WO2001011057A1 - Production of proteins - Google Patents

Production of proteins Download PDF

Info

Publication number
WO2001011057A1
WO2001011057A1 PCT/EP2000/007643 EP0007643W WO0111057A1 WO 2001011057 A1 WO2001011057 A1 WO 2001011057A1 EP 0007643 W EP0007643 W EP 0007643W WO 0111057 A1 WO0111057 A1 WO 0111057A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
pro
cleavage
fusion protein
process according
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2000/007643
Other languages
English (en)
French (fr)
Inventor
Günter STEMPFER
Jörg Windisch
Franz Knauseder
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sandoz GmbH
Original Assignee
Biochemie GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2001515842A priority Critical patent/JP4820512B2/ja
Priority to IL14745600A priority patent/IL147456A0/xx
Priority to US10/048,882 priority patent/US6936455B1/en
Priority to AU69933/00A priority patent/AU775662B2/en
Priority to MXPA02001424A priority patent/MXPA02001424A/es
Priority to DE60029968T priority patent/DE60029968T2/de
Priority to NZ516869A priority patent/NZ516869A/en
Priority to HU0202519A priority patent/HU230231B1/hu
Priority to SK185-2002A priority patent/SK287488B6/sk
Priority to CA2379571A priority patent/CA2379571C/en
Priority to HK02107014.5A priority patent/HK1047128B/en
Priority to EP00958389A priority patent/EP1200604B1/en
Application filed by Biochemie GmbH filed Critical Biochemie GmbH
Priority to PL353101A priority patent/PL200225B1/pl
Priority to KR1020027001666A priority patent/KR20020026366A/ko
Publication of WO2001011057A1 publication Critical patent/WO2001011057A1/en
Priority to NO20020633A priority patent/NO328339B1/no
Anticipated expiration legal-status Critical
Priority to US11/099,302 priority patent/US20050186564A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/503Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from viruses
    • C12N9/506Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from viruses derived from RNA viruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P21/00Preparation of peptides or proteins
    • C12P21/06Preparation of peptides or proteins produced by the hydrolysis of a peptide bond, e.g. hydrolysate products
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/74Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
    • C07K2319/75Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor containing a fusion for activation of a cell surface receptor, e.g. thrombopoeitin, NPY and other peptide hormones

Definitions

  • the present invention relates to a process for the recombinant production of a desired heterologous polypeptide with a clearly defined homogeneous N-terminus in a bacterial host cell, wherein initially a fusion protein which comprises a peptide having the autoproteolytic activity of an autoprotease N pro of a pestivirus and the heterologous polypeptide is produced in the form of cytoplasmic inclusion bodies in the host cell, and then the inclusion bodies are isolated and treated in such a way that the desired heterologous polypeptide is cleaved from the fusion protein by the N pro autoproteolytic activity.
  • N-]terminus On natural expression, for example in humans, many pharmaceutical proteins which are in use are transported into the extracellular space, and cleavage of the signal sequence present in the precursor protein for this purpose results in a clearly defined N-]terminus. Such a homogeneous N-terminus is not always easy to produce for example in bacterial cells for several reasons.
  • IBs insoluble inclusion bodies
  • IB material requires in vitro refolding of the expressed protein. This can in many cases be effected by methods known per se (R. Rudolph et al. (1996), in: Protein Function: A Practical Approach, Ed.: Creighton, T.E., 1-39). To do this, the proteins in the form of IBs are solubilized by adding strong denaturing agents under reducing conditions and are then renatured.
  • the bacterial cytoplasm differs considerably from the extracellular space of eukaryotes.
  • reducing conditions are present therein and, on the other hand, there is no mechanism for cleaving N-terminal leader sequences to form mature proteins.
  • ATG initiation of translation
  • This N-terminal methionine is retained in many proteins, while in others it is cleaved by the methionine aminopeptidase (MAP) present in the cytoplasm and intrinsic to the host.
  • MAP methionine aminopeptidase
  • the efficiency of the cleavage depends essentially on two parameters: 1. the nature of the following amino acid, and 2.
  • the N-terminal methionine is preferentially deleted when the following amino acid is serine, alanine, glycine, methionine or valine and when the N-terminus is exposed, i.e. not "hidden” inside the protein.
  • the following amino acid is a different one, in particular a charged one (glutamic acid, aspartic acid, lysine, arginine), or if the N-terminus is located inside the protein, in most cases cleavage of the N-terminal methionine does not occur (Knippers, Rolf (1995) Molekulare Genetik., 6th edition, Georg Thieme Verlag. Stuttgart, New York. ISBN 3-13-103916-7).
  • Pestiviruses form a group of pathogens which cause serious economic losses in pigs and ruminants around the world.
  • the pathogen of a notifiable transmissible disease the classical swine fever virus (CSFV) is particularly important.
  • CSFV classical swine fever virus
  • BVDV bovine viral diarrhoea virus
  • Pestiviruses are small enveloped viruses with a genome which acts directly as mRNA and is 12.3 kb in size and from which the viral gene products are transcribed in the cytoplasm. This takes place in the form of a single polyprotein which comprises about 4000 amino acids and which is broken down both by viral and by cellular proteases into about 12 mature proteins.
  • the N-terminal protease N pro is located at the N-terminus of the polyprotein and has an apparent molecular mass of 23 kd. It catalyses a cleavage which takes place between its own C-terminus (Cys168) and the N-terminus (Ser169) of nucleocapsid protein C (R. Stark et al., J. Virol. 67 (1993), 7088-7095).
  • duplications of the N pra gene have been described in cytopathogenic BVDV viruses.
  • N pro is an autoprotease with a length of 168 amino acids and an apparent M r of about 20,000 d (in vivo). It is the first protein in the polyprotein of pestiviruses (CSFV, BDV (border disease virus) or BVDV) and undergoes autoproteolytic cleavage from the following nucleocapsid protein C (M. Wiskerchen et al., J. Virol. 65 (1991), 4508-4514; Stark et al., J. Virol. 67 (1993), 7088-7095). This cleavage takes place after the last amino acid in the sequence of N pro , Cys168.
  • the autoproteolytic function of the autoprotease N pro can be utilized for cleaving a heterologous polypeptide from a fusion protein which is expressed in the form of inclusion bodies in a bacterial expression system and which comprises an autoprotease N pr0 of a pestivirus and the heterologous polypeptide.
  • This entails uncleaved N pro fusion protein being isolated from inclusion bodies, solubilized and cleaved during refolding.
  • the present invention thus relates to a process for the recombinant production of a heterologous polypeptide, comprising
  • a polypeptide with the autoproteolytic function of an autoprotease N pro of a pestivirus is, in particular, an autoprotease N pro of a pestivirus or a derivative thereof with autoproteolytic activity.
  • heterologous polypeptide means a polypeptide which is not naturally cleaved by an autoprotease N pro of a pestivirus from a naturally occurring fusion protein or polyprotein.
  • heterologous polypeptides are industrial enzymes (process enzymes) or polypeptides with pharmaceutical, in particular human pharmaceutical, activity.
  • polypeptides with human pharmaceutical activity examples include cytokines such as interleukins, for example IL-6, interferons such as leukocyte interferons, for example interf eron cc2B, growth factors, in particular haemopoietic or wound-healing growth factors, such as G-CSF, erythropoietin, or IGF, hormones such as human growth hormone (hGH), antibodies or vaccines.
  • cytokines such as interleukins, for example IL-6, interferons such as leukocyte interferons, for example interf eron cc2B
  • growth factors in particular haemopoietic or wound-healing growth factors, such as G-CSF, erythropoietin, or IGF
  • hormones such as human growth hormone (hGH), antibodies or vaccines.
  • the pestivirus is preferably selected from the group of CSFV, BDV and BVDV, with CSFV being particularly preferred.
  • the first polypeptide of the fusion protein comprises the following amino acid sequence of the autoprotease N pro of CSFV (see also EMBL database accession number X87939) (amino acids 1 to 168, reading from N-terminal to the C-terminal direction) ( 1 ) -MELNHFELLYKTSKQKPVGVEEPWDTAGRPLFGNPSEVHPQSTLKLPHDRGRGDIRTTLRD PRKGDCRSGNHLGPVSGIYIKPGPVYYQDYTGPVYHRAPLEFFDEAQFCEVTKRIGRVTGSDGK YH IYVCVDGCILLKLAKRGTPRTLK IR FTNCPLWVTSC- ( 168 ) ,
  • a polypeptide exhibiting the autoproteolytic activity of an autoprotease N pro may also be a derivative of an autoprotease N pro of a pestivirus which is derived from this autoprotease N pro of a pestivirus by mutagenesis, in particular amino acid substitution, deletion, addition and/or amino acid insertion, as long as the required autoproteolytic activity, in particular for generating a desired heterologous polypeptide with homogeneous N-terminus, is retained.
  • Methods for generating such derivatives by mutagenesis are familiar to the skilled person. It is possible by such mutations to optimize the activity of the autoprotease N pro in relation to different heterologous proteins to be cleaved from the fusion protein.
  • nucleic acid which codes for a fusion protein which, besides the desired heterologous protein, comprises an autoprotease N pro derivative which exhibits one or more mutations by comparison with a naturally occurring autoprotease N pro it is established whether the required function is present by determining the autoproteolytic activity.
  • the autoproteolytic activity can be detected, for example, by initially solubilizing the isolated/purified IBs in 7 M guanidine/HCI solution and then diluting 1 :100 in reaction solution. After incubation for about 24 h, the reaction solution is examined by SDS-PAGE for cleavage having taken place. A Western blot is carried out to identify the proportions processed and unprocessed. The proportion of cleaved material is determined by densitometric analysis of the Coomassie-stained SDS-PAGE gel.
  • a preferred process according to the present invention is, for example, one in which the expression vector comprises a nucleic acid molecule which codes for a fusion protein which has an N-terminal region in which one or more amino acids have been deleted or substituted in the region of amino acids 2 to 21 as long as the resulting derivative continues to exhibit the autocatalytic function of the autoprotease N pro to the desired extent.
  • autoprotease N pro derivatives which are preferred in the fusion protein comprise, for example, the amino acid sequence of the autoprotease N pro of CSFV with a deletion of amino acids 2 to 16 or 2 to 21. It is also possible by amino acid substitution or addition to exchange or introduce amino acid sequences, for example in order to introduce an amino acid sequence which assists purification.
  • a nucleic acid molecule which is particularly preferred in the process according to the present invention codes for a fusion protein in which the first polypeptide comprises the amino acid sequence Glu22 to Cys168 of the autoprotease N pro of CSFV or a derivative thereof with autoproteolytic activity, the first polypeptide furthermore having a Met as N-terminus, and the heterologous polypeptide being directly connected to the amino acid Cys168 of the autoprotease N pro of CSFV.
  • a nucleic acid molecule which is likewise preferred in the process according to the present invention codes for a fusion protein in which the first polypeptide comprises the amino acid sequence Pro17 to Cys168 of the autoprotease N pro of CSFV or a derivative thereof with autoproteolytic activity, the first polypeptide furthermore having a Met as N-terminus, and the heterologous polypeptide being directly connected to the amino acid Cys168 of the autoprotease N pro of CSFV.
  • the said nucleic acid molecule is, in particular, in the form of a DNA molecule in the process according to the present invention.
  • An expression vector to be employed in the process according to the present invention preferably comprises at least one expression control sequence.
  • Expression control sequences are, in particular, promoters (such as lac, tac, T3, T7, trp, gac, vhb, lambda pL or phoA), ribosome binding sites (for example natural ribosome binding sites which belong to the abovementioned promoters, cro or synthetic ribosome binding sites), or transcription terminators (for example rrnB T1T2 or bla).
  • the above-mentioned host cell is preferably a bacterial cell of the genus Escherichia, in particular E. coli. However, it is also possible to use other bacterial cells (see below).
  • the expression vector is a plasmid.
  • a bacterial host cell to be employed in the process according to the present invention can be selected, for example, from the group of the following microorganisms: Gram-negative bacteria such as Escherichia species, for example E. coli, or other Gram-negative bacteria, for example Pseudomonas sp., such as Pseudomonas aeruginosa, or Caulobacter sp., such as Caulobacter crescentus, or Gram-positive bacteria such as Bacillus sp., in particular Bacillus subtilis. E. coli is particularly preferred as host cell.
  • Gram-negative bacteria such as Escherichia species, for example E. coli
  • other Gram-negative bacteria for example Pseudomonas sp., such as Pseudomonas aeruginosa, or Caulobacter sp., such as Caulobacter crescentus
  • Gram-positive bacteria such as Bacillus sp., in particular Bacillus subtilis.
  • the bacterial host cell i.e. the expression strain
  • the strain is cultivated in accordance with microbiological practice known per se.
  • the strain is generally brought up starting from a single colony on a nutrient medium, but it is also possible to employ cryopreserved cell suspensions (cell banks).
  • the strain is generally cultivated in a multistage process in order to obtain sufficient biomass for further use.
  • a complex medium for example LB broth.
  • defined media for example citrate medium.
  • a small-volume preculture of the host strain inoculated with a single colony or with cell suspension from a cryoculture
  • the temperature for this cultivation not generally being critical for the later expression result, so that it is possible routinely to operate at relatively high temperatures (for example 30°C or 37°C).
  • the main culture is set up in a larger volume (for example 500 ml), where it is in particular necessary to ensure good aeration (large volume of flask compared with the volume of contents, high speed of rotation).
  • the main culture will in most cases also be carried out at relatively high temperature (for example 30 or 37°C).
  • Inducible systems are particularly suitable for producing inclusion bodies (for example with tip, lac, tac or phoA promoter).
  • incubation is continued for 1 to 5 hours.
  • most of the N pro fusion protein is deposited as inclusion bodies in the bacterial cytoplasm. The resulting cells can be harvested and processed further.
  • the multistage system consists of a plurality of bioreactors (fermenters), it being preferred to employ defined nutrient media in this case in order to be able to improve the process engineering control of the process.
  • bioreactors fermenters
  • the process is analogous to the shaken flask.
  • a preliminary stage fermenter and a main stage fermenter are used, the cultivation temperature being chosen similar to that in the shaken flask.
  • the preliminary stage fermenter is inoculated with a so-called inoculum which is generally grown from a single colony or a cryoculture in a shaken flask.
  • the inclusion bodies are isolated from the host cell in a known manner, as described, for example, in R. Rudolph et al., in: Creighton, T.E. (Ed.), Protein Function, A Practical Approach, IRL Press, (1996), 1-39; R. Rudolph , in: H. Tschesche (Ed.), Modern Methods in Protein and Nucleic Acid Research, De Gruyter, Berlin, (1990), 149-171 ; R. Rudolph, in: J.L Cleland & C.S. Craik (Eds.), Protein Engineering: Principles and Practices, Wiley-Liss Inc., (1995), 283-298.
  • the cells are harvested by centrifugation.
  • the inclusion bodies (IBs) present therein can be obtained, after disruption of the cells, for example by means of high-pressure dispersion, by a simple centrifugation at low rotor speed.
  • the purity in relation to the desired target protein can then be improved by multiple resuspension of the IBs in various buffers, for example in the presence of NaCI (for example 0.5-1.0 M) and/or detergent (for example Triton X-100). This usually leads to most of the foreign proteins in the IBs being removed. Any residual foreign proteins usually do not interfere with the autoproteolytic cleavage.
  • the solubilization routinely takes place by dissolving the IBs for example in a guanidine- containing buffer (for example 0.1 M tris/HCI, 6.0 M guanidine/HCI, 5 mM EDTA, 50 mM DTT) (see, for example, R. Rudolph et al., (1996); R. Rudolph (1990), R. Rudolph (1995), supra).
  • a protein determination can be carried out on the supernatant.
  • the autoproteolytic cleavage of the heterologous polypeptide from the fusion protein is achieved by diluting the solubilizate with a cleavage buffer (for example 1 ml of solubilizate + 99 ml of cleavage buffer), for example with a tris-containing cleavage buffer, preferred concentration 0.8-1.0 M, or with an arginine-containing cleavage buffer, preferably with 0.4-0.6 M arginine, for example at a neutral pH, preferably pH 7.0-7.5, and at a temperature of, for example, less than 30°C, preferably 10-20°C, thus forming the reaction solution (see also R. Rudolph (1996), supra).
  • the cleavage solution is subsequently incubated for a particular period, for example 12 h, and the extent of the N pr0 cleavage can be analysed by SDS-PAGE.
  • the solubilizate is diluted with an arginine-containing buffer so that the final concentration of arginine is up to 1.0 M, preferably 0.4-0.6 M.
  • dilution is also possible by dialysing the solubilized inclusion bodies against an appropriate arginine-containing cleavage buffer.
  • the temperature of the reaction solution for the cleavage is, for example, between 0°C and 30°C.
  • the temperature can preferably be 10°C-20°C.
  • the pH of the reaction solution is, for example, 5.0-9.0.
  • the pH is preferably 7.0-8.0, in particular 7.0-7.5.
  • the reaction solution contains DTT in a concentration of 0.5-100 mM.
  • the DDT concentration is preferably about 5.5 mM.
  • the protein concentration in the reaction solution during the cleavage can be, for example, in the region of 20-150 ⁇ g/ml.
  • the protein concentration is preferably less than 40 ⁇ g/ml.
  • the reaction solution can contain tris/HCI in a concentration of, for example, up to 1.0 M during the cleavage.
  • the tris/HCI concentration is preferably between 0.8 M and 1.0 M.
  • the pH in the cleavage buffer is 7.0-7.5
  • the temperature during the cleavage is 10°C-20°C
  • the protein concentration does not exceed 40-50 ⁇ g/ml
  • the cleavage buffer contains about 5mM DTT as reducing agent.
  • heterologous polypeptide which has been cleaved from the fusion protein is isolated in a manner known per se (see, for example, M.P. Deutscher, in: Methods in Enzymology: Guide to Protein Purification, Academic Press Inc., (1990), 309-392).
  • Example 1 Expression and in vitro cleavage of N pr °-hGH (human Growth Hormone)
  • the fusion proteins are produced by heterologous expression in Escherichia coli in an expression system (vector p160TP1 with host W3110). All the elements in this system for constructing the vector originate from the £ coli genome.
  • p160TP1 is a pBR322-derived vector in which the expression is under the control of a modified E. coli trp promoter with deleted attenuator.
  • the Shine-Dalgarno sequence of the attenuator peptide from the same operon is used as ribosome binding site (RBS).
  • RBS ribosome binding site
  • the double terminator T1T2 from the £ coli rrnB gene ensures, together with the bla gene terminator which remains in the construct, efficient termination of the transcription.
  • the expression cassette is inserted starting from the pBR322 EcoRI cleavage site in the counter-clockwise direction (i.e. contrary to the orientation of the tetracycline resistance gene).
  • the ⁇ -lactamase gene (bla) is deleted together with the promoter.
  • the structural genes for the heterologous proteins to be expressed are introduced (generally as PCR fragment cut to size) via the Xbal cleavage site at position 3506.
  • NPH-pET An expression plasmid
  • the plasmid comprises the known expression vector pET11a (F.W. Studier et al., Methods. Enzymol. 185 (1990), 60-89).
  • pET11a F.W. Studier et al., Methods. Enzymol. 185 (1990), 60-89.
  • a fusion protein composed of N pro and the CSFV nucleocapsid protein is cloned into the expression vector. This entails the first 16 amino acids of the natural N pro sequence (MELNHFELLYKTSKQK) being replaced by a 10 amino acids-long oligo-histidine purification aid (MASHHHHHHH).
  • a Spel cleavage site is introduced at the junction between N pr0 and nucleocapsid protein into the resulting expression plasmid by a targeted mutagenesis. This makes it possible to delete the structural gene for the nucleocapsid protein from the vector by restrictions with Spel (at the 5' end) and Xhol (at the 3' end).
  • the corresponding linearized N pro -pET11 a vector is removed by preparative gel electrophoresis from the nucleocapsid gene fragment. It is then possible to introduce the hGH structural gene via the "sticky" Spel and Xhol ends.
  • the structural gene is amplified from a cDNA bank from human brain, which can be processed (Clontech), using a high precision PCR (for example Pwo polymerase from Roche Biochemicals, procedure as stated by the manufacturer).
  • a high precision PCR for example Pwo polymerase from Roche Biochemicals, procedure as stated by the manufacturer.
  • the following oligonucleotides are employed for this purpose:
  • a Spel cleavage site is introduced at the 5 ' end, and an Xhol cleavage site is introduced at the 3 ' end via the oligonucleotide used.
  • the double ochre stop codon (TAATAA) is introduced at the end of the structural gene for efficient termination of translation.
  • the Spel cleavage site at the front end permits ligation in reading frame with the N pro -pET11a vector described above.
  • the Xhol cleavage site at the rear end makes directed cloning-in possible.
  • the plasmid produced in this way is named in NPH-pET.
  • This plasmid NPH-pET is that used, as already mentioned, as source of the structural gene of the N pro -hGH fusion protein.
  • a high-precision PCR with Pwo polymerase is employed using the plasmid NPH-pET linearized with Xhol as template.
  • the following primers are used to produce a clonable fragment:
  • oligonucleotides result in amplification of a structural gene with an open reading frame (ORF) for a fusion protein (FP) in which the His 7 purification aid and the preceding amino acids (with the exception of the methionine necessary for the start of translation) have been completely deleted.
  • ORF open reading frame
  • FP fusion protein
  • the sequence of the PCR fragment (1072 bp) which contains the open reading frame for the N pr0 -hGH fusion protein is depicted below.
  • the start codon and the two stop codons are printed in bold, and the Xbal cleavage sites used for the cloning are shown underlined.
  • This ORF thus codes for the fusion protein shown below, the proline at position two corresponding to the proline at position 17 of the natural N pro protein.
  • the sequence of the N pro hGH fusion protein (344 amino acids, of which 153 N pro and 191 hGH) is thus as follows (read from the N-terminal to the C-terminal direction), with proline 17 (position 2 of the fusion protein) from the natural N pr0 sequence being shown in italics, and the hGH sequence being printed in bold:
  • the FP in the reduced state has an M r of 39 316.92 d, and the M r after a possible cleavage would be 17 220.02 d for the N pr0 part (reduced) and 22 114.88 d for the hGH part (reduced).
  • N pr0 has six cysteines, and hGH four. In the bacterial cytoplasm these cysteines are likely to be in reduced form for the most part. During the subsequent processing there is presumably at least partial formation of disulfide bridges.
  • N-terminal methionine in the fusion protein (or the N pro part) will be mostly cleaved by the methionine aminopeptidase (MAP) intrinsic to the host, which would reduce the M r by, in each case, 131 d to 39 186 d (FP) and 17 089 d (N pro ) respectively.
  • MAP methionine aminopeptidase
  • the PCR fragment with the structural gene for the FP described is purified and cut with Xbal, and the two sought cleavage products are removed from the target fragment. This fragment is ligated to the expression vector p160TP1 as described.
  • the vector is initially linearized with Xbal and 5'-dephosphorylated with calf intestine phosphatase (CIP).
  • CIP calf intestine phosphatase
  • T4 DNA ligase is used for ligation.
  • the ligated DNA is introduced by electroporation into Escherichia coli K-12 DH10B and plated out on Luria broth (LB) agar plates with 15 mg/L tetracycline. Numerous clonal colonies result from this transformation.
  • Plasmid DNA is isolated from several clones and examined by restriction analysis for the presence of an insert with the correct size and orientation. One clone is selected and subjected to detailed characterization by restriction analysis and DNA sequencing. The plasmid behaves in accordance with the calculations in all the investigations. This plasmid is called pNPH1 and is used for the subsequent work.
  • N pro -hGH expression plasmid pNPH1 (4840 bp) is shown below.
  • the start codon and the stop codon for the N pro -hGH fusion protein are underlined.
  • the open reading frame runs in the reverse direction when shown in this form.
  • Escherichia coli host strain for expressing the N pro -hGH fusion protein is selected on the basis of considerations of productivity and biological safety.
  • Escherichia coli K-12 is the best-characterized line of the species £ coli (B.J. Bachmann; in: J.L. Ingraham et al., (Ed.) Escherichia coli and Salmonella typhimurium cellular and molecular biology. American Society for Microbiology, Washington D.C. (1987a), pp. 1191-1219; B.J. Bachmann 1987b; Barbara J. (1987b) Linkage map of Escherichia co//K-12, edition 7. In: Escherichia coli and Salmonella typhimurium, Vol. 2. Ed.: F. C. Neidhard. Am. Soc. Microbiol., Washington DC (1987b), 807-876; K.F. Jensen, J. Bactenol. 175 (1993), 3401 -3407) and its representatives are generally regarded as
  • Escherichia coli K-12 W3110 (ATCC 27325) is a prototropic derivative, which is very close to the wild type, of Escherichia coli - 2 and is frequently employed as host strain for expressing heterologous proteins. It has been deposited at the American Type Culture Collection (ATCC) and has the following genotype:
  • the strain can be purchased from the ATCC. Its growth is excellent on fully synthetic media without complex nitrogen sources and process engineering control thereof it possible very effectively.
  • the expression strain W3110[pNPH1] is produced by transformation of the expression plasmid pNPH1 described above into W3110. The transformation takes place by electroporation, using 10% glycerol as suspending medium. 50 ng (1 ⁇ L) of a pNPH1 solution in water were mixed with 30 ⁇ L of a W3110 cell suspension and exposed to an 1800 V pulse in a 1 mm cuvette (Eppendorf Electroporator 2510). The cells are resuspended in SOC medium, shaken at 37°C for 1 h and then plated out on Luria broth agar plates with 15 mg/L tetracycline. Numerous clones result from this transformation after incubation at 37°C (over night).
  • a medium-sized colony with distinct margins is picked and forms the basis for the expression strain W31 10[pNPH1].
  • the clone is cultivated and preserved in cryoampoules at -80°C (master cell bank MCB). For daily use, the strain is streaked on LB-tetracycline agar plates.
  • the strain W3110[pNPH1] is subcultured from a single colony on an agar plate and this is used to inoculate a preculture in Luria broth + 15 mg/L tetracycline (200 mL in a 1 L baffle flask).
  • the preculture is shaken at 250 rpm at 30°C for 14 h and, during this, reaches an OD 60 o of about 1.0.
  • 10 mL portions of preculture are then used to inoculate the main cultures (in each case 330 mL of citrate medium in 1 L baffle flasks) (3% inoculum).
  • the main cultures are grown at 37°C (250 rpm) until the OD 600 is 0.8 and then production of the fusion protein is induced with 50 ⁇ g of indoleacrylic acid per mL of culture (final concentration; stock solution 5 mg/mL in 100% analytical grade EtOH).
  • the cultures are cultivated further at 37°C and 250 rpm for 4 h, during which the OD ⁇ oo reaches about 1.5 to 3.0.
  • the cultures are transferred into sterile 500 mL centrifuge bottles and centrifuged at 10,000 g for 30 min. The centrifugation supernatant is completely discarded, and the pellets are frozen at -80°C until processed further.
  • BL12 l(DE3) cell pellet About 12 g (wet weight) of BL12 l(DE3) cell pellet are then suspended in 30 mL of 50 mM tris/HCI, 5 mM benzamidine, pH 8.0 and homogenized using an Ultraturrax. After addition of 0.5 mM EDTA and 0.1 % (w/v) lysozyme, the cell suspension is incubated in an ice bath for 30 min. Subsequent ultrasound treatment (7 x 20 sec with 20 sec pause in each case) leads to a complete disruption of the cells. Then 10 mM MgCI 2 and 0.006% (w/v) DNase are added to the disrupted suspension and incubated at 4°C for 30 min.
  • Insoluble and soluble constituents are subsequently separated by centrifugation (JA 20; 7700g).
  • the pellet is suspended in 40 mL of 50 mM tris/HCI, 5 mM benzamidine, 5 mM EDTA, pH 8.0 and again centrifuged (JA 20; 7700g). This step is repeated twice more, and the resulting pellets are suspended in 40 mL of 20 mM tris/HCI, pH 7.0. 20 mL of 1.5 M NaCI, 60 mM EDTA, pH 7.0 are added to the suspension and incubated in an ice bath for 30 min. Finally, a further centrifugation (JA 20; 7700g) and an H 2 O washing step are carried out. The resulting pellet represents the N pro -hGH IB (inclusion body) material.
  • Example 2 Cleavage of the inclusion body fusion proteins under various conditions
  • Cleavage of the N pro portion is made possible in principle by a 1 :100 (or larger) dilution of the solubilizate (see above) in cleavage buffer (residual concentration of guanidine hydrochloride ⁇ 0.06 M).
  • the protein concentration during this is routinely 20 ⁇ g/mL (in cases of exception, this is pointed out hereinafter).
  • the extent of the cleavage of the N pro portion can be measured by detecting the cleavage products after SDS-PAGE. This entails the polyacrylamide gels being photographed after SDS-PAGE has taken place, and the intensity of the appropriate bands being measured. The appropriate bands are identified by Western blot in preliminary tests.
  • the cleavage takes place by dilution (1:100) of the solubilizate in cleavage buffer (20 mM tris/HCI, 2 mM EDTA, 5 mM DTT, pH 7.0 and the particular arginine concentrations) at RT.
  • cleavage buffer (20 mM tris/HCI, 2 mM EDTA, 5 mM DTT, pH 7.0 and the particular arginine concentrations
  • the protein concentration in the cleavage mixtures is 20 ⁇ g/mL.
  • the extent of the cleavage is measured after 24 h by detecting the cleavage products after SDS-PAGE.
  • N pro cleavage efficiency can be distinctly increased by adding arginine in the cleavage buffer. Maximum cleavage takes place at a concentration of 0.4-0.6 M arginine.
  • Example 2.2 Cleavage of N pr0 from N pro -hGH by arginine at various temperatures
  • the cleavage takes place by dilution (1 :100) of the solubilizate in cleavage buffer (20 mM tris/HCI, 2 mM EDTA, 5 mM DTT, pH 7.0, 0 - 1.0 M arginine) at the particular temperatures.
  • the protein concentration in the cleavage mixture is 20 ⁇ g/mL.
  • the extent of the cleavage is measured after 24 h by detection of the cleavage products after SDS-PAGE.
  • Example 2.3 Extent of the cleavage of N pro from N pro -hGH as a function of the pH at various temperatures
  • the cleavage takes place by dilution (1 :100) of the solubilizate in cleavage buffer (20 mM tris/HCI, 2 mM EDTA, 5 mM DTT, 0.5 M arginine) at the particular pH.
  • cleavage buffer (20 mM tris/HCI, 2 mM EDTA, 5 mM DTT, 0.5 M arginine) at the particular pH.
  • the protein concentration in the cleavage mixture is 20 ⁇ g/mL.
  • the extent of the cleavage was measured after 24 h by detecting the cleavage products after SDS-PAGE.
  • a systematic variation of the pH in the cleavage buffer form pH 5.0 to 9.0 is carried out. With the arginine concentration employed, a pH of 7.0-7.5 is optimal for cleavage of the N pro fusion protein.
  • Example 2.4 Cleavage of N pro from N pro -hGH at various DTT concentrations
  • the cleavage takes place by dilution (1:100) of the solubilizate in cleavage buffer (20 mM tris/HCI, 2 mM EDTA, pH 7.0, 0.5 M arginine, 0-100 mM DTT at 15 °C). Because of the DTT concentration in the solubilizate, the mixture with "0 mM DTT" still contains 0.5 mM DTT.
  • the protein concentration in the cleavage mixture is 20 ⁇ g/mL. The extent of the cleavage is measured after 24 h by detecting the cleavage products after SDS-PAGE.
  • a maximum cleavage of the N pr0 portion is reached at about 5.5 mM DTT.
  • Example 2.5 Variation of the pH in solubilizate for cleavage of N pro -hGH
  • the cleavage takes place by dilution (1 :100) of the solubilizate at various pH values (pH 6.0, pH 7.0, pH 8.0, pH 9.0) in the cleavage buffer (20 mM tris/HCI, 2 mM EDTA, 5 mM DTT, pH 7.0, 0 - 0.8 M arginine at 15°C).
  • the pH values are adjusted by titrating the solubilization buffer to the appropriate pH values before mixing with the IBs.
  • the protein concentration in the cleavage mixture is 20 ⁇ g/mL.
  • the extent of the cleavage is measured after 24 h by detecting the cleavage products after SDS-PAGE.
  • Reactivation of denatured N pro -hGH is started by dilution (1 :100) in 20 mM tris/HCI, 0.5 M arginine, 2 mM EDTA, 10 mM DTT, pH 7.0 at 15°C.
  • Example 2.7 Cleavage of N pro from N pro -hGH by dilution at various protein concentrations
  • the cleavage takes place by dilution (1 :100) of the solubilizate in cleavage buffer (20 mM tris/HCI, 0.5 M arginine, 2 mM EDTA, 10 mM DTT, pH 7.0 at 15°C). A check is carried out to determine whether the cleavage has taken place after about 24 h by detection of the cleavage products after SDS-PAGE.
  • Example 2.8 N pro cleavage from N pro -hGH by dialysis as a function of the protein concentration
  • Guanidine hydrochloride is removed from solubilized N pro -hGH IB material by dialysis (1 :100) against 20 mM tris/HCI, 0.5 M arginine, 2 mM EDTA, 10 mM DTT, pH 7.0 at 4°C, and thus the cleavage is initiated. After about 24 h, SDS-PAGE is used to analyse for N pro cleavage having taken place. It emerges that cleavage of the N pro portion can be achieved not only by dilution but also by dialysis of the solubilized material.
  • Examole 2.9 Efficiency of cleavage of N pro from N pro -hGH as a function of the tris/HCI concentration
  • the cleavage takes place by dilution (1 :100) of the solubilizate in cleavage buffer (2 mM EDTA, 20 mM DTT, pH 7.0, 0.1 - 1.0 M tris/HCI at 15°C).
  • cleavage buffer (2 mM EDTA, 20 mM DTT, pH 7.0, 0.1 - 1.0 M tris/HCI at 15°C).
  • the cleavage was checked after about 24 h by detecting the cleavage products after SDS-PAGE.
  • the reaction ought thus preferably to take place at tris/HCI concentrations of 0.8-1.0 M.
  • N pro -pGH expression vector starts from pNPH1 (see Example 1 ).
  • the plasmid is linearized with Bglll and amplified by means of PCR. This entails the entire plasmid apart from the region of the hGH structural gene (from the codon for Phe1 to the codon for Phe 191 ) being amplified with Pwo polymerase and primers without 5 '-phosphate.
  • the purified PCR fragment is employed as vector in the ligation with the pGH structural gene. Removal of 5 ' -phosphates (for example using calf intestine phosphatase, Arctic shrimp alkaline phosphatase) prevents circularization by self-ligation.
  • the pGH structural gene is likewise produced by PCR amplification.
  • the template used is a porcine cDNA bank (for example porcine liver 5 ' -stretch cDNA library from Clontech or porcine brain or pituitary cDNA bank).
  • the following primers are used for the amplification, and are in each case provided with a 5 ' -phosphate during the synthesis:
  • Rear end (corresponding to the C-terminus of the protein) of the structural gene (Phe190 to Val184): 5'- GAA GGC ACA GCT GCT CTC CAC -3'
  • the PCR fragment contains exclusively the ORF (structural gene) for mature pGH. Ligation (T4 DNA ligase) results in an ORF for N pro -pGH which is analogous to that of pNPH1.
  • the fusion protein described hereinafter is encoded by this ORF.
  • the ligated DNA is introduced by electroporation in Escherichia coli K-12 DH10B (electrocompetent cells supplied by Life Technologies, genotype Escherichia coli K-12 F " mcrA A(mrr-hsdRMS-mctBC) ⁇ 80/acZ ⁇ M15 ⁇ /acX74 cteoR recA1 endAA araD139 A(ara, leu)7697 gal galK ⁇ - sL nupG) and plated out on Luria broth (LB) agar plates with 15 mg/L tetracycline. This transformation results in numerous clonal colonies.
  • Escherichia coli K-12 DH10B electroporation in Escherichia coli K-12 DH10B (electrocompetent cells supplied by Life Technologies, genotype Escherichia coli K-12 F " mcrA A(mrr-hsdRMS-mctBC) ⁇ 80/
  • the plasmid DNA is isolated from several clones and examined by a restriction analysis for the presence of an insert with the correct size and orientation. One clone is selected and subjected to detailed characterization by restriction analysis and DNA sequencing. The plasmid behaves in accordance with calculations in all the investigations. This plasmid is called pNPP1 and used for the subsequent work.
  • N pro -pGH fusion protein 342 amino acids, of which 153 are N pro and 189 are pGH
  • proline 17 position 2 of the fusion protein
  • the pGH sequence is shown in bold print.
  • the FP in the reduced state has an M r of 38 819.82 d, and the M r after a possible cleavage would be 17 220.02 d for the N pro part (reduced) and 21 617.79 d for the pGH part (reduced).
  • N pro has six cysteines, and pGH four. In the bacterial cytoplasm these cysteines are likely to be in reduced form for the most part. During the subsequent processing there is presumably at least partial formation of disulfide bridges.
  • N-terminal methionine in the fusion protein (or the N pro part) will be mostly cleaved by the methionine aminopeptidase (MAP) intrinsic to the host, which would reduce the M r by, in each case, 131 d to 38 689 d (FP) and 17 089 d (N pro ) respectively.
  • MAP methionine aminopeptidase
  • the expression strain W3110[pNPP1] is produced as described in Example 1 by transformation (electroporation) of the expression plasmid pNPP1 in Escherichia coli K-12 W3110. In this case too, even detailed characterization revealed no deviations from the expected restriction pattern.
  • a medium-sized colony with distinct margins is picked from the transformation plate and forms the basis for the expression strain W3110[pNPP1].
  • the clone is cultivated and preserved in cryoampoules at -80°C (master cell bank MCB).
  • the strain is streaked on LB- tetracycline agar plates for daily use.
  • N pr0 -pGH fusion protein takes place as described in Example 1 for the N pro -hGH fusion protein.
  • Solubilization and renaturation tests corresponding to those described above for N pro -hGH are carried out for the N pro -pGH fusion protein. After variation of the parameters already described (see above) it emerges that in-vitro cleavage of the N pro portion is possible after solubilization and renaturation also in the case of the N pro -pGH fusion protein.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Virology (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Enzymes And Modification Thereof (AREA)
PCT/EP2000/007643 1999-08-09 2000-08-07 Production of proteins Ceased WO2001011057A1 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
IL14745600A IL147456A0 (en) 1999-08-09 2000-08-07 Production of proteins
US10/048,882 US6936455B1 (en) 1999-08-09 2000-08-07 Production of heterologous proteins using an Npro autoprotease of a pestivirus and inclusion bodies
AU69933/00A AU775662B2 (en) 1999-08-09 2000-08-07 Production of proteins
MXPA02001424A MXPA02001424A (es) 1999-08-09 2000-08-07 Produccion de proteinas.
DE60029968T DE60029968T2 (de) 1999-08-09 2000-08-07 Proteinherstellung
NZ516869A NZ516869A (en) 1999-08-09 2000-08-07 Production of proteins
HU0202519A HU230231B1 (hu) 1999-08-09 2000-08-07 Fehérjék termelése
CA2379571A CA2379571C (en) 1999-08-09 2000-08-07 Process for the production of a heterologous peptide by autoproteolytic cleavage in vitro
SK185-2002A SK287488B6 (sk) 1999-08-09 2000-08-07 Spôsob rekombinantnej produkcie heterológneho polypeptidu pomocou peptidu s autoproteolytickou aktivitou
JP2001515842A JP4820512B2 (ja) 1999-08-09 2000-08-07 タンパク質の製造
EP00958389A EP1200604B1 (en) 1999-08-09 2000-08-07 Production of proteins
HK02107014.5A HK1047128B (en) 1999-08-09 2000-08-07 Production of proteins
PL353101A PL200225B1 (pl) 1999-08-09 2000-08-07 Sposób rekombinacyjnego wytwarzania polipeptydu heterologicznego
KR1020027001666A KR20020026366A (ko) 1999-08-09 2000-08-07 단백질의 생산
NO20020633A NO328339B1 (no) 1999-08-09 2002-02-08 Fremgangsmate for rekombinant fremstilling av heterologt polypeptid.
US11/099,302 US20050186564A1 (en) 1999-08-09 2005-04-05 Production of proteins

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
AT1367/99 1999-08-09
AT136799 1999-08-09

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US11/099,302 Continuation US20050186564A1 (en) 1999-08-09 2005-04-05 Production of proteins

Publications (1)

Publication Number Publication Date
WO2001011057A1 true WO2001011057A1 (en) 2001-02-15

Family

ID=3512357

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2000/007643 Ceased WO2001011057A1 (en) 1999-08-09 2000-08-07 Production of proteins

Country Status (21)

Country Link
US (2) US6936455B1 (cg-RX-API-DMAC7.html)
EP (1) EP1200604B1 (cg-RX-API-DMAC7.html)
JP (1) JP4820512B2 (cg-RX-API-DMAC7.html)
KR (1) KR20020026366A (cg-RX-API-DMAC7.html)
CN (1) CN1230543C (cg-RX-API-DMAC7.html)
AT (1) ATE335826T1 (cg-RX-API-DMAC7.html)
AU (1) AU775662B2 (cg-RX-API-DMAC7.html)
CA (1) CA2379571C (cg-RX-API-DMAC7.html)
CZ (1) CZ302366B6 (cg-RX-API-DMAC7.html)
DE (1) DE60029968T2 (cg-RX-API-DMAC7.html)
ES (1) ES2269173T3 (cg-RX-API-DMAC7.html)
HK (1) HK1047128B (cg-RX-API-DMAC7.html)
HU (1) HU230231B1 (cg-RX-API-DMAC7.html)
IL (1) IL147456A0 (cg-RX-API-DMAC7.html)
MX (1) MXPA02001424A (cg-RX-API-DMAC7.html)
NO (1) NO328339B1 (cg-RX-API-DMAC7.html)
NZ (1) NZ516869A (cg-RX-API-DMAC7.html)
PL (1) PL200225B1 (cg-RX-API-DMAC7.html)
SK (1) SK287488B6 (cg-RX-API-DMAC7.html)
TR (1) TR200200253T2 (cg-RX-API-DMAC7.html)
WO (1) WO2001011057A1 (cg-RX-API-DMAC7.html)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006113957A2 (en) 2005-04-26 2006-11-02 Sandoz Ag Production of recombinant proteins by autoproteolytic cleavage of a fusion protein
CN101198700B (zh) * 2005-04-26 2012-08-15 桑多斯股份公司 通过融合蛋白的自我蛋白剪切制备重组蛋白
AU2011253661B2 (en) * 2005-04-26 2013-06-13 Boehringer Ingelheim Rcv Gmbh & Co Kg Production of recombinant proteins by autoproteolytic cleavage of a fusion protein
EP2684951A1 (en) 2012-07-13 2014-01-15 Sandoz Ag Method for producing a recombinant protein of interest
EP2746391A1 (en) 2012-12-19 2014-06-25 Sandoz Ag Method for producing a recombinant protein of interest
EP2746390A1 (en) 2012-12-19 2014-06-25 Sandoz Ag Method for producing a recombinant protein of interest
WO2015087276A1 (en) 2013-12-12 2015-06-18 Novartis Ag A process for preparing a composition of pegylated proteins

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TR200200048T2 (tr) * 1999-08-09 2002-04-22 Biochemie Gesellschaft M.B.H. Otoproteolitik klevaj vasıtasıyla proteinlerin üretimi.
ES2453048T3 (es) 2004-03-30 2014-04-03 Relypsa, Inc. Polímeros de unión de ión y usos de los mismos
GB0508435D0 (en) * 2005-04-26 2005-06-01 Sandoz Ag Organic compounds
CN103069000A (zh) 2010-08-31 2013-04-24 天野酶株式会社 使用了酶的蛋壳膜的溶解方法
RU2619217C1 (ru) * 2015-12-04 2017-05-12 Федеральное государственное бюджетное учреждение "Государственный научно-исследовательский институт генетики и селекции промышленных микроорганизмов" (ФГБУ "ГосНИИгенетика") Температурочувствительный мутантный интеин для нерастворимой экспрессии предшественника целевого белка
CN114539425B (zh) * 2022-02-25 2023-04-28 湖南中晟全肽生化有限公司 一种提高线性多肽生物表达的方法

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0234888A2 (en) * 1986-02-24 1987-09-02 Creative Biomolecules, Inc. Process for producing human epidermal growth factor and analogs thereof
EP0321973A2 (de) * 1987-12-23 1989-06-28 BOEHRINGER INGELHEIM INTERNATIONAL GmbH Expression der viral kodierten Protease P2A des HRV2
WO1998049326A1 (en) * 1997-04-25 1998-11-05 Sembiosys Genetics Inc. Method for cleavage of fusion proteins
WO1999010503A1 (de) * 1997-08-22 1999-03-04 Roche Diagnostics Gmbh Autokatalytisch aktivierbare zymogene vorstufen von proteasen und deren verwendung
WO1999010483A2 (de) * 1997-08-22 1999-03-04 Roche Diagnostics Gmbh Autokatalytisch aktivierbare vorstufen von proteasen und deren verwendung

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0234888A2 (en) * 1986-02-24 1987-09-02 Creative Biomolecules, Inc. Process for producing human epidermal growth factor and analogs thereof
EP0321973A2 (de) * 1987-12-23 1989-06-28 BOEHRINGER INGELHEIM INTERNATIONAL GmbH Expression der viral kodierten Protease P2A des HRV2
WO1998049326A1 (en) * 1997-04-25 1998-11-05 Sembiosys Genetics Inc. Method for cleavage of fusion proteins
WO1999010503A1 (de) * 1997-08-22 1999-03-04 Roche Diagnostics Gmbh Autokatalytisch aktivierbare zymogene vorstufen von proteasen und deren verwendung
WO1999010483A2 (de) * 1997-08-22 1999-03-04 Roche Diagnostics Gmbh Autokatalytisch aktivierbare vorstufen von proteasen und deren verwendung

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
COLLINS-RACIE LISA A ET AL: "Production of recombinant bovine enterokinase catalytic subunit in Escherichia coli using the novel secretory fusion partner DsbA.", BIO-TECHNOLOGY (NEW YORK), vol. 13, no. 9, 1995, pages 982 - 987, XP002156881, ISSN: 0733-222X *
MUYLDERMANS GAETAN ET AL: "Expression in E. coli and purification of the active autoprotease P20 of classical swine fever virus.", VIRUS GENES, vol. 13, no. 2, 1996, pages 135 - 142, XP000971827, ISSN: 0920-8569 *
RUEMENAPF TILLMANN ET AL: "N-terminal protease of pestiviruses: Identification of putative catalytic residues by site-directed mutagenesis.", JOURNAL OF VIROLOGY, vol. 72, no. 3, March 1998 (1998-03-01), pages 2544 - 2547, XP002156880, ISSN: 0022-538X *
STARK ROBERT ET AL: "Processing of pestivirus polyprotein: Cleavage site between autoprotease and nucleocapsid protein of classical swine fever virus.", JOURNAL OF VIROLOGY, vol. 67, no. 12, 1993, pages 7088 - 7095, XP000971824, ISSN: 0022-538X *
WISKERCHEN M ET AL: "PESTIVIRUS GENE EXPRESSION: THE FIRST PROTEIN PRODUCT OF THE BOVINEVIRAL DIARRHEA VIRUS LARGE OPEN READING FRAME, P20, POSSESSES PROTEOLYTIC ACTIVITY", JOURNAL OF VIROLOGY,US,NEW YORK, US, vol. 65, no. 8, 1 August 1991 (1991-08-01), pages 4508 - 4514, XP000351822, ISSN: 0022-538X *

Cited By (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8372959B2 (en) 2005-04-26 2013-02-12 Sandoz Ag Production of recombinant proteins by autoproteolytic cleavage of a fusion protein
AU2006239723B2 (en) * 2005-04-26 2011-12-22 Boehringer Ingelheim Rcv Gmbh & Co Kg Production of recombinant proteins by autoproteolytic cleavage of a fusion protein
WO2006113958A3 (en) * 2005-04-26 2007-05-03 Sandoz Ag Affinity ligands
WO2006113957A3 (en) * 2005-04-26 2007-06-07 Sandoz Ag Production of recombinant proteins by autoproteolytic cleavage of a fusion protein
WO2006113957A2 (en) 2005-04-26 2006-11-02 Sandoz Ag Production of recombinant proteins by autoproteolytic cleavage of a fusion protein
AU2006239721B2 (en) * 2005-04-26 2011-07-14 Boehringer Ingelheim Rcv Gmbh & Co Kg Production of recombinant proteins by autoproteolytic cleavage of a fusion protein
EP2366719A2 (en) 2005-04-26 2011-09-21 Sandoz AG Process of production of a recombinant polypeptide by fusion with an autoprotease
EP2348053A3 (en) * 2005-04-26 2011-11-02 Sandoz AG Oligopeptide ligands
US8058410B2 (en) 2005-04-26 2011-11-15 Sandoz Ag Affinity ligands
US8163890B2 (en) 2005-04-26 2012-04-24 Sandoz Ag Production of recombinant proteins by autoproteolytic cleavage of a fusion protein
AU2006239722B2 (en) * 2005-04-26 2012-02-02 Boehringer Ingelheim Rcv Gmbh & Co Kg Affinity ligands
EP2366719A3 (en) * 2005-04-26 2012-03-07 Sandoz AG Process of production of a recombinant polypeptide by fusion with an autoprotease
WO2006113959A3 (en) * 2005-04-26 2007-03-22 Sandoz Ag Production of recombinant proteins by autoproteolytic cleavage of a fusion protein
CN101198700B (zh) * 2005-04-26 2012-08-15 桑多斯股份公司 通过融合蛋白的自我蛋白剪切制备重组蛋白
US7829319B2 (en) 2005-04-26 2010-11-09 Sandoz Ag Glutamic acid-modified classical swine fever virus autoproteases Npro
AU2011253661B2 (en) * 2005-04-26 2013-06-13 Boehringer Ingelheim Rcv Gmbh & Co Kg Production of recombinant proteins by autoproteolytic cleavage of a fusion protein
KR101289728B1 (ko) 2005-04-26 2013-08-07 베링거 인겔하임 에르체파우 게엠베하 운트 코 카게 융합 단백질의 자가 단백질 분해 절단에 의한 재조합단백질의 제조
CN103333252A (zh) * 2005-04-26 2013-10-02 桑多斯股份公司 通过融合蛋白的自我蛋白剪切制备重组蛋白
KR101374149B1 (ko) 2005-04-26 2014-03-14 베링거 인겔하임 에르체파우 게엠베하 운트 코 카게 융합 단백질의 자가단백질분해성 절단에 의한 재조합단백질 생산
WO2014009515A1 (en) 2012-07-13 2014-01-16 Sandoz Ag Method for producing a recombinant protein of interest
EP2684951A1 (en) 2012-07-13 2014-01-15 Sandoz Ag Method for producing a recombinant protein of interest
EP2746391A1 (en) 2012-12-19 2014-06-25 Sandoz Ag Method for producing a recombinant protein of interest
EP2746390A1 (en) 2012-12-19 2014-06-25 Sandoz Ag Method for producing a recombinant protein of interest
WO2014096239A1 (en) * 2012-12-19 2014-06-26 Sandoz Ag Method for producing a recombinant protein of interest
CN105189743A (zh) * 2012-12-19 2015-12-23 桑多斯股份公司 用于生产重组兴趣蛋白的方法
US9677107B2 (en) 2012-12-19 2017-06-13 Sandoz Ag Method for producing a recombinant protein of interest by using the Npro technology
AU2013366602B2 (en) * 2012-12-19 2019-05-30 Boehringer Ingelheim Rcv Gmbh & Co Kg Method for producing a recombinant protein of interest
WO2015087276A1 (en) 2013-12-12 2015-06-18 Novartis Ag A process for preparing a composition of pegylated proteins

Also Published As

Publication number Publication date
DE60029968D1 (de) 2006-09-21
HU230231B1 (hu) 2015-10-28
NO20020633L (no) 2002-04-05
US6936455B1 (en) 2005-08-30
IL147456A0 (en) 2002-08-14
NO328339B1 (no) 2010-02-01
ES2269173T3 (es) 2007-04-01
TR200200253T2 (tr) 2002-05-21
SK287488B6 (sk) 2010-11-08
CZ2002481A3 (cs) 2002-05-15
PL200225B1 (pl) 2008-12-31
AU6993300A (en) 2001-03-05
HUP0202519A2 (en) 2002-10-28
CZ302366B6 (cs) 2011-04-13
HK1047128A1 (en) 2003-02-07
CN1369014A (zh) 2002-09-11
EP1200604B1 (en) 2006-08-09
US20050186564A1 (en) 2005-08-25
HK1047128B (en) 2007-06-08
DE60029968T2 (de) 2006-12-21
NZ516869A (en) 2004-01-30
MXPA02001424A (es) 2002-08-12
SK1852002A3 (en) 2002-07-02
HUP0202519A3 (en) 2004-07-28
CA2379571C (en) 2011-03-29
PL353101A1 (en) 2003-10-20
NO20020633D0 (no) 2002-02-08
CN1230543C (zh) 2005-12-07
CA2379571A1 (en) 2001-02-15
JP4820512B2 (ja) 2011-11-24
JP2003506093A (ja) 2003-02-18
AU775662B2 (en) 2004-08-12
KR20020026366A (ko) 2002-04-09
EP1200604A1 (en) 2002-05-02
ATE335826T1 (de) 2006-09-15

Similar Documents

Publication Publication Date Title
US6936455B1 (en) Production of heterologous proteins using an Npro autoprotease of a pestivirus and inclusion bodies
EP1200603B1 (en) Production of proteins by autoproteolytic cleavage
EP0422049A4 (en) Vector for secretion of proteins directly into periplasm or culture medium

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A1

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A1

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
WWE Wipo information: entry into national phase

Ref document number: 2000958389

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 147456

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2379571

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 69933/00

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 516869

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2002/00253

Country of ref document: TR

WWE Wipo information: entry into national phase

Ref document number: 1852002

Country of ref document: SK

WWE Wipo information: entry into national phase

Ref document number: 008114595

Country of ref document: CN

Ref document number: 1020027001666

Country of ref document: KR

Ref document number: PV2002-481

Country of ref document: CZ

WWE Wipo information: entry into national phase

Ref document number: PA/a/2002/001424

Country of ref document: MX

WWP Wipo information: published in national office

Ref document number: 1020027001666

Country of ref document: KR

WWP Wipo information: published in national office

Ref document number: 2000958389

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: PV2002-481

Country of ref document: CZ

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

WWE Wipo information: entry into national phase

Ref document number: 10048882

Country of ref document: US

WWP Wipo information: published in national office

Ref document number: 516869

Country of ref document: NZ

WWG Wipo information: grant in national office

Ref document number: 516869

Country of ref document: NZ

WWG Wipo information: grant in national office

Ref document number: 69933/00

Country of ref document: AU

WWG Wipo information: grant in national office

Ref document number: 2000958389

Country of ref document: EP