing them, and methods of their use for inhibiting cyclin-dependent kinases |
| WO2003027275A1 (en) * | 2001-09-27 | 2003-04-03 | Alcon, Inc. | Inhibitors of glycogen synthase kinase-3 (gsk-3) for treating glaucoma |
| US20030083346A1 (en) * | 2001-08-31 | 2003-05-01 | May Jesse A. | Hydroxy substituted fused naphthyl-azoles and fused indeno-azoles and their use for the treatment of glaucoma |
| WO2003092584A2 (en) * | 2002-04-30 | 2003-11-13 | Alcon, Inc. | Agents which regulate, inhibit, or modulate the activity and/or expression of connective tissue growth factor (ctgf) as a unique means to both lower intraocular pressure and treat glaucomatous retinopathies/optic neuropathies |
| WO2004022529A2 (en) * | 2002-09-05 | 2004-03-18 | Neurosearch A/S | Diarylurea derivatives and their use as chloride channel blockers |
Family Cites Families (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4456757A (en) * | 1981-03-20 | 1984-06-26 | Asahi Kasei Kogyo Kabushiki Kaisha | Isoquinolinesulfonyl derivatives and process for the preparation thereof |
| US4678783B1 (en) * | 1983-11-04 | 1995-04-04 | Asahi Chemical Ind | Substituted isoquinolinesulfonyl compounds |
| US4959389A (en) * | 1987-10-19 | 1990-09-25 | Speiser Peter P | Pharmaceutical preparation for the treatment of psoriatic arthritis |
| US5124154A (en) * | 1990-06-12 | 1992-06-23 | Insite Vision Incorporated | Aminosteroids for ophthalmic use |
| JP3193301B2 (ja) * | 1995-09-14 | 2001-07-30 | 麒麟麦酒株式会社 | 生理活性タンパク質p160 |
| US5906819A (en) * | 1995-11-20 | 1999-05-25 | Kirin Beer Kabushiki Kaisha | Rho target protein Rho-kinase |
| US5681854A (en) * | 1995-11-22 | 1997-10-28 | Alcon Laboratories, Inc. | Use of aliphatic carboxylic acid derivatives in ophthalmic disorders |
| ATE289815T1 (de) * | 1995-12-21 | 2005-03-15 | Alcon Lab Inc | Verwendung von substituierten isochinolinsulfonyl-verbindungen zur herstellung eines medikaments für die behandlung von glaukom und okularer ischämie |
| ES2205166T3 (es) * | 1996-02-02 | 2004-05-01 | D. Western Therapeutics Institute | Derivados de isoquinolina y medicamento. |
| US6586425B2 (en) * | 1996-02-21 | 2003-07-01 | Wisconsin Alumni Research Foundation | Cytoskeletal active agents for glaucoma therapy |
| BR9711154A (pt) * | 1996-08-12 | 1999-08-17 | Yoshitomi Pharmaceutical | Agente farmac-utico contendo inibidor cinase rho |
| US5759787A (en) * | 1996-08-26 | 1998-06-02 | Tularik Inc. | Kinase assay |
| US6573044B1 (en) * | 1997-08-07 | 2003-06-03 | The Regents Of The University Of California | Methods of using chemical libraries to search for new kinase inhibitors |
| US6441033B1 (en) * | 1997-12-22 | 2002-08-27 | Alcon Manufacturing, Ltd. | 11β-fluoro 15β-hydroxy PGF2α analogs as FP receptor antagonists |
| US6274338B1 (en) * | 1998-02-24 | 2001-08-14 | President And Fellows Of Harvard College | Human c-Maf compositions and methods of use thereof |
| GB9806739D0 (en) * | 1998-03-28 | 1998-05-27 | Univ Newcastle Ventures Ltd | Cyclin dependent kinase inhibitors |
| US20010041174A1 (en) * | 1998-11-24 | 2001-11-15 | Najam Sharif | Use of implanted encapsulated cells expressing glutamate transporter proteins for the treatment of neurodegenerative diseases |
| BR9916327A (pt) * | 1998-12-17 | 2001-09-18 | Hoffmann La Roche | Oxindóis de 4-alquenila (e alquinila) como inibidores de cinases dependentes de ciclina, em particular, cdk2 |
| US6020383A (en) * | 1999-01-11 | 2000-02-01 | Eastman Chemicals Company | Method for reducing blood cholesterol and/or blood triglycerides |
| US6103756A (en) * | 1999-08-11 | 2000-08-15 | Vitacost Inc. | Ocular orally ingested composition for prevention and treatment of individuals |
| US6573299B1 (en) * | 1999-09-20 | 2003-06-03 | Advanced Medical Instruments | Method and compositions for treatment of the aging eye |
| WO2002002190A2 (en) * | 2000-07-05 | 2002-01-10 | Johns Hopkins School Of Medicine | Prevention and treatment of neurodegenerative diseases by glutathione and phase ii detoxification enzymes |
| GB0030727D0 (en) * | 2000-12-15 | 2001-01-31 | Lumitech Uk Ltd | Methods and kits for detecting kinase activity |
| US6756063B2 (en) * | 2001-03-29 | 2004-06-29 | Zoltan Laboratories, Llc | Methods and compositions for the treatment of human and animal cancers |
| US20030219846A1 (en) * | 2002-02-28 | 2003-11-27 | Pfizer Inc. | Assay for activity of the ActRIIB kinase |
| US7196090B2 (en) * | 2002-07-25 | 2007-03-27 | Warner-Lambert Company | Kinase inhibitors |
| US6747025B1 (en) * | 2002-11-27 | 2004-06-08 | Allergan, Inc. | Kinase inhibitors for the treatment of disease |
-
2004
- 2004-11-15 TW TW093134904A patent/TW200526224A/zh unknown
- 2004-11-26 AR ARP040104413A patent/AR046728A1/es not_active Application Discontinuation
- 2004-12-08 UY UY28660A patent/UY28660A1/es not_active Application Discontinuation
- 2004-12-21 US US11/018,283 patent/US20050159432A1/en not_active Abandoned
- 2004-12-21 CN CNA200480035441XA patent/CN1886138A/zh active Pending
- 2004-12-21 AU AU2004308938A patent/AU2004308938B2/en not_active Ceased
- 2004-12-21 WO PCT/US2004/042930 patent/WO2005063252A1/en not_active Ceased
- 2004-12-21 EP EP04815051A patent/EP1696928A1/en not_active Withdrawn
- 2004-12-21 CA CA002548035A patent/CA2548035A1/en not_active Abandoned
- 2004-12-21 JP JP2006545577A patent/JP2007515426A/ja active Pending
- 2004-12-21 KR KR1020067010098A patent/KR20060110301A/ko not_active Ceased
- 2004-12-21 RU RU2006126638/14A patent/RU2370267C2/ru not_active IP Right Cessation
- 2004-12-21 ZA ZA200604576A patent/ZA200604576B/en unknown
- 2004-12-21 BR BRPI0418033-0A patent/BRPI0418033A/pt not_active IP Right Cessation
- 2004-12-21 MX MXPA06007062A patent/MXPA06007062A/es not_active Application Discontinuation
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1997030701A2 (en) * | 1996-02-21 | 1997-08-28 | Wisconsin Alumni Research Foundation | Pharmaceutical compositions for the treatment of glaucoma |
| WO1999007705A1 (en) * | 1997-08-07 | 1999-02-18 | The Regents Of The University Of California | Purine inhibitor of protein kinases, g proteins and polymerases |
| WO2002012250A2 (en) * | 2000-08-09 | 2002-02-14 | Agouron Pharmaceuticals, Inc. | Pyrazole-thiazole compounds, pharmaceutical compositions containing them, and methods of their use for inhibiting cyclin-dependent kinases |
| US20030083346A1 (en) * | 2001-08-31 | 2003-05-01 | May Jesse A. | Hydroxy substituted fused naphthyl-azoles and fused indeno-azoles and their use for the treatment of glaucoma |
| WO2003027275A1 (en) * | 2001-09-27 | 2003-04-03 | Alcon, Inc. | Inhibitors of glycogen synthase kinase-3 (gsk-3) for treating glaucoma |
| WO2003092584A2 (en) * | 2002-04-30 | 2003-11-13 | Alcon, Inc. | Agents which regulate, inhibit, or modulate the activity and/or expression of connective tissue growth factor (ctgf) as a unique means to both lower intraocular pressure and treat glaucomatous retinopathies/optic neuropathies |
| WO2004022529A2 (en) * | 2002-09-05 | 2004-03-18 | Neurosearch A/S | Diarylurea derivatives and their use as chloride channel blockers |
Non-Patent Citations (1)
| Title |
|---|
| CLARK A F ET AL: "OPHTHALMIC DRUG DISCOVERY", NATURE REVIEWS. DRUG DISCOVERY, NATURE PUBLISHING GROUP, BASINGSTOKE, GB, vol. 2, no. 6, June 2003 (2003-06-01), pages 448 - 459, XP009040722, ISSN: 1474-1784 * |
Cited By (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008079980A1 (en) * | 2006-12-22 | 2008-07-03 | Alcon Research, Ltd. | Inhibitors of protein kinase c-delta for the treatment of glaucoma |
| US11072831B2 (en) | 2010-10-06 | 2021-07-27 | Fundació Institut De Recerca Biomèdica (Irb Barcelona) | Method for the diagnosis, prognosis and treatment of breast cancer metastasis |
| US10047398B2 (en) | 2010-10-06 | 2018-08-14 | Fundacio Institut De Recerca Biomedica (Irb Barcelona) | Method for the diagnosis, prognosis and treatment of breast cancer metastasis |
| US12312642B2 (en) | 2010-10-06 | 2025-05-27 | Fundacio Institut De Recerca Biomedica (Irb Barcelona) | Method for the diagnosis, prognosis and treatment of breast cancer metastasis |
| WO2012045905A2 (es) | 2010-10-06 | 2012-04-12 | Fundació Privada Institut De Recerca Biomèdica | Método para el diagnóstico, pronóstico y tratamiento de la metástasis de cáncer de mama |
| EP3517630A1 (en) | 2010-10-06 | 2019-07-31 | Institució Catalana de Recerca i Estudis Avançats | Method for the diagnosis, prognosis and treatment of breast cancer metastasis |
| US10866241B2 (en) | 2012-04-09 | 2020-12-15 | Institucio Catalana De Recerca I Estudis Avancats | Method for the prognosis and treatment of cancer metastasis |
| WO2013153458A2 (en) | 2012-04-09 | 2013-10-17 | Inbiomotion S.L. | Method for the prognosis and treatment of cancer metastasis |
| US12196758B2 (en) | 2012-04-09 | 2025-01-14 | FUNDACIO INSTITUT DE RECERCA BIOMEDICA (IRB BARCELONA) and INSTITUCIO CATALANA DE RECERCA I ESTUDIS AVANCATS | Method for the prognosis and treatment of cancer metastasis |
| US9702878B2 (en) | 2012-04-09 | 2017-07-11 | Fundació Institut de Recera Biomèdica (IRB Barcelona) | Method for the prognosis and treatment of cancer metastasis |
| EP3825692A1 (en) | 2012-04-09 | 2021-05-26 | Fundació Institut de Recerca Biomèdica (IRB Barcelona) | Method for the prognosis and treatment of cancer metastasis |
| WO2013182912A2 (en) | 2012-06-06 | 2013-12-12 | Fundacio Privada Institut De Recerca Biomedica | Method for the diagnosis, prognosis and treatment of lung cancer metastasis |
| US10006091B2 (en) | 2012-06-06 | 2018-06-26 | Fundació Institut De Recerca Biomèdica (Irb Barcelona) | Method for the diagnosis, prognosis and treatment of lung cancer metastasis |
| US11352673B2 (en) | 2012-06-06 | 2022-06-07 | Fundacio Institut De Recerca Biomedica (Irb Barcelona) | Method for the diagnosis, prognosis and treatment of lung cancer metastasis |
| EP3467124A1 (en) | 2012-06-06 | 2019-04-10 | Fundació Institut de Recerca Biomèdica IRB (Barcelona) | Method for the diagnosis, prognosis and treatment of lung cancer metastasis |
| US11041861B2 (en) | 2012-10-12 | 2021-06-22 | Inbiomotion S.L. | Method for the diagnosis, prognosis and treatment of prostate cancer metastasis |
| US10114022B2 (en) | 2012-10-12 | 2018-10-30 | Inbiomotion S.L. | Method for the diagnosis, prognosis and treatment of prostate cancer metastasis |
| US11892453B2 (en) | 2012-10-12 | 2024-02-06 | Inbiomotion S.L. | Method for the diagnosis, prognosis and treatment of prostate cancer metastasis |
| US11840740B2 (en) | 2012-10-12 | 2023-12-12 | Inbiomotion S.L. | Method for the diagnosis, prognosis and treatment of prostate cancer metastasis |
| US10119171B2 (en) | 2012-10-12 | 2018-11-06 | Inbiomotion S.L. | Method for the diagnosis, prognosis and treatment of prostate cancer metastasis |
| US11041213B2 (en) | 2012-10-12 | 2021-06-22 | Inbiomotion S.L. | Method for the diagnosis, prognosis and treatment of prostate cancer metastasis |
| EP3553186A1 (en) | 2012-10-12 | 2019-10-16 | Inbiomotion S.L. | Method for the diagnosis, prognosis and treatment of prostate cancer metastasis |
| WO2014140933A2 (en) | 2013-03-15 | 2014-09-18 | Fundacio Privada Institut De Recerca Biomedica | Method for the prognosis and treatment of cancer metastasis |
| WO2014184679A2 (en) | 2013-03-15 | 2014-11-20 | Inbiomotion S.L. | Method for the prognosis and treatment of renal cell carcinoma metastasis |
| US11591599B2 (en) | 2013-03-15 | 2023-02-28 | Fundació Institut De Recerca Biomèdica (Irb Barcelona) | Method for the diagnosis, prognosis and treatment of cancer metastasis |
| EP3272880A2 (en) | 2013-03-15 | 2018-01-24 | Fundació Institut de Recerca Biomèdica IRB (Barcelona) | Method for the diagnosis, prognosis and treatment of metastatic cancer |
| EP3524698A1 (en) | 2013-10-09 | 2019-08-14 | Fundació Institut de Recerca Biomèdica IRB (Barcelona) | Method for the prognosis and treatment of cancer metastasis |
| WO2015052583A2 (en) | 2013-10-09 | 2015-04-16 | Fundacio Institut De Recerca Biomedica (Irb Barcelona) | Method for the prognosis and treatment of cancer metastasis |
| US11596642B2 (en) | 2016-05-25 | 2023-03-07 | Inbiomotion S.L. | Therapeutic treatment of breast cancer based on c-MAF status |
| US11654153B2 (en) | 2017-11-22 | 2023-05-23 | Inbiomotion S.L. | Therapeutic treatment of breast cancer based on c-MAF status |
| US12233077B2 (en) | 2017-11-22 | 2025-02-25 | Inbiomotion S.L. | Therapeutic treatment of breast cancer based on c-MAF status |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2004308938B2 (en) | 2011-06-23 |
| ZA200604576B (en) | 2007-11-28 |
| JP2007515426A (ja) | 2007-06-14 |
| RU2006126638A (ru) | 2008-01-27 |
| RU2370267C2 (ru) | 2009-10-20 |
| UY28660A1 (es) | 2005-07-29 |
| EP1696928A1 (en) | 2006-09-06 |
| TW200526224A (en) | 2005-08-16 |
| CA2548035A1 (en) | 2005-07-14 |
| AR046728A1 (es) | 2005-12-21 |
| MXPA06007062A (es) | 2006-09-04 |
| AU2004308938A1 (en) | 2005-07-14 |
| KR20060110301A (ko) | 2006-10-24 |
| BRPI0418033A (pt) | 2007-04-17 |
| US20050159432A1 (en) | 2005-07-21 |
| CN1886138A (zh) | 2006-12-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2004308938B2 (en) | CDK2 antagonists as short form c-Maf transcription factor antagonists for treatment of glaucoma | |
| AU2008264214B2 (en) | Agents which regulate, inhibit, or modulate the activity and/or expression of connective tissue growth factor (CTGF) as a unique means to both lower intraocular pressure and treat glaucomatous retinopathies/optic neuropathies | |
| US20040213782A1 (en) | Compositions of an aquaporin modulating agent and an aqueous humor modulating agent for the treatment of elevated intraocular pressure | |
| US20080025973A1 (en) | Antagonists of endothelial differentiation gene subfamily 3 (edg-3, s1p3) receptors for prevention and treatment of ocular disorders | |
| JP2010513563A (ja) | 緑内障の診断および治療ならびに抗緑内障剤の同定のための血清アミロイドa遺伝子の使用 | |
| KR20080087814A (ko) | 보체 인자 h의 위험 변이체가 있는 환자에서 연령 관련황반변성의 예방 및 치료를 위한 c3-전환효소 저해제 | |
| EP1925306A2 (en) | Agents which Regulate, Inhibit, or Modulate the Activity and/or Expression of Connective Tissue Growth Factor (CTGF) to Lower Intraocular Pressure | |
| Szabó et al. | The variant N363S of glucocorticoid receptor in steroid-induced ocular hypertension in Hungarian patients treated with photorefractive keratectomy | |
| Mokbel et al. | Rho-Kinase Inhibitors as a novel medication for Glaucoma Treatment–A Review of the literature | |
| US20060275797A1 (en) | Use of agents which inhibit connective tissue growth factor (CTGF) binding and signaling via the TrkA/p75NTR receptor complex for the prevention and treatment of CTGF-mediated ocular disorders | |
| WO2004047868A1 (ja) | Limキナーゼ阻害作用を有する化合物を有効成分とする緑内障治療剤 | |
| KR20080111092A (ko) | 고안압증 조절 및 녹내장의 치료를 위한 프레닐트랜스퍼라아제 억제제 | |
| HK1142832A (en) | Cdk inhibitors for lowering intraocular pressure | |
| JP2004189735A (ja) | Limキナーゼ阻害作用を有する化合物を有効成分とする緑内障治療剤 | |
| HK1120423A (en) | Agents which regulate, inhibit, or modulate the activity and/or expression of connective tissue growth factor (ctgf) to lower intraocular pressure | |
| HK1091714A (en) | Gsk-3 inhibitors and cdk inhibitors as anti-glaucoma agents | |
| HK1169022A (en) | P38 mapk inhibitors for use in treating ocular hypertension | |
| HK1169022B (en) | P38 mapk inhibitors for use in treating ocular hypertension |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200480035441.X Country of ref document: CN |
|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2004815051 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006545577 Country of ref document: JP |
|
| DPEN | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed from 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2548035 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020067010098 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2004308938 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006/04576 Country of ref document: ZA Ref document number: 200604576 Country of ref document: ZA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2006/007062 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12006501241 Country of ref document: PH |
|
| ENP | Entry into the national phase |
Ref document number: 2004308938 Country of ref document: AU Date of ref document: 20041221 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004308938 Country of ref document: AU |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 4210/DELNP/2006 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006126638 Country of ref document: RU |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004815051 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020067010098 Country of ref document: KR |
|
| ENP | Entry into the national phase |
Ref document number: PI0418033 Country of ref document: BR |