WO2004073653A2 - Methods for treating pain by administering a nerve growth factor antagonist and an nsaid and compositions containing the same - Google Patents

Methods for treating pain by administering a nerve growth factor antagonist and an nsaid and compositions containing the same Download PDF

Info

Publication number
WO2004073653A2
WO2004073653A2 PCT/US2004/005162 US2004005162W WO2004073653A2 WO 2004073653 A2 WO2004073653 A2 WO 2004073653A2 US 2004005162 W US2004005162 W US 2004005162W WO 2004073653 A2 WO2004073653 A2 WO 2004073653A2
Authority
WO
WIPO (PCT)
Prior art keywords
ngf
antibody
pain
nsaid
antagonist
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2004/005162
Other languages
English (en)
French (fr)
Other versions
WO2004073653A8 (en
WO2004073653A3 (en
Inventor
David L. Shelton
German J. Vergara
Carole M. Loo
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Rinat Neuroscience Corp
Original Assignee
Rinat Neuroscience Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to UAA200508778A priority Critical patent/UA81299C2/uk
Priority to NZ541750A priority patent/NZ541750A/en
Priority to HR20050721A priority patent/HRP20050721A2/xx
Priority to PL379983A priority patent/PL379983A1/pl
Priority to DE602004030535T priority patent/DE602004030535D1/de
Priority to BR0407375-4A priority patent/BRPI0407375A/pt
Priority to EP04712940A priority patent/EP1594441B1/en
Priority to AU2004213044A priority patent/AU2004213044A1/en
Priority to JP2006503765A priority patent/JP2006525960A/ja
Priority to AT04712940T priority patent/ATE491444T1/de
Priority to MXPA05008815A priority patent/MXPA05008815A/es
Priority to EA200501319A priority patent/EA010159B1/ru
Application filed by Rinat Neuroscience Corp filed Critical Rinat Neuroscience Corp
Priority to CA002516454A priority patent/CA2516454A1/en
Publication of WO2004073653A2 publication Critical patent/WO2004073653A2/en
Publication of WO2004073653A8 publication Critical patent/WO2004073653A8/en
Anticipated expiration legal-status Critical
Priority to NO20054292A priority patent/NO20054292L/no
Publication of WO2004073653A3 publication Critical patent/WO2004073653A3/en
Ceased legal-status Critical Current

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
    • A61K31/19—Carboxylic acids, e.g. valproic acid
    • A61K31/192—Carboxylic acids, e.g. valproic acid having aromatic groups, e.g. sulindac, 2-aryl-propionic acids, ethacrynic acid 
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/02—Drugs for disorders of the nervous system for peripheral neuropathies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/04—Centrally acting analgesics, e.g. opioids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • This invention relates to methods and compositions for preventing or heating pain in a patient by administering a combination of a nerve growth factor antagonist and an NSAID.
  • NSAIDs non-steroidal anti- inflammatory drugs
  • the administration of NSAIDs has been shown to display pain alleviating properties.
  • treatment with NSAIDs has known disadvantages 5 including unwanted side effects such as irritation of the gastrointestinal tract and kidney and liver toxicity.
  • NSAIDs cannot achieve adequate pain alleviation even at their maximum therapeutically approved doses in some pain states.
  • Nerve growth factor was the first neurotrophin identified, and its role in the development and survival of both peripheral and central neurons has been well characterized. NGF has been shown to be a critical survival and maintenance factor in the development of peripheral sympathetic and embryonic sensory neurons and of basal forebrain cholinergic neurons (Smeyne, et al, Nature 368:246-249 (1994); Crowley, et al, Cell 76:1001-1011 (1994)).
  • NGF upregulates expression of neuropeptides in sensory neurons (Lindsay, et al, Nature 337:362-364 (1989)) and its activity is mediated through two different membrane-bound receptors, the TrkA tyrosine kinase receptor and the p75 receptor, which is structurally related to other members of the tumor necrosis factor receptor family (Chao, et al, Science 232:518-521 (1986)).
  • NGF has been increasingly implicated in processes outside of the nervous system.
  • exogenously administered NGF has been shown to enhance vascular permeability (Often, et al, Eur. J. Pharmacol. 106:199-201 (1984)), enhance T- and B-cell immune responses (Often, et al, Proc. Natl. Acad. Sci. U.S.A. 86:10059-10063 (1989)), induce lymphocyte differentiation and mast cell proliferation and cause the release of soluble biological signals from mast cells (Matsuda, et al, Proc. Natl. Acad. Sci. U.S.A.
  • NGF is produced by a number of cell types including mast cells (Leon, et al, Proc. Natl. Acad. Sci. U.S.A. 91:3739-3743 (1994)), B-lymphocytes (Torcia, et al, Cell 85:345-356 (1996), keratinocytes (Di Marco, etal, J. Biol Chem. 268:22838-22846)), smooth muscle cells (Ueyama, et al, J. Hypertens. 11:1061-1065 (1993)), fibroblasts (Lindholm, et al, Eur. J. Neurosci.
  • NGF receptors have been found on a variety of cell types outside of the nervous system. For example, TrkA has been found on human monocytes, T- and B-lymphocytes and mast cells.
  • the first category includes the nonsteroidal anti-inflammatory drugs (NSAIDs) which are used to treat mild pain, but whose therapeutic use is limited by undesirable gastrointestinal effects such as gastric erosion, formation of peptic ulcer or inflammation of the duodenum and of the colon and renal toxicity with prolonged use.
  • NSAIDs nonsteroidal anti-inflammatory drugs
  • the second category includes the opioid analgesics, such as morphine, which are used to treat moderate to severe pain but whose therapeutic use is limited because of undesirable effects such as constipation, nausea and vomiting, respiratory depression, mental clouding, renal colic, tolerance to prolonged use and risk of addiction.
  • the present invention is based upon the discovery that antagonists of NGF are effective in treating pain in conjunction with an NSAID. Such therapy results in unexpectedly enhanced pain treatment. In addition, such therapy generally allows a reduced dosage of NSAID to effect the same amount of pain reduction and/or other forms of enhancement of NSAID pain treatment.
  • the present invention features a method for treating (or, in other embodiments, preventing) pain comprising administering an amount of a nerve growth factor antagonist and an amount of an NSAID such that in conjunction they provide effective pain relief.
  • the relative amounts and ratios of NGF antagonist and NSAID may vary.
  • enough NGF antagonist will be administered so as to allow reduction of the normal dose of NSAID required to effect the same degree of pain amelioration.
  • enough NGF antagonist will be admimstered so as to allow reduction of the normal dose of NSAID required to effect the same degree of pain amelioration by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90%, or more. This reduction may be reflected in terms of amount administered at a given administration and/or amount administered over a given period of time (reduced frequency).
  • the invention provides methods for enhancing NSAID pain treatment comprising administering an effective amount of an NSAID in conjunction with an effective amount of an NGF antagonist.
  • Administration in conjunction comprises simultaneous administration and/or administration at different times.
  • Administration in conjunction also encompasses administration as a co-formulation (i.e., the NGF antagonist and NSAID are present (combined) in the same composition) and/or administration as separate compositions.
  • administration in conjunction is meant to encompass any circumstance wherein an NSAID and NGF antagonist are administered in an effective amount to an individual.
  • the NGF antagonist and NSAID can be admimstered at different dosing frequencies and/or intervals.
  • an anti-NGF antibody can be admimstered weekly, while an NSAID can be administered more frequently. It is understood that the NGF antagonist and the NSAID can be administered using the same route of administration or different routes of administration, and that different dosing regimens may change over the course of administration(s). Administration may be before the onset of pain.
  • the invention provides methods for reducing incidence of pain, ameliorating pain, palliating pain, and/or delaying the development or progression of pain in an individual, said methods comprising admmistering an effective amount of an NGF antagonist in conjunction with an effective amount of an NSAID.
  • the methods of the invention are suitable for treating or preventing any pain of any etiology, including pain where the use of an NSAID is generally prescribed.
  • the pain is post-surgical pain.
  • the pain is pain associated with burn.
  • the pain is pain associated with rheumatoid arthritis.
  • the pain is pain associated with osteoarthritis.
  • an NGF antagonist suitable for use in the methods of the invention is any agent that can directly or indirectly result in decreased NGF biological activity.
  • an NGF antagonist binds (physically interacts with) NGF (e.g., an antibody), binds to an NGF receptor (such as trkA receptor and/or p75) and/or reduces (impedes and/or blocks) downstream NGF receptor signaling (e.g., inhibitors of kinase signaling or other downstream signaling induced by NGF in a target cell).
  • an NGF antagonist inhibits (reduces) NGF synthesis and/or release.
  • an NGF antagonist decreases the expression or function of an NGF receptor TrkA and/or p75.
  • the NGF antagonist is an NGF antagonist that is not a TrkA immunoadhesin (i.e., is other than a TrkA immunoadhesin).
  • the NGF antagonist is selected from any one or more of the following: an anti-NGF antibody, an anti-sense molecule directed to a nucleic acid encoding an NGF (including an anti-sense molecule directed to a nucleic acid encoding NGF), an anti-sense molecule directed to an NGF receptor (such as TrkA and/or p75), an NGF inhibitory compound, an NGF structural analog, a dominant-negative mutation of a TrkA and/or p75 receptor that binds an NGF, an anti-TrkA antibody, an anti-p75 antibody and a kinase inhibitor.
  • an anti-NGF antibody an anti-sense molecule directed to a nucleic acid encoding an NGF
  • an anti-sense molecule directed to an NGF receptor such as TrkA and/or p75
  • an NGF inhibitory compound an NGF structural analog, a dominant-negative mutation of a TrkA and/or p75 receptor that binds an NGF, an
  • the NGF antagonist (such as anti-NGF antibody) binds NGF (such as hNGF) and does not significantly bind to related neurotrophins, such as NT-3, NT4/5, and/or BDNF.
  • the NGF antagonist is an anti- NGF antibody.
  • the anti-NGF antibody binds specifically to NGF.
  • the anti-NGF antibody recognizes human NGF.
  • the anti-NGF antibody specifically binds human NGF.
  • the antibody binds essentially the same NGF epitope 6 as an antibody selected from any one or more of the following: MAb 911, MAb 912 and MAb 938 (See Hongo, et al, Hybridoma 19:215-227 (2000)).
  • the anti-NGF antibody is humanized (including humanized Mab 911, such as antibody E3 described herein).
  • the anti-NGF antibody is antibody E3 (as described herein).
  • the anti-NGF antibody comprises one or more CDR(s) of antibody E3 (such as one, two, three, four, five, or, in some embodiments, all six CDRs from E3).
  • the anti-NGF antibody is human.
  • the anti-NGF antibody comprises the amino acid sequence of the heavy chain variable region shown in Table 1 (SEQ ID NO:l) and the amino acid sequence of the light chain variable region shown in Table 2 (SEQ ID NO:2).
  • the anti- NGF antibody comprises the amino acid sequence of the heavy chain variable region shown in Table 1 (SEQ ID NO:l).
  • the anti-NGF antibody comprises the amino acid sequence of the light chain variable region shown in Table 2 (SEQ ID NO:2).
  • the antibody comprises a modified constant region, such as a constant region that is immunologically inert, e.g., does not trigger complement mediated lysis, or does not stimulate antibody-dependent cell mediated cytotoxicity (ADCC).
  • the constant region is modified as described in Eur. J. Immunol. (1999) 29:2613-2624; PCT Application No. PCT/GB 99/01441; and/or UK Patent Application No. 9809951.8.
  • the NGF antagonist binds to the NGF molecule.
  • the NGF antagonist is an antibody that binds specifically to NGF.
  • the NGF antagonist may alternatively bind to the trkA receptor.
  • the NGF antagonist may be an anti-human NGF (anti-hNGF) monoclonal antibody that is capable of binding hNGF and effectively inhibiting the binding of hNGF to human TrkA (hTrkA).
  • the binding affinity of an anti-NGF antibody to NGF can be about 0.10 nM to about 0.80 nM, about 0.15 to about 0.75 nM and about 0.18 to about 0.72 nM. In one embodiment, the binding affinity is between about 2 pM and 22 pM. In some embodiments, the binding affinity is about 10 nM. In other embodiments, the binding affinity is less than about 10 nM. In other embodiments, the binding affinity is about 0.1 nM or about 0.07 nM. In other embodiments, the binding affinity is less than about 0.1 nM, or less than about 0.07 nM.
  • the binding affinity is any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM to any of about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 40 pM, or about 50 pM. In some embodiments, the binding affinity is any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM, or less than about 50 pM.
  • the binding affinity is less than any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM. In still other embodiments, the binding affinity is about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 40 pM, or greater than about 40 pM. As is well known in the art, binding affinity can be expressed as K D , or dissociation constant, and an increased binding affinity corresponds to a decreased K D .
  • the binding affinity of anti-NGF mouse monoplonal antibody 911 (Hongo et al., Hybridoma 19:215-227 (2000)) to human NGF is about 10 nM, and the binding affinity of humanized anti-NGF antibody E3 (described herein) to human NGF is about 0.07 nM.
  • the antibody may be an antibody fragment, including an antibody fragment selected from the group consisting of Fab, Fab', F(ab')2, Fv fragments, diabodies, single chain antibody molecules and multispecif ⁇ c antibodies formed from antibody fragments, and a single-chain Fv (scFv) molecule.
  • the NSAID may be any non-steroidal anti-inflammatory compound. NSAIDs are categorized by virtue of their ability to inhibit cyclooxygenase. Cyclooxygenase 1 and cyclooxygenase 2 are two major isoforms of cyclooxygenase and most standard NSAIDs are mixed inhibitors of the two isoforms.
  • NSAIDs fall within one of the following five structural categories: (1) propionie acid derivatives, such as ibuprofen, naproxen, naprosyn, diclofenac, and ketoprofen; (2) acetic acid derivatives, such as tolmetin and slindac; (3) fenamic acid derivatives, such as mefenamic acid and meclofenamic acid; (4) biphenylcarboxylic acid derivatives, such as diflunisal and flufenisal; and (5) oxicams, such as piroxim, sudoxicam, and isoxicam. [0022] Another class of NSAID has been described which selectively inhibit cyclooxygenase 2.
  • Cox-2 inhibitors have been described, e.g., in U.S. Pat. Nos. 5,616,601; 5,604,260; 5,593,994; 5,550,142; 5,536,752; 5,521,213; 5,475,995; 5,639,780; 5,604,253; 5,552,422; 5,510,368; 5,436,265; 5,409,944; and 5,130,311, all of which are hereby incorporated by reference.
  • COX-2 inhibitors include celecoxib (SC- 58635), rofecoxib, DUP-697, flosulide (CGP-28238), meloxicam, 6-methoxy-2 naphthylacetic acid (6-MNA), MK-966, nabumetone (prodrug for 6-MNA), nimesulide, NS-398, SC-5766, SC-58215, T-614; or combinations thereof.
  • the invention provides methods in which aspirin and/or acetominophen are used in conjunction with NGF antagonist (such as anti-NGF antibody).
  • NGF antagonist and/or NSAID can be administered to an individual via any suitable route.
  • they can be administered together or separately, and/or simultaneously and/or sequentially, orally, intravenously, sublingually, subcutaneously, intraarterially, intramuscularly, rectally, intraspinally, intrathoracically, intraperitoneally, intraventricularly, sublingually, transdermally or by inhalation.
  • Administration can be systemic, e.g., intravenous, or localized.
  • the present invention features compositions comprising a nerve growth factor antagonist and an NSAID.
  • the nerve growth factor antagonist and the NSAID may be present together with one or more pharmaceutically acceptable carriers or excipients, or they may be present in separate compositions.
  • the invention provides a synergistic composition of an NGF antagonist and an NSAID.
  • the present invention features a kit for use in any of the methods disclosed herein, said kit comprising an NGF antagonist and an NSAID.
  • the kit may further comprise instructions for any of the methods described herein.
  • the instructions may comprise administration of NGF antagonist (such as anti-NGF antibody) in conjunction with NSAID (i.e., simultaneous administration and/or administration at different times).
  • the NGF antagonist and NSAID are packaged together, but they may or may not be in the same container.
  • the kit comprises an NGF antagonist and an NSAID present in the same container, and instructions for use in any of the methods described herein.
  • the kit comprises an NGF antagonist and an NSAID present in separate containers.
  • the invention provides a method for treating pain in an individual comprising administering to the individual an effective amount of an anti-nerve growth factor (NGF) antibody and an NSAID.
  • NGF anti-nerve growth factor
  • the NSAID is selected from the group consisting of ibuprofen, naproxen, naprosyn, diclofenac, ketoprofen, tolmetin, slindac, mefenamic acid, meclofenamic acid, diflunisal, flufenisal, piroxim, sudoxicam, isoxicam, celecoxib, rofecoxib, DUP-697, flosulide, meloxicam, 6- methoxy-2 naphthylacetic acid, MK-966, nabumetone, nimesulide, NS-398, SC-5766, SC- 58215, T-614.
  • the NSAID is ibuprofen.
  • the anti-NGF antibody binds human NGF. In some embodiments, the anti-NGF antibody binds human NGF with a binding affinity of about 10 nM or less than about 10 nM. In some embodiments, the anti-NGF antibody is a human antibody. In some embodiments, the anti-NGF antibody is a humanized antibody. In some embodiments, the humanized antibody is an antibody comprising the heavy chain variable region shown in SEQ ID NO: 1 and the light chain variable region shown in SEQ ID NO:2. In some embodiments, the pain is post-surgical pain.
  • the invention provides a pharmaceutical composition for treating pain comprising an effective amount of an anti-NGF antibody and an NSAID, and a pharmaceutically acceptable carrier.
  • the invention provides a kit for treating pain comprising an anti-NGF antibody, an NSAID, and instructions for administering the anti-NGF antibody in conjunction with the NSAID to treat pain.
  • NGF antagonist anti-NGF antagonist Mab 911
  • ibuprofen 300 mg/ml in 45% beta- cyclodextrin liquid
  • Non-antibody treated control animals were also treated with ibuprofen at 10 mg/kg, 30 mg/kg, 100 mg/kg, and 300 mg/kg.
  • Ibuprofen was delivered sub-cutaneously in the scruff. One hour after the dose of ibuprofen, resting pain was tested. Treatment with anti-NGF antagonist antibody plus ibuprofen is more effective in reducing resting pain than treatment with either ibuprofen alone or anti-NGF antagonist antibody alone.
  • FIGURE 2 is a graph showing cumulative pain score in animals treated with diclofenac at 5 mg/kg, in combination with an NGF antagonist (anti-NGF antagonist Mab 911; see Hongo et al, Hybridoma 19:215-227 (2000)).
  • Animals were divided into two groups (control and antibody-treated).
  • Diclofenac was delivered sub-cutaneously in the scruff. One hour after the dose of diclofenac, resting pain was tested.
  • NGF antagonist such as an anti-NGF antibody
  • the methods and compositions of the present invention are useful for the treatment or prevention of pain, including any pain where the use of an NSAID is generally prescribed.
  • a nerve growth factor antagonist and an NSAID in conjunction in accordance with the present invention, it is now possible to treat pain with a lower dose of an NSAID thereby reducing the likelihood of side-effects associated with NSAID treatment.
  • enough NGF antagonist will be admimstered so as to allow reduction of the normal dose of NSAID required to effect the same degree of pain amelioration by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 60%, at least about 70%, or at least about 90%, or more.
  • the invention provides methods of treating or preventing pain in an individual (such as a mammal, both human and non-human) comprising administering an effective amount of an NGF antagonist in conjunction with an effective amount of an NSAID.
  • the invention provides methods of enhancing NSATD treatment or prevention of pain in an individual comprising administering an effective amount of an NGF antagonist (such as an anti-NGF antibody) in conjunction with an effective amount of an NSAID.
  • the invention provides methods of preventing, ameliorating and/or preventing the development or progression of pain.
  • the anti-NGF antibody is capable of binding NGF and effectively inhibiting the binding of NGF to its TrkA or p75 receptor in vivo or effectively inhibiting NGF from activating its TrkA or p75 receptor.
  • the binding affinity of the antibody to NGF is about 0.01 to about 1.00 nM, or about 0.05 to about 0.25 nM. In other embodiments, the binding affinity is about 1 pM, about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 50 pM, about 100 pM, or more. In one embodiment, the binding affinity is between about 2 pM and 22 pM.
  • the antibody binds essentially the same NGF epitope 6 as an antibody selected from any one or more of the following: MAb 911, MAb 912 and MAb 938. See Hongo, et al, Hybridoma 19:215-227 (2000).
  • the antibody may also be an antibody fragment, such as an antibody fragment selected from one or more of the following: Fab, Fab', F(ab')2, Fv fragments, diabodies, single chain antibody molecules and multispecific antibodies formed from antibody fragments, and a single-chain Fv (scFv) molecule.
  • the antibody may also be chimeric, and it may be humanized or human.
  • the antibody may also be bispecific.
  • NSAIDs useful in the present invention include, but are not limited to, (1) propionic acid derivatives, such as ibuprofen, naproxen, naprosyn, diclofenac, and ketoprofen; (2) acetic acid derivatives, such as tolmetin and slindac; (3) fenamic acid derivatives, such as mefenamic acid and meelofenamie acid; (4) biphenylcarboxylie acid derivatives, such as diflunisal and flufenisal; and (5) oxicams, such as piroxim, sudoxieam, and isoxicam.
  • propionic acid derivatives such as ibuprofen, naproxen, naprosyn, diclofenac, and ketoprofen
  • acetic acid derivatives such as tolmetin and slindac
  • fenamic acid derivatives such as mefenamic acid and meelofenamie acid
  • biphenylcarboxylie acid derivatives
  • Cox-2 inhibitors have been described, e.g., in U.S. Pat. Nos. 5,616,601; 5,604,260; 5,593,994; 5,550,142; 5,536,752; 5,521,213; 5,475,995; 5,639,780; 5,604,253; 5,552,422; 5,510,368; 5,436,265; 5,409,944; and 5,130,311, all of which are hereby incorporated by reference.
  • COX-2 inhibitors include celecoxib (SC- 58635), rofecoxib, DUP-697, flosulide (CGP-28238), meloxicam, 6-methoxy-2 naphthylacetic acid (6-MNA), MK-966, nabumetone (prodrug for 6-MNA), nimesulide, NS-398, SC-5766, SC-58215, T-614; or combinations thereof.
  • aspirin and/or acetominophen are used in conjunction with NGF antagonist (such as anti- NGF antibody).
  • the methods and compositions of the present invention are useful for the treatment of pain of any etiology, including acute and chronic pain, any pain with an inflammatory component, and any pain in which an NSAID is usually prescribed.
  • pain include post-surgical pain, post-operative pain (including dental pain), migraine, headache and trigeminal neuralgia, pain associated with burn, wound or kidney stone, pain associated with trauma (including traumatic head injury), neuropathic pain, pain associated with musculo-skeletal disorders such as rheumatoid arthritis, osteoarthritis, visceral pain, colitis, pancreatitis, gastritis, ankylosing spondylitis, sero-negative (non- rheumatoid) arthropathies, non-articular rheumatism and peri-articular disorders, and pain associated with cancer (including "break-through pain” and pain associated with terminal cancer), peripheral neuropathy, post-herpetic neuralgia, and pain associated with sickle- cell crisis.
  • Examples of pain with an inflammatory component include rheumatic pain, pain associated with mucositis, and dysmenorrhea.
  • the methods and compositions of the present invention are used for treatment or prevention of post-surgical pain and/or cancer pain.
  • the pain is a pain indication for which an NSAID is not generally prescribed, such as neuropathic pain.
  • the methods and compositions described herein are used for treatment and/or prevention of pain associated with burn.
  • the methods and compositions described herein are used for treatment and/or prevention of pain associated with rheumatoid arthritis.
  • the methods and compositions described herein are used for treatment and/or prevention of pain associated with osteoarthritis.
  • compositions and kits for treating pain comprising an NGF antagonist (such as an anti-NGF antibody) and an NSAID suitable for use in any of the methods described herein.
  • an NGF antagonist such as an anti-NGF antibody
  • an NSAID suitable for use in any of the methods described herein.
  • an "antibody” (interchangeably used in plural fo ⁇ n) is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
  • the term encompasses not only intact polyclonal or monoclonal antibodies, but also fragments thereof (such as Fab, Fab', F(ab')2, Fv), single chain (ScFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, chimeric antibodies, diabodies linear antibodies, single chain antibodies, multispecific antibodies (e.g., bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity.
  • An antibody includes an antibody of any class, such as IgG, IgA, or IgM ( or sub-class thereof), and the antibody need not be of any particular class.
  • immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2.
  • the heavy-chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
  • a “monoclonal antibody” refers to a homogeneous antibody population wherein the monoclonal antibody is comprised of amino acids (naturally occurring and non-naturally occurring) that are involved in the selective binding of an antigen. Monoclonal antibodies are highly specific, being directed against a single antigenic site.
  • the term "monoclonal antibody” encompasses not only intact monoclonal antibodies and full-length monoclonal antibodies, but also fragments thereof (such as Fab, Fab', F(ab')2, Fv), single chain (ScFv), mutants thereof, fusion proteins comprising an antibody portion, humanized monoclonal antibodies, chimeric monoclonal antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity and the ability to bind to an antigen. It is not intended to be limited as regards to the source of the antibody or the manner in which it is made (e.g., by hybridoma, phage selection, recombinant expression, transgenie animals, etc.).
  • Humanized antibodies refer to a molecule having an antigen binding site that is substantially derived from an immunoglobulin from a non-human species and the remaining immunoglobulin structure of the molecule based upon the structure and/or sequence of a human immunoglobulin.
  • the antigen binding site may comprise either complete variable domains fused onto constant domains or only the complementarity determining regions (CDRs) grafted onto appropriate framework regions in the variable domains.
  • Antigen binding sites may be wild type or modified by one or more amino acid substitutions, e.g., modified to resemble human immunoglobulin more closely.
  • Some forms of humanized antibodies preserve all CDR sequences (for example, a humanized mouse antibody which contains all six CDRs from the mouse antibodies).
  • humanized antibodies have one or more CDRs (one, two, three, four, five, six) which are altered with respect to the original antibody.
  • framework region (FR) residues or other residues of the human immunoglobulin replaced by corresponding non- human residues.
  • humanized antibodies may comprise residues which are not found in the recipient antibody or in the donor antibody.
  • nerve growth factor and “NGF” refers to nerve growth factor and variants (including, for example, splice variants and protein processing variants) thereof that retain at least part of the activity of NGF.
  • NGF includes all mammalian species of native sequence NGF, including human, non-human primate, canine, feline, equine, or bovine.
  • NGF receptor refers to a polypeptide that is bound by or activated by NGF.
  • NGF receptors include the TrkA receptor and the p75 receptor of any mammalian species, including, but are not limited to, human, canine, feline, equine, primate, or bovine.
  • An “NGF antagonist” refers to any molecule that blocks, suppresses or reduces (including significantly) NGF biological activity, including downstream pathways mediated by NGF signaling, such as receptor binding and/or elicitation of a cellular response to NGF.
  • antagonist implies no specific mechanism of biological action whatsoever, and is deemed to expressly include and encompass all possible pharmacological, physiological, and biochemical interactions with NGF whether direct or indirect, or whether interacting with NGF, its receptor, or tlirough another mechanism, and its consequences which can be achieved by a variety of different, and chemically divergent, compositions.
  • Exemplary NGF antagonists include, but are not limited to, an anti-NGF antibody, an anti-sense molecule directed to an NGF (including an anti-sense molecule directed to a nucleic acid encoding NGF), an NGF inhibitory compound, an NGF structural analog, a dominant-negative mutation of a TrkA receptor that binds an NGF, a TrkA immunoadhesin, an anti-TrkA antibody, an anti-p75 antibody, an anti-sense molecule directed to either or both of the TrkA and/or p75 receptors (including anti-sense molecules directed to a nucleic aid molecule encoding TrkA or p75), and a kinase inhibitor.
  • an anti-NGF antibody an anti-sense molecule directed to an NGF (including an anti-sense molecule directed to a nucleic acid encoding NGF)
  • an NGF inhibitory compound an NGF structural analog, a dominant-negative mutation of a TrkA receptor that bind
  • an NGF antagonist encompass all the previously identified terms, titles, and functional states and characteristics whereby the NGF itself, an NGF biological activity (including but not limited to its ability to mediate any aspect of pain), or the consequences of the biological activity, are substantially nullified, decreased, or neutralized in any meaningful degree.
  • an NGF antagonist binds (physically interact with) NGF (e.g., an antibody), binds to an NGF receptor (such as trkA receptor or p75 receptor), reduces (impedes and/or blocks) downstream NGF receptor signaling, and/or inhibits (reduces) NGF synthesis, production or release.
  • an NGF antagonist binds (physically interacts with) NGF (e.g., an antibody), binds to an NGF receptor (such as TrkA receptor or p75 receptor), and/or reduces (impedes and/or blocks) downstream NGF receptor signaling.
  • an NGF antagonist binds NGF and prevents TrkA receptor dimerization and/or TrkA autophosphorylation.
  • an NGF antagonist inhibits or reduces NGF synthesis and/or production (release). Examples of types of NGF antagonists are provided herein.
  • an "anti-NGF antibody” refers to an antibody which is able to bind to NGF and inhibit NGF biological activity and/or downstream pathway(s) mediated by NGF signaling.
  • TrkA immunoadhesin refers to a soluble chimeric molecule comprising a fragment of a TrkA receptor, for example, the extracellular domain of a TrkA receptor and an immunoglobulin sequence, which retains the binding specificity of the TrkA receptor.
  • Biological activity of NGF generally refers to the ability to bind NGF receptors and/or activate NGF receptor signaling pathways.
  • a biological activity includes any one or more of the following: the ability to bind an NGF receptor (such as p75 and/or TrkA); the ability to promote TrkA receptor dimerization and/or autophosphorylation; the ability to activate an NGF receptor signaling pathway; the ability to promote cell differentiation, proliferation, survival, growth and other changes in cell physiology, including (in the case of neurons, including peripheral and central neuron) change in neuronal morphology, synaptogenesis, synaptic function, neurotransmitter and/or neuropeptide release and regeneration following damage; and the ability to mediate pain.
  • an NGF receptor such as p75 and/or TrkA
  • TrkA receptor dimerization and/or autophosphorylation the ability to activate an NGF receptor signaling pathway
  • the ability to promote cell differentiation, proliferation, survival, growth and other changes in cell physiology including (in the case of neurons, including peripheral and central neuron) change in neuronal morphology, synaptogenesis, synaptic function, neurotransmitter and/or neuro
  • epitopope is used to refer to binding sites for (monoclonal or polyclonal) antibodies on antigens such as protein antigens.
  • beneficial or desired clinical results include, but are not limited to, one or more of the following: improvement or alleviation of any aspect of pain, including acute, chronic, inflammatory, neuropathic, or post-surgical pain.
  • beneficial or desired clinical results include, but are not limited to, one or more of the following: including lessening severity, alleviation of one or more symptoms associated with pain including any aspect of pain (such as shortening duration of pain, and/or reduction of pain sensitivity or sensation).
  • Reducing incidence of pain means any of reducing severity (which can include reducing need for and/or amount of (e.g., exposure to) other drugs and/or therapies generally used for this conditions), duration, and/or frequency (including, for example, delaying or increasing time to pain in an individual).
  • individuals may vary in terms of their response to treatment, and, as such, for example, a "method of reducing incidence of pain in an individual" reflects administering the NGF antagonist described herein in conjunction with an NSAID as described herein, based on a reasonable expectation that such administration may likely cause such a reduction in incidence in that particular individual.
  • “Ameliorating” pain or one or more symptoms of pain means a lessening or improvement of one or more symptoms of a pain as compared to not administering an NGF antagonist in conjunction with an NSAID. “Ameliorating” also includes shortening or reduction in duration of a symptom.
  • “Palliating" pain or one or more symptoms of pain means lessening the extent of one or more undesirable clinical manifestations of pain in an individual or population of individuals treated with an NGF antagonist in conjunction with an NSAID in accordance with the invention.
  • “delaying" the development of pain means to defer, hinder, slow, retard, stabilize, and/or postpone progression of pain. This delay can be of varying lengths of time, depending on the history of the disease and/or individuals being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop pain.
  • a method that "delays" development of the symptom is a method that reduces probability of developing the symptom in a given time frame and/or reduces extent of the symptoms in a given time frame, when compared to not using the method. Such comparisons are typically based on clinical studies, using a statistically significant number of subjects.
  • “Development” or “progression” of pain means initial manifestations and/or ensuing progression of the disorder. Development of pain can be detectable and assessed using standard clinical techniques as well known in the art. However, development also refers to progression that may be undetectable. For purpose of this invention, development or progression refers to the biological course of the symptoms. “Development” includes occurrence, recurrence, and onset. As used herein "onset” or “occurrence” of pain includes initial onset and/or recurrence.
  • an "effective amount” is an amount sufficient to effect beneficial or desired clinical results including alleviation or reduction in the pain sensation.
  • an effective amount of an NGF antagonist (such as an anti-NGF antibody) and an NSAID includes an amount sufficient to treat, ameliorate, reduce the intensity of or prevent pain (including nociception and the sensation of pain) of any sort, including acute, chronic, inflammatory, neuropathic, or post-surgical pain.
  • an effective amount of an NSAID and an NGF antagonist is a quantity of the NGF antagonist and the NSAID capable of modulating the sensitivity threshold to external stimuli to a level comparable to that observed in healthy subjects.
  • an effective amount of an NGF antagonist also encompasses an amount of an NGF antagonist sufficient to enhance NSAID treatment (therapeutic effect) of pain, as described herein, or to reduce the dose of NSAID necessary for treatment or prevention of pain, as described herein.
  • an effective amount of NGF antagonist in conjunction with NSAID may vary, depending on, inter alia, type of pain (and patient history as well as other factors such as the type (and/or dosage) or NGF antagonist and/or NSAID used.).
  • An effective amount, in the context of this invention may also be amounts of an NGF antagonist and an NSAID antagonist such that synergy is achieved.
  • An effective amount of an antagonist in the context of this invention generally means an amount sufficient to result in enhancement of a therapeutic effect of an NSAID for pain (which can, in turn, mean that dosage is reduced and/or some other beneficial effect is observed) and/or result in a beneficial effect as compared to NSAID treatment alone.
  • An "effective amount" of an NGF antagonist can also result in a synergistic effect as compared to administering NGF antagonist or NSAID alone.
  • An "individual" is a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, farm animals, sport animals, pets, primates, horses, cows, dogs, cats, mice and rats.
  • NSAID refers to a non-steroidal anti-inflammatory compound. NSAIDs are categorized by virtue of their ability to inhibit cyclooxygenase. Cyclooxygenase 1 and cyclooxygenase 2 are two major isoforms of cyclooxygenase and most standard NSAIDs are mixed inhibitors of the two isoforms.
  • NSAIDs fall within one of the following five structural categories: (1) propionic acid derivatives, such as ibuprofen, naproxen, naprosyn, diclofenac, and ketoprofen; (2) acetic acid derivatives, such as tolmetin and slindac; (3) fenamic acid derivatives, such as mefenamic acid and meclofenamic acid; (4) biphenylcarboxylic acid derivatives, such as diflunisal and flufenisal; and (5) oxicams, such as piroxim, sudoxicam, and isoxicam. [0060] Another class of NSAID has been described which selectively inhibit cyclooxygenase 2.
  • Cox-2 inhibitors have been described, e.g., in U.S. Pat. Nos. 5,616,601; 5,604,260; 5,593,994; 5,550,142; 5,536,752; 5,521,213; 5,475,995; 5,639,780; 5,604,253; 5,552,422; 5,510,368; 5,436,265; 5,409,944; and 5,130,311, all of which are hereby incorporated by reference.
  • COX-2 inhibitors include eeleeoxib (SC- 58635), DUP-697, flosulide (CGP-28238), meloxicam, 6-methoxy-2 naphthylacetie acid (6-MNA), rofecoxib, MK-966, nabumetone (prodrug for 6-MNA), nimesulide, NS-398, SC-5766, SC-58215, T-614; or combinations thereof.
  • aspirin and/or acetaminophen are taken in conjunction with NGF antagonist (such as anti-NGF antibody).
  • NGF antagonist such as anti-NGF antibody
  • Aspirin is another type of non- steroidal anti-inflammatory compound.
  • administration "in conjunction” includes simultaneous administration and/or administration at different times. Administration in conjunction also encompasses administration as a co-formulation (i.e., the NGF antagonist and NSAID are present in the same composition) or administration as separate compositions. As used herein, administration in conjunction is meant to encompass any circumstance wherein an NSAID and NGF antagonist are administered to an individual, which can occur simultaneously and/or separately. As further discussed herein, it is understood that the NGF antagonist and NSAID can be administered at different dosing frequencies or intervals. For example, an anti-NGF antibody can be admimstered weekly, while an NSAID can be administered more frequently. It is understood that the NGF antagonist and the NSAID can be administered using the same route of administration or different routes of administration.
  • Post-surgical pain refers to pain arising or resulting from an external trauma such as a cut, puncture, incision, tear, or wound into tissue of an individual (including that that arises from all surgical procedures, whether invasive or non-invasive).
  • post-surgical pain does not include pain that occurs (arises or originates) without an external physical trauma.
  • post-surgical pain is internal or external (including peripheral) pain, and the wound, cut, trauma, tear or incision may occur accidentally (as with a traumatic wound) or deliberately (as with a surgical incision).
  • pain includes nociception and the sensation of pain, and pain can be assessed objectively and subjectively, using pain scores and other methods well-known in the art.
  • Post-surgical pain includes allodynia (i.e., increased response (i.e., a noxious perception) to a normally non-noxious stimulus) and hyperalgesia (i.e., increased response to a normally noxious or unpleasant stimulus), which can in turn, be thermal or mechanical (tactile) in nature.
  • the pain is characterized by thermal sensitivity, mechanical sensitivity and/or resting pain.
  • the post-surgical pain comprises mechanically-induced pain or resting pain. In other embodiments, the post-surgical pain comprises resting pain.
  • NSAID treatment of pain is "enhanced" when an aspect of NSAID treatment is improved (as compared to administering NSAID without administering an NGF antagonist).
  • efficacy of NSAID treatment of pain may be increased in the presence of NGF antagonist relative to efficacy of a NSAID in the absence of NGF antagonist.
  • treatment or prevention of pain with an NSAID may be "enhanced” by the use of an NGF antagonist in conjunction with the NSAID when that use permits better pain relief (for example, when a dose of NSAID is used that does not permit effective treatment or prevention of pain).
  • NGF antagonists and NSAIDs also include compositions comprising one or more of these agents.
  • the present invention is useful for treating pain in individuals including all mammals, both human and non-human.
  • the invention provides methods of treating pain in an individual comprising administering an effective amount of an NGF antagonist (such as an anti-NGF antibody) in conjunction with an effective amount of an NSAID.
  • an NGF antagonist such as an anti-NGF antibody
  • enough NGF antagonist will be administered so as to allow reduction of the normal dose of NSAID required to effect the same degree of pain amelioration by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90%, or more.
  • the invention provides methods of enhancing NSAID treatment of pain in an individual comprising administering an effective amount of an NGF antagonist in conjunction with an effective amount of an NSAID.
  • pain comprises any one or more of the following: acute and/or chronic pain, any pain with an inflammatory component, post-operative pain (including dental pain), migraine, headache and trigeminal neuralgia, pain associated with burn, wound or kidney stone, pain associated with trauma (including traumatic head injury), neuropathic pain, pain associated with sickle cell crisis, pain associated with dysmenorhea or intestinal dysfunction, and pain associated with cancer (including "breakthrough pain” and pain associated with terminal cancer).
  • the pain is any pain that is usually treated with an NSAID (such as ibuprofen).
  • the pain is pain associated with burn.
  • the pain is pain associated with rheumatoid arthritis.
  • the pain is pain associated with osteoarthritis.
  • the invention provides methods of preventing, ameliorating and/or preventing the development or progression of pain.
  • the NGF antagonist such as an anti-NGF antibody, and/or NSAID are administered prior to a painful event (such as surgery).
  • the NGF antagonist can be administered 30 minutes, one hour, 5 hours, 10 hours, 15 hours, 24 hours or even more, such as 1 day, several days, or even a week, 2 weeks, 3 weeks, or more prior to the activity likely to result in, or at a risk of causing pain, such as external trauma or an operation.
  • Treatment or prevention of pain is assessed using methods well-known in the art.
  • Assessment may be performed based on objective measure, such as observation of behavior such as reaction to stimuli, facial expressions and the like. Assessment may also be based on subjective measures, such as patient characterization of pain using various pain scales. See, e.g., Katz et al, Surg Clin North Am. (1999) 79 (2):231-52; Caraceni et al. J Pain Symptom Manage (2002) 23(3):239-55.
  • Diagnosis or assessment of rheumatoid arthritis pain is well-established in the art. Assessment may be performed based on measures known in the art, such as patient characterization of pain using various pain scales. See, e.g., Katz et al, Surg Clin North Am. (1999) 79 (2):231-52; Caraceni et al. JPain Symptom Manage (2002) 23(3):239-55. There are also commonly used scales to measure disease state such as the American College of Rheumatology (ACR) (Felson, et al., Arthritis and Rheumatism (1993) 36(6): 729-740), the Health Assessment Questionnaire (HAQ) (Fries, et al., (1982) J.
  • ACR American College of Rheumatology
  • HAQ Health Assessment Questionnaire
  • Diagnosis or assessment of osteoarthritis pain is well-established in the art. Assessment may be performed based on measures known in the art, such as patient characterization of pain using various pain scales. See, e.g., Katz et al, Surg Clin North Am. (1999) 79 (2):231-52; Caraceni et al. J Pain Symptom Manage (2002) 23(3):239-55.
  • WOMAC Ambulation Pain Scale including pain, stiffness, and physical function
  • VAS 100 mm Visual Analogue Scale
  • the nerve growth factor antagonist and the NSAID are presented in a ratio which is consistent with the manifestation of the desired effect.
  • the ratio by weight of the nerve growth factor antagonist to the NSAID may be approximately 1 to 1. In some embodiments, this ratio may be between about 0.001 to about 1 and about 1000 to about 1, between about 0.01 to about 1 and about 100 to about 1, or between about 0.1 to about 1 and about 10 to about 1. Other ratios are contemplated.
  • a nerve growth factor antagonist and NSAID required for use in the treatment or prevention of pain will vary not only with the particular compounds or compositions selected but also with the route of administration, the nature of the condition being treated, and the age and condition of the patient, and will ultimately be at the discretion of the attending physician.
  • NGF antagonist refers to any molecule that blocks, suppresses or reduces (including significantly) NGF biological activity, including downstream pathways mediated by NGF signaling, such as receptor binding and/or elicitation of a cellular response to NGF.
  • antagonist implies no specific mechanism of biological action whatsoever, and is deemed to expressly include and encompass all possible pharmacological, physiological, and biochemical interactions with NGF and its consequences which can be achieved by a variety of different, and chemically divergent, compositions.
  • Exemplary NGF antagonists include, but are not limited to, an anti-NGF antibody, a polypeptide (including a polypeptide comprising an NGF binding domain derived from an anti-NGF antibody, e.g., a binding domain comprising CDR regions sufficient to bind NGF), an anti-sense molecule directed to an NGF (including an anti-sense molecule directed to a nucleic acid encoding NGF), an anti- sense molecule directed to either or both of the TrkA and/or p75 receptors (including anti- sense molecules directed to a nucleic aid molecule encoding trkA or p75), an NGF inhibitory compound, an NGF structural analog, a dominant-negative mutation of a TrkA receptor that binds an NGF, a TrkA immunoadhesin, an anti-TrkA antibody, an anti-p75 antibody, and a kinase inhibitor.
  • an anti-NGF antibody e.g., a polypeptide comprising an
  • an NGF antagonist e.g., an antibody
  • NGF receptor such as TrkA and/or p75 receptor
  • an NGF antagonist binds (physically interacts with) NGF.
  • an NGF antagonist binds to an NGF receptor (such as trkA receptor or p75). In other embodiments, an NGF antagonist reduces (impedes and/or blocks) downstream NGF receptor signaling (e.g., inhibitors of kinase signaling). In other embodiments, an NGF antagonist inhibits (reduces) NGF synthesis and/or release. In another embodiment, the NGF antagonist is a TrkA immunoadhesin. In another embodiment, the NGF antagonist is other than an anti-NGF antibody. In some embodiments, the NGF antagonist binds NGF (such as hNGF) and does not significantly bind to related neurotrophins, such as NT-3, NT4/5, and/or BDNF.
  • NGF such as hNGF
  • the NGF antagonist binds human NGF, and does not significantly bind an NGF from another vertebrate species (in some embodiments, mammalian). In some embodiments, the NGF antagonist binds human NGF as well as one or more NGF from another vertebrate species (in some embodiments, mammalian). In some embodiments, the NGF antagonist binds NGF as well as at least one other neurotrophin. In some embodiments, the NGF antagonist binds to a mammalian species of NGF, such as horse or dog, but does not significantly bind to NGF from another mammalian species.
  • the NGF antagonist comprises an anti- NGF antibody.
  • An anti-NGF antibody should exhibit any one or more of the following characteristics: (a) bind to NGF and inhibit NGF biological activity and/or downstream pathway(s) mediated by NGF signaling function; (b) treating or preventing any aspect of pain, particularly in conjunction with an NSAID; (c) block or decrease NGF receptor activation (including trkA receptor dimerization and/or autophosphorylation); (d) increase clearance of NGF; (e) enhance NSAID treatment of pain.
  • Anti-NGF antibodies are known in the art, see, e.g., PCT Publication Nos. WO02096458; WO 01/78698, WO 01/64247, U.S. Patent No. 5,844,092, 5,877,016, and 6,153,189; Hongo et al, Hybridoma, 19:215-227 (2000); Cell. Molec. Biol. 13:559-568 (1993); GenBank Accession Nos. U39608, U39609, L17078, or L17077.
  • the anti-NGF antibody binds specifically to NGF.
  • the anti-NGF antibody is humanized (such as antibody E3 described herein).
  • the anti-NGF antibody is antibody E3 (as described herein). In other embodiments, the anti-NGF antibody comprises one or more CDR(s) of antibody E3 (such as one, two, three, four, five, or, in some embodiments, all six CDRs from E3). In other embodiments, the antibody is human. In still other embodiments, the anti-NGF antibody comprises the amino acid sequence of the heavy chain variable region shown in Table 1 (SEQ ID NO: 1) and the amino acid sequence of the light chain variable region shown in Table 2 (SEQ ID NO:2). In still other embodiments, the anti-NGF antibody comprises the amino acid sequence of the heavy chain variable region shown in Table 1 (SEQ ID NO: 1).
  • the anti-NGF antibody comprises the amino acid sequence of the light chain variable region shown in Table 2 (SEQ ID NO:2).
  • the antibody comprises a modified constant region, such as a constant region that is immunologically inert, e.g., does not trigger complement mediated lysis, or does not stimulate antibody-dependent cell mediated cytotoxicity (ADCC).
  • the constant region is modified as described in Eur. J. Immunol. (1999) 29:2613-2624; PCT Application No. PCT/GB99/01441 ; and/or UK Patent Application No. 9809951.8.
  • the anti-NGF antibody is any antibody described in U.S. Ser. No. 10/745,775.
  • the anti-NGF antibody is a humanized mouse anti-NGF monoclonal antibody termed antibody "E3", which comprises the human heavy chain IgG2a constant region containing the following mutations: A330P331 to S330S331 (amino acid numbering with reference to the wildtype IgG2a sequence; see Eur. J. Immunol. (1999) 29:2613-2624); the human light chain kappa constant region; and the heavy and light chain variable regions shown in Tables 1 and 2.
  • E3 humanized mouse anti-NGF monoclonal antibody termed antibody "E3”, which comprises the human heavy chain IgG2a constant region containing the following mutations: A330P331 to S330S331 (amino acid numbering with reference to the wildtype IgG2a sequence; see Eur. J. Immunol. (1999) 29:2613-2624); the human light chain kappa constant region; and the heavy and light chain variable regions shown in Tables 1 and 2.
  • Table 1 Heavy chain variable region QVQLQESGPGLVKPSETLSLTCTVSGFSLIGYDLNWIRQPPGKGLEWIGIIWGDGTT DYNSAVKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCARGGYWYATSYYFDYW GQGTLVTVS(SEQ ID NO:l).
  • Vector Eb.911.3E is a polynucleotide encoding the light chain variable region shown in Table 2; vector Eb.pur.911.3E is a polynucleotide encoding the light chain variable region shown in Table 2 and vector Db.911.3E is a polynucleotide encoding the heavy chain variable region shown in Table 1. These polynucleotides also encode constant domains.
  • CDRs There are at least two techniques for determining CDRs: (1) an approach based on cross-species sequence variability (i.e., Kabat et al. Sequences of Proteins of Immunologic ⁇ l Interest, (5th ed., 1991, National Institutes of Health, Bethesda MD)); and (2) an approach based on crystallographic studies of antigen-antibody complexes (Chothia et al. (1989) Nature 342:877; Al-lazikani et al (1997) J. Molec. Biol. 273:927-948)).
  • a CDR may refer to CDRs defined by either approach or by a combination of both approaches.
  • the anti-NGF antibody comprises one or more CDR(s) of antibody E3 (such as one, two, three, four, five, or, in some embodiments, all six CDRs from E3). Determination of CDR regions is well within the skill of the art. CDR(s) may be Kabat, Chothia, or a combination of Kabat and Chothia.
  • the antibodies useful in the present invention can encompass monoclonal antibodies, polyclonal antibodies, antibody fragments (e.g., Fab, Fab', F(ab')2, Fv, Fc, etc.), chimeric antibodies, bispecific antibodies, heteroconjugate antibodies, single chain (ScFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies.
  • the antibodies may be murfne, rat, human, or any other origin (including chimeric or humanized antibodies).
  • the antibody reacts with NGF in a manner that inhibits NGF and/or downstream pathways mediated by the NGF signaling function.
  • the antibody is a human antibody which recognizes one or more epitopes on human NGF.
  • the antibody is a mouse or rat antibody which recognizes one or more epitopes on human NGF.
  • the antibody recognizes one or more epitopes on an NGF selected from the group consisting of: primate, rodent, canine, feline, equine, and bovine.
  • the antibody comprises a modified constant region, such as a constant region that is immunologically inert (i.e., does not trigger complement mediated lysis), or does not stimulate antibody-dependent cell mediated cytotoxicity (ADCC).
  • ADCC activity can be assessed using methods disclosed in U.S. Patent No. 5, 500, 362.
  • the constant region is modified as described in Eur. J. Immunol. (1999) 29:2613-2624; PCT Publication No. PCT/GB99/01441; and/or UK Patent Application No. 9809951.8.
  • the binding affinity of an anti-NGF antibody to NGF can be about 0.01 to about 1 nM, about 0.05 to about 0.25 nM, about 0.10 to about 0.80 nM, about 0.15 to about 0.75 nM and about 0.18 to about 0.72 nM. In some embodiments, the binding affinity is about 1 pM, about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 40 pM, or greater than about 40 pM. In one embodiment, the binding affinity is between about 2 pM and 22 pM.
  • the binding affinity is less than about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, about 50 pM, about 10 pM. In some embodiments, the binding affinity is about 10 nM. In other embodiments, the binding affinity is less than about 10 nM. In other embodiments, the binding affinity is about 0.1 nM or about 0.07 nM. In other embodiments, the binding affinity is less than about 0.1 nM or less than about 0.07 nM.
  • the binding affinity is any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM to any of about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, or about 40 pM. In some embodiments, the binding affinity is any of about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, or about 50 pM, or less than about 50 pM.
  • the binding affinity is about 2 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 40 pM, or greater than about 40 pM.
  • One way of determining binding affinity of antibodies to NGF is by measuring affinity of monofunctional Fab fragments of the antibody.
  • an antibody for example, IgG
  • an antibody can be cleaved with papain or expressed recombinantly.
  • the affinity of an anti-NGF Fab fragment of an antibody can be determined by surface plasmon resonance (BlAcore3000TM surface plasmon resonance (SPR) system, BIAcore, INC, Piscaway NJ).
  • CM5 chips can be activated with N-ethyl-N'- (3-dimethylaminopropyl)-carbodiinide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions.
  • EDC N-ethyl-N'- (3-dimethylaminopropyl)-carbodiinide hydrochloride
  • NHS N-hydroxysuccinimide
  • HBS- EP buffer (0.01MHEPES, pH 7.4, 0.15 NaCl, 3mMEDTA, 0.005% Surfactant P20) is used as running buffer for the BIAcore assays. Serial dilutions (0.1-1 Ox estimated K D ) of purified Fab samples are injected for 1 min at 100 ⁇ L/min and dissociation times of up to 2h are allowed.
  • the concentrations of the Fab proteins are determined by ELISA and/or SDS-PAGE electrophoresis using a Fab of known concentration (as determined by amino acid analysis) as a standard.
  • Kinetic association rates (k on ) and dissociation rates (k off ) are obtained simultaneously by fitting the data to a 1 : 1 Langmuir binding model (Karlsson, R. Roos, H. Fagerstam, L. Petersson, B. (1994). Methods Enzyology 6:99-110) using the BIAevaluation program.
  • Equilibrium dissociation constant (K D ) values can be calculated as k o f ⁇ m - This protocol is suitable for use in determining binding affinity of an antibody to NGF of any species, including human NGF, NGF of another vertebrate (in some embodiments, mammalian) (such as mouse NGF, rat NGF, primate NGF), as well as for use with other neurotrophins, such as the related neurotrophins NT3, NT4/5, and/or BDNF.
  • the antibody binds human NGF, and does not significantly bind an NGF from another vertebrate species (in some embodiments, mammalian). In some embodiments, the antibody binds human NGF as well as one or more NGF from another vertebrate species (in some embodiments, mammalian, such as rodent). In still other embodiments, the antibody binds NGF and does not significantly cross-react with other neurotrophins (such as the related neurotrophins, NT3, NT4/5, and/or BDNF). In some embodiments, the antibody binds NGF as well as at least one other neurotrophin. In some embodiments, the antibody binds to a mammalian species of NGF, such as horse or dog, but does not significantly bind to NGF from another mammalian species.
  • the epitope(s) can be continuous or discontinuous, hi one embodiment, the antibody binds essentially the same hNGF epitope as an antibody selected from the group consisting of MAb 911, MAb 912, and MAb 938 as described in Hongo et al, Hybridoma, 19:215-227 (2000). In another embodiment, the antibody binds essentially the same hNGF epitope as MAb 911. In still another embodiment, the antibody binds essentially the same epitope as MAb 909. Hongo et al, supra.
  • the epitope may comprise one or more of: residues K32, K34 and E35 within variable region 1 (amino acids 23-35) of hNGF; residues F79 and T81 within variable region 4 (amino acids 81-88) of hNGF; residues H84 and K88 within variable region 4; residue R103 between variable region 5 (amino acids 94-98) of hNGF and the C-terminus (amino acids 111-118) of hNGF; residue El 1 within pre-variable region 1 (amino acids 10-23) of hNGF; Y52 between variable region 2 (amino acids 40-49) of hNGF and variable region 3 (amino acids 59-66) of hNGF; residues LI 12 and SI 13 within the C-terminus of hNGF; residues R59 and R69 within variable region 3 of hNGF; or residues VI 8, V20, and G23 within pre-variable region 1 of hNGF.
  • an epitope can comprise one or more of the variable region 1, variable region 3, variable region 4, variable region 5, the N-terminus region, and /or the C-terminus of hNGF.
  • the antibody significantly reduces the solvent accessibility of residue R103 of hNGF.
  • antibodies e.g., human, humanized, mouse, chimeric
  • antibodies that can inhibit NGF may be made by using immunogens that express full length or partial sequence of NGF.
  • an imrnunogen comprising a cell that overexpresses NGF may be used.
  • Another example of an imrnunogen that can be used is NGF protein that contains full-length NGF or a portion of the NGF protein.
  • the anti-NGF antibodies may be made by any method known in the art.
  • the route and schedule of immunization of the host animal are generally in keeping with established and conventional techniques for antibody stimulation and production, as further described herein.
  • General techniques for production of human and mouse antibodies are known in the art and are described herein.
  • any mammalian subject including humans or antibody producing cells therefrom can be manipulated to serve as the basis for production of mammalian, including human, hybridoma cell lines.
  • the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantar, and/or intradermally with an amount of imrnunogen, including as described herein.
  • Hybridomas can be prepared from the lymphocytes and immortalized myeloma cells using the general somatic cell hybridization technique of Kohler, B. and Milstein, C (1975) Nature 256:495-497 or as modified by Buck, D.
  • myeloma lines including but not limited to X63-Ag8.653 and those from the Salk Institute, Cell Distribution Center, San Diego, Calif, USA, may be used in the hybridization.
  • a fusogen such as polyethylene glycol
  • the technique involves fusing myeloma cells and lymphoid cells using a fusogen such as polyethylene glycol, or by electrical means well known to those skilled in the art.
  • the cells are separated from the fusion medium and grown in a selective growth medium, such as hypoxanthine-aminopterin-thymidine (HAT) medium, to eliminate unhybridized parent cells.
  • HAT hypoxanthine-aminopterin-thymidine
  • EBV immortalized B cells may be used to produce the anti-NGF monoclonal antibodies of the subject invention.
  • the hybridomas are expanded and subcloned, if desired, and supernatants are assayed for anti-immunogen activity by conventional immunoassay procedures (e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay).
  • Hybridomas that may be used as source of antibodies encompass all derivatives, progeny cells of the parent hybridomas that produce monoclonal antibodies specific for NGF, or a portion thereof.
  • Hybridomas that produce such antibodies may be grown in vitro or in vivo using known procedures.
  • the monoclonal antibodies may be isolated from the culture media or body fluids, by conventional immunoglobulin purification procedures such as ammonium sulfate precipitation, gel electrophoresis, dialysis, chromatography, and ultrafiltration, if desired.
  • Undesired activity if present, can be removed, for example, by running the preparation over adsorbents made of the imrnunogen attached to a solid phase and eluting or releasing the desired antibodies off the imrnunogen.
  • a protein that is immunogenic in the species to be immunized e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin
  • the anti-NGF antibody (monoclonal or polyclonal) of interest may be sequenced and the polynucleotide sequence encoding the anti-NGF antibody polypeptide may then be cloned into a vector for expression or propagation.
  • the sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use.
  • the polynucleotide sequence may be used for genetic manipulation to "humanize" the antibody or to improve the affinity, or other characteristics of the antibody.
  • the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans.
  • a number of "humanized" antibody molecules comprising an antigen-binding site derived from a non-human immunoglobulin have been described, including chimeric antibodies having rodent or modified rodent V regions and their associated complementarity determining regions (CDRs) fused to human constant domains.
  • CDRs complementarity determining regions
  • rodent CDRs grafted into a human supporting framework region Prior to fusion with an appropriate human antibody constant domain. See, for example, Riechmann et al Nature 332:323-327 (1988), Verhoeyen et al. Science 239:1534-1536 (1988), and Jones et al. Nature 321:522- 525 (1986).
  • Another reference describes rodent CDRs supported by recombinantly veneered rodent framework regions. See, for example, European Patent Publication No. 519,596. These "humanized" molecules are designed to minimize unwanted immunological response toward rodent anti-human antibody molecules which limits the duration and effectiveness of therapeutic applications of those moieties in human recipients.
  • the antibody constant region can be engineered such that it is immunologically inert (e.g., does not trigger complement lysis). See, e.g. PCT/GB99/01441; UK patent application No. 9809951.8.
  • Other methods of humanizing antibodies that may also be utilized are disclosed by Daugherty et al, Nucl. Acids Res. 19:2471-2476 (1991) and in U.S. Patent Nos. 6,180,377; 6,054,297; 5,997,867; 5,866,692; 6,210671; 6,350,861; and PCT Publication No. WO 01/27160. Other methods are described in U.S. Ser. No. 10/745,775.
  • Fully human antibodies may be obtained by using commercially available mice that have been engineered to express specific human immunoglobulin proteins.
  • Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response may also be used for generation of humanized or human antibodies. Examples of such technology are Xenomouse TM from Abgenix, Inc. (Fremont, CA) and HuMAb-Mouse® and TC MouseTM from Medarex, Inc. (Princeton, NJ).
  • antibodies may be made recombinantly and expressed using any method known in the art.
  • antibodies may be made recombinantly by phage display technology. See, for example, U.S. Patent Nos. 5,565,332; 5,580,717; 5,733,743; 6,265,150; and Winter et l, Annu. Rev. Immunol 12:433-455 (1994).
  • the phage display technology McCafferty et al, Nature 348:552-553 (1990)
  • V immunoglobulin variable
  • antibody V domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as Ml 3 or fd, and displayed as functional antibody fragments on the surface of the phage particle.
  • a filamentous bacteriophage such as Ml 3 or fd
  • the filamentous particle contains a single-stranded DNA copy of the phage genome
  • selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties.
  • the phage mimics some of the properties of the B cell.
  • Phage display can be performed in a variety of formats; for review see, e.g., Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural Biology 3, 564-571 (1993).
  • V-gene segments can be used for phage display.
  • Clackson et al Nature 352:624-628 (1991) isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V genes derived from the spleens of immunized mice.
  • a repertoire of V genes from unimmunized human donors can be constructed and antibodies to a diverse array of antigens (including self-antigens) can be isolated essentially following the techniques described by Mark et al, J. Mol Biol. 222:581-597 (1991), or Griffith et al, EMBOJ. 12:725-734 (1993).
  • antibody genes accumulate mutations at a high rate (somatic hypermutation).
  • Antibodies may be made recombinantly by first isolating the antibodies and antibody producing cells from host animals, obtaining the gene sequence, and using the gene sequence to express the antibody recombinantly in host cells (e.g., CHO cells). Another method which may be employed is to express the antibody sequence in plants (e.g., tobacco) or transgenic milk. Methods for expressing antibodies recombinantly in plants or milk have been disclosed. See, for example, Peeters, et al. Vaccine 19:2756 (2001); Lonberg, N. and D. Huszar Int. Rev. Immunol 13:65 (1995); and Pollock, et al, J Immunol Methods 231:147(1999). Methods for making derivatives of antibodies, e.g., humanized, single chain, etc. are known in the art.
  • Immunoassays and flow cytometry sorting techniques such as fluorescence activated cell sorting (FACS) can also be employed to isolate antibodies that are specific for NGF.
  • FACS fluorescence activated cell sorting
  • the antibodies can be bound to many different carriers.
  • Carriers can be active and/or inert. Examples of well-known carriers include polypropylene, polystyrene, polyethylene, dextran, nylon, amylases, glass, natural and modified celluloses, polyacrylamides, agaroses and magnetite. The nature of the carrier can be either soluble or insoluble for purposes of the invention. Those skilled in the art will know of other suitable carriers for binding antibodies, or will be able to ascertain such, using routine experimentation.
  • DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies).
  • the hybridoma cells serve as a preferred source of such DNA.
  • the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
  • the DNA also may be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences, Morrison et ah, Proc. Nat. Acad. Sci. 81:6851 (1984), or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.
  • "chimeric" or “hybrid” antibodies are prepared that have the binding specificity of an anti- NGF monoclonal antibody herein.
  • the DNA encoding an antagonist anti-NGF antibody (such as a humanized anti-human NGF antagonist antibody) can be used for delivery and expression of antagonist anti-NGF antibody by a desired cell, as described herein. DNA delivery techniques are further described herein.
  • Anti-NGF antibodies may be characterized using methods well known in the art. For example, one method is to identify the epitope to which it binds, termed "epitope mapping.” There are many methods known in the art for mapping and characterizing the location of epitopes on proteins, mcluding solving the crystal structure of an antibody- antigen complex, competition assays, gene fragment expression assays, and synthetic peptide-based assays, as described, for example, in Chapter 11 of Harlow and Lane, Using Antibodies, a Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1999. In an additional example, epitope mapping can be used to determine the sequence to which an anti-NGF antibody binds.
  • Epitope mapping is commercially available from various sources, for example, Pepscan Systems (Edelhertweg 15, 8219 PH Lelystad, The Netherlands).
  • the epitope can be a linear epitope, i.e., contained in a single stretch of amino acids, or a conformational epitope formed by a three-dimensional interaction of amino acids that may not necessarily be contained in a single stretch.
  • Peptides of varying lengths e.g., at least 4-6 amino acids long
  • the epitope to which the anti-NGF antibody binds can be determined in a systematic screening by using overlapping peptides derived from the NGF sequence and determining binding by the anti-NGF antibody.
  • the gene fragment expression assays the open reading frame encoding NGF is fragmented either randomly or by specific genetic constructions and the reactivity of the expressed fragments of NGF with the antibody to be tested is determined.
  • the gene fragments may, for example, be produced by PCR and then transcribed and translated into protein in vitro, in the presence of radioactive amino acids. The binding of the antibody to the radioactively labeled NGF fragments is then determined by immunoprecipitation and gel electrophoresis.
  • Certain epitopes can also be identified by using large libraries of random peptide sequences displayed on the surface of phage particles (phage libraries). Alternatively, a defined library of overlapping peptide fragments can be tested for binding to the test antibody in simple binding assays.
  • mutagenesis of an antigen binding domain, domain swapping experiments and alanine scanning mutagenesis can be performed to identify residues required, sufficient, and/or necessary for epitope binding.
  • domain swapping experiments can be performed using a mutant NGF in which various fragments of the NGF polypeptide have been replaced (swapped) with sequences from a closely related, but antigenically distinct protein (such as another member of the neurotrophin protein family). By assessing binding of the antibody to the mutant NGF, the importance of the particular NGF fragment to antibody binding can be assessed.
  • Yet another method which can be used to characterize an anti-NGF antibody is to use competition assays with other antibodies known to bind to the same antigen, i.e., various fragments on NGF, to determine if the anti-NGF antibody binds to the same epitope as other antibodies.
  • Competition assays are well known to those of skill in the art.
  • Example of antibodies that can be used in the competition assays for the present invention include MAb 911, 912, 938, as described in Hongo, et al, Hybridoma 19:215-227 (2000).
  • NGF antagonists other than anti-NGF antibodies may be used.
  • the NGF antagonist comprises at least one antisense molecule capable of blocking or decreasing the expression of a functional NGF, or of functional trkA and/or p75 receptor.
  • Nucleotide sequences of NGF, trkA and p75 are known and are readily available from publicly available databases. See, e.g., Borsani et al, Nuc. Acids Res. 1990, 18, 4020; Accession Number NM 002506; Ullrich et al, Nature 303:821-825 (1983).
  • oligonucleotide molecules that will specifically bind NGF, trkA or p75 mRNA without cross-reacting with other polynucleotides.
  • sites of targeting include, but are not limited to, the initiation codon, the 5' regulatory regions, the coding sequence and the 3' untranslated region.
  • the oligonueleotides are about 10 to 100 nucleotides in length, about 15 to 50 nucleotides in length, about 18 to 25 nucleotides in length, or more.
  • the oligonueleotides can comprise backbone modifications such as, for example, phosphorothioate linkages, and 2'-O sugar modifications well know in the art.
  • antisense molecules include the NGF antisense molecules described in U.S. Publication No. 20010046959; see also http://www.ma-tec.com/repair.htm. [0108]
  • NGF expression and/or release can be decreased using gene knockdown, morpholino oligonueleotides, RNAi, or ribozymes, methods that are well- known in the art. See e.g., Rossi, J.J.
  • the NGF antagonist comprises at least one NGF inhibitory compound.
  • NGF inhibitory compound refers to a compound other than an anti-NGF antibody that dhectly or indirectly reduces, inhibits, neutralizes, or abolishes NGF biological activity.
  • An NGF inhibitory compound should exhibit any one or more of the following characteristics: (a) bind to NGF and inhibit NGF biological activity and/or downstream pathway(s) mediated by NGF signaling function; (b) treating or preventing any aspect of pain, particularly in conjunction with an NSAID; (c) block or decrease NGF receptor activation (including trkA receptor dimerization and/or autophosphorylation); (d) increase clearance of NGF; (e) inhibit (reduce) NGF synthesis, production or release; (f) enhance NSAID treatment of pain.
  • Exemplary NGF inhibitory compounds include the small molecule NGF inhibitors described in U.S. Publication No. 20010046959; the compounds that inhibit NGF's binding to p75, as described in PCT Publication No.
  • NGF inhibitory compounds include the compounds described in PCT Publication Nos. WO 02/17914, WO 02/20479, U.S. Patent No. 5,342,942, 6,127,401, and 6,359,130.
  • Further exemplary NGF inhibitory compounds are compounds that are competitive inhibitors of NGF. See U.S. Patent No. 6,291,247.
  • one skilled in the art can prepare other small molecules NGF inhibitory compounds.
  • an NGF inhibitory compound binds NGF.
  • sites of targeting include, but are not limited to, the portion of the NGF that binds to the TrkA receptor and/or p75 receptor, and those portions of the NGF that are adjacent to the receptor-binding region and which are responsible, in part, for the correct three-dimensional shape of the receptor-binding portion.
  • an NGF inhibitory compound binds an NGF receptor (such as TrkA and/or p75) and inhibits an NGF biological activity.
  • Exemplary sites of targeting include those portions of TrkA and/or p75 that bind to NGF.
  • a small molecule in embodiment comprising small molecule, can have a molecular weight of about any of 100 to 20,000 daltons, 500 to 15,000 daltons, or 1000 to 10,000 daltons. Libraries of small molecules are commercially available.
  • the small molecules can be administered using any means known in the art, including inhalation, intraperitoneally, intravenously, hitramuscularly, subcutaneously, intrathecally, intraventricularly, orally, enterally, parenterally, intranasally, or dermally.
  • the NGF-antagonist when the NGF-antagonist is a small molecule, it will be administered at the rate of 0.1 to 300 mg/kg of the weight of the patient divided into one to three or more doses. For an adult patient of normal weight, doses ranging from 1 mg to 5g per dose can be administered.
  • the NGF antagonist comprises at least one NGF structural analog.
  • NGF structural analogs in the present invention refer to compounds that have a similar 3-dimensional structure as part of that of NGF and which bind to an NGF receptor under physiological conditions in vitro or in vivo.
  • the NGF structural analog binds to a TrkA and/or a p75 receptor.
  • Exemplary NGF structural analogs include, but are not limited to, the bicyclic peptides described in PCT Publication No. WO 97/15593; the bicyclic peptides described in U.S. Patent No. 6,291,247; the cyclic compounds described in U.S. Patent No.
  • NGF structural analogs can also be designed and synthesized through molecular modeling of NGF-receptor binding, for example by the method described in PCT Publication No. WO 98/06048.
  • the NGF structural analogs can be monomers or dimers/oligomers in any desired combination of the same or different structures to obtain improved affinities and biological effects.
  • the invention provides an NGF antagonist comprising at least one dominant-negative mutant of the TrkA receptor and/or p75 receptor.
  • One skilled in the art can prepare dominant-negative mutants of, e.g., the TrkA receptor such that the receptor will bind the NGF and, thus, act as a "sink" to capture NGFs.
  • the dominant- negative mutants will not have the normal bioactivity of the receptor (such as TrkA receptor) upon binding to NGF.
  • Exemplary dominant-negative mutants include, but are not limited to, the mutants described in the following references: Li et ah, Proc. Natl. Acad. Sci. USA 1998, 95, 10884; Eide et al, J. Neurosci.
  • the dominant negative mutants can be administered in protein form or in the form of an expression vector such that dominant-negative mutant (e.g., a mutant TrkA receptor) is expressed in vivo.
  • the protein or expression vector can be administered using any means known in the art, such as intraperitoneally, intravenously, intramuscularly, subcutaneously, intrathecally, intraventricularly, orally, enterally, parenterally, intranasally, dermally, or by inhalation.
  • administration of expression vectors includes local or systemic administration, including injection, oral administration, particle gun or catheterized administration, and topical administration.
  • the protein or expression vector is administered directly to the sympathetic or sensory trunk or ganglion.
  • One skilled in the art is familiar with administration of expression vectors to obtain expression of an exogenous protein in vivo. See, e.g., U.S. Patent Nos. 6,436,908; 6,413,942; 6,376,471.
  • Targeted delivery of therapeutic compositions containing an antisense polynucleotide, expression vector, or subgenomic polynucleotides can also be used.
  • Receptor-mediated DNA delivery techniques are described in, for example, Findeis et al, Trends Biotechnol (1993) 11:202; Chiou et ⁇ /., Gene Therapeutics: Methods And Applications Of Direct Gene Transfer (J.A. Wolff, ed.) (1994); Wu et al, J. Biol Chem. (1988) 263:621; Wu et al, J. Biol. Chem. (1994) 269:542; Zenke et al, Proc. Natl. Acad. Sci.
  • compositions containing a polynucleotide are administered in a range of about 100 ng to about 200 mg (or more) of DNA for local administration in a gene therapy protocol.
  • concentration ranges of less than about 500 ng, about 500 ng to about 50 mg, about 1 ⁇ g to about 2 mg, about 5 ⁇ g to about 500 ⁇ g, and about 20 ⁇ g to about 100 ⁇ g or more of DNA can also be used during a gene therapy protocol.
  • the therapeutic polynucleotides and polypeptides of the present invention can be delivered using gene delivery vehicles.
  • the gene delivery vehicle can be of viral or non- viral origin (see generally, Jolly, Cancer Gene Therapy (1994) 1:51; Kimura, Human Gene Therapy (1994) 5:845; Connelly, Human Gene Therapy (1995) 1:185; and Kaplitt, Nature Genetics (1994) 6: 148). Expression of such coding sequences can be induced using endogenous mammalian or heterologous promoters and/or enhancers. Expression of the coding sequence can be either constitutive or regulated.
  • Viral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art.
  • Exemplary viral-based vehicles include, but are not limited to, recombinant retroviruses (see, e:g., PCT Publication Nos. WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/11230; WO 93/10218; WO 91/02805; U.S. Patent Nos. 5, 219,740; 4,777,127; GB Patent No. 2,200,651; and EP Pat. No.
  • alphavirus-based vectors e.g., Sindbis virus vectors, Semliki forest virus (ATCC VR-67; ATCC VR-1247), Ross River virus (ATCC VR-373; ATCC VR-1246) and Venezuelan equine encephalitis virus (ATCC VR-923; ATCC VR-1250; ATCC VR 1249; ATCC VR-532)
  • AAV adeno-associated virus
  • Non-viral delivery vehicles and methods can also be employed, including, but not limited to, polycationic condensed DNA linked or unlinked to killed adenovirus alone (see, e.g., Curiel, Hum. Gene Ther. (1992) 3:147); ligand-linked DNA(see, e.g., Wu, J. Biol. Chem. (1989) 264:16985); eukaryotic cell delivery vehicles cells (see, e.g., U.S. Patent No. 5,814,482; PCT Publication Nos. WO 95/07994; WO 96/17072; WO 95/30763; and WO 97/42338) and nucleic charge neutralization or fusion with cell membranes.
  • polycationic condensed DNA linked or unlinked to killed adenovirus alone see, e.g., Curiel, Hum. Gene Ther. (1992) 3:147
  • ligand-linked DNA see, e.g., Wu, J. Biol. Chem. (1989)
  • Naked DNA can also be employed.
  • Exemplary naked DNA introduction methods are described in PCT Publication No. WO 90/11092 and U.S. Patent No. 5,580,859.
  • Liposomes that can act as gene delivery vehicles are described in U.S. Patent No. 5,422,120; PCT Publication Nos. WO 95/13796; WO 94/23697; WO 91/14445; and EP Pat. No. 0 524 968. Additional approaches are described in Philip, Mol Cell Biol (1994) 14:2411, and in Woffendin, Proc. Natl Acad. Sci. (1994) 91:1581.
  • an expression vector can be used to direct expression of any of the protein-based NGF antagonists described herein (e.g., anti-NGF antibody, TrkA immunoadhesin, etc.).
  • a polynucleotide encoding an antagonist anti-NGF antibody may also be used for delivery and expression of antagonist anti-NGF antibody in a desired cell.
  • an expression vector can be used to direct expression of an antagonist anti-NGF antibody.
  • the expression vector can be administered intraperitoneally, intravenously, intramuscularly, subcutaneously, intrathecally, intraventricularly, orally, enterally, parenterally, intranasally, dermally, or by inhalation.
  • administration of expression vectors includes local or systemic administration, including injection, oral administration, particle gun or catheterized administration, and topical administration.
  • administration of expression vectors includes local or systemic administration, including injection, oral administration, particle gun or catheterized administration, and topical administration.
  • one skilled in the art is familiar with administration of expression vectors to obtain expression of an exogenous protein hi vivo. See, e.g., U.S. Patent Nos. 6,436,908; 6,413,942; and 6,376,471.
  • Other TrkA receptor fragments that are capable of blocking (from partial to complete blocking) NGF and/or an NGF biological activity are known in the art.
  • the NGF antagonist comprises at least one TrkA immunoadhesin.
  • TrkA immunoadhesins refer to soluble chimeric molecules comprising the extracellular domain of a TrkA receptor (or a portion thereof) and an immunoglobulin sequence, which retains the binding specificity (in some embodiments, substantially retains the binding specificity) of the TrkA receptor and is capable of binding to NGF.
  • a TrkA immunoadhesin is capable of blocking (reducing and/or suppressing) a NGF biological activity, as described herein. [0119] TrkA immunoadhesins are known in the art, and have been found to block (reduce or suppress) the binding of NGF to the TrkA receptor. See, e.g., U.S. Patent No. 6,153,189.
  • the TrkA immunoadhesin comprises a fusion of a TrkA receptor amino acid sequence capable of binding NGF (or an amino acid sequence that substantially retains the binding specificity of the trkA receptor) and an immunoglobulin sequence (or an amino acid that substantially retains the binding specificity of the TrkA receptor).
  • the TrkA receptor is a human TrkA receptor sequence
  • the fusion is with an immunoglobulin constant domain sequence.
  • the immunoglobulin constant domain sequence is an immunoglobulin heavy chain constant domain sequence.
  • TrkA receptor-immunoglobulin heavy chain fusions results in a homodimeric immunoglobulin-like structure.
  • An immunoglobulin light chain can further be associated with one or both of the TrkA receptor- immunoglobulin chimeras in the disulfide-bonded dimer to yield a homotrimeric or homotetrameric structure.
  • TrkA immunoadhesins include those described in U.S. Patent No. 6,153,189.
  • the NGF antagonist comprises at least one anti-TrkA antibody capable of blocking, suppressing, altering, and/or reducing NGF physical interaction with the TrkA receptor and/or downstream signaling, whereby an NGF biological activity is reduced and/or blocked.
  • Anti-TrkA antibodies are known in the art. Exemplary anti-TrkA antibodies include those described in PCT Publication Nos. WO 97/21732, WO 00/73344, WO 02/15924, and U.S. Publication No. 20010046959.
  • the NGF antagonist comprises at least one anti-p75 antibody capable of blocking, suppressing and/or reducing NGF physical interaction with the p75 receptor and/or downstream signaling, whereby an NGF biological activity is reduced and/or blocked.
  • the NGF antagonist comprises at least one kinase inhibitor capable of inhibiting downstream kinase signaling associated with TrkA and/or p75 receptor activity.
  • exemplary kinase inhibitors are K252a or K252b, which are known in the art and described in Knusel et al, J. Neurochem. 59:715-722 (1992); Knusel et al, J. Neurochemistry 57:955-962 (1991); Koizumi etal, J. Neuroscience 8:715-721 (1988); Hirata et al, Chemical Abstracts 111 :728, XP00204135, see abstract and 12th Collective Chemical Substance Index, p. 34237, c.
  • Anti-NGF antibodies and other NGF antagonists can be identified or characterized using methods known in the art, whereby reduction, amelioration, or neutralization of an NGF biological activity is detected and/or measured.
  • a kinase receptor activation (KIRA) assay described in U.S. Patent No. 5,766,863 and 5,891,650 can be used to identify anti-NGF agents.
  • This ELISA-type assay is suitable for qualitative or quantitative measurement of kinase activation by measuring the autophosphorylation of the kinase domain of a receptor protein tyrosine kinase (hereinafter "rPTK”), e.g.
  • rPTK receptor protein tyrosine kinase
  • TrkA receptor as well as for identification and characterization of potential antagonists of a selected rPTK, e.g., TrkA.
  • the first stage of the assay involves phosphorylation of the kinase domain of a kinase receptor, for example, a TrkA receptor, wherein the receptor is present in the cell membrane of a eukaryotic cell.
  • the receptor may be an endogenous receptor or nucleic acid encoding the receptor, or a receptor construct, may be transformed into the cell.
  • a first solid phase e.g., a well of a first assay plate
  • a substantially homogeneous population of such cells usually a mammalian cell line
  • a "receptor construct” it usually comprises a fusion of a kinase receptor and a flag polypeptide.
  • the flag polypeptide is recognized by the capture agent, often a capture antibody, in the ELISA part of the assay.
  • An analyte such as a candidate anti-NGF antibody or other NGF antagonist, is then added together with NGF to the wells having the adherent cells, such that the tyrosine kinase receptor (e.g. TrkA receptor) is exposed to (or contacted with) NGF and the analyte.
  • This assay enables identification antibodies (or other NGF antagonist) that inhibit activation of TrkA by its ligand NGF.
  • the adhering cells are solubilized using a lysis buffer (which has a solubilizing detergent therein) and gentle agitation, thereby releasing cell lysate which can be subjected to the ELISA part of the assay directly, without the need for concentration or clarification of the cell lysate.
  • the cell lysate thus prepared is then ready to be subjected to the ELISA stage of the assay.
  • a second solid phase usually a well of an ELISA microtiter plate
  • a capture agent which binds specifically to the tyrosine kinase receptor, or, in the case of a receptor construct, to the flag polypeptide.
  • Coating of the second solid phase is carried out so that the capture agent adheres to the second solid phase.
  • the capture agent is generally a monoclonal antibody, but, as is described in the examples herein, polyclonal antibodies may also be used.
  • the cell lysate obtained is then exposed to, or contacted with, the adhering capture agent so that the receptor or receptor construct adheres to (or is captured in) the second solid phase.
  • a washing step is then carried out, so as to remove unbound cell lysate, leaving the captured receptor or receptor construct.
  • the adhering or captured receptor or receptor construct is then exposed to, or contacted with, an anti-phosphotyrosine antibody which identifies phosphorylated tyrosine residues in the tyrosine kinase receptor.
  • the anti-phosphotyrosine antibody is conjugated (directly or indirectly) to an enzyme which catalyses a color change of a non-radioactive color reagent.
  • phosphorylation of the receptor can be measured by a subsequent color change of the reagent.
  • the enzyme can be bound to the anti-phosphotyrosine antibody directly, or a conjugating molecule (e.g., biotin) can be conjugated to the anti-phosphotyrosine antibody and the enzyme can be subsequently bound to the anti-phosphotyrosine antibody via the conjugating molecule.
  • binding of the anti-phosphotyrosine antibody to the captured receptor or receptor construct is measured, e.g., by a color change in the color reagent.
  • the NGF antagonists can also be identified by incubating a candidate agent with NGF and monitoring any one or more of the following characteristics: (a) binding to NGF and inhibiting NGF biological activity and/or downstream pathway(s) mediated by NGF signaling function; (b) blocking or decreasing NGF receptor activation; (c) increasing clearance of NGF; (d) inhibiting NGF receptor activation (including TrkA dimerization and/or autophosphorylation); (e) treating, ameliorating or preventing any aspect of pain, particularly in conjunction with an NSAID; (f) inhibit (reduce) NGF synthesis, production or release; (g) enhance NSAID treatment of pain..
  • an NGF antagonist is identified by incubating an candidate agent with NGF and monitoring binding and attendant reduction or neutralization of a biological activity of NGF.
  • the binding assay may be performed with purified NGF polypeptide(s), or with cells naturally expressing, or transfected to express, NGF polypeptide(s).
  • the binding assay is a competitive binding assay, where the ability of a candidate antibody to compete with a known NGF antagonist for NGF binding is evaluated.
  • the assay may be performed in various formats, including the ELISA format.
  • an NGF antagonist is identified by incubating a candidate agent with NGF and monitoring attendant inhibition of TrkA receptor dimerization and/or autophosphorylation.
  • NGF promotes a number of morphologically recognizable changes in responsive cells. These include, but are not limited to, promoting the differentiation of PC 12 cells and enhancing the growth of neurites from these cells (Urfer et al, Biochem. 36:4775-4781 (1997); Tsoulfas et al, Neuron 10:975-990 (1993)), promoting neurite outgrowth from explants of responsive sensory and sympathetic ganglia (Levi-Montalcini, R. and Angeletti, P. Nerve growth factor.
  • the assay for inhibition of NGF biological activity entail culturing NGF responsive cells with NGF plus an analyte, such as a candidate anti-NGF antibody and a candidate NGF antagonist. After an appropriate time the cell response will be assayed (cell differentiation, neurite outgrowth or cell survival).
  • the ability of a candidate NGF antagonist to block or neutralize a biological activity of NGF can also be carried out by monitoring the ability of the candidate agent to inhibit NGF mediated survival in the embryonic rat dorsal root ganglia survival bioassay as described in Hongo et al, Hybridoma 19:215-227 (2000).
  • a method of identifying modulators of NGF activity is described in PCT/US2004/01609.
  • compositions of the invention comprise an effective amount of an NGF antagonist (such as anti-NGF antibody) and an NSAID, as described in various embodiments herein.
  • the compositions further comprise a pharmaceutically acceptable excipient.
  • the composition is for use in any of the methods described herein (such as methods for treating post-surgical pain). Examples of such compositions, as well as how to formulate, are also described in an earlier section and below.
  • the NGF antagonist and NSAID may be present in a single composition or present as separate compositions. Accordingly, in some embodiments, the NGF antagonist and the NSAID are present in the same composition. In other embodiments, the NGF antagonist and NSAID are present in separate compositions.
  • the invention provides a synergistic composition of an NGF antagonist and an NSAID.
  • the invention provides pharmaceutical compositions comprising an NGF antagonist for use in the treatment of pain (such as post-surgical pain), wherein said use comprises simultaneous and/or sequential administration of an NSAID.
  • the invention provides pharmaceutical compositions comprising an NSAID for use in the treatment of pain, wherein said use comprises simultaneous and/or sequential administration of an NGF antagonist.
  • the invention provides pharmaceutical compositions comprising an NGF antagonist and an NSAID for separate, simultaneous and/or sequential use for treatment of pain.
  • the NGF antagonist is an anti-NGF antibody (such as antibody E3 as described herein).
  • the NSAID is ibuprofen.
  • the NGF antagonist is an anti-NGF antibody and the NSAID is ibuprofen.
  • the compositions can comprise more than one NGF antagonist.
  • a composition can comprise more than one member of a class of NGF antagonist (e.g., a mixture of anti-NGF antibodies that recognize different epitopes of NGF) , as well as members of different classes of NGF antagonists (e.g., an anti-NGF antibody and an NGF inhibitory compound).
  • Other exemplary compositions comprise more than one anti-NGF antibodies that recognize the same epitope(s), different species of anti-NGF antibodies that bind to different epitopes of NGF, or different NGF inhibitory compounds.
  • the composition comprises one or more NGF antagonists selected from the group consisting of an antagonist that binds (physically interacts with) NGF (e.g., an antibody), an antagonist that binds to an NGF receptor (such as the TrkA receptor or the p75 receptor), and an antagonist that reduces (impedes and/or blocks) downstream NGF receptor signaling.
  • an antagonist that binds (physically interacts with) NGF e.g., an antibody
  • an antagonist that binds to an NGF receptor such as the TrkA receptor or the p75 receptor
  • an antagonist that reduces (impedes and/or blocks) downstream NGF receptor signaling e.g., an antagonist that binds (physically interacts with) NGF (e.g., an antibody)
  • an antagonist that binds to an NGF receptor such as the TrkA receptor or the p75 receptor
  • composition used in the present invention can further comprise pharmaceutically acceptable carriers, excipients, or stabilizers (Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover), in the form of lyophilized formulations or aqueous solutions.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations used, and may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine,
  • compositions described herein may contain additional compounds known to be useful for the treatment of pain.
  • the NGF antagonist and NSAID, and compositions thereof can also be used in conjunction with other agents that serve to enhance and/or complement the effectiveness of the agents.
  • the invention provides compositions (described herein) for use in any of the methods described herein, whether in the context of use as a medicament and/or use for manufacture of a medicament.
  • kits of the invention include one or more containers comprising an NGF antagonist (such as an anti- NGF antibody), an NSAID, and in some embodiments, further comprise instructions for use in accordance with any of the methods described herein.
  • the kit comprises an anti-NGF antibody (such as antibody E3 described herein).
  • the kit comprises an anti-NGF antibody comprising one or more CDR(s) of antibody E3 (such as one, two, three, four, five, or, in some embodiments, all six CDRs from E3).
  • the kit may further comprise a description of selecting an individual suitable for treatment based on identifying whether that individual has pain or whether the individual is at risk of pain.
  • kits for use with any of the methods described herein said kit comprising an NGF antagonist.
  • the kit comprises an anti-NGF antibody.
  • the kit comprises a humanized anti-NGF antibody (such as antibody E3 described herein).
  • the instructions comprise description of administering an NGF antagonist in conjunction with NSAIDs to treat, prevent and/or ameliorate any pain (such as post-surgical pain, pain associated with burn, rheumatoid arthritis, or osteoarthritis).
  • the kit comprises an NGF antagonist (such as an anti- NGF antibody), an NSAID, and instructions for administering the NGF antagonist and the NSAID simultaneously and/or sequentially, for the effective treatment of pain.
  • the kit comprises an NGF antagonist (such as an anti-NGF antibody), and instructions for administering the NGF antagonist (such as anti-NGF antibody) and an NSAID in conjunction with each other, for the effective treatment of pain.
  • the kit comprises an NGF antagonist (such as an anti-NGF antibody), and an NSAID (such as ibuprofen), and instruction for administering the NGF antagonist and the NSAID in conjunction with each other, for the effective treatment of pain.
  • the kit comprises an anti-NGF antibody.
  • the anti-NGF antibody is an antibody comprising the heavy chain variable region shown in Table 1 and the light chain variable region shown in Table 2.
  • the anti-NGF antibody is antibody E3 as described herein.
  • the NGF antagonist (such as an anti-NGF antibody) and NSAID can be present in separate containers or in a single container. It is understood that the kit may comprise one distinct composition or two or more compositions wherein one composition comprises an NGF antagonist and one composition comprises an NSAID.
  • the kits of this invention are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Kits may optionally provide additional components such as buffers and interpretive information.
  • the instructions relating to the use of an NGF antagonist generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
  • the containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses.
  • Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
  • kits of this invention are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Also contemplated are packages for use in combination with a specific device, such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump.
  • a specific device such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump.
  • a kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • the container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • At least one active agent in the composition is an NGF antagonist, such as an anti-NGF antibody.
  • the container may further comprise a second pharmaceutically active agent.
  • Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container.
  • kits comprising contents of the kits described above.
  • the kits comprise an NGF antagonist (such as anti-NGF antibody) and/or NSAID with information indicating use to treat pain (in conjunction with each other).
  • the NGF antagonist and NSAID can be administered to an individual via any suitable route.
  • they can be administered together or separately, orally, intravenously, sublingually, subcutaneously, intraarterially, intramuscularly, intraspinally, rectally, intrathoracically, intraperitoneally, intraventricularly, sublingually, transdermally or by inhalation.
  • They can be administered orally, for example, in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, chewing gum, lolliopops, suppositories or the like prepared by art recognized procedures. It will be apparent to a person skilled in the art that the examples described herein are not intended to be limiting but to be illustrative of the techniques available.
  • the NGF antagonist such as an anti-NGF antibody
  • intravenous administration e.g., as a bolus or by continuous infusion over a period of time
  • intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, inhalation or topical routes e.g., nebulizers for liquid formulations, including jet nebulizers and ultrasonic nebulizers are useful for administration. Liquid formulations can be directly nebulized and lyophilized powder can be nebulized after reconstitution.
  • NGF antagonist such as anti- NGF antibody
  • NGF antagonist can be aerosolized using a fluorocarbon formulation and a metered dose inhaler, or inhaled as a lyophilized and milled powder.
  • Site-specific or targeted local delivery techniques are also useful for administration. Examples of site-specific or targeted local delivery techniques include various implantable depot sources of the NGF antagonist and/or NSAID, or local delivery catheters, such as infusion catheters, an indwelling catheter, or a needle catheter, synthetic grafts, adventitial wraps, shunts and stents or other implantable devices, site specific carriers, direct injection, use of a patient controlled analgesis (PC A) technique or device, and/or direct application. See, e.g., PCT Publication No. WO 00/53211 and U.S. Patent No. 5,981,568.
  • PC A patient controlled analgesis
  • agents such as anti-NGF antibodies or fragments thereof may be used for administration.
  • agent(s) such as the anti-NGF antibodies or fragments thereof may be administered neat.
  • the agents comprise an anti-NGF antibody may be in various formulations, including formulations comprising a pharmaceutically acceptable excipient.
  • Pharmaceutically acceptable excipients are known in the art, and are relatively inert substances that facilitate administration of a pharmacologically effective substance. For example, an excipient can give form or consistency, or act as a diluent.
  • Suitable excipients include but are not limited to stabilizing agents, wetting and emulsifying agents, salts for varying osmolarity, encapsulating agents, buffers, and skin penetration enhancers. Excipients as well as formulations for parenteral and nonparenteral drug delivery are set forth in Remington, et al, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).
  • these agents are formulated for administration by injection (e.g., intraperitoneally, intravenously, subcutaneously, intramuscularly, etc.). Accordingly, these agents can be combined with pharmaceutically acceptable vehicles such as saline, Ringer's solution, dextrose solution, and the like.
  • pharmaceutically acceptable vehicles such as saline, Ringer's solution, dextrose solution, and the like.
  • the particular dosage regimen i.e., dose, timing and repetition, will depend on the particular individual and that individual's medical history.
  • the dosing regimen can vary over time.
  • Anti-NGF antibodies can be administered using any suitable method, including by injection (e.g., intraperitoneally, intravenously, subcutaneously, intramuscularly, etc.). Anti- NGF antibodies can also be administered via inhalation, as described herein. Generally, for administration of anti-NGF antibodies, an initial candidate dosage can be about 0.2 mg/kg or about 2 mg/kg. In some embodiments, a typical daily dosage might range from any of about 3 ⁇ g/kg to 30 ⁇ g/kg to 300 ⁇ g/kg to 3 mg/kg to 30 mg/kg to 100 mg/kg or more, depending on the factors mentioned above.
  • An exemplary dosing regimen comprises administering an initial dose of about 2 mg/kg, followed by a weekly maintenance dose of about 1 mg/kg of the anti-NGF antibody, or followed by a maintenance dose of about 1 mg/kg every other week.
  • other dosage regimens may be useful, depending on the pattern of pharmacokinetic decay that the practitioner wishes to achieve. For example, dosing from one-four times a week is contemplated.
  • Other dosing regimens include a regimen of up to 1 time per day, 1 to 4 times per week, or less frequently.
  • the compounds are administered about once per week, about 1 to 4 times per month. Dosage of anti-NGF antibodies are described herein. The progress of this therapy is easily monitored by conventional techniques and assays. [0151] In some embodiments, when it is not an antibody, an NGF antagonist according to the invention may be administered at the rate of 0.1 to 300 mg/kg of the weight of the patient divided into one to three doses, or as disclosed herein. In some adult patients of normal weight, doses ranging from about 0.3 to 5.00 mg/kg may be administered.
  • the particular dosage regimen i.e., dose, timing and repetition, will depend on the particular individual and that individual's medical history, as well as the properties of the individual agents (such as the half-life of the agent, and other considerations well known in the art).
  • the NSAID may be administered at a dosage level up to conventional dosage levels for such analgesics. In some embodiment, the NSAID is administered at a reduced level. Suitable dosage levels will depend upon the analgesic effect of the chosen NSAID, but typically suitable levels will be about 0.001 to 25 mg/kg per day, about 0.005 to 10 mg/kg per day, or about 0.05 to 1 mg/kg per day, or less..
  • the compound may be administered on a regimen of up to 6 times per day (or more), 1 to 4 times per day, or it may be administered less often.
  • the NSAID is administered continuously, or very frequently (as with, for example PCA).
  • the nerve growth factor antagonist and the NSAID are presented in a ratio which is consistent with the manifestation of the desired effect.
  • by weight of the nerve growth factor antagonist to the NSAID will be approximately 1 to 1.
  • this ratio may be between about 0.001 to about 1 and about 1000 to about 1, between about 0.01 to about 1 and 100 to about 1, or between about 0.1 to about 1 and about 10 to about 1. Other ratios are contemplated.
  • a nerve growth factor antagonist and NSAID required for use in the treatment or prevention of pain will vary not only with the particular compounds or compositions selected but also with the route of administration, the nature of the condition being treated, and the age and condition of the patient, the course or stage of treatment, and will ultimately be at the discretion of the attending physician.
  • an NGF antagonist such as an anti- NGF antibody
  • the appropriate dosage of an NGF antagonist will depend on the NGF antagonist(s) (or compositions thereof) employed, the type and severity of the pain to be treated, whether the agent is admimstered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the agent, and the discretion of the attending physician.
  • the clinician will administer an NGF antagonist, such as an anti-NGF antibody, until a dosage is reached that achieves the desired result.
  • Empirical considerations such as the half-life, generally will contribute to the determination of the dosage.
  • antibodies that are compatible with the human immune system such as humanized antibodies or fully human antibodies may be used to prolong half-life of the antibody and to prevent the antibody being attacked by the host's immune system.
  • Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and/or suppression and/or amelioration and/or delay of pain.
  • sustained continuous release formulations of an NGF antagonist and/or an NSAID may be appropriate.
  • formulations and devices for achieving sustained release are known in the art.
  • dosages for an NGF antagonist may be determined empirically in individuals who have been given one or more administrations) of an agent that inhibits NGF activities to treat pain. Individuals are given incremental dosages of an agent that inhibits NGF, e.g., anti-NGF antibody, in conjunction with NSAID. To assess efficacy of the treatment, an indicator of pain can be followed.
  • Administration of an NGF antagonist and the NSAID in accordance with the method in the present invention can be continuous or intermittent, depending, for example, upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners.
  • an NGF antagonist may be essentially continuous over a preselected period of time or may be in a series of spaced dose, e.g., either before, during, or after developing pain; before and after; during and after; before and during; or before, during, and after developing pain.
  • administration can be before, during and/or after wound, incision, trauma, surgery, and any other event likely to give rise to pain.
  • more than one NGF antagonist, such as an antibody may be present.
  • the antagonist can be the same or different from each other. At least one, at least two, at least three, at least four, at least five, or more different NGF antagonists can be present. Generally, those NGF antagonists have complementary activities that do not adversely affect each other.
  • NGF antagonists can also be used in conjunction with other agents that serve to enhance and/or complement the effectiveness of the agents.
  • more than one NSAID may be present.
  • the NSAID can be the same or different from each other. At least one, at least two, at least three, at least four, at least five or more different NSAID can be present. Generally, those NSAIDs have complementary activities that do not adversely affect each other.
  • An NSAID(s) can also be used in conjunction with other agents that serve to enhance and/or complement the effectiveness of the agent(s).
  • Therapeutic formulations of the NGF antagonist (such as an antibody) and NSAID used in accordance with the present invention are prepared for storage by mixing an antibody having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000)), in the form of lyophilized formulations or aqueous solutions.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and may comprise buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride, antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine,
  • Liposomes containing the NGF antagonist are prepared by methods known in the art, such as described in Epstein, et al, Proc. Natl. Acad. Sci. USA 82:3688 (1985); Hwang, etal, Proc. Natl Acad. Sci. USA 77:4030 (1980); and U.S. Patent Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Patent No. 5,013,556.
  • Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG- PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
  • PEG- PE PEG-derivatized phosphatidylethanolamine
  • the active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-mefhacrylate), or 'poly(v nylalcohol)), polylactides (U.S. Patent No.
  • copolymers of L-glutamic acid and 7 ethyl-L- glutamate copolymers of L-glutamic acid and 7 ethyl-L- glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-(-)-3hydroxybutyric acid.
  • LUPRON DEPOTTM injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate
  • sucrose acetate isobutyrate sucrose acetate isobutyrate
  • poly-D-(-)-3hydroxybutyric acid poly-D-(-)-3hydroxybutyric acid.
  • compositions to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes.
  • Therapeutic NGF antagonist (such as anti-NGF antibody) compositions are generally placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
  • the compositions according to the present invention may be in unit dosage forms such as tablets, pills, capsules, powders, granules, solutions or suspensions, or suppositories, for oral, parenteral or rectal administration, or administration by inhalation or insufflation.
  • the principal active ingredient is mixed with a pharmaceutical carrier, e.g. conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g. water, to fonn a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof.
  • a pharmaceutical carrier e.g. conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g. water, to fonn a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof.
  • preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that the composition may be readily subdivided into equally effective unit dosage forms such as tablets, pills and capsules.
  • This solid preformulation composition is then subdivided into unit dosage forms of the type described above containing from about 0.01 mg to about 0.1 mg to about 500 mg of the active ingredient of the present invention.
  • the tablets or pills of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action.
  • the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former.
  • the two components can be separated by an enteric layer which serves to resist disintegration in the stomach and permits the inner component to pass intact into the duodenum or to be delayed in release.
  • enteric layers or coatings such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
  • the liquid forms in which the compositions of the present invention may be incorporated for administration orally or by injection include aqueous solutions, suitably flavored syrups, aqueous or oil suspensions, and flavored emulsions with edible oils such as cottonseed oil, sesame oil, coconut oil or peanut oil, as well as elixirs and similar pharmaceutical vehicles.
  • Suitable dispersing or suspending agents for aqueous suspensions include synthetic and natural gums such as tragacanth, acacia, alginate, dextran, sodium carboxymethylcellulose, methylcellulose, polyvinylpyrrolidone or gelatin.
  • the active ingredients may also be incorporated in highly viscous controlled release products such as sucrose acetate isobutyrate or others. These formulations may be used either for oral dosing, or injection. The injection can result in a local depot of the drug which is released locally over the course of 1 day to three months.
  • compositions for administration by injection include those comprising a NGF antagonist and an NSAID, as the active ingredients, in association with a surface-active agent (or wetting agent or surfactant) or in the form of an emulsion (as a water-in-oil or oil-in-water emulsion).
  • Suitable surface-active agents include, in particular, non-ionic agents, such as polyoxyethylenesorbitans (e.g. TweenTM 20, 40, 60, 80 or 85) and other sorbitans (e.g. SpanTM 20, 40, 60, 80 or 85).
  • Compositions with a surface-active agent will conveniently comprise between 0.05 and 5% surface-active agent, or between 0.1 and 2.5%. It will be appreciated that other ingredients may be added, for example mannitol or other pharmaceutically acceptable vehicles, if necessary.
  • Suitable emulsions may be prepared using commercially available fat emulsions, such as IntralipidTM, LiposynTM, InfonutrolTM, LipofundinTM and LipiphysanTM.
  • the active ingredient may be either dissolved in a pre-mixed emulsion composition or alternatively it may be dissolved in an oil (e.g. soybean oil, saf lower oil, cottonseed oil, sesame oil, corn oil or almond oil) and an emulsion formed upon mixing with a phospholipid (e.g. egg phospholipids, soybean phospholipids or soybean lecithin) and water.
  • an oil e.g. soybean oil, saf lower oil, cottonseed oil, sesame oil, corn oil or almond oil
  • a phospholipid e.g. egg phospholipids, soybean phospholipids or soybean lecithin
  • Suitable emulsions will typically contain up to 20% oil, for example, between 5 and 20%.
  • the fat emulsion can comprise fat droplets between 0.1 and 1.0 ⁇ m, particularly 0.1 and 0.5 ⁇ m, and have a pH in the range of5.5 to 8.0.
  • emulsion compositions are those prepared by mixing a nerve growth factor antagonist with IntralipidTM or the components thereof (soybean oil, egg phospholipids, glycerol and water).
  • compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders.
  • the liquid or solid compositions may contain suitable pharmaceutically acceptable excipients as set out above.
  • the compositions are administered by the oral or nasal respiratory route for local or systemic effect.
  • Compositions in preferably sterile pharmaceutically acceptable solvents may be nebulised by use of gases. Nebulised solutions may be breathed directly from the nebulising device or the nebulising device may be attached to a face mask, tent or intermittent positive pressure breathing machine.
  • Solution, suspension or powder compositions may be administered (including orally or nasally) from devices which deliver the formulation in an appropriate manner.
  • Treatment efficacy can be assessed by methods well-known in the art.
  • the following Examples are provided to illustrate but not limit the invention.
  • Anti-NGF antagonist antibody 911 (see Hongo, et al, Hybridoma 19:215-227 (2000)) was given at 1 mg/kg of body weight]. Ibuprofen was given at various concentrations ranging from 10, 30, 100 and 300 mg/kg (s.c.) 24 hours after surgery to all animals. [0176] The surgery was based on the procedure described by Brennan, et al, Pain 64:493-501 (1996). Animals were anesthetized with 2% isoflurane and air mixture that was maintained during surgery via a nose cone.
  • the plantar surface of the right hind paw was prepared with a povidone-iodine pad, and a 1-cm central longitudinal incision was made through skin and fascia, starting 0.5 cm from the edge of the heel and extending toward the toes. Measurements were made with a ruler with the foot held in a flexed position. The plantaris muscle was elevated using curved forceps and incised longitudinally. The muscle was incised through its full depth, between the origin and insertion. Bleeding was controlled throughout surgery by pressure applied through a gauze pad. The wound was closed with two mattress sutures (5-0 ethicon black monofilament). These sutures were knotted 5-6 times, with the first knot loosely tied.
  • the wound site was swabbed with bacitracin solution. Animals were allowed to recover and rest in clean cages for 22 hours before behavioral testing began. [0177] For each experiment, the animals were divided into two groups (control and antibody-treated). Anti-NGF antibody was given 15 hours before surgery. Resting pain was assessed 22 hours after surgery in both groups ("baseline” in the following graphs). At twenty four hours post surgery, all animals were then treated with ibuprofen at 10, 30, 100 or 300 mg/kg (s.c.) mg/kg. Resting pain was assessed beginning one hour after ibuprofen treatment.
  • Table 1 Cumulative pain score in animals, following treatment with 1 mg/kg anti-NGF antagonist antibody and 0, 10 mg/kg, 30mg/kg, 100 mg/kg or 300 mg/kg ibuprofen, one day after surgery. Data are shown as mean (SEM). Data were analyzed by one way analysis of variance and then individual pairs were analyzed using Bonferroni correction for multiple comparisons using Prizm software.
  • Pre-operative treatment with anti-NGF antibody and ibuprofen is more effective in reducing resting pain than ibuprofen alone or treatment with antibody alone. It is appreciated that the Mab911 (1 mg/kg) treatment in combination with 10 mg/kg of ibuprofen is at least as effective as 300 mg/kg of ibuprofen alone.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Endocrinology (AREA)
  • Neurosurgery (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Steroid Compounds (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2004/005162 2003-02-19 2004-02-19 Methods for treating pain by administering a nerve growth factor antagonist and an nsaid and compositions containing the same Ceased WO2004073653A2 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
NZ541750A NZ541750A (en) 2003-02-19 2004-02-19 Use of an anti-nerve growth factor antibody and an NSAID for the preparation of a medicament for treating pain
HR20050721A HRP20050721A2 (en) 2003-02-19 2004-02-19 Methods for treating pain by administering a nerve growth factor antagonist and an nsaid and composition containing the same
PL379983A PL379983A1 (pl) 2003-02-19 2004-02-19 Sposoby leczenia bólu polegające na podaniu antagonisty czynnika wzrostu nerwów i niesteroidowego leku przeciwzapalnego oraz zawierające je kompozycje
DE602004030535T DE602004030535D1 (de) 2003-02-19 2004-02-19 Verfahren zur behandlung von schmerzen durch verabreichung eines nervenwachstumsfaktor-antagonisten und eines nsaid und diese enthaltende zusammensetzung
BR0407375-4A BRPI0407375A (pt) 2003-02-19 2004-02-19 Métodos para tratar dor por meio da administração de um antagonista do fator de crescimento neural e u nsaid e composições contendo os mesmos
EP04712940A EP1594441B1 (en) 2003-02-19 2004-02-19 Method for treating pain by administering a nerve growth factor antagonist and an nsaid and composition containing the same
AU2004213044A AU2004213044A1 (en) 2003-02-19 2004-02-19 Methods for treating pain by administering a nerve growth factor antagonist and an NSAID and compositions containing the same
AT04712940T ATE491444T1 (de) 2003-02-19 2004-02-19 Verfahren zur behandlung von schmerzen durch verabreichung eines nervenwachstumsfaktor- antagonisten und eines nsaid und diese enthaltende zusammensetzung
JP2006503765A JP2006525960A (ja) 2003-02-19 2004-02-19 神経成長因子アゴニストおよびnsaid、ならびにこれらを含む組成物の投与によって疼痛を処置するための方法
UAA200508778A UA81299C2 (en) 2003-02-19 2004-02-19 Method for treating pain by administering a nerve growth factor antagonist and an nsaid and composition containing thereof
EA200501319A EA010159B1 (ru) 2003-02-19 2004-02-19 Способы лечения боли введением антагониста фактора роста нервов и нестероидного противовоспалительного средства и содержащие их композиции
MXPA05008815A MXPA05008815A (es) 2003-02-19 2004-02-19 Metodos para tratar el dolor al administrar un antagonista del factor de crecimiento de nervios y un farmaco antiinflamatorio no esteroidal y composiciones que contienen los mismos.
CA002516454A CA2516454A1 (en) 2003-02-19 2004-02-19 Methods for treating pain by administering a nerve growth factor antagonist and an nsaid and compositions containing the same
NO20054292A NO20054292L (no) 2003-02-19 2005-09-16 Fremgangsmate for behandling av smerte ved administrering av en nervevekstfaktorantagonist og NSAID og preparat inneholdende dette

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US44882303P 2003-02-19 2003-02-19
US44885303P 2003-02-19 2003-02-19
US60/448,823 2003-02-19
US60/448,853 2003-02-19

Publications (3)

Publication Number Publication Date
WO2004073653A2 true WO2004073653A2 (en) 2004-09-02
WO2004073653A8 WO2004073653A8 (en) 2004-12-02
WO2004073653A3 WO2004073653A3 (en) 2006-06-08

Family

ID=32912311

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2004/005162 Ceased WO2004073653A2 (en) 2003-02-19 2004-02-19 Methods for treating pain by administering a nerve growth factor antagonist and an nsaid and compositions containing the same

Country Status (16)

Country Link
US (2) US7655231B2 (OSRAM)
EP (2) EP2191846A1 (OSRAM)
JP (1) JP2006525960A (OSRAM)
KR (1) KR20050111598A (OSRAM)
AT (1) ATE491444T1 (OSRAM)
AU (1) AU2004213044A1 (OSRAM)
BR (1) BRPI0407375A (OSRAM)
CA (1) CA2516454A1 (OSRAM)
DE (1) DE602004030535D1 (OSRAM)
EA (1) EA010159B1 (OSRAM)
HR (1) HRP20050721A2 (OSRAM)
MX (1) MXPA05008815A (OSRAM)
NO (1) NO20054292L (OSRAM)
NZ (1) NZ541750A (OSRAM)
PL (1) PL379983A1 (OSRAM)
WO (1) WO2004073653A2 (OSRAM)

Cited By (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006137106A3 (en) * 2005-06-24 2007-06-07 Lay Line Genomics Spa Method for the potentiation of opioid analgesics effects on pain
US7252822B2 (en) 2002-10-08 2007-08-07 Rinat Neuroscience Corp. Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist
US7255860B2 (en) 2002-10-08 2007-08-14 Rinat Neuroscience Corp. Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist antibody
US7425329B2 (en) 2004-04-07 2008-09-16 Rinat Neuroscience Corp. Methods for treating bone cancer pain by administering a nerve growth factor antagonist
US7449616B2 (en) 2002-12-24 2008-11-11 Pfizer Inc. Anti-NGF antibodies and methods using same
US7569364B2 (en) 2002-12-24 2009-08-04 Pfizer Inc. Anti-NGF antibodies and methods using same
US7655231B2 (en) 2003-02-19 2010-02-02 Pfizer Inc. Methods for treating pain by administering a nerve growth factor antagonist and an NSAID
WO2010035725A1 (ja) 2008-09-24 2010-04-01 株式会社リボミック Ngfに対するアプタマー及びその使用
WO2011118682A1 (ja) 2010-03-24 2011-09-29 株式会社リボミック Ngfに対するアプタマー及びその使用
US8246956B2 (en) 2003-12-24 2012-08-21 Abbott Research B.V. Humanized anti-nerve growth factor antibodies
US9012508B2 (en) 2009-03-12 2015-04-21 Cumberland Pharmaceuticals Administration of intravenous ibuprofen
US9161735B2 (en) 2005-09-21 2015-10-20 The Regents Of The University Of California Systems, compositions, and methods for local imaging and treatment of pain
US9295639B2 (en) 2009-07-15 2016-03-29 Cumberland Pharmaceuticals Inc. Treating critically ill patients with intravenous ibuprofen
US9328164B2 (en) 2011-05-06 2016-05-03 Nvip Pty Ltd Anti-nerve growth factor antibodies and methods of preparing and using the same
US9447181B2 (en) 2009-05-04 2016-09-20 Abbvie Research B.V. Antibodies against nerve growth factor (NGF) with enhanced in vivo stability
US9505829B2 (en) 2010-08-19 2016-11-29 Zoetis Belgium S.A. Anti-NGF antibodies and their use
US9617334B2 (en) 2012-06-06 2017-04-11 Zoetis Services Llc Caninized anti-NGF antibodies and methods thereof
US9688749B2 (en) 2005-06-07 2017-06-27 Abbvie Inc. Molecules that are able to inhibit the binding between NGF and the TrkA receptor as analgesics with prolonged effect
US10323086B2 (en) 2002-12-24 2019-06-18 Rinat Neuroscience Corp. Methods for treating osteoarthritis pain by administering a nerve growth factor antagonist and compositions containing the same
US10765775B2 (en) 2013-03-14 2020-09-08 Bio Dg, Inc. Implantable medical devices comprising bio-degradable alloys with enhanced degradation rates
US10982002B2 (en) 2018-03-12 2021-04-20 Zoetis Services Llc Anti-NGF antibodies and methods thereof
US11806400B2 (en) 2012-03-16 2023-11-07 Cumberland Pharmaceuticals Inc. Injectable ibuprofen formulation
EP4344740A3 (en) * 2018-10-10 2024-10-02 Paradigm Biopharmaceuticals Limited Treatment of pain with polysulfated polysaccharides

Families Citing this family (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2340849A1 (en) * 2001-05-30 2011-07-06 Genentech, Inc. Anti-NGF antibodies for the treatment of various disorders
CA2500901A1 (en) * 2002-10-04 2004-04-22 Rinat Neuroscience Corp. Methods for treating cardiac arrhythmia and preventing death due to cardiac arrhythmia using ngf antagonists
UA80447C2 (en) * 2002-10-08 2007-09-25 Methods for treating pain by administering nerve growth factor antagonist and opioid analgesic
JP2009504685A (ja) * 2005-08-15 2009-02-05 アラーナ・テラピューティクス・リミテッド 新世界霊長類フレームワーク領域を用いる設計された抗体
AU2007230716B2 (en) * 2006-03-28 2012-05-03 Javelin Pharmaceuticals, Inc. Formulations of low dose diclofenac and beta-cyclodextrin
EP2003970A4 (en) * 2006-03-28 2012-07-11 Javelin Pharmaceuticals Inc FORMULATIONS OF LOW-DOSEED NON-STEROID INFLAMMATORY INHIBITORS AND BETA-CYCLODEXTRIN
MX2009006594A (es) * 2006-12-21 2009-08-12 Amgen Inc Formulaciones de ph regulado y estables que contienen polipeptidos.
NZ579010A (en) 2007-02-20 2012-03-30 Anaptysbio Inc Somatic hypermutation systems
MY161564A (en) 2007-08-10 2017-04-28 Regeneron Pharma High affinity human antibodies to human nerve growth factor
US8309088B2 (en) 2007-08-10 2012-11-13 Regeneron Pharmaceuticals, Inc. Method of treating osteoarthritis with an antibody to NGF
US8202525B2 (en) 2009-12-22 2012-06-19 Pondera Biotechnologies, LLC Methods and compositions for treating distress dysfunction and enhancing safety and efficacy of specific medications
US9067988B2 (en) 2010-12-01 2015-06-30 Alderbio Holdings Llc Methods of preventing or treating pain using anti-NGF antibodies
US11214610B2 (en) 2010-12-01 2022-01-04 H. Lundbeck A/S High-purity production of multi-subunit proteins such as antibodies in transformed microbes such as Pichia pastoris
US9884909B2 (en) 2010-12-01 2018-02-06 Alderbio Holdings Llc Anti-NGF compositions and use thereof
US9078878B2 (en) 2010-12-01 2015-07-14 Alderbio Holdings Llc Anti-NGF antibodies that selectively inhibit the association of NGF with TrkA, without affecting the association of NGF with p75
NZ611076A (en) 2010-12-01 2015-09-25 Alderbio Holdings Llc Anti-ngf compositions and use thereof
US9539324B2 (en) 2010-12-01 2017-01-10 Alderbio Holdings, Llc Methods of preventing inflammation and treating pain using anti-NGF compositions
US9580496B2 (en) * 2011-05-06 2017-02-28 Nexvet Australia Pty Ltd Therapeutic canine immunoglobulins and methods of using same
GB201114858D0 (en) * 2011-08-29 2011-10-12 Nvip Pty Ltd Anti-nerve growth factor antibodies and methods of using the same
US9072661B2 (en) 2012-03-16 2015-07-07 Cumberland Pharmaceuticals Inc. Injectable ibuprofen formulation
US20190290614A1 (en) * 2016-11-09 2019-09-26 Beth Israel Deaconess Medical Center, Inc. Methods for Reducing Recurrence of Tumors
US10799289B2 (en) 2018-10-15 2020-10-13 Avent, Inc. Compositions, systems, kits, and methods for neural ablation

Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5130311A (en) 1990-11-20 1992-07-14 Adir Et Compagnie Oxazolopyridine compounds, compositions and use
US5409944A (en) 1993-03-12 1995-04-25 Merck Frosst Canada, Inc. Alkanesulfonamido-1-indanone derivatives as inhibitors of cyclooxygenase
US5436265A (en) 1993-11-12 1995-07-25 Merck Frosst Canada, Inc. 1-aroyl-3-indolyl alkanoic acids and derivatives thereof useful as anti-inflammatory agents
US5475995A (en) 1994-05-16 1995-12-19 Livingston; George G. Truck spare tire locking rod
US5510368A (en) 1995-05-22 1996-04-23 Merck Frosst Canada, Inc. N-benzyl-3-indoleacetic acids as antiinflammatory drugs
US5521213A (en) 1994-08-29 1996-05-28 Merck Frosst Canada, Inc. Diaryl bicyclic heterocycles as inhibitors of cyclooxygenase-2
US5536752A (en) 1993-06-24 1996-07-16 Merck Frosst Canada Inc. Phenyl heterocycles as COX-2 inhibitors
US5552422A (en) 1995-01-11 1996-09-03 Merck Frosst Canada, Inc. Aryl substituted 5,5 fused aromatic nitrogen compounds as anti-inflammatory agents
US5593994A (en) 1994-09-29 1997-01-14 The Dupont Merck Pharmaceutical Company Prostaglandin synthase inhibitors
US5604253A (en) 1995-05-22 1997-02-18 Merck Frosst Canada, Inc. N-benzylindol-3-yl propanoic acid derivatives as cyclooxygenase inhibitors
US5604260A (en) 1992-12-11 1997-02-18 Merck Frosst Canada Inc. 5-methanesulfonamido-1-indanones as an inhibitor of cyclooxygenase-2
US5616601A (en) 1994-07-28 1997-04-01 Gd Searle & Co 1,2-aryl and heteroaryl substituted imidazolyl compounds for the treatment of inflammation
US5639780A (en) 1995-05-22 1997-06-17 Merck Frosst Canada, Inc. N-benzyl indol-3-yl butanoic acid derivatives as cyclooxygenase inhibitors
US5981568A (en) 1993-01-28 1999-11-09 Neorx Corporation Therapeutic inhibitor of vascular smooth muscle cells
WO2000053211A2 (en) 1999-03-09 2000-09-14 University Of Southern California Method of promoting myocyte proliferation and myocardial tissue repair

Family Cites Families (122)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
SU975016A1 (ru) * 1979-12-17 1982-11-23 Московский научно-исследовательский онкологический институт им.П.А.Герцена Болеутол ющее средство
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4544545A (en) * 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
US5807715A (en) * 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US4754065A (en) * 1984-12-18 1988-06-28 Cetus Corporation Precursor to nucleic acid probe
US4683195A (en) * 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683202A (en) * 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4676980A (en) * 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4777127A (en) * 1985-09-30 1988-10-11 Labsystems Oy Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus
US4800159A (en) * 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US6548640B1 (en) * 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
IL85035A0 (en) * 1987-01-08 1988-06-30 Int Genetic Eng Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same
GB8702816D0 (en) 1987-02-07 1987-03-11 Al Sumidaie A M K Obtaining retrovirus-containing fraction
US5219740A (en) * 1987-02-13 1993-06-15 Fred Hutchinson Cancer Research Center Retroviral gene transfer into diploid fibroblasts for gene therapy
WO1989009225A1 (en) 1988-03-28 1989-10-05 The Regents Of The University Of California Nerve growth factor peptides
US5422120A (en) 1988-05-30 1995-06-06 Depotech Corporation Heterovesicular liposomes
AP129A (en) 1988-06-03 1991-04-17 Smithkline Biologicals S A Expression of retrovirus gag protein eukaryotic cells
GB8823869D0 (en) * 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5047335A (en) * 1988-12-21 1991-09-10 The Regents Of The University Of Calif. Process for controlling intracellular glycosylation of proteins
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
WO1990007936A1 (en) 1989-01-23 1990-07-26 Chiron Corporation Recombinant therapies for infection and hyperproliferative disorders
EP0737750B1 (en) 1989-03-21 2003-05-14 Vical, Inc. Expression of exogenous polynucleotide sequences in a vertebrate
US6673776B1 (en) * 1989-03-21 2004-01-06 Vical Incorporated Expression of exogenous polynucleotide sequences in a vertebrate, mammal, fish, bird or human
US5703055A (en) 1989-03-21 1997-12-30 Wisconsin Alumni Research Foundation Generation of antibodies through lipid mediated DNA delivery
EP0487587A1 (en) 1989-08-18 1992-06-03 Chiron Corporation Recombinant retroviruses delivering vector constructs to target cells
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5656435A (en) * 1989-08-28 1997-08-12 Takeda Chemical Industries, Ltd. Antibodies to peptides having NGF-like activity, said antibodies having no substantial cross-reactivity with NGF, and use thereof
DE69031726T2 (de) 1989-08-28 1998-03-12 Takeda Chemical Industries Ltd Antikörper, ihre Herstellung und Verwendung
US5013556A (en) * 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
NZ237464A (en) 1990-03-21 1995-02-24 Depotech Corp Liposomes with at least two separate chambers encapsulating two separate biologically active substances
US5427908A (en) * 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
US5545806A (en) * 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5633425A (en) * 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
AU8507191A (en) * 1990-08-29 1992-03-30 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) * 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) * 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5147294A (en) * 1990-10-01 1992-09-15 Trustees Of Boston University Therapeutic method for reducing chronic pain in a living subject
ES2113940T3 (es) * 1990-12-03 1998-05-16 Genentech Inc Metodo de enriquecimiento para variantes de proteinas con propiedades de union alteradas.
US5278299A (en) * 1991-03-18 1994-01-11 Scripps Clinic And Research Foundation Method and composition for synthesizing sialylated glycosyl compounds
JPH04315209A (ja) * 1991-04-12 1992-11-06 Mitsubishi Electric Corp マイクロコンピュータ
DE69233482T2 (de) 1991-05-17 2006-01-12 Merck & Co., Inc. Verfahren zur Verminderung der Immunogenität der variablen Antikörperdomänen
WO1994004679A1 (en) 1991-06-14 1994-03-03 Genentech, Inc. Method for making humanized antibodies
ATE255131T1 (de) * 1991-06-14 2003-12-15 Genentech Inc Humanisierter heregulin antikörper
GB9115364D0 (en) 1991-07-16 1991-08-28 Wellcome Found Antibody
WO1993003769A1 (en) 1991-08-20 1993-03-04 THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES Adenovirus mediated transfer of genes to the gastrointestinal tract
CA2078539C (en) * 1991-09-18 2005-08-02 Kenya Shitara Process for producing humanized chimera antibody
US5565332A (en) * 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
EP0605522B1 (en) * 1991-09-23 1999-06-23 Medical Research Council Methods for the production of humanized antibodies
WO1993010218A1 (en) 1991-11-14 1993-05-27 The United States Government As Represented By The Secretary Of The Department Of Health And Human Services Vectors including foreign genes and negative selective markers
WO1993010260A1 (en) * 1991-11-21 1993-05-27 The Board Of Trustees Of The Leland Stanford Junior University Controlling degradation of glycoprotein oligosaccharides by extracellular glycosisases
GB9125623D0 (en) 1991-12-02 1992-01-29 Dynal As Cell modification
US5714350A (en) * 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
FR2688514A1 (fr) 1992-03-16 1993-09-17 Centre Nat Rech Scient Adenovirus recombinants defectifs exprimant des cytokines et medicaments antitumoraux les contenant.
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
JPH07507689A (ja) 1992-06-08 1995-08-31 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア 特定組織のターゲティング方法及び組成物
US5342942A (en) 1992-06-09 1994-08-30 Warner-Lambert Company Pyrazoloquinazolone derivatives as neurotrophic agents
WO1993025698A1 (en) 1992-06-10 1993-12-23 The United States Government As Represented By The Vector particles resistant to inactivation by human serum
GB2269175A (en) 1992-07-31 1994-02-02 Imperial College Retroviral vectors
US6210671B1 (en) * 1992-12-01 2001-04-03 Protein Design Labs, Inc. Humanized antibodies reactive with L-selectin
JPH08503855A (ja) 1992-12-03 1996-04-30 ジェンザイム・コーポレイション 嚢胞性線維症に対する遺伝子治療
EP0695169B1 (en) 1993-04-22 2002-11-20 SkyePharma Inc. Multivesicular cyclodextrin liposomes encapsulating pharmacologic compounds and methods for their use
US6180377B1 (en) 1993-06-16 2001-01-30 Celltech Therapeutics Limited Humanized antibodies
ATE304604T1 (de) 1993-06-24 2005-09-15 Frank L Graham Adenovirus vektoren für gentherapie
EP0711829A3 (en) 1993-09-15 1997-07-09 Viagene Inc Recombinant alphavirus vector
US6015686A (en) 1993-09-15 2000-01-18 Chiron Viagene, Inc. Eukaryotic layered vector initiation systems
DE69434594T2 (de) 1993-10-25 2006-09-21 Canji, Inc., San Diego Rekombinante adenoviren-vektor und verfahren zur verwendung
JP3002702B2 (ja) 1993-11-16 2000-01-24 スカイファーム インコーポレーテッド 活性物質の制御放出を有する小胞
JP3442784B2 (ja) 1993-11-23 2003-09-02 ジェネンテク,インコーポレイテッド キナーゼ受容体活性化検定法
AU697142B2 (en) 1993-11-23 1998-10-01 Genentech Inc. Protein tyrosine kinases named Rse
GB9402331D0 (en) * 1994-02-07 1994-03-30 Univ Mcgill Nerve growth factor structural analogs and their uses
US5844092A (en) * 1994-03-18 1998-12-01 Genentech, Inc. Human TRK receptors and neurotrophic factor inhibitors
US5877016A (en) * 1994-03-18 1999-03-02 Genentech, Inc. Human trk receptors and neurotrophic factor inhibitors
US6436908B1 (en) 1995-05-30 2002-08-20 Duke University Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function
JP4303315B2 (ja) 1994-05-09 2009-07-29 オックスフォード バイオメディカ(ユーケー)リミテッド 非交差性レトロウイルスベクター
US6291247B1 (en) 1994-05-11 2001-09-18 Queen's University At Kingston Methods of screening for factors that disrupt neurotrophin conformation and reduce neurotrophin biological activity
GB9514160D0 (en) 1994-07-25 1995-09-13 Zeneca Ltd Aromatic compounds
WO1996017072A2 (en) 1994-11-30 1996-06-06 Chiron Viagene, Inc. Recombinant alphavirus vectors
US6265150B1 (en) * 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
AU3695295A (en) 1995-10-25 1997-05-15 Queen's University At Kingston Neurotrophin antagonists
GB9525180D0 (en) 1995-12-08 1996-02-07 Univ Mcgill Design of hormone-like antibodies with agonistic and antagonistic fuctions
AU2998597A (en) 1996-05-06 1997-11-26 Chiron Corporation Crossless retroviral vectors
UA67725C2 (en) 1996-06-03 2004-07-15 Cephalon Inc K-252a derivatives and a method for improvement of functioning and cell survival enhancement
GB9616105D0 (en) 1996-07-31 1996-09-11 Univ Kingston TrkA binding site of NGF
CA2268450C (en) 1996-10-21 2008-08-05 Allelix Biopharmaceuticals, Inc. Neurotrophin antagonist compositions
US6284794B1 (en) * 1996-11-05 2001-09-04 Head Explorer Aps Method for treating tension-type headache with inhibitors of nitric oxide and nitric oxide synthase
DE19732928C2 (de) * 1997-07-31 2000-05-18 Gruenenthal Gmbh Verwendung substituierter Imidazolidin-2,4-dion-Verbindungen als Schmerzmittel
US6376471B1 (en) * 1997-10-10 2002-04-23 Johns Hopkins University Gene delivery compositions and methods
US6506559B1 (en) 1997-12-23 2003-01-14 Carnegie Institute Of Washington Genetic inhibition by double-stranded RNA
US6127401A (en) 1998-06-05 2000-10-03 Cephalon, Inc. Bridged indenopyrrolocarbazoles
US6468990B1 (en) 1999-05-17 2002-10-22 Queen's University At Kingston Method of inhibiting binding of nerve growth factor to p75 NTR receptor
US6492380B1 (en) * 1999-05-17 2002-12-10 Queen's University At Kingston Method of inhibiting neurotrophin-receptor binding
IT1306704B1 (it) 1999-05-26 2001-10-02 Sirs Societa Italiana Per La R Anticorpi monoclonali e suoi derivati sintetici o biotecnologici ingrado di agire come molecole antagoniste per il ngf.
US6399780B1 (en) * 1999-08-20 2002-06-04 Cephalon, Inc. Isomeric fused pyrrolocarbazoles and isoindolones
US6849425B1 (en) 1999-10-14 2005-02-01 Ixsys, Inc. Methods of optimizing antibody variable region binding affinity
EP1235842A4 (en) 1999-10-15 2003-04-23 Univ Massachusetts Rna interference pathway genes as tools for targeted genetic interference
US6548062B2 (en) * 2000-02-29 2003-04-15 Cephalon, Inc. Method of treating cancer with anti-neurotrophin agents
FR2807660A1 (fr) 2000-04-13 2001-10-19 Warner Lambert Co Utilisation d'antagonistes du ngf pour la prevention ou le traitement de douleurs viscerales chroniques
JP4901051B2 (ja) 2000-05-30 2012-03-21 ジョンソン アンド ジョンソン リサーチ プロプライアトリー リミテッド RNAiを増強する因子を使用することによって遺伝子抑制を媒介する方法
US7022484B2 (en) * 2000-06-08 2006-04-04 Board Of Regents, The University Of Texas System Methods for treating neuropathological states and neurogenic inflammatory states and methods for identifying compounds useful therein
GB0020504D0 (en) 2000-08-18 2000-10-11 Univ Bristol Therapeutic method
US6630500B2 (en) 2000-08-25 2003-10-07 Cephalon, Inc. Selected fused pyrrolocarbazoles
AU2001288374A1 (en) 2000-09-01 2002-03-22 Glaxo Group Limited Substituted oxindole derivatives as tyrosine kinase inhibitors
KR100872437B1 (ko) 2000-12-01 2008-12-05 막스-플랑크-게젤샤프트 츄어 푀르더룽 데어 비쎈샤프텐 에.파우. Rna 간섭을 매개하는 작은 rna 분자
US7128825B2 (en) * 2001-03-14 2006-10-31 Applied Materials, Inc. Method and composition for polishing a substrate
EP2340849A1 (en) * 2001-05-30 2011-07-06 Genentech, Inc. Anti-NGF antibodies for the treatment of various disorders
US20030008807A1 (en) * 2001-06-14 2003-01-09 The Regents Of The University Of California Novel signaling pathway for the production of inflammatory pain and neuropathy
EP1434576A4 (en) * 2001-09-13 2006-03-29 Kenneth E Miller METHOD FOR RELIEVING PAIN
US20040038874A1 (en) * 2002-08-22 2004-02-26 Osemwota Omoigui Method of treatment of persistent pain
US6919426B2 (en) * 2002-09-19 2005-07-19 Amgen Inc. Peptides and related molecules that modulate nerve growth factor activity
AU2003299071A1 (en) 2002-09-26 2004-04-19 L'oreal Glossy non-transfer composition comprising a sequenced polymer
CA2500901A1 (en) 2002-10-04 2004-04-22 Rinat Neuroscience Corp. Methods for treating cardiac arrhythmia and preventing death due to cardiac arrhythmia using ngf antagonists
UA80447C2 (en) * 2002-10-08 2007-09-25 Methods for treating pain by administering nerve growth factor antagonist and opioid analgesic
EP1556083B1 (en) * 2002-10-08 2011-02-02 Rinat Neuroscience Corp. Methods for treating post-surgical pain by admisnistering an antibody against nerve growth factor and compositions containing the same
US7255860B2 (en) 2002-10-08 2007-08-14 Rinat Neuroscience Corp. Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist antibody
EP2270048B1 (en) 2002-12-24 2015-11-11 Rinat Neuroscience Corp. Anti-NGF antibodies and methods using same
WO2004065560A2 (en) 2003-01-18 2004-08-05 Rinat Neuroscience Corp. Methods of screening for modulators of nerve growth factor
KR20050111598A (ko) 2003-02-19 2005-11-25 리나트 뉴로사이언스 코퍼레이션 신경 성장 인자 길항제 및 nsaid를 투여함으로써통증을 치료하는 방법 및 그것을 함유하는 조성물
MEP31508A (hr) 2003-07-15 2010-10-10 Amgen Inc Humana anti-ngf neutrališuća antitijela kao selektivni ihibitori ngf signalne kaskade
AU2005243247B2 (en) 2004-04-07 2012-03-01 Regents Of The University Of Minnesota Methods for treating bone cancer pain by administering a nerve growth factor antagonist
EP2298345A3 (en) 2005-01-24 2012-03-21 MedImmune Limited Specific binding members for NGF

Patent Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5130311A (en) 1990-11-20 1992-07-14 Adir Et Compagnie Oxazolopyridine compounds, compositions and use
US5604260A (en) 1992-12-11 1997-02-18 Merck Frosst Canada Inc. 5-methanesulfonamido-1-indanones as an inhibitor of cyclooxygenase-2
US5981568A (en) 1993-01-28 1999-11-09 Neorx Corporation Therapeutic inhibitor of vascular smooth muscle cells
US5409944A (en) 1993-03-12 1995-04-25 Merck Frosst Canada, Inc. Alkanesulfonamido-1-indanone derivatives as inhibitors of cyclooxygenase
US5536752A (en) 1993-06-24 1996-07-16 Merck Frosst Canada Inc. Phenyl heterocycles as COX-2 inhibitors
US5550142A (en) 1993-06-24 1996-08-27 Merck Frosst Canada Inc. Phenyl heterocycles as cox-2 inhibitors
US5436265A (en) 1993-11-12 1995-07-25 Merck Frosst Canada, Inc. 1-aroyl-3-indolyl alkanoic acids and derivatives thereof useful as anti-inflammatory agents
US5475995A (en) 1994-05-16 1995-12-19 Livingston; George G. Truck spare tire locking rod
US5616601A (en) 1994-07-28 1997-04-01 Gd Searle & Co 1,2-aryl and heteroaryl substituted imidazolyl compounds for the treatment of inflammation
US5521213A (en) 1994-08-29 1996-05-28 Merck Frosst Canada, Inc. Diaryl bicyclic heterocycles as inhibitors of cyclooxygenase-2
US5593994A (en) 1994-09-29 1997-01-14 The Dupont Merck Pharmaceutical Company Prostaglandin synthase inhibitors
US5552422A (en) 1995-01-11 1996-09-03 Merck Frosst Canada, Inc. Aryl substituted 5,5 fused aromatic nitrogen compounds as anti-inflammatory agents
US5604253A (en) 1995-05-22 1997-02-18 Merck Frosst Canada, Inc. N-benzylindol-3-yl propanoic acid derivatives as cyclooxygenase inhibitors
US5639780A (en) 1995-05-22 1997-06-17 Merck Frosst Canada, Inc. N-benzyl indol-3-yl butanoic acid derivatives as cyclooxygenase inhibitors
US5510368A (en) 1995-05-22 1996-04-23 Merck Frosst Canada, Inc. N-benzyl-3-indoleacetic acids as antiinflammatory drugs
WO2000053211A2 (en) 1999-03-09 2000-09-14 University Of Southern California Method of promoting myocyte proliferation and myocardial tissue repair

Non-Patent Citations (13)

* Cited by examiner, † Cited by third party
Title
ALOE ET AL., ARCH. RHEUM., vol. 35, 1992, pages 351 - 355
ALOE ET AL., CLIN. EXP. RHEUMATOL., vol. 10, 1992, pages 203 - 204
ALOE, INT. J. TISSUE REACTIONS-EXP. CLIN. ASPECTS, vol. 15, 1993, pages 139 - 143
BORSANI ET AL., NUC. ACIDS RES., vol. 18, 1990, pages 4020
CARACENI ET AL., J PAIN SYMPTOM MANAGE, vol. 23, no. 3, 2002, pages 239 - 55
FELSON ET AL., ARTHRITIS AND RHEUMATISM, vol. 36, no. 6, 1993, pages 729 - 740
FRIES ET AL., J. RHEUMATOL., vol. 9, 1982, pages 789 - 793
HONGO ET AL., HYBRIDOMA, vol. 19, 2000, pages 215 - 227
KATZ ET AL., SURG CLIN NORTH AM., vol. 79, no. 2, 1999, pages 231 - 52
MEENAM ET AL., ARTHRITIS AND RHEUMATOLOGY, vol. 25, 1982, pages 1048 - 1053
PAULUS ET AL., ARTHRITIS AND RHEUMATISM, vol. 33, 1990, pages 477 - 484
SAFIEH-GARABEDIAN. B ET AL., BRITISH JOURNAL OF PHARMACOLOGY, vol. 115, 1995, pages 1265 - 1275
ULLRICH ET AL., NATURE, vol. 303, 1983, pages 821 - 825

Cited By (52)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7252822B2 (en) 2002-10-08 2007-08-07 Rinat Neuroscience Corp. Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist
US7255860B2 (en) 2002-10-08 2007-08-14 Rinat Neuroscience Corp. Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist antibody
US8088384B2 (en) 2002-12-24 2012-01-03 Rinat Neuroscience Corp. Anti-NGF antibodies and methods using same
US10323086B2 (en) 2002-12-24 2019-06-18 Rinat Neuroscience Corp. Methods for treating osteoarthritis pain by administering a nerve growth factor antagonist and compositions containing the same
US7449616B2 (en) 2002-12-24 2008-11-11 Pfizer Inc. Anti-NGF antibodies and methods using same
US7569364B2 (en) 2002-12-24 2009-08-04 Pfizer Inc. Anti-NGF antibodies and methods using same
US7655232B2 (en) 2002-12-24 2010-02-02 Pfizer Inc. Anti-NGF antibodies and methods using same
US11008386B2 (en) 2002-12-24 2021-05-18 Rinat Neuroscience Corp. Anti-NGF antibodies and methods using same
EP2270048B1 (en) 2002-12-24 2015-11-11 Rinat Neuroscience Corp. Anti-NGF antibodies and methods using same
US7655231B2 (en) 2003-02-19 2010-02-02 Pfizer Inc. Methods for treating pain by administering a nerve growth factor antagonist and an NSAID
US8257710B2 (en) 2003-12-24 2012-09-04 Abbott Research, B.V. Method for the treatment of pain with humanized anti-nerve growth factor antibodies
US8246956B2 (en) 2003-12-24 2012-08-21 Abbott Research B.V. Humanized anti-nerve growth factor antibodies
US8877491B2 (en) 2003-12-24 2014-11-04 Abbvie Inc. Polynucleotides encoding humanized anti-NGF antibodies
EP2206728A1 (en) 2004-04-07 2010-07-14 Rinat Neuroscience Corp. Methods for treating bone cancer pain by administering a nerve growth factor antagonistic antibody
EP3372614A1 (en) 2004-04-07 2018-09-12 Rinat Neuroscience Corp. Methods for treating bone cancer pain by administering a nerve growth factor antagonist
US8226951B2 (en) 2004-04-07 2012-07-24 Pfizer Inc. Methods for treating bone cancer by administering a nerve growth factor antagonist antibody
US8007800B2 (en) 2004-04-07 2011-08-30 Pfizer Inc. Methods for treating bone cancer pain by administering a nerve growth factor antagonist antibody
US7425329B2 (en) 2004-04-07 2008-09-16 Rinat Neuroscience Corp. Methods for treating bone cancer pain by administering a nerve growth factor antagonist
US9688749B2 (en) 2005-06-07 2017-06-27 Abbvie Inc. Molecules that are able to inhibit the binding between NGF and the TrkA receptor as analgesics with prolonged effect
US7988966B2 (en) 2005-06-24 2011-08-02 Lay Line Genomics S.P.A. Method for the potentiation of opioid analgesics effects on pain
US8715666B2 (en) 2005-06-24 2014-05-06 Lay Line Genomics S.P.A. Method for the potentiation of opioid analgesics effects on pain
WO2006137106A3 (en) * 2005-06-24 2007-06-07 Lay Line Genomics Spa Method for the potentiation of opioid analgesics effects on pain
US10123759B2 (en) 2005-09-21 2018-11-13 The Regents Of The University Of California Systems, compositions, and methods for local imaging and treatment of pain
US9161735B2 (en) 2005-09-21 2015-10-20 The Regents Of The University Of California Systems, compositions, and methods for local imaging and treatment of pain
WO2010035725A1 (ja) 2008-09-24 2010-04-01 株式会社リボミック Ngfに対するアプタマー及びその使用
US10260070B2 (en) 2008-09-24 2019-04-16 Ribomic Inc. Aptamer for NGF and use thereof
US9012508B2 (en) 2009-03-12 2015-04-21 Cumberland Pharmaceuticals Administration of intravenous ibuprofen
US9447181B2 (en) 2009-05-04 2016-09-20 Abbvie Research B.V. Antibodies against nerve growth factor (NGF) with enhanced in vivo stability
US9295639B2 (en) 2009-07-15 2016-03-29 Cumberland Pharmaceuticals Inc. Treating critically ill patients with intravenous ibuprofen
US9649284B2 (en) 2009-07-15 2017-05-16 Cumberland Pharmaceuticals, Inc. Treating critically ill patients with intravenous ibuprofen
US9931311B2 (en) 2009-07-15 2018-04-03 Cumberland Pharmaceuticals Inc. Treating critically ill patients with intravenous ibuprofen
US9175292B2 (en) 2010-03-24 2015-11-03 Fujimoto Pharmaceutical Corporation Aptamer for NGF and use thereof
WO2011118682A1 (ja) 2010-03-24 2011-09-29 株式会社リボミック Ngfに対するアプタマー及びその使用
US9505829B2 (en) 2010-08-19 2016-11-29 Zoetis Belgium S.A. Anti-NGF antibodies and their use
US10125192B2 (en) 2010-08-19 2018-11-13 Zoetis Belgium S.A. Caninized anti-NGF antibodies and their use
US10093725B2 (en) 2010-08-19 2018-10-09 Zoetis Belgium S.A. Anti-NGF antibodies and their use
US9328164B2 (en) 2011-05-06 2016-05-03 Nvip Pty Ltd Anti-nerve growth factor antibodies and methods of preparing and using the same
US11806400B2 (en) 2012-03-16 2023-11-07 Cumberland Pharmaceuticals Inc. Injectable ibuprofen formulation
US9951128B2 (en) 2012-06-06 2018-04-24 Zoetis Services Llc Caninized anti-NGF antibodies and methods thereof
US9617334B2 (en) 2012-06-06 2017-04-11 Zoetis Services Llc Caninized anti-NGF antibodies and methods thereof
US10765775B2 (en) 2013-03-14 2020-09-08 Bio Dg, Inc. Implantable medical devices comprising bio-degradable alloys with enhanced degradation rates
US11478570B2 (en) 2013-03-14 2022-10-25 Bio Dg, Inc. Implantable medical devices comprising bio-degradable alloys with enhanced degradation rates
US10982002B2 (en) 2018-03-12 2021-04-20 Zoetis Services Llc Anti-NGF antibodies and methods thereof
US12049509B2 (en) 2018-03-12 2024-07-30 Zoetis Services Llc Nucleic acids encoding a canine antibody which binds nerve growth factor and vectors and host cells thereof
US12049507B2 (en) 2018-03-12 2024-07-30 Zoetis Services Llc Felinized anti-NGF antibodies and methods of treating pain
US12049508B2 (en) 2018-03-12 2024-07-30 Zoetis Services Llc Canine anti-NGF antibodies and methods of treating pain thereof
US12084506B2 (en) 2018-03-12 2024-09-10 Zoetis Services Llc Methods of treating a canine and inhibiting NGF activity through use of anti-NGF antibodies
US12084507B2 (en) 2018-03-12 2024-09-10 Zoetis Services Llc Humanized anti-NGF antibodies and methods of treating pain thereof
US12497459B2 (en) 2018-03-12 2025-12-16 Zoetis Services Llc Nucleic acids encoding canine anti-NGF antibodies and methods thereof
US12552871B2 (en) 2018-03-12 2026-02-17 Zoetis Services Llc Nucleic acids encoding humanized anti-NGF antibodies
EP4344740A3 (en) * 2018-10-10 2024-10-02 Paradigm Biopharmaceuticals Limited Treatment of pain with polysulfated polysaccharides
AU2024205072B2 (en) * 2018-10-10 2025-10-16 Paradigm Biopharmaceuticals Ltd Treatment of pain with polysulfated polysaccharides

Also Published As

Publication number Publication date
EA010159B1 (ru) 2008-06-30
AU2004213044A1 (en) 2004-09-02
PL379983A1 (pl) 2006-11-27
NO20054292L (no) 2005-09-16
JP2006525960A (ja) 2006-11-16
WO2004073653A8 (en) 2004-12-02
WO2004073653A3 (en) 2006-06-08
MXPA05008815A (es) 2006-05-25
BRPI0407375A (pt) 2006-02-07
NZ541750A (en) 2008-11-28
HRP20050721A2 (en) 2007-03-31
US8034346B2 (en) 2011-10-11
ATE491444T1 (de) 2011-01-15
CA2516454A1 (en) 2004-09-02
US20100143355A1 (en) 2010-06-10
US7655231B2 (en) 2010-02-02
EP1594441B1 (en) 2010-12-15
US20040253244A1 (en) 2004-12-16
EA200501319A1 (ru) 2006-08-25
EP1594441A2 (en) 2005-11-16
KR20050111598A (ko) 2005-11-25
DE602004030535D1 (de) 2011-01-27
EP1594441A4 (en) 2007-09-26
EP2191846A1 (en) 2010-06-02

Similar Documents

Publication Publication Date Title
US8034346B2 (en) Methods for treating pain by administering a nerve growth factor antagonist and an NSAID and compositions containing the same
EP1575522B1 (en) Methods for treating pain by administering an antagonist antibody against the nerve growth factor and an opioid analgesic and compositions containing the same
US7252822B2 (en) Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist
US8226951B2 (en) Methods for treating bone cancer by administering a nerve growth factor antagonist antibody
US7255860B2 (en) Methods for treating post-surgical pain by administering an anti-nerve growth factor antagonist antibody
JP2006517524A5 (OSRAM)
ES2355558T3 (es) Procedimiento para tratar el dolor administrando un antagonista del factor de crecimiento neuronal y un aine y la composición que contiene los mismos.
HK1074173B (en) Methods for treating post-surgical pain by administering an antibody against nerve growth factor and compositions containing the same

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
CFP Corrected version of a pamphlet front page

Free format text: UNDER (54) PUBLISHED TITLE REPLACED BY CORRECT TITLE

WWE Wipo information: entry into national phase

Ref document number: 170208

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 541750

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2006503765

Country of ref document: JP

Ref document number: 1617/KOLNP/2005

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2005/06509

Country of ref document: ZA

Ref document number: 200506509

Country of ref document: ZA

WWE Wipo information: entry into national phase

Ref document number: P20050721A

Country of ref document: HR

Ref document number: 2516454

Country of ref document: CA

Ref document number: PA/a/2005/008815

Country of ref document: MX

Ref document number: 2004712940

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 1020057015300

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2004213044

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 05093178

Country of ref document: CO

DPEN Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed from 20040101)
ENP Entry into the national phase

Ref document number: 2004213044

Country of ref document: AU

Date of ref document: 20040219

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2004213044

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 200501319

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 20048074654

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 2004712940

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 1020057015300

Country of ref document: KR

ENP Entry into the national phase

Ref document number: PI0407375

Country of ref document: BR