WO1998001555A2 - Truncated soluble tumor necrosis factor type-i and type-ii receptors - Google Patents

Truncated soluble tumor necrosis factor type-i and type-ii receptors Download PDF

Info

Publication number
WO1998001555A2
WO1998001555A2 PCT/US1997/012244 US9712244W WO9801555A2 WO 1998001555 A2 WO1998001555 A2 WO 1998001555A2 US 9712244 W US9712244 W US 9712244W WO 9801555 A2 WO9801555 A2 WO 9801555A2
Authority
WO
WIPO (PCT)
Prior art keywords
cys
seq
stnfr
amino acid
tumor necrosis
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US1997/012244
Other languages
English (en)
French (fr)
Other versions
WO1998001555A3 (en
Inventor
Eric F. Fisher
Carl K. Edwards
Gary L. Kieft
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Amgen Inc
Original Assignee
Amgen Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to DE69737814T priority Critical patent/DE69737814T2/de
Priority to ES97932603T priority patent/ES2288304T3/es
Priority to NZ333647A priority patent/NZ333647A/xx
Priority to EP97932603A priority patent/EP0914431B1/en
Priority to AU36013/97A priority patent/AU3601397A/en
Priority to BR9710350A priority patent/BR9710350A/pt
Priority to EA199900095A priority patent/EA003900B1/ru
Priority to IL12787497A priority patent/IL127874A0/xx
Priority to SK15-99A priority patent/SK1599A3/sk
Priority to CA2259156A priority patent/CA2259156C/en
Priority to JP50536998A priority patent/JP2002514048A/ja
Application filed by Amgen Inc filed Critical Amgen Inc
Publication of WO1998001555A2 publication Critical patent/WO1998001555A2/en
Publication of WO1998001555A3 publication Critical patent/WO1998001555A3/en
Priority to PL97331240A priority patent/PL189309B1/pl
Priority to NO990086A priority patent/NO990086L/no
Anticipated expiration legal-status Critical
Priority to AU11121/01A priority patent/AU774307B2/en
Priority to US09/882,735 priority patent/US6989147B2/en
Priority to US11/126,126 priority patent/US7732587B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7151Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for tumor necrosis factor [TNF], for lymphotoxin [LT]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/525Tumour necrosis factor [TNF]
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/14Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/02Drugs for disorders of the nervous system for peripheral neuropathies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/08Antiepileptics; Anticonvulsants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/02Nutrients, e.g. vitamins, minerals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/14Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/08Vasodilators for multiple indications
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/05Animals comprising random inserted nucleic acids (transgenic)
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/0306Animal model for genetic diseases
    • A01K2267/0325Animal model for autoimmune diseases
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10TECHNICAL SUBJECTS COVERED BY FORMER USPC
    • Y10STECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10S530/00Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof
    • Y10S530/81Carrier - bound or immobilized peptides or proteins and the preparation thereof, e.g. biological cell or cell fragment as carrier
    • Y10S530/812Peptides or proteins is immobilized on, or in, an organic carrier
    • Y10S530/815Carrier is a synthetic polymer

Definitions

  • the present invention relates to the field of inflammation. More specifically, the present invention relates to truncated tumor necrosis factor receptors (sTNFRs) .
  • sTNFRs tumor necrosis factor receptors
  • Inflammation is the body's defense reaction to injuries such as those caused by mechanical damage, infection or antigenic stimulation.
  • An inflammatory reaction may be expressed pathologically when inflammation is induced by an inappropriate stimulus such as an autoantigen, is expressed in an exaggerated manner or persists well after the removal of the injurious agents.
  • Such inflammatory reaction may include the production of certain cytokines. While the etiology of inflammation is poorly understood, considerable information has recently been gained regarding the molecular aspects of inflammation. This research has led to identification of certain cytokines which are believed to figure prominently in the mediation of inflammation. Cytokines are extracellular proteins that modify the behavior of cells, particularly those cells that are in the immediate area of cytokine synthesis and release.
  • Tumor necrosis factors are a class of cytokines produced by numerous cell types, including monocytes and macrophages .
  • TNF alpha TNF- ⁇
  • TNF beta TNF- ⁇ or lymphotoxin
  • TNF- ⁇ and TNF- ⁇ are major inflammatory cytokines.
  • TNFs have important physiological effects on a number of different target cells which are involved in inflammatory responses to a variety of stimuli such as infection and injury.
  • the proteins cause both fibroblasts and synovial cells to secrete latent collagenase and prostaglandin E 2 and cause osteocyte cells to stimulate bone resorption.
  • These proteins increase the surface adhesive properties of endothelial cells for neutrophils. They also cause endothelial cells to secrete coagulant activity and reduce their ability to lyse clots. In addition they redirect the activity of adipocytes away from the storage of lipids by inhibiting expression of the enzyme lipoprotein lipase.
  • TNFs also cause hepatocytes to synthesize a class of proteins known as "acute phase reactants," which act on the hypothalamus as pyrogens (Selby et al . (1988), Lancet , 1 -8583- :483; Starnes, Jr. et al . (1988), J. Clin . Invest . , £2:1321; Oliff et al. (1987), Cell, ££L:555; and Waage et al. (1987), Lancet , ⁇ &522L) : 355) .
  • acute phase reactants act on the hypothalamus as pyrogens
  • EP 308 378 reports that a protein derived from the urine of fever patients has a TNF inhibiting activity. The effect of this protein is presumably due to a competitive mechanism at the level of the receptors.
  • EP 308 378 discloses a protein sufficiently pure to be characterized by its N-terminus. The reference, however, does not teach any DNA sequence or a recombinantly-produced TNF inhibitor.
  • EP 393 438 and EP 422 339 teach the amino acid and nucleic acid sequences of a mature, recombinant human "30kDa TNF inhibitor” (also known as a p55 receptor and as sTNFR-I) and a mature, recombinant human "40kDa inhibitor” (also known as a p75 receptor and as sTNFR-II) as well as modified forms thereof, e.g., fragments, functional derivatives and variants.
  • EP 393 438 and EP 422 339 also disclose methods for isolating the genes responsible for coding the inhibitors, cloning the gene in suitable vectors and cell types, and expressing the gene to produce the inhibitors.
  • sTNFR-I and sTNFR-II are members of the nerve growth factor/TNF receptor superfa ily of receptors which includes the nerve growth factor receptor (NGF) , the B cell antigen CD40, 4-1BB, the rat T-cell antigen MRC 0X 0, the Fas antigen, and the CD27 and CD30 antigens (Smith et al . (1990), Science, 2 . : 1019-1023) .
  • cysteine-rich extracellular ligand binding domain which can be divided into four repeating motifs of about forty amino acids and which contains 4-6 cysteine residues at positions which are well conserved (Smith et al . (1990), supra) .
  • EP 393 438 further teaches a 40kDa TNF inhibitor ⁇ 51 and a 40kDa TNF inhibitor ⁇ 53, which are truncated versions of the full-length recombinant 40kDa TNF inhibitor protein wherein 51 or 53 amino acid residues, respectively, at the carboxyl terminus of the mature protein are removed. Accordingly, a skilled artisan would appreciate that the fourth domain of each of the 30kDa TNF inhibitor and the 40kDa inhibitor is not necessary for TNF inhibition. In fact various groups have confirmed this understanding.
  • the present invention is directed to functionally active truncated forms of sTNFR-I and sTNFR-II, respectively, and are referred to herein as "truncated sTNFR(s)".
  • the truncated sTNFRs are modified forms of sTNFR-I and sTNFR-II which do not contain the fourth domain (amino acid residues Thr 127 -Asn 161 of sTNFR-I and amino acid residues Pro 1 1 -Thr 179 of sTNFR- II) ; a portion of the third domain (amino acid residues Asn ⁇ :L1 -Cys 126 of sTNFR-I and amino acid residues Pro 123 - Lys 140 of sTNFR-II); and, optionally, which do not contain a portion of the first domain (amino acid residues Asp 1 -Cys 19 of sTNFR-I and amino acid residues Leu i -Cys 32 of s
  • the truncated sTNFRs of the present invention include the proteins represented by the formula R ⁇
  • Ri- [Cys 19 -Cys 103 ] -R 2 is meant one or more proteins wherein [Cys 19 -Cys 103 ] represents residues 19 through 103 of sTNFR-I, the amino acid residue numbering scheme of which is provided in Figure 1 (SEQ ID NO: 2) to facilitate the comparison; wherein Ri represents a methionylated or nonmethionylated amine group of Cys 19 or of amino-terminus amino acid residue (s) selected from the group: C IC SIC
  • VCPQGKYIHPQNNSIC (SEQ ID NO: 27)
  • R 2 represents a carboxy group of Cys 103 or of carboxy-terminal amino acid residues selected from the group :
  • FCCS FCCSL (SEQ ID NO: 30) FCCSL (SEQ ID NO: 31) FCCSLC (SEQ ID NO: 32) FCCSLCL (SEQ ID NO: 33);
  • R x represents a methionylated or nonmethionylated amine group of amino acid sequence VCPQGKYIHPQNNSIC or an N-terminal truncation thereof of from 1 to 15 residues
  • R ⁇ [Cys 19 -Cys 103 ] -R 2 protein is not an addition variant having the formula R ⁇ [Cys 19 -Cys 103 ] -FCCSLCL-R 3 , wherein R 3 represents a carboxyl group of amino acid sequence Asn 11] —Asn 161 of Figure 1 or a carboxy-terminal truncation thereof.
  • Exemplary truncated sTNFR-I of the present invention include the following molecules: H 2 -
  • MDSVCPQGKYIHPQNNSIC-[Cys 19 -Cys 103 ]-FC-COOH also referred to as sTNFR-I 2.6D/C105
  • NH 2 -MDSVCPQGKYIHPQNNSIC- [Cys 19 - Cys 103 ]-FNCSL-COOH also referred to as sTNFR-I
  • R 4 - [Cys 32 -Cys 115 ]-R 5 ⁇ is meant one or more proteins wherein [Cys 32 -Cys 115 ] represents residues Cys 32 through Cys 115 of sTNFR-I, the amino acid residue numbering scheme of which is provided in Figure 8 (SEQ ID NO: 35) to facilitate the comparison; wherein R 4 represents a methionylated or nonmethionylated amine group of Cys 32 or of amino-terminus amino acid residue (s) selected from the group: C
  • FTPYAPEPGSTCRLREYYDQTAQMC (SEQ ID NO: 57)
  • VAFTPYAPEPGSTCRLREYYDQTAQMC SEQ ID NO: 59
  • LPAQVAFTPYAPEPGSTCRLREYYDQTAQMC (SEQ ID NO: 63); and wherein R 5 represents a carboxy group of Cys 115 or of carboxy-terminal amino acid residues selected from the group :
  • a AP APL APLR (SEQ ID NO: 64) APLRK (SEQ ID NO: 65) APLRKC (SEQ ID NO: 66) APLRKCR (SEQ ID NO: 67)
  • R 4 represents a methionylated or nonmethionylated amine group of amino acid sequence TCRLREYYDQTAQMC or an N-terminal truncation thereof of from 1 to 15 residues
  • R 4 - [Cys 32 -Cys 115 ] -R 5 is not an addition variant having the formula R 4 - [Cys 32 -Cys 115 ] -APLRKCR-R 6 , wherein R ⁇ represents a carboxyl group of amino acid sequence
  • the truncated sTNFRs may be made in glycosylated or non-glycosylated orms. Truncated sTNFRs are produced by recombinant genetic engineering techniques. In an alternative embodiment, truncated sTNFRs are synthesized by chemical techniques or a combination of the recombinant and chemical techniques.
  • truncated sTNFRs may be derivatized by attaching the truncated sTNFRs to a water soluble polymer.
  • the truncated sTNFRs may be conjugated to one or more polyethylene glycol molecules in order to improve pharmacokinetic performance by increasing the molecule's apparent molecular weight.
  • Yet another aspect of the present invention includes the various polynucleotides encoding truncated sTNFRs. Suitable nucleic acid sequences include, for example, those specifically depicted in the Figures as well as degenerate sequences and naturally occurring allelic variations thereof. Such nucleic acid sequences may be used in the expression of truncated sTNFRs in eukaryotic or prokaryotic host cells, wherein the expression products or derivatives thereof are characterized by the ability to modulate the activity of TNF.
  • a further aspect of the present invention involves vectors containing the polynucleotides encoding truncated sTNFRs operatively linked to amplification and/or expression control sequences.
  • Both prokaryotic and eukaryotic host cells may be stably transformed or • transfected with such vectors to express the truncated sTNFRs .
  • the present invention further includes the recombinant production of truncated sTNFRs wherein host cells containing such polynucleotides are grown in a suitable nutrient medium and the truncated sTNFRs expressed by the cells are, optionally, isolated from the host cells and/or the nutrient medium.
  • compositions containing truncated sTNFRs or derivatives thereof include pharmaceutical compositions containing truncated sTNFRs or derivatives thereof.
  • the truncated sTNFRs or derivatives thereof may be formulated in association with pharmaceutically acceptable vehicles.
  • a variety of other formulation materials may be used to facilitate manufacture, storage, handling, delivery and/or efficacy of the truncated sTNFRs or derivatives thereof.
  • TNF-mediated diseases e.g., diseases mediated by TNF- ⁇ and/or TNF- ⁇
  • TNF-mediated diseases may be treated by administering to a patient therapeutically effective amounts of truncated sTNFRs or derivatives thereof.
  • polynucleotides encoding truncated sTNFRs may also be used in cell therapy or gene therapy applications.
  • sTNFR-I has a deamidation site within the amino acid sequence 111 to 126 (amino acids Asn 11:L -Gly 126 ) . The absence of this site is expected to enhance biochemical stability of the purified protein, decreasing possible degradation products and resulting in more storage-stable proteins. Truncated sTNFRs have fewer disulfide bridges than do other previously disclosed TNF inhibitor proteins.
  • sTNFR-I has two disulfide bridges within the amino acid sequence 111 to 126 and three disulfide bridges within the amino acid sequence 127 to 161; and sTNFR-II has a disulfide bridge between Cys 121 and Cys 139 , Cys 142 and Cys 157 , and Cys 163 and Cys 178 .
  • the reduced number of disulfide bridges is important in that greater numbers of these linkages can complicate the protein refolding process.
  • truncated sTNFRs have fewer sites for antigenic epitopes than do other previously disclosed TNF inhibitor proteins (e.g., a shortened form of sTNFR-I having the first three domains has neo-epitopes caused by exposing certain residues, see Example III) , resulting in comparatively reduced antigenicity and having no significant reduction in clearance rate with repeated administration.
  • the reduced immunogenicity of truncated sTNFRs is expected to be suitable for treatment of TNF-mediated diseases, particularly including chronic inflammatory diseases. Additional aspects and advantages of the invention will be apparent to those skilled in the art upon consideration of the following description, which details the practice of the present invention.
  • Figure 1 depicts a nucleic acid sequence (SEQ ID N0:1) encoding Asp 1 -Asn 161 , full length recombinant human sTNFR-I. Also depicted is the amino acid sequence (SEQ ID NO: 2) of Aspi-Asn 161 .
  • Figure 2 depicts a nucleic acid sequence (SEQ ID NO: 3) encoding NH -MDSVCPQGKYIHPQNNSIC- [Cys 19 -
  • Cys 103 ]-FC-COOH also referred to as sTNFR-I 2.6D/C105. Also depicted is the amino acid sequence (SEQ ID NO: 4) of NH 2 -MDSVCPQGKYIHPQNNSIC-[Cys 19 -Cys 103 ]-FC-COOH.
  • Figure 3 depicts a nucleic acid sequence (SEQ ID NO: 5) encoding NH 2 -MDSVCPQGKYIHPQNNSIC- [Cys 19 -
  • Figure 4 depicts a nucleic acid sequence (SEQ ID NO: 7) encoding NH 2 -MDSVCPQGKYIHPQNNSIC- [Cys 19 - Cys 103 ] -FN-COOH (also referred to as sTNFR-I 2.6D/N105). Also depicted is the amino acid sequence (SEQ ID NO: 8) of NH 2 -MDSVCPQGKYIHPQNNSIC- [Cys 19 -Cys 103 ] -FN-COOH.
  • Figure 5 depicts a nucleic acid sequence (SEQ ID NO: 11) encoding NH 2 -MYIHPQNNSIC- [Cys 19 -Cys 103 ]- FNCSL-COOH (also referred to as sTNFR-I 2.3D/d8) .
  • amino acid sequence (SEQ ID NO: 12) of NH 2 -MDSVCPQGKYIHPQNNSIC-[Cys 19 -Cys 103 ] -FNCSL-COOH.
  • Figure 6 depicts a nucleic acid sequence (SEQ ID NO: 9) encoding NH 2 - - [Cys 19 -Cys 103 ] -FNCSL-COOH (also referred to as sTNFR-I 2.3D/dl8).
  • amino acid sequence (SEQ ID NO: 10) of NH -M- [Cys 19 -Cys 103 ] -FNCSL-COOH.
  • Figure 7 depicts a nucleic acid sequence (SEQ ID NO: 13) encoding NH 2 -MSIS- [Cys 19 -Cys 103 ] -FNCSL- COOH (also referred to as sTNFR-I 2.3D/dl5) . Also depicted is the amino acid sequence (SEQ ID NO: 14) of NH 2 -MSIS-[Cys 19 -Cys 103 ] -FNCSL-COOH.
  • Figure 8 depicts a nucleic acid sequence (SEQ ID NO: 34) encoding Leu 1 -Thr 179 , mature recombinant human sTNFR-II. Also depicted is the amino acid sequence (SEQ ID NO: 35) of Leu 1 -Thr 179 .
  • Figure 9 depicts the amount of swelling induced in a Streptococcal cell wall-induced reactivation model, as described in Example II.
  • Figure 10 depicts the plasma profiles of sTNFR-I 4D/C105db in healthy baboons following two minute intravenous infusion of 0.2 mg/kg, as described in Example III .
  • Figure 11 depicts the plasma profiles of sTNFR-I 3D/C105db in healthy baboons following two minute intravenous infusion of 0.2 mg/kg, as described in Example III.
  • Figure 12 depicts the plasma profiles of sTNFR-I 2.6D/C105db in healthy baboons following two minute intravenous infusion of 0.2 mg/kg, as described in Example III .
  • Figure 13 depicts realtionship between dose and clearance of different dimeric sTNFR-I contructs, as described in Example III. DETAILED DESCRIPTION OF THE INVENTION
  • sTNFR-I and sTNFR-II may each be reduced in size to exclude not only the fourth domain but a portion of the third domain and, optionally, a portion of the first domain, and yet retain biological activity and have reduced antigenicity.
  • these molecules may have one less potentially destabilizing deamidation site.
  • these molecules have fewer disulfide bridges, potentially making refolding and purifying easier.
  • these molecules have reduced sites for potential antigenic epitopes.
  • truncated sTNFR(s) includes one or more biologically active synthetic or recombinant molecules of the formula R ⁇ [Cys 19 -Cys 103 ] -R 2 or R 4 - [Cys 32 -Cys 115 ] -R 5 , and variants (including insertion, substitution and deletion variants) thereof, as described below.
  • biologically active means that a truncated sTNFR demonstrates similar TNF inhibiting properties, but not necessarily all of the same properties and not necessarily to the same degree as sTNFR-I and/or sTNFR-II.
  • truncated sTNFRs and derivatives thereof have the ability to inhibit TNF.
  • Bioassays of truncated sTNFRs are further described in Example II below. The selection of the particular TNF-inhibiting properties of interest depends upon the desired use of a truncated sTNFR.
  • truncated sTNFRs may advantageously be produced via recombinant techniques in bacterial, mammalian or insect cell systems and may be either a glycosylated or non-glycosylated forms of the protein.
  • truncated sTNFRs may be chemically synthesized. Currently preferred production methods are described in greater detail below.
  • Truncated sTNFRs each may typically be isolated and purified to be substantially free from the presence of other proteinaceous materials (i.e., non- truncated sTNFRs) .
  • a truncated sTNFR is about 80% free of other proteins which may be present due to the production technique used in the manufacture of the truncated sTNFR. More preferably a truncated sTNFR is about 90% free of other proteins, particularly preferably about 95% free of other proteins, and most preferably about >98% free of other proteins. It will be appreciated, however, that the desired protein may be combined with other active ingredients, chemical compositions and/or suitable pharmaceutical formulation materials prior to administration, as described in further detail below.
  • truncated sTNFRs of the present invention may be one or more proteins represented by the following formula: R ⁇ -[Cys 19 -Cys 103 ]-R 2 wherein [Cys 19 -Cys 103 l represents residues 19 through 103 of sTNFR-I, the amino acid residue numbering scheme of which is provided in Figure 1 (SEQ ID NO:2) to facilitate the comparison; wherein Ri represents a methionylated or nonmethionylated amine group of Cys 19 or of amino-terminus amino acid residue (s) selected from the group : C IC SIC
  • VCPQGKYIHPQNNSIC (SEQ ID NO: 27)
  • R represents a carboxy group of Cys 103 or of carboxy-terminal amino acid residues selected from the group :
  • FCCS FCCSL (SEQ ID NO: 30) FCCSL (SEQ ID NO: 31) FCCSLC (SEQ ID NO: 32) FCCSLCL (SEQ ID NO:33);
  • Rj represents a methionylated or nonmethionylated amine group of amino acid sequence VCPQGKYIHPQNNSIC or an N-terminal truncation thereof of from 1 to 15 residues
  • R ⁇ -[Cys 19 -Cys 103 ] -R 2 is not an addition variant having the formula Rj .
  • R3 represents a carboxyl group of amino acid sequence
  • truncated sTNFRs of the present invention may be one or more proteins represented by the following formula: R 4 - [Cys 32 -Cys 115 ] -R 5 wherein [Cys 3 -Cys 115 ] represents residues Cys 32 through Cys 115 of sTNFR-II, the amino acid residue numbering scheme of which is provided in Figure 8 (SEQ ID NO: 35) to facilitate the comparison; wherein R 4 represents a methionylated or nonmethionylated amine group of Cys 32 or of amino-terminus amino acid residue (s) selected from the group:
  • FTPYAPEPGSTCRLREYYDQTAQMC (SEQ ID NO: 57)
  • VAFTPYAPEPGSTCRLREYYDQTAQMC SEQ ID NO: 59
  • R 5 represents a carboxy group of Cys 115 or of carboxy-terminal amino acid residues selected from the group :
  • APLRKC SEQ ID NO: 66
  • R 4 represents a methionylated or nonmethionylated amine group of amino acid sequence TCRLREYYDQTAQMC or an
  • R 4 - [Cys 3 -Cys 115 ] -R 5 is not an addition variant having the formula R 4 - [Cys 32 -Cys 115 ] -APLRKCR-R 6 , wherein R 6 represents a carboxyl group of amino acid residues Pro 123 -Thr 179 of Figure 8 or a carboxy-terminal truncation thereof.
  • Another aspect of the present invention includes one or more variants of Rj . - [Cys 19 -Cys 103 ] -R and R 4 -[Cys 32 -Cys 115 ]-R 5 , either methionylated or nonmethionylated.
  • truncated sTNFR(s) thus includes one or more naturally-occurring allelic variants of R ⁇ [Cys 19 -Cys 103 ] -R and R 4 - [Cys 32 -Cys 115 ] -R 5 , and one or more other variant proteins in which amino acids have been deleted from (“deletion variants") , inserted into (“addition variants”), or substituted for ("substitution variants") residues within the amino acid sequences of R ⁇ [Cys 19 -Cys 103 ] -R 2 or R 4 - [Cys 32 -Cys 115 ] -R 5 .
  • Amino acid sequence deletions typically range from about 20 amino acid residues, more typically from about 1 to 10 residues, and most typically from about 1 to 5 residues, so as not to disrupt protein folding. N-terminal, C-terminal and internal intrasequence deletions are contemplated. The number of total deletions and/or consecutive deletions will be selected so as to preserve the tertiary structure of the protein in the affected domain, e.g., cysteine crosslin ing .
  • Deletions within the R ⁇ _- [Cys 19 -Cys 103 ] -R 2 amino acid sequence and within the R 4 - [Cys 32 -Cys 115 ] -R 5 amino acid sequence may be made in regions of low homology with the sequences of other members of the NGF/TNF receptor family in the group of cell surface membrane proteins.
  • Deletions within the R - [Cys 19 -Cys 103 ] -R 2 amino acid sequence and within the R 4 - [Cys 32 -Cys 115 ] -R 5 amino acid sequence may be made in areas of substantial homology with the sequences of other members of the NGF/TNF receptor family and will be more likely to significantly modify the biological activity.
  • the sequence similarity among NGF/TNF receptor family members is particularly high in the region corresponding to the first two disulfide loops of domain 1, the whole of domain 2, and the first disulfide loop of domain 3 (Banner et al . (1993), Cell , 73:431- 445) .
  • two exemplary deletion variants of Ri-[Cys 1 -Cys 103 ]-R 2 are Ri- [Cys 19 ( ⁇ Thr 20 ) -Cys 103 ] -R 2 and R ⁇ -[Cys 19 ( ⁇ Cys 19 -Lys 21 ) -Cys 103 ]-R 2 , wherein R- and R are as defined above.
  • three exemplary deletion variants of R 4 - [Cys 32 -Cys 115 ] -R 5 are R 4 ⁇ [Cys 32 -
  • Amino acid sequence additions may include amino- and/or carboxyl-terminal fusions ranging in length from one residue to one hundred or more residues, as well as internal intrasequence insertions of single or multiple amino acid residues. Internal additions may range typically from about 1 to 10 amino acid residues, more typically from about 1 to 5 amino acid residues and most typically from about 1 to 3 amino acid residues.
  • Amino-terminus addition variants include the addition of a methionine (for example, as an artifact of the direct expression of the protein in bacterial recombinant cell culture) or an additional amino acid residue or sequence.
  • a further example of an amino- terminal insertion includes the fusion of a signal sequence, as well as or with other pre-pro sequences, to facilitate the secretion of protein from recombinant host cells.
  • the signal sequence may be substituted by a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase or heat-stable enterotoxin II leaders.
  • the signal sequence may be selected, for example, from the group of the yeast invertase, alpha factor or acid phosphatase leader sequences.
  • sTNFR-I or of sTNFR-II are satisfactory, although other mammalian signal sequences may be suitable (e.g., sequences derived from other NGF/TNF receptor family members) .
  • Carboxy-terminus addition variants do not involve the addition of one or more amino acid residues that would result in the reconstruction of the sTNFR-I or of sTNFR-II, respectively. It will be appreciated that a carboxy-terminus addition variant will not include the addition of one or more carboxy acid residues that would result in the reconstruction of the third domain or fourth domain of sTNFR-I or sTNFR-II.
  • An example of carboxy-terminus addition variants includes chimeric proteins comprising the fusion of Ri-[Cys 19 -Cys 103 ]-R 2 or R- [Cys 32 -Cys 115 ] -R 5 with all or part of a constant domain of a heavy or light chain of human immunoglobulin .
  • immunoglobulin portion of each comprises all domains except the first domain of the constant region of the heavy chain of human immunoglobulin, such as IgG, IgA, IgM or IgE, especially IgG, e.g., IgGl or IgG3.
  • IgG, IgA, IgM or IgE especially IgG, e.g., IgGl or IgG3.
  • any amino acid of each immunoglobulin portion can be deleted or substituted with one or more amino acids, or one or more amino acids can be added as long as the TNF binding portion still binds TNF and the immunoglobulin portion shows one or more of its characteristic properties.
  • Another group of variants are amino acid substitution variants.
  • substitution variants each have at least one amino acid residue in R ⁇ [Cys 19 -Cys 103 ] -R 2 or R 4 - [Cys 32 -Cys 115 ] -R 5 removed and a different residue inserted in its place.
  • substitution variants include allelic variants, which are characterized by naturally-occurring nucleotide sequence changes in the species population that may or may not result in an amino acid change.
  • allelic variants which are characterized by naturally-occurring nucleotide sequence changes in the species population that may or may not result in an amino acid change.
  • One skilled in the art can use any information known about the binding or active site of the polypeptide in the selection of possible mutation sites.
  • alanine scanning mutagenesis One method for identifying amino acid residues or regions for mutagenesis of a protein is called “alanine scanning mutagenesis” (Cunningham and Wells (1989), Science, 2 ⁇ A: 1081-1085, the disclosure of which is hereby incorporated by reference) .
  • an amino acid residue or group of target residues of a protein is identified (e.g., charged residues such as Arg, Asp, His, Lys and Glu) and replaced by a neutral or negatively-charged amino acid (most preferably alanine or polyalanine) to effect the interaction of the amino acids with the surrounding aqueous environment in or outside the cell.
  • Those residues demonstrating functional sensitivity to the substitutions are then refined by introducing additional or alternate residues at the sites of substitution.
  • the site for introducing an amino acid sequence modification is predetermined and, to optimize the performance of a mutation at a given site, alanine scanning or random mutagenesis may be conducted and the resulting variant polypeptide screened for the optimal combination of desired activity and degree of activity.
  • Sites of interest for substitutional mutagenesis include sites where the amino acids found in R ⁇ -[Cys 19 -Cys 103 ]-R 2 or R 4 - [Cys 32 -Cys 115 ] -R 5 are substantially different in terms of side-chain bulk, charge and/or hydrophobicity from sTNFR-like proteins such as sTNFRs of other various species or of other members of the NGF/TNF receptor family.
  • Other sites of interest include those in which particular residues are similar or identical with those of such sTNFR-I-like proteins and sTNFR-II-like proteins. Such positions are generally important for the biological activity of a protein.
  • Residues Tyr 9 , Thr 39 , His 55 in Domain 1, residues Phe 49 , Ser 63 , Asp 82 in Domain 2 and residues Tyr 92 and Ser 107 in Domain 3 have been identified as being potentially important for the stabilization of the structure of Domains 1, 2 and 3, respectively.
  • Residues Pro 12 and His 55 have been identified as potentially interacting with Ser B6 -Tyr 87 on subunit C of TNF ⁇ .
  • Residues Glu 45 -Phe 49 have been identified as being in a loop which potentially interacts with residues Leu 29 -Arg 32 of TNF ⁇ subunit A.
  • Residues Gly 48 has been identified as potentially interacting with Asn 19 -Pro 20 on subunit A of TNF ⁇ .
  • Residue His 58 -Leu 60 have been identified as being in an extended strand conformation and side chain interactions with residues Arg 31 -Ala 33 on subunit A of TNF ⁇ have been potentially identified with residue His 58 of sTNFR-I specifically interacting with residue Arg 31 .
  • Residues Lys 64 -Arg 66 have been identified as being in an extended strand conformation and have been identified as having side chain and main chain interactions with residues
  • Residue Met 69 has been identified as potentially interacting with residue Tyr 115 on subunit A of TNF ⁇ .
  • Residues His 9 -Phe 101 have been identified as forming a loop which interacts with residues Thr 72 -Leu 75 and Asn 137
  • the hydropathic index of amino acids may be considered.
  • Each amino acid has been assigned a hydropathic index on the basis of their hydrophobicity and charge characteristics, these are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine (-1.3); proline (- 1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine (-3.9); and arginine (-4.5).
  • hydropathic amino acid index in conferring interactive biological function on a protein is generally understood in the art (Kyte and Doolittle (1982), J. Mol . Biol . , 15_7: 105-131, the disclosure of which are incorporated herein by reference) . It is known that certain amino acids may be substituted for other amino acids having a similar hydropathic index or score and still retain a similar biological activity. In making changes based upon the hydropathic index, the substitution of amino acids whose hydropathic indices are within ⁇ 2 is preferred, those which are within ⁇ 1 are particularly preferred, and those within ⁇ 0.5 are even more particularly preferred. It is also understood in the art that the substitution of like amino acids can be made effectively on the basis of hydrophilicity, particularly where the biological functional equivalent protein or peptide thereby created is intended for use in immunological embodiments, as in the present case.
  • hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0 + 1); glutamate (+3.0 ⁇ 1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5 ⁇ 1); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4).
  • U.S. Patent 4,554,101 also teaches the identification and preparation of epitopes from primary amino acid sequences on the basis of hydrophilicity. Through the methods disclosed in U.S. Patent 4,554,101 one of skill in the art would be able to identify epitopes from within an amino acid sequence such as the sTNFRs sequences disclosed herein. These regions are also referred to as "epitopic core regions".
  • R ⁇ -[Cys 19 - Cys 103 ]-R and R4- [Cys 32 -Cys 115 ] -R5 may be accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the protein at the target site or (c) the bulk of the side chain.
  • Naturally- occurring residues are divided into groups based on common side chain properties:
  • Non-conservative substitutions may involve the exchange of a member of one of these groups for another. Such substituted residues may be introduced into regions of R ⁇ -[Cys 19 -Cys 103 ]-R 2 and R - [Cys 32 -Cys 115 ] -R 5 that are homologous or non-homologous with other NGF/TNF receptor family members.
  • Figure 5 wherein naturally-occurring Asn 105 of the sTNFR-I is changed to Cys to facilitate the attachment of a polyethylene glycol molecule (Example I) .
  • the sequences of R ⁇ [Cys 19 -Cys 103 ] -R and R4- [Cys 32 -Cys 115 ] -R5 may be modified to add glycosylation sites or to delete N-linked or O-linked glycosylation sites.
  • An asparagine-linked glycosylation recognition site comprises a tripeptide sequence which is specifically recognized by appropriate cellular glycosylation enzymes.
  • tripeptide sequences are either Asn-Xaa-Thr or Asn-Xaa-Ser, where Xaa can be any amino acid other than Pro.
  • Proven or predicted asparagine residues of sTNFR-I exist at positions 14, 105 and 111.
  • Proven or predicted asparagine residues of sTNFR-II exist at positions 149 and 171.
  • a variety of amino acid substitutions or deletions may be made to modify or add N-linked or O-linked glycosylation sites, resulting in a protein with altered glycosylation.
  • the variants are substantially homologous to the amino acid of R ⁇ -[Cys 19 - Cys 103 ]-R 2 or R 4 - [Cys 32 -Cys 115 ] -R 5 .
  • substantially homologous means a degree of homology that is preferably in excess of 70%, more preferably in excess of 80%, even more preferably in excess of 90% or most preferably even 95%.
  • the percentage of homology as described herein is calculated as the percentage of amino acid residues found in the smaller of the two sequences which align with identical amino acid residues in the sequence being compared when four gaps in a length of 100 amino acids may be introduced to assist in that alignment, as set forth by Dayhoff (1972), in Atlas of Protein Sec ience and Structure, ⁇ : 124, National Biochemical Research Foundation, Washington, D.C., the disclosure of which is hereby incorporated by reference.
  • truncated sTNFRs which may be isolated by virtue of cross-reactivity with antibodies to the amino acid sequences of SEQ ID NO: 2 and SEQ ID NO: 35, respectively, or whose genes may be isolated through hybridization with the DNA of SEQ ID N0:1 or SEQ ID NO: 34 or with segments thereof.
  • Exemplary sTNFRs of the present invention include the following molecules: NH 2 -MDSVCPQGKYIHPQNNSIC -[Cys 19 -Cys 103 ]-FC-COOH (also referred to as sTNFR-I
  • variant truncated sTNFRs are described in further detail below.
  • Such variants may be prepared by introducing appropriate nucleotide changes into the DNA encoding the truncated sTNFRs or by in vitro chemical synthesis of the desired truncated sTNFRs. It will be appreciated by those skilled in the art that many combinations of deletions, insertions and substitutions can be made, provided that the final truncated sTNFRs are biologically active.
  • Mutagenesis techniques for the replacement, insertion or deletion of one or more selected amino acid residues are well known to one skilled in the art (e.g., U.S. Pat. No. 4,518,584, the disclosure of which is hereby incorporated by reference) .
  • Each mutation site can be modified individually or in series, e.g., by (1) substituting first with conservative amino acid choices and then with more radical selections, depending upon the results achieved, (2) deleting the target amino acid residue or (3) inserting amino acid residues adjacent to the located site.
  • truncated sTNFRs Chemically modified derivatives of truncated sTNFRs may be prepared by one skilled in the art, given the disclosures herein. Conjugates may be prepared using glycosylated, non-glycosylated or de-glycosylated truncated sTNFRs. Typically, non-glycosylated truncated sTNFRs will be used. Suitable chemical moieties for derivatization of truncated sTNFRs include water soluble polymers.
  • Water soluble polymers are desirable because the protein to which each is attached will not precipitate in an aqueous environment, such as a physiological environment.
  • the polymer will be pharmaceutically acceptable for the preparation of a therapeutic product or composition.
  • One skilled in the art will be able to select the desired polymer based on such considerations as whether the polymer/protein conjugate will be used therapeutically and, if so, the desired dosage, circulation time and resistance to proteolysis .
  • Suitable, clinically acceptable, water soluble polymers include, but are not limited to, polyethylene glycol (PEG) , polyethylene glycol propionaldehyde, copolymers of ethylene glycol/propylene glycol, monomethoxy-polyethylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol (PVA) , polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-1, 3, 6-trioxane, ethylene/maleic anhydride copolymer, poly ( ⁇ -amino acids) (either homopolymers or random copolymers) , poly(n-vinyl pyrrolidone) polyethylene glycol, propropylene glycol homopolymers (PPG) and other polyakylene oxides, polypropylene oxide/ethylene oxide copolymers, polyoxyethylated polyols (POG) (e.g., glycerol) and other polyoxyethylated polyols
  • polyethylene glycol is meant to encompass any of the forms that have been used to derivatize other proteins, such as mono- (C1-C10) alkoxy- or aryloxy-polyethylene glycol.
  • Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
  • the water soluble polymers each may be of any molecular weight and may be branched or unbranched.
  • the water soluble polymers each typically have an average molecular weight of between about 2kDa to about lOOkDa (the term "about” indicating that in preparations of a water soluble polymer, some molecules will weigh more, some less, than the stated molecular weight) .
  • the average molecular weight of each water soluble polymer preferably is between about 5kDa and about 50kDa, more preferably between about 12kDa and about 40kDa and most preferably between about 20kDa and about 35kDa.
  • the higher the molecular weight or the more branches the higher the polymer :protein ratio.
  • the water soluble polymers each should be attached to the protein with consideration of effects on functional or antigenic domains of the protein.
  • chemical derivatization may be performed under any suitable condition used to react a protein with an activated polymer molecule.
  • Activating groups which can be used to link the water soluble polymer to one or more proteins include the following: sulfone, maleimide, sulfhydryl, thiol, triflate, tresylate, azidirine, oxirane and 5-pyridyl .
  • the water soluble polymers each are generally attached to the protein at the ⁇ - or ⁇ -amino groups of amino acids or a reactive thiol group, but it is also contemplated that a water soluble group could be attached to any reactive group of the protein which is sufficiently reactive to become attached to a water soluble group under suitable reaction conditions.
  • a water soluble polymer may be covalently bound to a protein via a reactive group, such as a free amino or carboxyl group.
  • the amino acid residues having a free amino group may include lysine residues and the N-terminal amino acid residue.
  • Those having a free carboxyl group may include aspartic acid residues, glutamic acid residues and the C-terminal amino acid residue.
  • Those having a reactive thiol group include cysteine residues.
  • Methods for preparing proteins conjugated with water soluble polymers will each generally comprise the steps of (a) reacting a protein with a water soluble polymer under conditions whereby the protein becomes attached to one or more water soluble polymers and (b) obtaining the reaction product.
  • Reaction conditions for each conjugation may be selected from any of those known in the art or those subsequently developed, but should be selected to avoid or limit exposure to reaction conditions such as temperatures, solvents and pH levels that would inactivate the protein to be modified.
  • the optimal reaction conditions for the reactions will be determined case-by-case based on known parameters and the desired result . For example, the larger the ratio of water soluble polymer :protein conjugate, the greater the percentage of conjugated product.
  • the optimum ratio in terms of efficiency of reaction in that there is no excess unreacted protein or polymer
  • the desired degree of derivatization e.g., mono-, di-, tri-, etc.
  • the ratio of water soluble polymer (e.g., PEG) to protein will generally range from 1:1 to 100:1.
  • One or more purified conjugates may be prepared from each mixture by standard purification techniques, including among others, dialysis, salting-out, ultrafiltration, ion-exchange chromatography, gel filtration chromatography and electrophoresis .
  • the method of obtaining the N-terminal chemically modified protein preparation may be by purification of the N-terminal chemically modified protein material from a population of chemically modified protein molecules.
  • Selective N-terminal chemical modification may be accomplished by reductive alkylation which exploits differential reactivity of different types of primary amino groups (lysine versus the N-terminal) available for derivatization in a particular protein.
  • substantially selective derivatization of the protein at the N-terminus with a carbonyl group containing polymer is achieved.
  • attachment of a water soluble polymer to a protein is controlled: the conjugation with the polymer takes place predominantly at the N-terminus of the protein and no significant modification of other reactive groups, such as the lysine side chain amino groups, occurs.
  • the water soluble polymer may be of the type described above and should have a single reactive aldehyde for coupling to the protein.
  • Polyethylene glycol propionaldehyde, containing a single reactive aldehyde, may be used.
  • the present invention specifically contemplates the chemically derivatized protein to include mono- or poly- (e.g., 2-4) PEG moieties.
  • Pegylation may be carried out by any of the pegylation reactions known in the art.
  • Methods for preparing a pegylated protein product will generally comprise the steps of (a) reacting a protein product with polyethylene glycol (such as a reactive ester or aldehyde derivative of PEG) under conditions whereby the protein becomes attached to one or more PEG groups and (b) obtaining the reaction product (s) .
  • polyethylene glycol such as a reactive ester or aldehyde derivative of PEG
  • the optimal reaction conditions for the reactions will be determined case-by-case based on known parameters and the desired result.
  • the pegylation specifically may be carried out via an acylation reaction or an alkylation reaction with a reactive polyethylene glycol molecule.
  • protein products according to the present invention include pegylated proteins wherein the PEG group (s) is (are) attached via acyl or alkyl groups.
  • Such products may be mono-pegylated or poly-pegylated (e.g., containing 2-6, and preferably 2-5, PEG groups) .
  • the PEG groups are generally attached to the protein at the ⁇ - or ⁇ -amino groups of amino acids, but it is also contemplated that the PEG groups could be attached to any amino group attached to the protein which is sufficiently reactive to become attached to a PEG group under suitable reaction conditions.
  • Pegylation by acylation generally involves reacting an active ester derivative of polyethylene glycol (PEG) with the protein.
  • the polymer (s) selected should have a single reactive ester group. Any known or subsequently discovered reactive PEG molecule may be used to carry out the pegylation reaction.
  • a preferred activated PEG ester is PEG esterified to N-hydroxysuccinimide (NHS) .
  • acylation is contemplated to include, without limitation, the following types of linkages between the therapeutic protein and a water soluble polymer such as PEG: amide, carbamate, urethane, and the like (see Chamow (1994), Bioconjugate Chem .
  • reaction conditions may be selected from any of those known in the pegylation art or those subsequently developed, but should avoid conditions such as temperature, solvent and pH that would inactivate the protein to be modified.
  • Pegylation by acylation will generally result in a poly-pegylated protein.
  • the connecting linkage will be an amide.
  • the resulting product will be substantially only (e.g., > 95%) mono, di- or tri-pegylated.
  • some species with higher degrees of pegylation may be formed in amounts depending on the specific reaction conditions used.
  • more purified pegylated species may be separated from the mixture (particularly unreacted species) by standard purification techniques, including among others, dialysis, salting-out, ultrafiltration, ion-exchange chromatography, gel filtration chromatography and electrophoresis.
  • Pegylation by alkylation generally involves reacting a terminal aldehyde derivative of PEG with the protein in the presence of a reducing agent.
  • the polymer (s) selected should have a single reactive aldehyde group.
  • An exemplary reactive PEG aldehyde is polyethylene glycol propionaldehyde, which is water stable, or mono C1-C10 alkoxy or aryloxy derivatives thereof (see, U.S. Patent 5,252,714, the disclosure of which are incorporated herein by reference) .
  • Pegylation by alkylation can also result in poly-pegylated protein.
  • the PEG groups are preferably attached to the protein via a -CH 2 -NH- group. With particular reference to the -CH 2 - group, this type of linkage is referred to herein as an "alkyl" linkage.
  • Reductive alkylation to produce a substantially homogeneous population of mono-polymer/ protein product will generally comprise the steps of: (a) reacting a protein with a reactive PEG molecule under reductive alkylation conditions, at a pH suitable to permit selective modification of the ⁇ -amino group at the amino terminus of said protein and (b) obtaining the reaction product (s) .
  • Derivatization via reductive alkylation to produce a monopegylated product exploits pKa differences between the lysine amino groups and the ⁇ -amino group at the N-terminus (the pKa being the pH at which 50% of the amino groups are protonated and 50% are not) .
  • the reaction is performed at a pH which allows one to take advantage of the pKa differences between the ⁇ -amino groups of the lysine residues and that of the ⁇ amino group of the N-terminal residue of the protein.
  • a pH which allows one to take advantage of the pKa differences between the ⁇ -amino groups of the lysine residues and that of the ⁇ amino group of the N-terminal residue of the protein.
  • the pH is lower, a larger excess of polymer to protein will be desired (i.e., the less reactive the N-terminal ⁇ -amino group, the more polymer needed to achieve optimal conditions) .
  • the pH is higher, the polymer :protein ratio need not be as large (i.e., more reactive groups are available, so fewer polymer molecules are needed) .
  • the pH will generally fall within the range of 3-9, preferably 3-6.
  • the reducing agent should be stable in aqueous solution and preferably be able to reduce only the Schiff base formed in the initial process of reductive alkylation.
  • Suitable reducing agents may be selected from sodium borohydride, sodium cyanoborohydride, dimethylamine borane, trimethylamine borane and pyridine borane.
  • a particularly suitable reducing agent is sodium cyanoborohydride.
  • Other reaction parameters such as solvent, reaction times, temperatures and means of purification of products can be determined case-by-case, based on the published information relating to derivatization of proteins with water soluble polymers.
  • a water soluble polymer that contains a reactive group such as an aldehyde
  • the conjugation with the polymer takes place predominantly at the N-terminus of the protein and no significant modification of other reactive groups, such as the lysine side chain amino groups, occurs.
  • the preparation will typically be greater than 90% monopolymer/protein conjugate, and more typically greater than 95% monopolymer/protein conjugate, with the remainder of observable molecules being unreacted (i.e., protein lacking the polymer moiety).
  • a specific embodiment of the present invention is an unbranched monomethoxy-polyethylene glycol aldehyde molecule having an average molecular weight of either about 20kDa or about 33kDa (e.g., between 30kDa and 35kDa) , or a tertiary-butyl polyethylene glycol aldehyde having an average molecular weight of about 33kDa (e.g., between 30kDa and 35kDa) conjugated via reductive alkylation to sTNFR-I 2.6D/N105.
  • the pegylation also may specifically be carried out via water soluble polymers having at least one reactive hydroxy group (e.g.
  • polyethylene glycol can be reacted with a reagent having a reactive carbonyl, nitrile or sulfone group to convert the hydroxyl group into a reactive Michael acceptor, thereby forming an "activated linker" useful in modifying various proteins to provide improved biologically-active conjugates.
  • "Reactive carbonyl, nitrile or sulfone” means a carbonyl, nitrile cr sulfone group to which a two carbon group is bonded having a reactive site for thiol-specific coupling on the second carbon from the carbonyl, nitrile or sulfone group (WO 92/16221) .
  • the activated linkers can be monofunctional, bifunctional, or multifunctional.
  • Useful reagents having a reactive sulfone group that can be used in the methods include, without limitation, chlorosulfone, vinylsulfone and divinylsulfone .
  • the water soluble polymer is activated with a Michael acceptor.
  • WO 95/13312 describes, inter alia , water soluble sulfone-activated PEGs which are highly selective for coupling with thiol moieties instead of amino moieties on molecules and on surfaces. These PEG derivatives are stable against hydrolysis for extended periods in aqueous environments at pHs of about 11 or less, and can form linkages with molecules to form conjugates which are also hydrolytically stable.
  • the linkage by which the PEGs and the biologically active molecule are coupled includes a sulfone moiety coupled to a thiol moiety and has the structure PEG-S0 2 -CH 2 -CH 2 -S-W, where W represents the biologically active molecule, and wherein the sulfone moiety is vinyl sulfone or an active ethyl sulfone.
  • Two particularly useful homobifunctional derivatives are PEG-jis-chlorosulfone and PEG-jis-vinylsulfone .
  • the present invention contemplates the following prokaryote-expressed molecules chemically derivatized to include mono- or poly- (e.g., 2-4) PEG moieties: sTNFR-I 2.6D/C105, STNFR-I 2.6D/C106, sTNFR-I 2.6D/N105, sTNFR-I 2.3D/d8, sTNFR-I 2.3D/dl8 and sTNFR-I 2.3D/dl5, either methionylated or nonmethionylated, and variants and derivatives thereof.
  • PEG moieties sTNFR-I 2.6D/C105, STNFR-I 2.6D/C106, sTNFR-I 2.6D/N105, sTNFR-I 2.3D/d8, sTNFR-I 2.3D/dl8 and sTNFR-I 2.3D/dl5, either methionylated or nonmethionylated, and variants and derivatives thereof
  • Polyvalent form(s), i.e., molecules comprising more than one active moiety, may be constructed.
  • the molecule may possess multiple tumor necrosis factor binding sites for the TNF ligand (e.g., a combination of a truncated sTNFR product) .
  • the molecule may possess at least one tumor necrosis factor binding site and, depending upon the desired characteristic of polyvalent form, at least one binding site of another molecule (e.g., a combination of at least one truncated sTNFR product and at least one interleukin-1 receptor antagonist ("IL-lra"), as described below) .
  • IL-lra interleukin-1 receptor antagonist
  • the polyvalent form may be constructed, for example, by chemically coupling at least one truncated sTNFR product and another moiety, preferably another truncated sTNFR product, with any clinically acceptable linker (e.g., water-soluble polymer, as described above) .
  • linker e.g., water-soluble polymer, as described above
  • the linker should not impart new immunogenicity nor, by virtue of the new amino acid residues, alter the hydrophobicity and charge balance of the structure to deleteriously affect its biodistribution and clearance.
  • Such polymers when used as linkers can be homopolymers, random or block copolymers and terpolymers based on the monomers listed above, straight chain or branched, substituted or unsubstituted.
  • the polymer can be of any length or molecular weight, but these characteristics can affect the biological properties. Polymer average molecular weights particularly useful for decreasing clearance rates in pharmaceutical applications are in the range of 2,000 to 35,000 daltons. In addition, the length of the polymer can be varied to optimize or confer the desired biological activity.
  • Activating groups which can be used to link the water soluble polymer to two or more proteins include the following: sulfone, maleimide, sulfhydryl, thiol, triflate, tresylate, azidirine, oxirane and 5-pyridyl.
  • a bifunctional or multifunctional activated linker having at least one reactive Michael acceptor may be prepared in accordance with United States Patent Application No. 08/473,809 and purified in accordance with United States Patent Application No. 08/611,918.
  • the active moieties may be linked using conventional coupling techniques (see PCT Publication No. WO 92/16221 and PCT Publication No. WO 95/34326, the disclosures of which are hereby incorporated by reference). Furthermore, PCT Publication No. WO 92/16221 describes the preparation of various dimerized sTNFR-I inhibitor molecules, e.g., dimerized cl05 sTNFR-I.
  • An exemplary polyvalent tumor necrosis factor binding proteins having the formula (sTNFR-I
  • a bivalent molecule may consist of two tandem repeats of truncated sTNFR products separated by a polypeptide linker region.
  • the design of the polypeptide linkers is similar in design to the insertion of short loop sequences between domains in the de novo design of proteins (Mutter (1988), TIBS, 1-2:260- 265 and Regan and DeGrado (1988), Science, 241:976-978, the disclosures of which are hereby incorporated by reference) . It has been shown that a linker suitable for single chain antibodies is effective to produce a dimeric form of the recombinant human sTNFR-II (Neve et al. (1996), Cytokine, 8 (5) -.365-370.
  • linker constructs have been assembled and shown to be useful for antibodies; the most functional linkers vary in size from 12 to 25 amino acids (amino acids having unreactive side groups, e.g., alanine, serine and glycine) which together constitute a hydrophilic sequence, have a few oppositely charged residues to enhance solubility and are flexible (Whitlow and Filpula (1991), Methods : A Companion to Methods in Enzymology, 2:97-105 and Brigido et al . (1993), J. Immunol . , 150 :469-479 f the disclosures of which are hereby incorporated by reference) .
  • amino acids having unreactive side groups e.g., alanine, serine and glycine
  • truncated sTNFRs may be chemically coupled to biotin, and the biotin/truncated sTNFRs which are conjugated are then allowed to bind to avidin, resulting in tetravalent avidin/biotin/truncated sTNFR molecules.
  • Truncated sTNFRs may also be covalently coupled to dinitrophenol (DNP) or trinitrophenol (TNP) and the resulting conjugates precipitated with anti-DNP or anti-TNP-IgM to form deca eric conjugates with a valency of 10 for TNF binding sites.
  • DNP dinitrophenol
  • TNP trinitrophenol
  • recombinant fusion proteins may also be produced having a truncated sTNFR wherein each recombinant chimeric molecule has a sTNFR sequence, as described above, substituted for the variable domains of either or both of the immunoglobulin molecule heavy and light chains and having all or parts of the constant domains, but at least one constant domain, of the heavy or light chain of human immunoglobulin.
  • each such chimeric truncated sTNFR/IgGl fusion protein may be produced from two chimeric genes: a truncated sTNFR/human kappa light chain chimera (truncated sTNFR/Ck) and a truncated sTNFR/human gamma-1 heavy chain chimera (truncated sTNFR/Cg-1) .
  • the gene products may be assembled into a single chimeric molecule having a truncated sTNFR displayed bivalently. Additional details relating to the construction of such chimeric molecules are disclosed in United States Patent 5,116,964, PCT Publication No. WO 89/09622, PCT Publication No. WO 91/16437 and EP 315062, the disclosures of which are hereby incorporated by reference .
  • recombinant fusion proteins may also be produced having a truncated sTNFR wherein each recombinant chimeric molecule has a sTNFR sequence, as described above, and at least a portion of the region 186-401 of osteoprotegerin (OPG) , as described in European Patent Application No. 96309363.8.
  • OPG osteoprotegerin
  • the present invention further provides polynucleotides which encode truncated sTNFRs. Based upon the present description and using the universal codon table, one of ordinary skill in the art can readily determine all of the nucleic acid sequences which encode the amino acid sequences of truncated sTNFRs. Presently preferred nucleic acid sequences include those polynucleotides encoding sTNFR-I
  • sequences can then be used to generate detection probes or amplification primers.
  • a polynucleotide encoding a truncated sTNFR can be inserted into an expression vector. By introducing the expression vector into an appropriate host, the desired truncated sTNFR may be produced in large amounts.
  • host/vector systems available for the propagation of desired nucleic acid sequences and/or the production of truncated sTNFRs. These include but are not limited to plasmid, viral and insertional vectors, and prokaryotic and eukaryotic hosts.
  • host/vector system which is capable of propagating or expressing heterologous DNA to produce or express the sequences of the present invention.
  • novel nucleic acid sequences include degenerate nucleic acid sequences encoding truncated sTNFRs having the sequences set forth in the Figures, and those nucleic acid sequences which hybridize (preferably under stringent hybridization conditions) to complements of these nucleic acid sequences (Maniatis et al . (1982), Molecular Cloning (A Laboratory Manual), Cold Spring Harbor Laboratory, pages 387 to 389) .
  • Exemplary stringent hybridization conditions are hybridization in 4 x SSC at 62-67°C, followed by washing in 0.1 x SSC at 62-67°C for approximately an hour.
  • exemplary stringent hybridization conditions are hybridization in 45-55% formamide, 4 x SSC at 40-45°C. Also included are DNA sequences which hybridize to the nucleic acid sequences set forth in Figures 1 and 9 under relaxed hybridization conditions and which encode truncated sTNFRs. Examples of such relaxed stringency hybridization conditions are 4 x SSC at 45-55°C or hybridization with 30-40% formamide at 40-45°C.
  • nucleic acid sequence encoding a truncated sTNFR (with or without signal peptides) is in operative association with a suitable expression control or regulatory sequence capable of directing the replication and/or expression of the truncated sTNFR in a selected host .
  • Nucleic acid sequences encoding truncated sTNFRs can readily be obtained in a variety of ways including, without limitation, chemical synthesis, cDNA or genomic library screening, expression library screening and/or PCR amplification of cDNA. These methods and others which are useful for isolating such nucleic acid sequences are set forth in Sambrook et al . , Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, (1989) ; by Ausubel et al .
  • nucleic acid sequence synthesis methods include, inter alia, the phosphotriester, phosphoramidite and H-phosphonate methods of nucleic acid sequence synthesis.
  • Large nucleic acid sequences for example those larger than about 100 nucleotides in length, can be synthesized as several fragments. The fragments can then be ligated together to form nucleic acid sequences encoding truncated sTNFRs.
  • a preferred method is polymer-supported synthesis using standard phosphoramidite chemistry.
  • a suitable nucleic acid sequence may be obtained by screening an appropriate cDNA library (i.e., a library prepared from one or more tissue source believed to express the protein) or a genomic library (a library prepared from total genomic DNA) .
  • the source of the cDNA library is typically a tissue from any species that is believed to express a desired protein in reasonable quantities.
  • the source of the genomic library may be any tissue or tissues from any mammalian or other species believed to harbor a gene encoding a truncated sTNFR.
  • Hybridization mediums can be screened for the presence of a DNA encoding a truncated sTNFR using one or more nucleic acid probes (oligonucleotides, cDNA or genomic DNA fragments that possess an acceptable level of homology to the cDNA or gene to be cloned) that will hybridize selectively with cDNA(s) or gene(s) present in the library.
  • the probes typically used for such screening encode a small region of DNA sequence from the same or a similar species as the species from which the library is prepared. Alternatively, the probes may be degenerate, as discussed herein.
  • Hybridization is typically accomplished by annealing the oligonucleotide probe or cDNA to the clones under conditions of stringency that prevent non-specific binding but permit binding of those clones that have a significant level of homology with the probe or primer.
  • Typical hybridization and washing stringency conditions depend in part on the size (i.e., number of nucleotides in length) of the cDNA or oligonucleotide probe and whether the probe is degenerate. The probability of identifying a clone is also considered in designing the hybridization medium (e.g., whether a cDNA or genomic library is being screened) .
  • a DNA fragment such as cDNA
  • typical hybridization conditions include those as set forth in Ausubel et al . (1994), eds . , supra .
  • the hybrization medium is washed at a suitable stringency depending on several factors such as probe size, expected homology of probe to clone, the hybridization medium being screened, the number of clones being screened and the like.
  • Examples of stringent washing solutions which are usually low in ionic strength and are used at relatively high temperatures, are as follows: one such stringent wash is 0.015 M NaCl, 0.005 M NaCitrate and 0.1% SDS at 55-65°C; another such stringent wash is lmM Na EDTA, 40mM NaHP0 4 , pH 7.2, and 1% SDS at about 40-50°C; and one other stringent wash is 0.2 X SSC and 0.1% SDS at about 50-65°C.
  • a first protocol uses 6 X SSC with 0.05 percent sodium pyrophosphate at a temperature of between about 35°C and 63°C, depending on the length of the probe. For example, 14 base probes are washed at 35-40°C, 17 base probes at 45-50°C, 20 base probes at 52-57°C, and 23 base probes at 57-63°C. The temperature can be increased 2-3°C where the background non-specific binding appears high.
  • a second protocol uses tetramethylammoniu chloride (TMAC) for washing.
  • TMAC tetramethylammoniu chloride
  • One such stringent washing solution is 3 M TMAC, 50mM Tris-HCl, pH 8.0 and 0.2% SDS.
  • PCR polymerase chain reaction
  • cDNA is prepared from poly (A) +RNA or total RNA using the enzyme reverse transcriptase .
  • Two primers typically complementary to two separate regions of cDNA (oligonucleotides) encoding a truncated sTNFR, are then added to the cDNA along with a polymerase such as Taq polymerase, and the polymerase amplifies the cDNA region between the two primers.
  • the oligonucleotide sequences selected as probes or primers should be of adequate length and sufficiently unambiguous so as to minimize the amount of non-specific binding that may occur during screening or PCR amplification.
  • the actual sequence of the probes or primers is usually based on conserved or highly homologous sequences or regions.
  • the probes or primers can be fully or partially degenerate, i.e., can contain a mixture of probes/primers, all encoding the same amino acid sequence but using different codons to do so.
  • An alternative to preparing degenerate probes is to place an inos e in some or all of those codon positions that vary by species.
  • the oligonucleotide probes or primers may be prepared by chemical synthesis methods for DNA, as described above.
  • a variant sequence is a natural (e.g., an allelic variation) or synthetic sequence that contains one or more nucleotide substitutions, deletions, and/or insertions as compared to the sequence of Figures 2, 3, 4, 5, 6 and 7 and that results in the expression of amino acid sequence variations as compared to the wild type amino acid sequence.
  • Preparation of synthetic variant sequences is also well known in the art, and is described, for example, in Sambrook et al . (1989), supra and Wells et al. (1985), Gene, .24:315, the disclosure of which is hereby incorporated by reference.
  • DNA encoding truncated sTNFRs may be inserted into vectors for further cloning (amplification of the DNA) or for expression. Suitable vectors are commercially available, or the vector may be specifically constructed. The selection or construction of an appropriate vector will depend on (1) whether it is to be used for DNA amplification or for DNA expression, (2) the size of the DNA to be inserted into the vector, and (3) the intended host cell to be transformed with the vector.
  • the vectors each involve a nucleic acid sequence which encodes a desired protein operatively linked to one or more of the following expression control or regulatory sequences capable of directing, controlling or otherwise effecting the expression of a desired protein by a selected host cell.
  • Each vector contains various components, depending on its function (amplification of DNA or expression of DNA) and its compatibility with the intended host cell.
  • the vector components generally include but are not limited to one or more of the following: a signal sequence, an origin of replication, one or more selection or marker genes, promoters, enhancer elements, a transcription termination sequence and the like. These components may be obtained from natural sources or be synthesized by known procedures .
  • prokaryotic cloning vectors examples include bacteriophages such as lambda derivatives, or plasmids from E. coli (e . g . pBR322, col El, pUC, the F-factor and Bluescript® plasmid derivatives (Stratagene, LaJolla, CA) ) .
  • E. coli e . g . pBR322, col El, pUC, the F-factor and Bluescript® plasmid derivatives (Stratagene, LaJolla, CA)
  • Other appropriate expression vectors of which numerous types are known in the art for the host cells described below, can also be used for this purpose.
  • the nucleic acid encoding a signal sequence may be inserted 5' of the sequence encoding a truncated sTNFR, e.g., it may be a component of a vector, or it may be a part of a nucleic acid encoding a truncated sTNFR.
  • the nucleic acid encoding the native signal sequences of sTNFR-I and sTNFR-II are known (EP 393 438 and EP 422 339) .
  • Expression and cloning vectors each generally include a nucleic acid sequence that enables the vector to replicate in one or more selected host cells.
  • this sequence is typically one that enables the vector to replicate independently of the host chromosomal DNA, and includes origins of replication or autonomously replicating sequences.
  • origins of replication or autonomously replicating sequences.
  • the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, and various origins (e.g., SV40, polyoma, adenovirus, VSV or BPV) are useful for cloning vectors in mammalian cells.
  • the origin of replication is not needed for mammalian expression vectors (for example, the SV40 origin is often used only because it contains the early promoter) .
  • the expression and cloning vectors each typically contain a selection gene.
  • This gene encodes a "marker" protein necessary for the survival or growth of the transformed host cells when grown in a selective culture medium. Host cells that are not transformed with the vector will not contain the selection gene and, therefore, they will not survive in the culture medium.
  • Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., a picillin, neomycin, methotrexate or tetracycline; (b) complement auxotrophic deficiencies or (c) supply critical nutrients not available from the culture medium. Other selection genes may be used to amplify the genes to be expressed.
  • Amplification is the process wherein genes which are in greater demand for the production of a protein critical for growth are reiterated in tandem within the chromosomes of successive generations of recombinant cells.
  • suitable selectable markers for mammalian cells include dihydrofolate reductase (DHFR) and thymidine kinase.
  • DHFR dihydrofolate reductase
  • thymidine kinase thymidine kinase.
  • Selection pressure is imposed by culturing the transformed cells under conditions in which the concentration of selection agent in the medium is successively changed, thereby leading co amplification of both the selection genes and the DNA that encodes truncated sTNFRs. As a result, increased quantities of truncated sTNFRs are synthesized from the amplified DNA.
  • cells transformed with the DHFR selection gene are first identified by culturing all of the transformants in a culture medium that contains methotrexate, a competitive antagonist of DHFR.
  • An appropriate host cell when wild-type DHFR is used is the Chinese hamster ovary cell line deficient in DHFR activity (Urlaub and Chasin (1980), Proc. Natl . Acad. Sci . , USA, 22121:4216-4220, the disclosure of which is hereby incorporated by reference) .
  • the transformed cells are then exposed to increased levels of methotrexate. This leads to the synthesis of multiple copies of the DHFR gene and, concomitantly, multiple copies of other DNA present in the expression vector, such as the DNA encoding a truncated sTNFR.
  • Expression and cloning vectors each will typically contain a promoter that is recognized by the host organism and is operably linked to a nucleic acid sequence encoding a truncated sTNFR.
  • a promoter is an untranslated sequence located upstream (5') to the start codon of a structural gene (generally within about 100 to 1000 bp) that controls the transcription and translation of a particular nucleic acid sequence, such as that encoding a truncated sTNFR.
  • a promoter may be conventionally grouped into one of two classes, inducible promoters and constitutive promoters.
  • An inducible promoter initiates increased levels of transcription from DNA under its control in response to some change in culture conditions, such as the presence or absence of a nutrient or a change in temperature.
  • a large number of promoters recognized by a variety of potential host cells, are well known.
  • a promoter may be operably linked to DNA encoding a truncated sTNFR by removing the promoter from the source DNA by restriction enzyme digestion and inserting the desired promoter sequence.
  • the native sTNFR-I promoter sequence or sTNFR-II promoter sequence may be used to direct amplification and/or expression of DNA encoding a truncated sTNFR.
  • a heterologous promoter is preferred, however, if it permits greater transcription and higher yields of the expressed protein as compared to the native promoter and if it is compatible with the host cell system that has been selected for use.
  • any one of the native promoter sequences of other NGF/TNF family members may be used to direct amplification and/or expression of the DNA encoding a truncated sTNFR.
  • Promoters suitable for use with prokaryotic hosts include the beta-lactamase and lactose promoter systems; alkaline phosphatase, a tryptophan (trp) promoter system; a bacterial luminescence (luxR) gene system and hybrid promoters such as the tac promoter. Other known bacterial promoters are also suitable.
  • Suitable promoting sequences for use with yeast hosts are also well known in the art.
  • Suitable promoters for use with mammalian host cells are well known and include those obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2) , bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and, most preferably. Simian Virus 40 (SV40) .
  • Other suitable mammalian promoters include heterologous mammalian promoters, e.g., heat-shock promoters and the actin promoter.
  • Enhancers are cis-acting elements of DNA, usually from about 10-300 bp in length, that act on the promoter to increase its transcription.
  • Enhancers are relatively orientation and position independent. They have been found 5' and 3' to the transcription unit. Yeast enhancers are advantageously used with yeast promoters. Several enhancer sequences available from mammalian genes are known (e.g., globin, elastase, albumin, alpha-feto-protein and insulin) . Additionally, viral enhancers such as the SV40 enhancer, the cytomegalovirus early promoter enhancer, the polyoma enhancer and adenovirus enhancers are exemplary enhancing elements for the activation of eukaryotic promoters . While an enhancer may be spliced into a vector at a position 5' or 3' to a DNA encoding truncated sTNFR, it is typically located at a site 5' from the promoter.
  • Expression vectors used in eukaryotic host cells each will typically contain a sequence necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5' and occasionally 3' untranslated regions of eukaryotic DNAs or cDNAs . These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding a truncated sTNFR.
  • Vector Construction The construction of a suitable vector containing one or more of the above-listed components (together with the coding sequence encoding a truncated sTNFR) is accomplished by standard ligation techniques. Isolated plasmids or DNA fragments are cleaved, tailored and religated in the desired order to generate the vector required. To confirm that the correct sequence has been constructed, the ligation mixture may be used to transform E. coli, and successful transformants may be selected by known techniques as described above. Quantities of the vector from the transformants are then prepared, analyzed by restriction endonuclease digestion and/or sequenced to confirm the presence of the desired construct .
  • a vector that provides for the transient expression of DNA encoding a truncated sTNFR in mammalian cells may also be used.
  • transient expression involves the use of an expression vector that is able to replicate efficiently in a host cell, such that the host cell accumulates many copies of the expression vector and, in turn, synthesizes high levels of the desired protein encoded by the expression vector.
  • Each transient expression system comprising a suitable expression vector and a host cell, allows for the convenient positive identification of proteins encoded by cloned DNAs, as well as for the rapid screening of such proteins for desired biological or physiological properties, i.e., identifying a biologically-active truncated sTNFR.
  • prokaryotic and eukaryotic host cells include bacterial, mammalian, fungal, insect, yeast or plant cells.
  • Prokaryotic host cells include but are not limited to eubacteria such as Gram-negative or Gram-positive organisms (e.g., E. coli (HB101, DH5a, DH10 and MC1061) ; Bacilli such as B. subtilis;
  • eubacteria such as Gram-negative or Gram-positive organisms (e.g., E. coli (HB101, DH5a, DH10 and MC1061) ; Bacilli such as B. subtilis;
  • a desired protein may be expressed in E. coli .
  • eukaryotic microbes such as filamentous fungi or yeast may be suitable hosts for the expression of truncated sTNFRs. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms, but a number of other genera, species and strains are well known and commonly available .
  • a truncated sTNFR may be expressed in glycosylated form by any one of a number of suitable host cells derived from multicellular organisms. Such host cells are capable of complex processing and glycosylation activities. In principle, any higher eukaryotic cell culture might be used, whether such culture involves vertebrate or invertebrate cells, including plant and insect cells. As a specific embodiment, a desired protein may be expressed in baculovirus cells.
  • Vertebrate cells may be used, as the propagation of vertebrate cells in culture (tissue culture) is a well-known procedure.
  • useful mammalian host cell lines include but are not limited to monkey kidney CV1 line transformed by SV40 (COS-7), human embryonic kidney line (293 cells or 293 cells subcloned for growth in suspension culture) , baby hamster kidney cells and Chinese hamster ovary cells.
  • Other suitable mammalian cell lines include but are not limited to HeLa, mouse L-929 cells, 3T3 lines derived from Swiss, Balb-c or NIH mice, and BHK or HaK hamster cell lines.
  • a desired protein may be expressed in COS cells.
  • a host cell may be transfected and preferably transformed with a desired nucleic acid under appropriate conditions permitting expression of the nucleic acid.
  • suitable host cells and methods for transformation, culture, amplification, screening and product production and purification are well known in the art (Gething and Sambrook (1981), Nature, 293 : 620-625 or, alternatively, Kaufman et al . (1985), Mol . Cell . Biol . , 5-121:1750-1759, or U.S. Pat. No. 4,419,446, the disclosures of which are hereby incorporated by reference) .
  • the calcium phosphate precipitation method may be used for mammalian cells without cell walls. Electroporation, micro injection and other known techniques may also be used.
  • truncated sTNFRs may be produced by homologous recombination or with recombinant production methods utilizing control elements introduced into cells already containing DNA encoding truncated sTNFRs.
  • Homologous recombination is a technique originally developed for targeting genes to induce or correct mutations in transcriptionally-active genes (Kucherlapati (1989), Prog, in Nucl . Acid Res . and Mol . Biol . , 2£:301, the disclosure of which is hereby incorporated by reference) .
  • the basic technique was developed as a method for introducing specific mutations into specific regions of the mammalian genome (Thomas et al.
  • the DNA sequence to be inserted into the genome can be directed to a specific region of the gene of interest by attaching it to targeting DNA.
  • the targeting DNA is DNA that is complementary (homologous) to a region of the genomic DNA. Small pieces of targeting DNA that are complementary to a specific region of the genome are put in contact with the parental strand during the DNA replication process.
  • a general property of DNA that has been inserted into a cell is to hybridize and therefore recombine with other pieces of endogenous DNA through shared homologous regions. If this complementary strand is attached to an oligonucleotide that contains a mutation or a different sequence of DNA, it too is incorporated into the newly synthesized strand as a result of the recombination. As a result of the proofreading function, it is possible for the new sequence of DNA to serve as the template. Thus, the transferred DNA is incorporated into the genome.
  • the expression control sequence (a piece of DNA that is complementary to a selected region of the gene) can be synthesized or otherwise obtained, such as by appropriate restriction of the native DNA at specific recognition sites bounding the region of interest. This piece serves as a targeting sequence upon insertion into the cell and will hybridize to its homologous region within the genome. If this hybridization occurs during DNA replication, this piece of DNA, and any additional sequence attached thereto, will act as an Okazaki fragment and will be backstitched into the newly synthesized daughter strand of DNA. Attached to these pieces of targeting DNA are regions of DNA which may interact with the expression of a truncated sTNFR.
  • a promoter/enhancer element, a suppresser or an exogenous transcription modulatory element is inserted into the genome of the intended host cell in proximity and orientation sufficient to influence the transcription of DNA encoding the desired truncated sTNFR.
  • the control element does not encode the truncated sTNFR, but instead controls a portion of the DNA present in the host cell genome.
  • the expression of a truncated sTNFR may be achieved not by transfection of DNA that encodes a truncated sTNFR, but rather by the use of targeting DNA (containing regions of homology with the endogenous gene of interest) coupled with DNA regulatory segments that provide the endogenous gene sequence with recognizable signals for transcription of a truncated sTNFR.
  • each of the one or more recombinant host cells for production of a desired protein will vary depending upon many factors and considerations; the optimum production procedure for a given situation will be apparent to those skilled in the art through minimal experimentation.
  • Such recombinant host cells are cultured in suitable medium and the expressed truncated sTNFR is then optionally recovered, isolated and purified from the culture medium (or from the cell, if expressed intracellularly) by appropriate means known to those skilled in the art.
  • each of the recombinant cells used to produce a desired truncated sTNFR may be cultured in media suitable for inducing promoters, selecting suitable recombinant host cells or amplifying the gene encoding the desired truncated sTNFR.
  • the media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin or epidermal growth factor) , salts (such as sodium chloride, calcium, magnesium and phosphate) , buffers (such as HEPES) , nucleosides (such as adenosine and thymidine) , antibiotics (such as gentamicin) , trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range) , and glucose or another energy source.
  • growth factors such as insulin, transferrin or epidermal growth factor
  • salts such as sodium chloride, calcium, magnesium and phosphate
  • buffers such as HEPES
  • nucleosides such as adenosine and thymidine
  • antibiotics such as gentamicin
  • trace elements defined as inorganic compounds usually present at final concentrations in the micromolar range
  • glucose or another energy source glucose or another energy source.
  • Other supplements may also be included, at appropriate concentration
  • the resulting expression product may then be purified to near homogeneity using procedures known in the art. Exemplary purification techniques are taught in EP 393 438 and EP 422 339, the disclosures of which are incorporated herein by reference.
  • compositions each will generally include a therapeutically effective amount of truncated sTNFRs and chemically-modified derivatives of truncated sTNFRs (collectively, "truncated sTNFR product (s)") in admixture with a vehicle.
  • the vehicle preferably includes one or more pharmaceutically and physiologically acceptable formulation materials in admixture with the truncated sTNFR product (s) and controlled release material.
  • the primary solvent in a vehicle may be either aqueous or non-aqueous in nature.
  • the vehicle may contain other pharmaceutically acceptable excipients for modifying or maintaining the pH preferably between 5-6.5, and more preferably between 5.5-6.0 (e.g., buffers such as citrates, phosphates and amino acids such glycine) ; bulking agents for lyophilized formulation (e.g., annitol and glycine); osmolarity (e.g., mannitol and sodium chloride); surfactants (e.g., polysorbate 20, polysorbate 80, triton, and pluronics) ; viscosity; clarity; color; sterility; stability (e.g., sucrose and sorbitol) ; antioxidants (e.g., sodium sulfite and sodium hydrogen- sulfite) ; preservatives (e.g., benzoic acid and salicylic acid) ; odor of the formulation; flavoring and di
  • compositions may also involve particulate preparations of polymeric compounds such as bulk erosion polymers (e.g., poly (lactic-co-glycolic acid) (PLGA) copolymers, PLGA polymer blends, block copolymers of PEG, and lactic and glycolic acid, poly (cyanoacrylates) ) ; surface erosion polymers (e.g., poly (anhydrides) and poly(ortho esters)); hydrogel esters (e.g., pluronic polyols, poly (vinyl alcohol), poly (vinylpyrrolidone) , maleic anhydride-alkyl vinyl ether copolymers, cellulose, hyaluronic acid derivatives, alginate, collagen, gelatin, albumin, and starches and dextrans) and composition systems thereof; or preparations of liposomes or microspheres
  • bulk erosion polymers e.g., poly (lactic-co-glycolic acid) (PLGA) copolymers, PLGA polymer blends
  • compositions may influence the physical state, stability, rate of in vivo release, and rate of in vivo clearance of the present proteins and derivatives.
  • the optimal pharmaceutical formulation for a desired protein will be determined by one skilled in the art depending upon the route of administration and desired dosage. Exemplary pharmaceutical compositions are disclosed in Remington 's Pharmaceutical Sciences, 18th Ed. (1990), Mack Publishing Co., Easton, PA 18042, pages 1435-1712; Gombotz and Pettit (1995), Bioconjugate Chem . , :332- 351; Leone-Bay, et al . (1995), Journal of Medicinal Chemistry, 2-1:4263-4269; Haas, et al .
  • hyaluronan is intended to include hyaluronan, hyaluronic acid, salts thereof (such as sodium hyaluronate) , esters, ethers, enzymatic derivatives and cross-linked gels of hyaluronic acid, and chemically modified derivatives of hyaluronic acid (such as hylan) .
  • Exemplary forms of hyaluronan are disclosed in Peyron and Balazs (1974), Path . Biol . , 221-81:731-736; Isdale et al. (1991), J. Drug Dev.
  • HealonTM a rooster-comb derived hyaluronic acid
  • Hyaluronic Acid FCH a high molecular weight (e.g., -1.5-2.2 x IO 6 MW) hyaluronic acid prepared from cultures of Streptococcus zooepidemicus; Sodium Hyaluronate MV, -1.0-1.6 x 10 6 MW and Sodium Hyaluronate LV, -1.5-2.2 x 10 6 MW) ;
  • the pharmaceutical composition may be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or a dehydrated or lyophilized powder.
  • Such formulations may be stored either in a ready-to-use form or in a form (e.g., lyophilized) requiring reconstitution prior to administration .
  • the present invention is directed to kits for producing a single-dose administration unit.
  • the kits may each contain both a first container having a dried protein and a second container having an aqueous formulation.
  • Kits included within the scope of this invention are single and multi-chambered pre-filled syringes; exemplary pre-filled syringes (e.g., liquid syringes, and lyosyringes such as Lyo-Ject®, a dual- chamber pre-filled lyosyringe) are available from Vetter GmbH, Ravensburg, Germany.
  • exemplary pre-filled syringes e.g., liquid syringes, and lyosyringes such as Lyo-Ject®, a dual- chamber pre-filled lyosyringe
  • Truncated sTNFR products may be useful as research reagents and as therapeutic and diagnostic agents.
  • the truncated sTNFRs may be used in in vitro and/or in vivo diagnostic assays to quantify the amount of native sTNFR-I or sTNFR-II in a tissue or organ sample or to determine and/or isolate cells which express TNF (Scallon et al . (1995), supra) .
  • 125 I-truncated sTNFRs binding to TNF there will be less radioactivity from 125 I-truncated sTNFRs binding to TNF, as compared to a standardized binding curve of 125 I-truncated sTNFRs, due to unlabeled native sTNFR-I or sTNFR-I binding to TNF.
  • the use of 125 I-truncated sTNFRs may be used to detect the presence of TNF in various cell types .
  • This invention also contemplates the use of truncated sTNFR products in the generation of antibodies and the resultant antibodies (specifically including those which also bind to native sTNFR-I or sTNFR-II) .
  • Antibodies can be developed which bind to truncated sTNFRs, such as to epitopes within the R ⁇ [Cys 19 -Cys 103 ] - R 2 amino acid sequence or within the R 4 - [Cys 32 -Cys 115 ] -R 5 amino acid sequence.
  • the present invention also relates to methods for the treatment of certain diseases and medical conditions (many of which can be characterized as inflammatory diseases) that are mediated by TNF.
  • a disease or medical condition is considered to be a "TNF-mediated disease” if the spontaneous or experimental disease is associated with elevated levels of TNF in bodily fluids or in tissues adjacent to the focus of the disease or indication within the body.
  • TNF-mediated diseases may also be recognized by the following two conditions: (1) pathological findings associated with a disease can be mimicked experimentally in animals by the administration of TNF and (2) the pathology induced in experimental animal models of the disease can be inhibited or abolished by treatment with agents which inhibit the action of TNF. Many TNF-mediated diseases satisfy two of these three conditions, and others will satisfy all three conditions.
  • TNF-mediated diseases as well as the related sequela and symptoms associated therewith, that each may be treated according to the methods of the present invention are adult respiratory distress syndrome; cachexia/anorexia; cancer (e.g., leukemias) ; chronic fatigue syndrome; graft versus host rejection; hyperalgesia; inflammatory bowel disease; neuroinflammatory diseases; ischemic/reperfusion injury, including cerebral ischemia (brain injury as a result of trauma, epilepsy, hemorrhage or stroke, each of which may lead to neurodegeneration) ; diabetes (e.g., juvenile onset Type 1 diabetes mellitus) ; multiple sclerosis; ocular diseases; pain; pancreatitis; pulmonary fibrosis; rheumatic diseases (e.g., rheumatoid arthritis, osteoarthritis, juvenile (rheumatoid) arthritis, seronegative polyarthritis, ankylosing spondylitis, Reiter's syndrome and reactive arthritis,
  • cancer e.
  • the truncated sTNFR products each may be administered to a patient in therapeutically effective amounts for the treatment of TNF-mediated diseases, as defined above, including such as rheumatic diseases
  • patient e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal-induced ("septic") arthritis
  • patient is intended to encompass animals (e.g., cats, dogs and horses) as well as humans.
  • a truncated sTNFR product may be administered via topical, enteral or parenteral administration including, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intra-articular, subcapsular, subarachnoid, intraspinal, intraventricular and intrasternal injection and infusion.
  • a truncated sTNFR product may also be administered via oral administration or be administered through mucus membranes, that is, intranasally, sublingually, buccally or rectally for systemic delivery.
  • truncated sTNFR products be administered via intra-articular, subcutaneous, intramuscular or intravenous injection.
  • truncated sTNFR product may be administered by a continuous infusion (e.g., constant or intermittent implanted or external infusion flow-modulating devices) so as to continuously provide the desired level of truncated sTNFR product in the blood for the duration of the administration.
  • a continuous infusion e.g., constant or intermittent implanted or external infusion flow-modulating devices
  • This is preferably accomplished by means of continuous infusion via, e.g., mini-pump such as osmotic mini-pump.
  • Various pumps are commercially available, from suppliers such as MiniMed Inc, Sylmar, CA (e.g., MT507) and Alza Corp., Palo Alto, CA (e.g., Alzet osmotic pump, model 2MLI) .
  • truncated sTNFR products for the treatment of TNF-mediated diseases, including inflammatory conditions of a joint (e.g., osteoarthritis, psoriatic arthritis and rheumatoid arthritis)
  • TNF-mediated diseases including inflammatory conditions of a joint (e.g., osteoarthritis, psoriatic arthritis and rheumatoid arthritis)
  • truncated sTNFR products may be administered intra-articularly for the treatment of rheumatoid arthritis and osteoarthritis.
  • truncated sTNFR products may be administered subcutaneously or intramuscularly for the treatment of rheumatoid arthritis, inflammatory bowel disease, cachexia/anorexia or multiple sclerosis.
  • truncated sTNFR products may be administered intravenously for the treatment of brain injury as a result of trauma, epilepsy, hemorrhage or stroke; or administered intraventricularly for the treatment of brain injury as a result of trauma.
  • a preferred mode for the treatment of arthritis includes: (1) a single intra-articular injection of a truncated sTNFR product given periodically as needed to prevent or remedy the flare-up of arthritis and (2) periodic subcutaneous injections of a truncated sTNFR product.
  • the initiation of treatment for septic shock should begin as soon as possible after septicemia or the chance of septicemia is diagnosed. For example, treatment may be begun immediately following surgery or an accident or any other event that may carry the risk of initiating septic shock.
  • Preferred modes for the treatment of adult respiratory distress syndrome include: (1) single or multiple intratracheal administrations of a truncated sTNFR product and (2) bolus or continuous intravenous infusion of a truncated sTNFR product.
  • cell therapy e.g., implantation of cells producing a truncated sTNFR
  • This embodiment of the present invention may include implanting into patients cells which are capable of synthesizing and secreting a biologically-active form of a truncated sTNFR.
  • Such cells producing a truncated sTNFR may be cells which do not normally produce a truncated sTNFR but which have been modified to produce a truncated sTNFR, or which may be cells whose ability to produce a truncated sTNFR have been augmented by transformation with a polynucleotide suitable for the expression and secretion of a truncated sTNFR.
  • the cells be of the same species as the patient (e.g., human) or that the cells be encapsulated with material that provides a barrier against immune recognition, or that cells be placed into an immunologically privileged anatomical location, such as in the testis, eye or central nervous system.
  • Human or non-human animal cells may be implanted in patients in biocompatible, semi-permeable polymeric enclosures or membranes to allow release of a truncated sTNFR, but to prevent destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissue.
  • the patient's own cells, transformed ex vivo to produce a truncated sTNFR may be implanted directly into the patient without such encapsulation.
  • the methodology for the membrane encapsulation of living cells is familiar to those of ordinary skill in the art, and the preparation of the encapsulated cells and their implantation in patients may be accomplished.
  • a nucleic acid sequence encoding a truncated sTNFR is introduced directly into a patient.
  • a nucleic acid sequence encoding a truncated sTNFR is introduced into target cells via local injection of a nucleic acid construct, with or without an appropriate delivery vector, such as an adeno-associated virus vector.
  • Alternative viral vectors include but are not limited to retrovirus, adenovirus, herpes simplex virus and papilloma virus vectors.
  • Physical transfer may be achieved in vivo by local injection of the desired nucleic acid construct or other appropriate delivery vector containing the desired nucleic acid sequence, liposome-mediated transfer, direct injection (naked DNA), receptor-mediated transfer (ligand-DNA complex) or microparticle bombardment (gene gun) .
  • the treatment of a TNF-mediated disease requires a dose or total dose regimen of a truncated sTNFR effective to reduce or alleviate symptoms of the disease.
  • Other factors in determining the appropriate dosage can include the disease or condition to be treated or prevented, the severity of the disease, the route of administration, and the age, sex and medical condition of the patient. Further refinement of the calculations necessary to determine the appropriate dosage for treatment is routinely made by those skilled in the art, especially in light of the dosage information ad assays disclosed herein.
  • the dosage can also be determined through the use of known assays for determining dosages used in conjunction with appropriate dose-response data.
  • the specific dose is calculated according to the approximate body weight or body surface area of the patient.
  • the frequency of dosing depends on the pharmacokinetic parameters of the truncated sTNFR in the formulation used.
  • the truncated sTNFR may be administered once, or in cases of severe and prolonged disorders, administered daily in less frequent doses or administered with an initial bolus dose followed by a continuous dose or sustained delivery.
  • parenteral unit doses for example, may each be up to 10 mg, generally up to 15 mg and more generally up to 20 mg .
  • the pharmaceutical composition When administered into an articular cavity, the pharmaceutical composition is preferably administered as a single injection from, for example, a 3 to 10 ml syringe containing a dose, for example, of between about 5 mg/ml to 10 mg/ml truncated sTNFR dissolved in isotonic phosphate buffered saline.
  • the preparation may be administered into an articular cavity at a frequency, for example, of once every 7 to 10 days. In such a manner, the administration is continuously conducted, for example, 4 to 5 times while varying the dose if necessary.
  • truncated sTNFR products may be administered as an adjunct to other therapy and also with other pharmaceutical formulations suitable for the indication being treated.
  • a truncated sTNFR product and any of one or more traditional or new anti-inflammatory drugs may be administered separately or in combination.
  • Truncated sTNFR products e.g.,
  • R l [Cys 19 -Cys 103 ] -R proteins) and any of one or more additional anti-inflammatory drugs may be administered separately or in combination.
  • Information regarding the following compounds can be found in The Merck Manual of Diagnosis and Therapy, Sixteenth Edition, Merck, Sharp & Dohme Research Laboratories, Merck & Co., Rahway, NJ (1992) and in Pharmaprojects, PJB Publications Ltd.
  • TNF-mediated diseases including acute and chronic inflammation
  • rheumatic diseases e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal- induced ("septic") arthritis
  • NSAIDs non-steroidal, anti-inflammatory drugs
  • Secondary treatments include corticosteroids, slow acting antirheumatic drugs (SAARDs) or disease modifying (DM) drugs .
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein) and any of one or more NSAIDs for the treatment of TNF-mediated diseases, as defined above, including acute and chronic inflammation such as rheumatic diseases (e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal-induced ("septic") arthritis); and graft versus host disease.
  • rheumatic diseases e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal-induced ("septic") arthritis
  • septic staphylococcal-induced
  • NSAIDs owe their anti-inflammatory action, at least in part,, to the inhibition
  • NSAIDs can be characterized into nine groups: (1) salicylic acid derivatives; (2) propionic acid derivatives; (3) acetic acid derivatives; (4) fenamic acid derivatives;
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more salicylic acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof.
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -Cys 103 ] -R protein
  • Such salicylic acid derivatives, prodrug esters and pharmaceutically acceptable salts thereof comprise: acetaminosalol, aloxiprin, aspirin, benorylate, bromosaligenin, calcium acetylsalicylate, choline magnesium trisalicylate diflusinal, etersalate, fendosal, gentisic acid, glycol salicylate, imidazole salicylate, lysine acetylsalicylate, mesalamine, morpholine salicylate, 1-naphthyl salicylate, olsalazine, parsalmide, phenyl acetylsalicylate, phenyl salicylate, salacetamide, salicylamide O-acetic acid, salsalate and sulfasalazine.
  • Structurally related salicylic acid derivatives having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group.
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more propionic acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof.
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein
  • the propionic acid derivatives, prodrug esters and pharmaceutically acceptable salts thereof comprise: alminoprofen, benoxaprofen, bucloxic acid, carprofen, dexindoprofen, fenoprofen, flunoxaprofen, fluprofen, flurbiprofen, furcloprofen, ibuprofen, ibuprofen aluminum, ibuproxam, indoprofen, isoprofen, ketoprofen, loxoprofen, miroprofen, naproxen, oxaprozin, piketoprofen, pimeprofen, pirprofen, pranoprofen, protizinic acid, pyridoxiprofen, suprofen, tiaprofenic acid and tioxaprofen. Structurally related propionic acid derivatives having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group.
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more acetic acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof.
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein
  • acetic acid derivatives e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein
  • prodrug esters and pharmaceutically acceptable salts thereof comprise: acemetacin, alclofenac, amfenac, bufexamac, cinmetacin, clopirac, delmetacin, diclofenac sodium, etodolac, felbinac, fenclofenac, fenclorac, fenclozic acid, fentiazac, furofenac, glucametacin, ibufenac, indomethacin, isofezolac, isoxepac, lonazolac, metiazinic acid, oxametacin, oxpinac, pimetacin, proglumetacin, sulindac, talmetacin, tiaramide, tiopinac, tolmetin, zidometacin and zomepirac.
  • Structurally related acetic acid derivatives having similar analgesic and anti-inflammatory properties are also intended to be encompasse
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more fenamic acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof.
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein
  • the fenamic acid derivatives, prodrug esters and pharmaceutically acceptable salts thereof comprise: enfenamic acid, etofenamate, flufenamic acid, isonixin, meclofenamic acid, meclofenamate sodium, medofenamic acid, mefanamic acid, niflumic acid, talniflumate, terofenamate, tolfenamic acid and ufenamate.
  • Structurally related fenamic acid derivatives having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group.
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more carboxylic acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof.
  • a carboxylic acid derivatives, prodrug esters and pharmaceutically acceptable salts thereof which can be used comprise: clidanac, diflunisal, flufenisal, inoridine, ketorolac and tinoridine.
  • Structurally related carboxylic acid derivatives having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group.
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more butyric acid derivatives, prodrug esters or pharmaceutically acceptable salts thereof.
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -Cys 103 ] -R protein
  • the butyric acid derivatives, prodrug esters and pharmaceutically acceptable salts thereof comprise: bumadizon, butibufen, fenbufen and xenbucin. Structurally related butyric acid derivatives having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group .
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R - [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more oxicams, prodrug esters or pharmaceutically acceptable salts thereof.
  • a truncated sTNFR product e.g., R - [Cys 19 -Cys 103 ] -R 2 protein
  • the oxicams, prodrug esters and pharmaceutically acceptable salts thereof comprise: droxicam, enolicam, isoxicam, piroxicam, sudoxicam, tenoxicam and 4-hydroxyl-l, 2-benzothiazine 1,1-dioxide 4- (N-phenyl) - carboxamide .
  • Structurally related oxicams having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group.
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more pyrazoles, prodrug esters or pharmaceutically acceptable salts thereof.
  • the pyrazoles, prodrug esters and pharmaceutically acceptable salts thereof which may be used comprise: difenamizole and epirizole.
  • Structurally related pyrazoles having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group.
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more pyrazolones, prodrug esters or pharmaceutically acceptable salts thereof.
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -Cys 103 ] -R protein
  • the pyrazolones, prodrug esters and pharmaceutically acceptable salts thereof which may be used comprise: apazone, azapropazone, benzpiperylon, feprazone, mofebutazone, morazone, oxyphenbutazone, phenylbutazone, pipebuzone, propylphenazone, ramifenazone, suxibuzone and thiazolinobutazone .
  • Structurally related pyrazalones having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group.
  • the present invention is directed to the use of a truncated sTNFR product (e.g., Rj . - [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more of the following
  • NSAIDs ⁇ -acetamidocaproic acid, S-adenosylmethionine,
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 j -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more corticosteroids, prodrug esters or pharmaceutically acceptable salts thereof for the treatment of TNF-mediated diseases, as defined above, including acute and chronic inflammation such as rheumatic diseases (e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal- induced ("septic") arthritis); and multiple sclerosis.
  • rheumatic diseases e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal- induced ("septic") arthritis
  • multiple sclerosis e.g
  • Corticosteroids, prodrug esters and pharmaceutically acceptable salts thereof include hydrocortisone and compounds which are derived from hydrocortisone, such as 21-acetoxypregnenolone, alclomerasone, algestone, amcinonide, beclomethasone, betamethasone, betamethasone valerate, budesonide, chloroprednisone, clobetasol, clobetasol propionate, clobetasone, clobetasone butyrate, clocortolone, cloprednol, corticosterone, cortisone, cortivazol, deflazacon, desonide, desoximerasone, dexamethasone, diflorasone, diflucortolone, difluprednate, enoxolone, fluazacort, flucloronide, flumethasone, flumethasone pivalate, flunisolide, flucinolone
  • Structurally related corticosteroids having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group.
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more slow-acting antirheumatic drugs (SAARDs) or disease modifying antirheumatic drugs (DMARDS) , prodrug esters or pharmaceutically acceptable salts thereof for the treatment of TNF-mediated diseases, as defined above, including acute and chronic inflammation such as rheumatic diseases (e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal- induced ("septic”) arthritis); and multiple sclerosis.
  • SAARDs slow-acting antirheumatic drugs
  • SAARDs or DMARDS, prodrug esters and pharmaceutically acceptable salts thereof comprise: allocupreide sodium, auranofin, aurothioglucose, aurothioglycanide, azathioprine, brequinar sodium, bucillamine, calcium 3- aurothio-2-propanol-l-sulfonate, chlorambucil, chloroquine, clobuzarit, cuproxoline, cyclophosphamide, cyclosporin, dapsone, 15-deoxyspergualin, diacerein, glucosamine, gold salts (e.g., cycloquine gold salt, gold sodium thiomalate, gold sodium thiosulfate) , hydroxychloroquine, hydroxyurea, kebuzone, levamisole, lobenzarit, melittin, 6-mercaptopurine, methotrexate, mizoribine, mycophenolate mofetil, my
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more C0X2 inhibitors.
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein
  • C0X2 inhibitors their prodrug esters or pharmaceutically acceptable salts thereof for the treatment of TNF-mediated diseases, as defined above, including acute and chronic inflammation.
  • C0X2 inhibitors, prodrug esters or pharmaceutically acceptable salts thereof include, for example, celecoxib.
  • Structurally related C0X2 inhibitors having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group.
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more antimicrobials, prodrug esters or pharmaceutically acceptable salts thereof for the treatment of TNF-mediated diseases, as defined above, including acute and chronic inflammation.
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein
  • any of one or more antimicrobials, prodrug esters or pharmaceutically acceptable salts thereof for the treatment of TNF-mediated diseases, as defined above, including acute and chronic inflammation.
  • Antimicrobials include, for example, ampicillin, amoxycillin, aureomicin, bacitracin, ceftazidime, ceftriaxone, cefotaxime, cephachlor, cephalexin, cephradine, ciprofloxacin, clavulanic acid, cloxacillin, dicloxacillan, erythromycin, flucloxacillan, gentamicin, gramicidin, methicillan, neomycin, oxacillan, penicillin and vancomycin. Structurally related antimicrobials having similar analgesic and anti-inflammatory properties are also intended to be encompassed by this group .
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more of the following compounds for the treatment of TNF-mediated diseases, as defined above, including acute and chronic inflammation: granulocyte colony stimulating factor; thalidomide; BN 50730; tenidap; E 5531; tiapafant PCA 4248; nimesulide; panavir; rolipram; RP 73401; peptide T; MDL 201,449A; (IR, 3S)-Cis-l-[9- (2, 6-diaminopurinyl) ] -3-hydroxy-4- cyclopentene hydrochloride; (IR, 3R) -trans-1- [9- (2, 6- diamino)purine]-3-acetoxycyclopen
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with one or more additional TNF inhibitors for the treatment of TNF-mediated diseases, as defined above, including acute and chronic inflammation.
  • TNF inhibitors include compounds and proteins which block in vivo synthesis or extracellular release of TNF, including the following compounds.
  • TNF inhibitors include anti-TNF antibodies (e.g., MAK 195F Fab antibody (Holler et al.
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ -[Cys 19 -Cys 103 ]-R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with the soluble recombinant human Fas antigen or recombinant versions thereof (WO 96/20206 and Mountz et al . , J. Immunology, 15-5.: 4829-4837; and EP 510 691), the disclosures of which are hereby incorporated by reference.
  • a truncated sTNFR product e.g., R ⁇ -[Cys 19 -Cys 103 ]-R 2 protein
  • the soluble recombinant human Fas antigen or recombinant versions thereof WO 96/20206 and Mountz et al . , J. Immunology, 15-5.: 4829-4837; and EP 510 691
  • WO 96/20206 discloses secreted human Fas antigen (native and recombinant, including an Ig fusion protein) , methods for isolating the genes responsible for coding the soluble recombinant human Fas antigen, methods for cloning the gene in suitable vectors and cell types, and methods for expressing the gene to produce the inhibitors.
  • EP 510 691 teaches DNAs coding for human Fas antigen, including soluble Fas antigen, vectors expressing for said DNAs and transformants transfected with the vector. When administered parenterally, doses of a Fas antigen fusion protein each are generally from 1 micrograms/kg to 100 micrograms/kg .
  • the present invention is directed to the use of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ]-R 2 protein) in combination (pretreatment, post-treatment or concurrent treatment) with any of one or more interleukin-1 inhibitors for the treatment of TNF-mediated diseases, as defined above, including acute and chronic inflammation such as rheumatic diseases (e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal-induced ("septic") arthritis) ; brain injury as a result of trauma, epilepsy, hemorrhage or stroke; and multiple sclerosis.
  • rheumatic diseases e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal-induced ("septic") arthritis
  • Classes of interleukin-1 inhibitors include interleukin- 1 receptor antagonists (any compound capable of specifically preventing activation of cellular receptors to IL-1) such as IL-lra, as described below; anti-IL-1 receptor monoclonal antibodies (e.g., EP 623674, the disclosure of which is hereby incorporated by reference) ; IL-1 binding proteins such as soluble IL-1 receptors (e.g., U.S.P. 5,492,888, U.S.P. 5,488,032, U.S.P. 5,464,937, U.S.P. 5,319,071 and U.S. P.
  • interleukin- 1 receptor antagonists any compound capable of specifically preventing activation of cellular receptors to IL-1
  • anti-IL-1 receptor monoclonal antibodies e.g., EP 623674, the disclosure of which is hereby incorporated by reference
  • IL-1 binding proteins such as soluble IL-1 receptors (e.g., U.S.P.
  • Interleukin-1 receptor antagonist is a human protein that acts as a natural inhibitor of interleukin-1.
  • Preferred receptor antagonists as well as methods of making and methods of using thereof, are described in U.S. Patent No. 5,075,222 (referred to herein as the '222 patent); WO 91/08285; WO 91/17184; AU 9173636; WO 92/16221; W093/21946; PCT International Application No.
  • US97/02131 which teaches a pharmaceutical composition
  • a pharmaceutical composition comprising (a) an effective amount of controlled release polymer (e.g., hyaluronic acid) and (b) an effective amount of an IL-lra; WO 94/06457; WO 94/21275; FR 2706772; WO 94/21235; DE 4219626, WO 94/20517; and WO 96/22793, the disclosures of which are incorporated herein by reference .
  • the proteins include glycosylated as well as non- glycosylated IL-1 receptor antagonists.
  • IL-lra ⁇ , IL-lra ⁇ and IL-lrax are disclosed and described in U.S. Patent No. 5,075,222 by Hannum et al . , entitled "Interleukin-1 Inhibitors.”
  • This U.S. Patent referred to herein as the '222 patent, is specifically incorporated herein by reference. All three of these interleukin-1 inhibitors possess similar functional and immunological activities.
  • Methods for producing IL-1 inhibitors, particularly IL-lras are also disclosed in the '222 patent. One disclosed method involves isolating the inhibitors from human monocytes (where they are naturally produced) .
  • a second disclosed method involves isolating the gene responsible for coding the IL-lras, cloning the gene in suitable vectors and cell types, expressing the gene to produce the IL-lras and harvesting the IL-lras.
  • the latter method which is exemplary of recombinant DNA methods in general, is a preferred method of the present invention.
  • an IL-lra contains an N-terminal methionyl group as a consequence of expression in E. coli .
  • the present invention also includes modified IL-lras.
  • the modified IL-lras include, for example, muteins of such inhibitors in whicli a cysteine residue is substituted for an amino acid at one or more sites in the amino acid sequence of a naturally-occurring inhibitor. Such muteins may then be site-selectively reacted with functionalized polyethylene glycol (PEG) units or other sulfhydryl-containing polyethers to create IL-lra PEG species.
  • PEG polyethylene glycol
  • PCT Publication No. WO 92/16221 discloses a number of modified IL-lra species and methods of making such PEG modified inhibitors.
  • An additional class of interleukin-1 inhibitors includes compounds capable of specifically preventing activation of cellular receptors to IL-1. Such compounds include IL-1 binding proteins, such as soluble receptors and monoclonal antibodies. Such compounds also include monoclonal antibodies to the receptors .
  • a further class of interleukin-1 inhibitors includes compounds and proteins which block in vivo synthesis and/or extracellular release of IL-1. Such compounds include agents which affect transcription of IL-1 genes or processing of IL-1 preproteins .
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated, each unit containing a predetermined quantity of additional anti-inflammatory compounds calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coating, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like which are compatible with the active ingredient and with the mode of administration and other ingredients of the formulation and not deleterious to the recipient.
  • solvents dispersion media, coating, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like which are compatible with the active ingredient and with the mode of administration and other ingredients of the formulation and not deleterious to the recipient.
  • the use of such media and agents is well known in the art (see for example, Remington 's Pharmaceutical Sciences, 18th Ed. (1990), Mack Publishing Co., Easton, PA 18042, pages 1435-1712, the disclosure of which is hereby incorporated by reference) .
  • Supplementary active ingredients can also be incorporated into the compositions .
  • the additional anti-inflammatory compound may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixers, suspensions, syrups, wafers and the like, or it may be incorporated directly with the food in the diet.
  • the tablets, troches, pills, capsules and the like may also contain the following: a binder such as gum tragacanth, acacia, corn starch or gelatin; excipients such as dicalcium phosphate; a disintegrating agent such as corn starch, alginic acid and the like; a lubricant such as magnesium stearate; a sweetening agent such as sucrose, lactose or saccharin; or a flavoring agent such as peppermint, oil of wintergreen or cherry or orange flavoring.
  • a binder such as gum tragacanth, acacia, corn starch or gelatin
  • excipients such as dicalcium phosphate
  • a disintegrating agent such as corn starch, alginic acid and the like
  • a lubricant such as magnesium stearate
  • a sweetening agent such as sucrose, lactose or saccharin
  • a flavoring agent such as peppermint, oil of wintergreen or cherry or orange flavoring
  • tablets, pills or capsules may be coated with shellac, sugar or both.
  • any material used in preparing any dosage unit form should be pharmaceutically pure and substantially non-toxic in the amounts employed.
  • the additional anti-inflammatory compound may be incorporated into a sustained-release preparation and formulation. The amount of the additional anti-inflammatory compound in such a therapeutically useful composition is such that a suitable dosage will be obtained.
  • each additional anti-inflammatory compound may be incorporated with a sterile injectable solution.
  • the sterile injectable solution may be prepared by incorporating the additional anti-inflammatory compound in the required amount in an appropriate pharmaceutically acceptable carrier, with various other ingredients enumerated below (required) , followed by filtered sterilization.
  • each may be prepared by incorporating the additional anti-inflammatory compound into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
  • each may be prepared by incorporating a powder of the additional anti-inflammatory compound and, optionally, any additional desired ingredient from a previously sterile-filtered solution thereof, wherein the powder is prepared by any suitable technique (e.g., vacuum drying and freeze drying) .
  • the specific dose of the additional anti- inflammatory compound is calculated according to the approximate body weight or surface area of the patient.
  • Other factors in determining the appropriate dosage can include the acute or chronic inflammatory disease or condition to be treated or prevented, the severity of the disease, the route of administration, and the age, sex and medical condition of the patient. Further refinement of the calculations necessary to determine the appropriate dosage for treatment involving each of the above-mentioned formulations is routinely made by those skilled in the art. Dosages can also be determined through the use of known assays for determining dosages used in conjunction with appropriate dose-response data.
  • doses of the additional anti-inflammatory compounds selected for treating a particular acute or chronic inflammatory disease such as rheumatic diseases (e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal-induced ("septic") arthritis) can be varied to achieve a desired therapeutic effect.
  • rheumatic diseases e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal-induced ("septic") arthritis
  • rheumatic diseases e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal-induced (“septic”) arthritis
  • septic staphylococcal-induced
  • chronic methotrexate treatment is associated with gastrointestinal
  • Tests for monitoring the improvement of a disease can include specific tests directed, for example, to the determination of systemic response to inflammation, which include the erythrocyte sedimentation rate (ESR) and acute phase reactants (APR) . Observations are made of the swelling, etc. of the afflicted body parts. Improvement in stiffness, and grip (where applicable) , and reduction in pain of the patient is also observed. If the patient's condition is stable, he is re-treated at the same dosage weekly and is evaluated weekly. Provided the patient's condition is stable, the treatment may be continued. After six months of treatment, anatomical changes of the skeleton are determined by radiologic imaging, for example by X-radiography .
  • the patient is again evaluated.
  • ESR and APR indicates the efficacy of the treatments.
  • the dosage may be increased or maintained constant for the duration of treatment.
  • the present invention is directed to a method with, optionally, one of the following combinations to treat or prevent an acute or chronic inflammatory disease and condition, as defined above, such as rheumatic diseases (e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal- induced ("septic") arthritis) : a truncated sTNFR product (e.g., Ri- [Cys 19 -Cys 103 ] -R 2 protein) and methotrexate; a truncated sTNFR product (e.g., R ⁇ [Cys 1 -Cys 103 ] -R 2 protein) , methotrexate and an IL-1 inhibitor, preferably IL-lra; a truncated sTNFR product (e.g., R ⁇ -[Cys 19 - Cys 103 ]-
  • a truncated sTNFR product e.g., Ri ⁇ [Cys 19 -Cys 103 ] -R protein
  • methotrexate and ciprofloxacin e.g., cyclosporin
  • a truncated sTNFR product e.g., Ri ⁇ [Cys 19 -Cys 103 ] -R protein
  • methotrexate and ciprofloxacin e.g., R]_- [Cys 19 -Cys 103 ] -R protein
  • an IL-1 inhibitor preferably IL-lra
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein
  • a truncated sTNFR product e.g., R ⁇ [
  • the method comprises the administration (e.g., intra- articular, subcutaneous or intramuscular) of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein, optionally formulated in a sustained release formulation (e.g., hyaluronan)) optionally in combination (pretreatment, post-treatment or concurrent treatment) with methotrexate and/or an IL-1 inhibitor (e.g., IL- lra) and/or the soluble recombinant human Fas antigen to treat rheumatic diseases, as defined above (e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal-induced ("septic”) and the symptoms associated therewith.
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -C
  • the method comprises the administration (e.g., intravenous or intraventricular) of a truncated sTNFR product (e.g., Ri- [Cys 19 -Cys 103 ]-R 2 protein, optionally formulated in a sustained release formulation (e.g., hyaluronan)) optionally in combination (pretreatment, post-treatment or concurrent treatment) with tissue plasminogen activator and/or an IL-1 inhibitor (e.g., IL-lra) to treat brain injury as a result of trauma, epilepsy, hemorrhage or stroke, each of which may lead to neurodegeneration .
  • a truncated sTNFR product e.g., Ri- [Cys 19 -Cys 103 ]-R 2 protein, optionally formulated in a sustained release formulation (e.g., hyaluronan)
  • tissue plasminogen activator and/or an IL-1 inhibitor e.g., IL-lr
  • the method comprises the administration (e.g., subcutaneous or intramuscular) of a truncated sTNFR product (e.g., R l - [Cys 19 -Cys 103 ] -R protein, optionally formulated in a sustained release formulation (e.g., hyaluronan)) optionally in combination (pretreatment, post-treatment or concurrent treatment) with one or more of a corticosteroid, cyclosporin, FK-506, or an interferon (e.g., alpha interferon, beta interferon, gamma interferon or consensus interferon) and/or IL-lra to treat multiple sclerosis.
  • a truncated sTNFR product e.g., R l - [Cys 19 -Cys 103 ] -R protein, optionally formulated in a sustained release formulation (e.g., hyaluronan)
  • a corticosteroid e
  • the method comprises the administration (e.g., subcutaneous or intramuscular) of a truncated sTNFR product (e.g., Ri ⁇ [Cys 19 -Cys 103 ]-R protein, optionally formulated in a sustained release formulation (e.g., hyaluronan)) optionally in combination (pretreatment, post-treatment or concurrent treatment) with G-CSF and/or IL-lra to treat inflammatory bowel disease.
  • a truncated sTNFR product e.g., Ri ⁇ [Cys 19 -Cys 103 ]-R protein
  • a sustained release formulation e.g., hyaluronan
  • the method comprises the administration (e.g., subcutaneous or intramuscular) of a truncated sTNFR product (e.g., R l ⁇ [Cys 19 -Cys 103 ]-R2 protein, optionally formulated in a sustained release formulation (e.g., hyaluronan)) optionally in combination (pretreatment, post-treatment or concurrent treatment) with leptin, MarinolTM or MegaceTM to treat cachexia/anorexia.
  • a truncated sTNFR product e.g., R l ⁇ [Cys 19 -Cys 103 ]-R2 protein, optionally formulated in a sustained release formulation (e.g., hyaluronan)
  • a sustained release formulation e.g., hyaluronan
  • the method comprises the administration (e.g., subcutaneous, intraventricular or intrathecal) of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ]-R 2 protein, optionally formulated in a sustained release formulation (e.g., hyaluronan)) optionally in combination- (pretreatment, post-treatment or concurrent treatment) with an NSAID (e.g., indomethacin) and/or an IL-1 inhibitor (e.g. IL-lra) to treat Alzheimer's disease.
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -Cys 103 ]-R 2 protein
  • a sustained release formulation e.g., hyaluronan
  • an NSAID e.g., indomethacin
  • an IL-1 inhibitor e.g. IL-lra
  • the method comprises the administration (e.g., subcutaneous, intraventricular or intrathecal) of a truncated sTNFR product (e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein, optionally formulated in a sustained release formulation (e.g., hyaluronan)) optionally in combination
  • a truncated sTNFR product e.g., R ⁇ [Cys 19 -Cys 103 ] -R 2 protein, optionally formulated in a sustained release formulation (e.g., hyaluronan)
  • a sustained release formulation e.g., hyaluronan
  • cancer e.g., leukemias
  • diabetes e.g., juvenile onset Type 1 diabetes mellitus
  • graft versus host rejection hepatitis
  • ischemic/reperfusion injury including cerebral ischemia (brain injury as a result of trauma, epilepsy, hemorrhage or stroke, each of which may lead to neurodegeneration)
  • neuroinflammatory diseases rheumatic diseases, as defined above (e.g., lyme disease, juvenile (rheumatoid) arthritis, osteoarthritis, psoriatic arthritis, rheumatoid arthritis and staphylococcal-induced ("septic") and tissue transplantation.
  • septic staphylococcal-induced
  • FNCSL-COOH (sTNFR-I 2.6D/C106); NH 2 -MDSVCPQGKYIHPQNNSIC- [Cys 19 -Cys 103 ] -FN-COOH (sTNFR-I 2.6D/N105); NH 2 -
  • PCR amplification of sTNFR-I 2.6D/C106 is carried out using as a template a cloned cDNA derived from the clone lambda-gtl07ctnfbp (EP 422339) and the following PCR primers :
  • OLIGOfl and OLIGO#2 encode Ndel and -Hindlll and anneal to the 5' and 3' end of the truncated gene, respectively.
  • PCR amplification is run for 25 cycles; each cycle consisting of 30 seconds at 94°C for denaturation, 15 seconds at 55°C for annealing, and 1 minute at 72°C for elongation [Model 2400 thermocycler (Perkin-Elmer Cetus, ⁇ orwalk, CT) ] .
  • the PCR product is purified using a QIAquickTM PCR Purification Kit (QIAGE ⁇ ,
  • the purified PCR product is cut with iVdel and Hindlll then gel purified using the QIAquickTM Gel
  • the gel isolated PCR product is ligated into pAMGll (WO 95/26746) and transformed into FM15 E. coli cells (ATCC 55765) .
  • PCR amplification of sT ⁇ FR-I 2.6D/C105 is carried out using the sT ⁇ FR-I 2.6D/C106 plasmid D ⁇ A as a template and the following PCR primers:
  • OLIGO#4 (SEQ ID NO: 71)
  • OLIGO#3 and OLIGO#4 encode Ba-mHI and mutation N(105)C followed by a stop codon .
  • the OLIGOS are designed to extend completely around the template for incorporation of the new BamHI site for ligation.
  • PCR amplification is run for 35 cycles; 10 cycles, each cycle consisting of 10 seconds at 92°C for denaturation, 30 seconds at 55°C for annealing, and 4 minutes at 68°C for elongation followed by 25 cycles, each cycle consisting of 10 seconds at 92°C for denaturation, 30 seconds at 55°C for annealing, and 4 minutes + 20 seconds at 68°C for elongation [Model 2400 thermocycler (Perkin-Elmer Cetus, Norwalk, CT) ] .
  • the PCR product is gel purified using the QIAquickTM Gel Extraction
  • Kit (QIAGEN, Chatsworth, CA) according to the manufacturer's instructions, cut with Ba ⁇ il , phenol/chloroform extracted and ethanol precipitated. It is then resuspended, ligated into pAMGll, and transformed into FM15 E. coli cells.
  • sTNFR-I 2.6D 1Q5 PCR amplification of sTNFR-I 2.6D/N105 is carried out using the sTNFR-I 2.6D/C106 plasmid DNA as a template and the following PCR primers:
  • 0LIG0#5 and 0L1G0#6 encode Ndel and BamHl and anneal to the 5' and 3' end of the truncated gene, respectively.
  • PCR amplification is run for 30 cycles; each cycle consisting of 45 seconds at 95°C for denaturation, one minute at 65°C for annealing, and two minutes at 72°C for elongation [Model 2400 thermocycler (Perkin-Elmer Cetus, Norwalk, CT) ] .
  • the PCR product is purified using the WizardTM
  • DNA Clean-Up System (Promega, Madison, WI) according to the manufacturer's instructions.
  • the purified PCR product is cut with Ndel and BamHI, phenol/chloroform extracted and ethanol precipitated. It is then resuspended, ligated into pAMGll and transformed into FM15 E. coli cells.
  • 2.3D/d8 and sTNFR-I 2.3D/dl5 are each carried out using 2.6D/C106 plasmid DNA as a template and the following PCR primers :
  • OLIGO#7 (SEQ ID NO:74) 5 ' -CCCCATATGTATATCCACCCTCAAAATAAT-3 ' 3' OLIGO#8: (SEQ ID NO: 75) 5 ' -CCCAAGCTTTTACAGAGAGCAATTGAAGCACTG-3 '
  • PCR amplifications are run for 25 cycles; each cycle consisting of 45 seconds at 95°C for denaturation, 1 minute at 65°C for annealing, and 2 minutes at 72°C for elongation [Model 2400 thermocycler (Perkin-Elmer Cetus, Norwalk, CT) ] .
  • the PCR products are purified using the WizardTM DNA Clean-Up System (Promega, Madison, WI) according to the manufacturer's instructions.
  • the purified PCR products are cut with Ndel and Hindlll , phenol/chloroform extracted and ethanol precipitated. They are resuspended, ligated into pAMGll, and transformed into FM15 E. coli cells.
  • one small freshly cultured inocula of the desired recombinant E . coli clone harboring the desired construct for sTNFR-I 2.6D/N105, sTNFR-I 2.6D/C105 sTNFR-I 2.6D/C106, sTNFR 2.3D/dl8, sTNFR-I 2.3D/d8 and sTNFR-I 2.3D/dl5 is started by transferring the entire contents of a frozen glycerol stock seed ampule (ca. 1.5 mL) into a 2 L flask containing 500 mL of Luna broth. The culture is incubated in a gyratory shaker at 37°C operating at 350 rpm. The density of the culture is determined by measuring absorbance at 660 nm (OE> 6 6 ⁇ ) . The seed culture is grown to a density of >. 2.0
  • the batch medium and fermentation conditions for the production fermentation are the complex medium fermentation conditions as described by Sniff (1993) , "A Chemically-Defined Medium for the Overproduction of a Recombinant Protein in E. coli, " thesis, Colorado State University.
  • the reference teaches the use of a complex medium containing casein hydrolysate, salts, glycerin and antifoam, which are sterilized in the fermentor. After the tank is cooled to below 40°C, filter sterilized trace minerals and thiamine hydrochloride are added.
  • the medium temperature is stable at 37°C
  • the medium is inoculated with the seed culture.
  • Culture growth is monitored by measuring OD 660 - ⁇ h e culture is maintained at a pH of 6.0 by the automatic addition of 5 M sodium hydroxide and 5 M hydrochloric acid.
  • OD6 6 0 is between 9.5 and 10.5
  • IPTG sterile isopropyl ⁇ -D thiogalactopyranoside
  • the culture medium and growth conditions are as described by Sniff (1993) , supra, with the following exceptions: ammonium sulfate (2.0 g/L) and L-cysteine hydrochloride monohydrate (1.0 g/L) are added to the medium; tetracycline hydrochloride is omitted from the medium; the pH is maintained at 6.0 with sodium hydroxide and hydrochloric acid, rather than at 7.0 with only sodium hydroxide; the growth temperature is increased to 37°C; the inducer concentration has been increased from 0.15mM to 0.50mM IPTG; and the harvest criteria is based on cessation of growth rather than time after induction.
  • the cells are harvested in centrifugation in 500 mL bottles.
  • the cells are pelleted by centrifugation at 10,000 rpm for 30 minutes.
  • the recovered cell paste is diluted to 15% solids in a breaking buffer composed of 50mM Tris and 5mM EDTA at pH 8.0.
  • the suspended cells are then lysed by passing the solution through a homogenizer (APV Gaulin, Inc., Everett, MA) operating at 8000 psi pressure three times.
  • the homogenate is then centrifuged at 10,000 rpm for 30 minutes to recover the inclusion bodies (IBs) .
  • IBs inclusion bodies
  • the IBs are washed by resuspendmg in breaking buffer and centrifugmg the solution a third time at 10,000 rpm for 30 minutes.
  • the IBs are resuspended in deionized water (1:1 ratio) and centrifuged a final time at 10,000 rpm for 30 minutes for the second wash.
  • the recovered, washed inclusion bodies for each protein are ready for solubilization, refold and purification. Each run yields approximately 200-250g of IBs.
  • the truncated sTNFR-1 may be fermented as follows:
  • a small freshly cultured inoculum of the desired recombinant E. coli clone harboring the desired construct for sTNFR-I 2.6D/N105 or sTNFR-I 2.6D/C106 is started by transferring the entire contents of a frozen glycerol stock seed ampule (ca. 1.5 mL) into a 2 L flask containing 500 mL of 10 g/L BBL yeast extract, pH 7.0. The culture is incubated in a gyratory shaker at 33°C operating at 300 rpm. The density of the culture is determined by measuring absorbance at 600 nm (OD60 0 ) • The seed culture is grown to a density of -> 2.0
  • the production fermentation employs a fed- batch process.
  • the batch medium is a complex medium containing yeast extract, salts, and antifoam, which are sterilized in the fermentor.
  • filter sterilized trace minerals, glucose, magnesium sulfate, and hexametaphosphate are added.
  • Two feeds are employed, the first being a carbon containing feed (glucose/magnesium sulfate) and the second a nitrogen feed containing yeast extract.
  • the medium is inoculated with the seed culture.
  • Culture growth is monitored by measuring ODgoo-
  • the culture is maintained at a pH of 7.0 by the automatic addition of ammonium hydroxide and 48.7% citric acid.
  • feed I is initiated using an exponential feed rate.
  • feed 2 is initiated using a constant feed rate.
  • the culture is induced by the aseptic addition of sterile autoinducer (homoserine lactone) to a final concentration of 0.6 mg/L. Both feed I and II rates are changed to a constant rate at induction.
  • the culture is harvested at 16 ⁇ 2 hrs post induction..
  • the cells are harvested in centrifugation in 500 mL bottles.
  • the cells are pelleted by centrifugation at 10,000 rpm for 30 minutes.
  • the recovered cell paste is diluted to 15% solids in a breaking buffer composed of 50 mM Tris and 5 mM EDTA at pH 8.0.
  • the suspended cells are then lysed by passing the solution through a homogenizer (APV Gaulin, Inc., Everett, MA) operating at 8000 psi pressure three times.
  • the homogenate is then centrifuged at 10,000 rpm for 30 minutes to recover the inclusion bodies (IBs) .
  • IBs inclusion bodies
  • the IBs are washed by resuspending in breaking buffer and centrifuging the solution a third time at 10,000 rpm for 30 minutes.
  • the IBs are resuspended in deionized water (1:1 ratio) and centrifuged a final time at 10,000 rpm for 30 minutes for the second wash.
  • the recovered, washed inclusion bodies are ready for solubilization, refold and purification.
  • the washed IBs from each entire 10 L fermentation are solubilized in 800 mL of solubilization buffer (50mM Tris, 8M Urea, 160mM cysteine pH9.5) .
  • solubilization buffer 50mM Tris, 8M Urea, 160mM cysteine pH9.5
  • the pH of the solubilization mixture is adjusted to 9.5 with ION NaOH and allowed to stir at room temperature for 2-3 hours. Each run yielded approximately 200-250g of IBs.
  • Each solubilization mixture is diluted 1:20 into cold Renaturation Buffer (50mM Tris, 1.1M Urea) . Each final volume is about 16 L. Thereafter each mixture is adjusted to pH 9.7 with 6N HC1, and slowly stirred at 4°C for 2-3 days.
  • Renaturation Buffer 50mM Tris, 1.1M Urea
  • each mixture is then adjusted to 5.0 with glacial acetic acid and 6N HC1.
  • a precipitate is formed which is removed by centrifugation at 10,000 X g on a Beckman Model J2-HS centrifuge.
  • Each material is then filtered through a 5 ⁇ m and a 0.22 ⁇ m filter.
  • the refold materials are ready for column purification on an IX-1 SP-Sepharose Big BeadTM column
  • TX-1 SP-Sepharose Big BeadTM column (4.4 cm x 20 cm)
  • a column is equilibrated with 4-5 column volumes Buffer A prior to separate loadings of each refold material.
  • the refold materials are separately loaded onto the column for purification.
  • the column is loaded with no more than twelve grams of protein per liter of resin.
  • the column is then washed with 3-4 column volumes of Buffer A (until U.V. returned to baseline) .
  • Buffer A until U.V. returned to baseline
  • protein is eluted off the column using a linear eight column volume increasing salt gradient running from 50-375mM NaCl.
  • the entire protein peak for each loading is collected into one pool. The collection of each protein peak is started when the U.V. absorbance rose to about 20% of peak maximum. Pooling is stopped when the earlier of either the U.V. absorbance reached about 50% of peak maximum or the absorbance stops declining.
  • Each IX-1 pool is ready for purification on a Toyo PearlTM Butyl 650M HIC column (Toso Haas,
  • the column is equilibrated with 4-5 column volumes of Buffer A prior to separate loadings of each IX-1 pool material.
  • Each IX-1 pool is diluted 1:1 with Dilution Buffer and the pH adjusted to 6.0.
  • the diluted IX-1 pool is loaded onto a column.
  • the column is loaded with no more than ten grams of protein per liter of resin.
  • the column is washed with 3 column volumes of buffer.
  • protein is eluted off the column with a linear eight column volume decreasing salt gradient running from 1.8M NaCl to H 2 0.
  • the collection of each protein peak is started when the U.V. absorbance rose to about 15-20% of peak maximum. Pooling is stopped when the earlier of either the U.V. absorbance reached about 50% of peak maximum or the absorbance stops declining.
  • Each HIC pool is ready for concentration/ diafiltration.
  • a 1 sq ft PLCCTM regenerated cellulose 5,000 M.W. cutoff membrane (Milli-Pore, Bedford, MA) is used for the C/D step for each HIC pool.
  • Each HIC pool is concentrated down to around 200 mL and then diafiltrated against 6-7 volumes of 20mM NaP0 4 pH6.0 until the conductivity is ⁇ 4mm hour.
  • Each concentration/ diafiltration step is done at room temperature.
  • Each C/D pool is then ready for purification on an IX-2 - 365 mL SP-Sepharose HPTM column (Pharmacia Biotech, Inc., Piscataway, NJ) .
  • the column is equilibrated with 4 column volumes Equilibration Buffer prior to separate loadings of each C/D pool.
  • Each C/D pool is loaded onto the column using no more then eight grams of protein per liter of resin.
  • the column is washed with 3 column volumes Equilibration Buffer followed by 3 column volumes Buffer A.
  • protein is eluted off the column with a linear eight column volume gradient consisting of a pH gradient from 6.3 - 6.8 and a salt gradient running from 0 - 50mM NaCl (Buffer B) . Pooling is started at 1.0 O.D. up the front side of the peak and stopped at 50% of the peak max on the back side.
  • the truncated sTNFR-1 may be solubilized, re-folded and purified as follows :
  • the washed IBs are solubilized with 8M urea, 60mM Tris, lOOmM cysteine to give a final concentration of 6.5 M urea, 50mM Tris and 80mM cysteine, pH 9.4 and 5
  • truncated sTNFR-1 (The latter is based on a quantitation of the amount of truncated sTNFR-1 in washed IBs on a g/L basis.)
  • the material is allowed to stir at room temperature for 90 minutes and is then refolded by diluting 1:10 into cold (4 - 8 °C) 0.85M urea, 50mM Tris, pH 9.8 (pH measurement taken at 4 - 8 °C) .
  • the clarified acid precipitation pool is loaded onto an SP-Sepharose Big BeadTM column (Pharmacia).
  • the SP-BB pool is diluted 1:1 with 2M NaCl, 60mM acetate, pH 4.5 and the pH adjusted to 4.5 if necessary.
  • the diluted SP-BB pool is loaded on to a ToyopearlTM Butyl 650M column (Toso Haas, Philadelphia,
  • SP-HP Pulacia Biotech, Inc., Piscataway, NJ
  • 30mM acetate, pH 4.5 loading no more than ⁇ 15 g/L bed volume
  • the column is then washed with 3 column volumes of 30mM acetate, pH 4.5 and eluted with a linear 12 column volume gradient going from lOOmM to 400mM NaCl in 30mM acetate, pH 4.5.
  • the purified truncated sTNFR-1 fractions are pooled and adjusted to pH 5.0 with NaOH.
  • NaCNBH3 is added to a final concentration of 20mM, and the reaction mixture is stirred at 7°C for 18-24 hours.
  • the extent of the protein modification during the course of the reaction is monitored by SEC HPLC using a TSKG3000sw XL column (Toso Haas, Montgomeryville, PA) eluting with 0.1 M sodium phosphate buffer pH 6.9, 0.5M NaCl, and 10% ethanol at 0.7 ml/min (Toso Haas, Montgomeryville, PA) .
  • the pH of the reaction mixture is adjusted to ca. 3.5 with IM HCl, and the reaction mixture is diluted with water to a final protein concentration of 1.5 mg/ml .
  • sTNFR-I 2.6D/N105-t-BuPEG(33kDa) is separated from the excess of t-BuPEG and other reaction byproducts by using a SP Sepharose HP 16/10TM ion-exchange chromatography (Pharmacia Biotech, Inc., Piscataway, NJ) .
  • the reaction mixture is loaded onto the column and the unreacted t-BuPEG is eluted with 3 column volumes of the starting Buffer A (20mM sodium acetate, pH 4.0) .
  • the sTNFR-I 2.6D/N105-t-BuPEG (33kDa) is eluted using a linear 20 column volume gradient from 0-30% Buffer B (IM NaCl in 20mM acetate, pH 4.0. The eluent is monitored at 280 nm.
  • Buffer B IM NaCl in 20mM acetate, pH 4.0.
  • the eluent is monitored at 280 nm.
  • Each fraction containing sTNFR-I 2.6D/N105-t-BuPEG (33kDa) is analyzed by SDS-PAGE using 4-20% precast gradient gels (Novex, San Diego, CA) . Based on SDS-PAGE analysis results, fractions are pooled, concentrated, and sterile filtered.
  • sTNFR-I 2.6D/N105-t-BuPEG 33kDa
  • SDS-PAGE and SEC HPLC This protein is formulated in lOmM sodium phosphate, pH 6.5 and 20mM NaCl. 2.
  • sTNFR-I 2.6D/N105-MePEG 33kDa is separated from the excess of MePEG and other reaction by-products by ion exchange chromatography using an SP Sepharose HPTM column (Pharmacia Biotech, Inc., Piscataway, NJ) .
  • the reaction mixture is loaded (no more than 8mg/ml of resin) onto the column and the unreacted MePEG is eluted with 3 column volumes of the starting buffer A (20mM sodium citrate, pH 3.0).
  • the sTNFR-I 2.6D/N105- MePEG (33kDa) is eluted using a linear 16 column volume gradient from 0.1 - 0.5 M NaCl in 20mM citrate, pH 3.0.
  • the eluent is monitored at 280 nm.
  • Each fraction containing sTNFR-I 2.6D/N105-MePEG (33kDa) is analyzed by SDS-PAGE using 4-20% precast gradient gels (Novex, San Diego, CA) .
  • fractions are pooled, concentrated, and sterile filtered.
  • Each final pool of purified sTNFR-I 2.6D/N105-MePEG(33kDa) is again analyzed by SDS-PAGE.
  • the purified sTNFR-I 2.6D/N105-MePEG (33kDa) is concentrated to 5 - 20 mg/mL and formulated in either
  • PBS pH 6.5 (10 mM sodium phosphate, 35-100 mM NaCl) or 20mM acetate, 100 mM NaCl, pH 5.0.
  • step A for the preparation of sTNFR-I 2.6D/N105-MePEG(33kDa) .
  • This protein is formulated in lOmM sodium phosphate, pH 6.5 and 20mM NaCl.
  • MePEG (33kDa) , with the exception that the following types of PEG aldehydes (Shearwater Polymers, Inc.) are used: linear monofunctional - MW 5kDa, 6kDa, and 57kDa; branched monofunctional - MW lOkDa, 20kDa and 40kDa; linear difunctional - MW 8kDa and 20kDa; branched trifunctional - MW lOkDa.
  • PEG aldehydes Shearwater Polymers, Inc.
  • These proteins are formulated in lOmM sodium phosphate, pH 6.5 and 20mM NaCl.
  • the truncated sTNFR-l molecules may be pegylated and purified by the following techniques:
  • the SP-HP eluate (3 - 5 mg/mL adjusted to pH 5.0) is reacted with 2 moles of polyethylene glycol (e.g., MePEG or t-BuPEG) per mole of sTNFR-I 2.6D/N105 (-5 grams of t-BuPEG per gram of sTNFR-I 2.6D/N105) .
  • polyethylene glycol e.g., MePEG or t-BuPEG
  • 10 - 20mM sodium cyanoborohydride is added and the solution is allowed to incubate overnight at 7 - 15 °C.
  • the reaction is quenched by adding lOmM glycine.
  • the pegylation mixture is diluted with 4 volumes of 50mM acetate, pH 4.0, adjusted to pH 4.0 if necessary, and loaded onto a SP-HP column that has been equilibrated with 50mM acetate, pH 4.0.
  • the column is loaded to no more than ⁇ 8 grams of sTNFR-2.6D/N105 per Liter bed volume. After loading, the column is washed with 3 column volumes of Equilibration Buffer and eluted with a linear 0 - 0.3M NaCl gradient in 50mM acetate, pH 4.0.
  • the sTNFR-2.6D/N105-30kDa monopegylated fractions are collected, adjusted to pH 5.0, concentrated and diafiltered into an isotonic formulation buffer. All purification steps are carried out at room temperature.
  • the protein is formulated in either PBS, pH 6.5 (10 mM sodium phosphate, 35-100 mM NaCl) or 20mM acetate, 100 mM NaCl, pH
  • Sulfone activated polyethylene glycol prepared and purified substantially in accordance with United States Patent Application No. 08/473,809, filed June 7, 1995 and United States Patent Application No. 08/611,918, filed March 6, 1996) [PEG-20, 000-jis-vinyl sulfone], are used to dimerize proteins substantially in accordance with the method described in PCT Publication No. WO 95/34326, except for the reduction and reaction conditions.
  • the proteins are reduced prior to the attachment of the polyethylene glycol with 4 mole DTT per one mole of protein at 5-6°C, pH 7.6. All reactions are performed in the presence of 30% glycerol.
  • the dimerized proteins are termed sTNFR-I 2.6D/C105db and sTNFR-I 2.6D/C106db. Each protein is formulated in either PBS, pH 6.5 (10 mM sodium phosphate, 35-100 mM NaCl) or 20mM acetate, 100 mM NaCl, pH 5.0. - Ill - 7. Preparation of Comparative sTNFR-I Molecules
  • sTNFR-I 4D/N105 is prepared as described in EP 422339.
  • sTNFR-I 4D/N105-t-BuPEG (33kda) is prepared by pegylating sTNFR-I 4D/N105 substantially in accordance with the procedures set forth above for the pegylation of sTNFR-I 2.6D/N105-t-BuPEG (33kDa).
  • sTNFR-I 4D/N105-t- MePEG(33kda) is prepared by pegylating sTNFR-I 4D/N105 substantially in accordance with the procedures set forth above for the pegylation of sTNFR-I 2.6D/N105-
  • MePEG (33kDa) .
  • sTNFR-I 4D/C105 and sTNFR-I 4D/C105db are prepared as described in PCT Publication No. WO 95/34326. This protein is formulated in lOmM sodium phosphate, pH 6.5 and 20mM NaCl.
  • sTNFR-I 4D/C105-33kDa (MePEG) is prepared by pegylating 4D/C105 substantially in accordance with the procedures set forth above for the pegylation of sTNFR-I 2.6D/C105-33kDa(MePEG) with the exception that the reaction occurs at pH 7.5 with 1.3 moles of DTT per mole of sTNFR-I for ⁇ 5-6 hours, followed by removal of the DTT on an SP-SepharoseTM FF column and PEGylation with
  • This protein is formulated in either PBS, pH 6.5 (10 mM sodium phosphate, 35-100 mM NaCl) or 20mM acetate, 100 mM NaCl, pH 5.0.
  • sTNFR-I 3D/N105 (a truncation of the c-terminus 34 amino acids of sTNFR-I 4D/N105) is prepared as follows. PCR amplification is carried out using sTNFR-I 4D/N105 as the template and OLIGO#13 and OLIGO#14 which encode Ndel and Hindl l , respectively, and anneal to the 5' and 3' ends of the truncated gene, respectively.
  • PCR amplifications are run for 25 cycles; each cycle consisting of 30 seconds at 94°C for denaturation, 15 seconds at 60°C for annealing, and 1 minute at 72°C for elongation [Model 2400 thermocycler (Perkin-Elmer Cetus, Norwalk, CT) ] .
  • the PCR product is purified using a QIAquickTM PCR Purification Kit (QIAGEN, Chatsworth, CA) .
  • the purified PCR product is cut with Ndel and HindiII then gel purified using the QIAquickTM Gel Extraction Kit
  • the gel isolated PCR product is ligated into pAMGll and transformed into FM15 E. coli cells .
  • This protein is formulated in lOmM sodium phosphate, pH 6.5 and 20mM NaCl.
  • sTNFR-I 3D/C105 (a truncation of the c- terminus 34 amino acids of sTNFR-I 4D/C105) is prepared substantially as sTNFR-I 3D/N105, with the exception that the template is sTNFR-I 4D/C105.
  • sTNFR-I 3D/C105 is formulated in either PBS, pH 6.5 (10 mM sodium phosphate, 35-100 mM NaCl) or 20mM acetate, 100 mM NaCl, pH 5.0.
  • sTNFR-I 3D/C105db is prepared substantially as sTNFR-I 4D/C105db, with the exception that sTNFR-I 3D/C105 is used as the starting material instead of sTNFR-I 4D/C105.
  • sTNFR-I 3D/C105db is formulated in either PBS, pH 6.5 (10 mM sodium phosphate, 35-100 mM NaCl) or 20mM acetate, 100 mM NaCl, pH 5.0.
  • Various forms of truncated, recombinant soluble TNFR-I are assessed for their ability to inhibit TNF activity.
  • the WEHI assay is an in vitro cell proliferation assay (Edwards et al . (1991), Endocrinology. 12£: 989-996) .
  • the cell lines are sensitive to TNF- ⁇ (i.e., TNF- ⁇ is cytotoxic) .
  • TNF- ⁇ is cytotoxic
  • the cells are protected from the cytotoxic effect and thus are able to proliferate.
  • TNF-sensitive WEHI 164 clone 13 cells (ATCC, Rockville, MD) are suspended at a concentration of 20 x IO 4 cells/mL in RPMI (Gibco, Grand Island, NY) medium supplemented with 5% Fetal Calf Serum (Hyclone, Ogden, UT) and penicillin 50U/mL: streptomycin 50 mg/mL.
  • RPMI Gibco, Grand Island, NY
  • penicillin 50U/mL penicillin 50U/mL: streptomycin 50 mg/mL.
  • One hundred microliters of this cell suspension are placed in each well of flat-bottomed 96-cell microtiter plates, and the cells are allowed to adhere for 4-6 hours at 37°C in 5% C0 .
  • To each well 10 ⁇ L of a 0.0060 mg/mL actinomycin-D (Sigma Chemical Co., St. Louis, MO) is added.
  • sTNFR-I 2.6D/C106, sTNFR-I 4D/C105 and sTNFR-I 4D/C105db Serially diluted 2-fold concentrations of the various sTNFR forms (sTNFR-I 2.6D/C106, sTNFR-I 4D/C105 and sTNFR-I 4D/C105db) are diluted PBS and then added to duplicate wells (10 ⁇ L/well) containing adherent WEHI 164 cells after the addition of recombinant human TNF- ⁇ . WEHI-164 clone 13 cells are incubated for 18 hours at 37°C in 5% CO 2 .
  • % specific cytotoxicity 100% X [abs (cells + medium) - abs (cells + sample) ] /abs (cells + medium) - abs (cells + TX-100) ] .
  • the number of units of TNF in each sample is determined using the percent specific cytotoxicities of the murine standards, as described previously.
  • the L929 cytotoxicity assay is an in vitro cell proliferation assay (Parmely et al . (1993), J. Immunol . , 1-51:389-396) which also assesses the cytotoxicity of TNF- ⁇ -sensitive killing.
  • the cell lines are sensitive to TNF- ⁇ (i.e., TNF- ⁇ is cytotoxic). In the presence of a soluble TNF- ⁇ inhibitor, the cells are protected from the cytotoxic effect and thus are able to proliferate.
  • the medium used for propagation is RPMI Medium 1640 supplemented with 10% FBS +1% L-Glutamine Solution +1% Penicillin-Streptomycin Solution.
  • 96-well microtiter plates (Corning) are used in the assay and only the inner 60 wells are utilized. The standard and test sample are tested in triplicate on the same plate.
  • the TNF ⁇ used in the assay is from R&D Systems
  • the final concentration of TNF ⁇ used in the assay is 1 ng/mL in all assay wells.
  • the assay diluent is L929 growth medium, 10 ng/mL of TNF ⁇ , and 10 ⁇ g/mL of Actinomycin D (Sigma Chemical Co., St. Louis, MO).
  • the plates are harvested using an XTT/MEN Solution (1.5 mg/mL XTT + 75 mM MEN) .
  • cells are plates on assay plates.
  • a cell suspension is prepared by trypsinizing and 4 resuspending cells at 3.33x10 cells/mL. 180 mL of this cell suspension is plated into each of the inner 60 wells of the assay plates. 200mL of growth medium is dispensed into the outer 36 wells to help avoid evaporation artifacts in the assay.
  • the plates are allowed to sit at room temperature, covered with foil and free from drafts, for approximately 1 hour.
  • Assay plates are placed in a 37 ⁇ 2 * C high humidity 5 ⁇ 1% C ⁇ 2 incubator. Plates are incubated for approximately 20-22 hours prior to addition of sTNFR-I serial dilutions.
  • sTNFR-I 4D/N105 standard is prepared and test samples: Dilute sTNFR-I 4D/N105 standard and test samples to a concentration of approximately 2.0 mg/mL, (or another appropriate concentration) . Make serial dilutions of this concentration to create a 10- point dilution curve ranging from approximately 1.0 x IO 6 ng/mL to 1.0 x 10 "3 ng/mL, including a 0 ng/mL (Assay Diluent only) point. If other concentrations are appropriate, they may be used. Add 1000 ⁇ L of each dilution in triplicate on each assay plate. Incubate the plates in a 37°C ⁇ 2°C high humidity 5 ⁇ 1% CO2 incubator for 20 ⁇ 1 hours after transfer of serial dilution aliquots to the assay plates.
  • optical density (O.D.) of the assay plates is read at 450 nm minus 650 nm on an ELISA plate reader (SpectraMAX, Beckman Instruments, Inc.,
  • the data indicate that the sTNFR-I 4D/C105db and the sTNFR-I 2.6D/C105db and sTNFR-I 2.6D/C106db are active and have comparable dose responses when compared to the standard.
  • the data also indicate that the sTNFR- I STNFR-I 4D/N105-t-BuPEG(33kda) and sTNFR-I 2.6D/C105- t-BuPEG (33kda) are nearly 2 logs lower in activity, but are active in this assay, nonetheless, when compared to the STNFR-I 4D/C105db.
  • sTNFR-I 3D/C105db is active and the ED 50 values are in the range of the sTNFR-I 4D/C105db (Run #1), the sTNFR-I 2.6D/C105db (Run #1), and the sTNFR-I 2.6D/C106db (Run #1).
  • the data also indicate that the sTNFR-I 3D/N105 is less active than the sTNFR-I 4D/C105 internal standard.
  • the Streptococcal cell wall induced reactivation model of arthritis in rats assays is accomplished using known protocols (Esser et al . (1985), Arthritis And Rheumatism, 23. : 1402-1411 and Makarov et al. (1996), Proc . Natl . Acad . Sci . USA, 32. : 402-406) .
  • SCW peptidoglycan-polysaccharide
  • the second dose of SCW is sufficient to reactivate inflammation in the ankle joint previously injected with SCW and has little effect on the saline- injected ankle.
  • the dimensions of the ankle joint are measured by ankle caliper measurements of the hind ankle at 0, 24, 36, 48, and 72 hours after reactivation of the arthritis and then contralateral hind limb harvest for histology (e.g., inflammation, pannus formation, cartilage damage and bone damage) .
  • sTNFR-I 2.6D/C106db demonstrates statistically significant efficacy in reducing joint swelling, by analysis of variance (ANOVA) Fisher's post-hoc test
  • AUC Area under the curve
  • the sTNFR-I 2.6D/N105-t-BuPEG (33kDa) show a significant reduction in ankle width and histological indexes when compared to the disease control group in the model .
  • D. D-galactosamine/Lipopolysaccharide model The D-galactosamine (D-GalNH2) /Lipopolysaccharide (LPS) model (Parmely et al . (1993), supra) , is an in vi vo, highly TNF- ⁇ -dependent animal model of lethality. Additionally, MRL-lpr/lpr autoimmune mice have been shown to be extremely sensitive to LPS- or SEB-induced TNF- ⁇ (Mountz et al . (1995), J. Immunol . , 15-5_: 4829-4837) .
  • sTNFR various forms are given in serial 2-fold dilutions (mg/kg dosages) to obtain ED 50 curves generated with statistical software for the Macintosh (Statview®, Mountain View, CA) . Lethality is followed through +48h after challenge.
  • E. Adjuvant induced arthritis model Rheumatoid arthritis induced in rats by adjuvant bears many resemblances to human rheumatoid arthritis. The purpose of this experiment is to demonstrate that systemic administration of truncated sTNFRs has a mitigating effect on the pathogenesis of adjuvant-induced arthritis in mice.
  • Male Lewis rats (5-7/group) (Charles River Laboratories, Inc., Wilmington, MA) weighing at least 200g are cannulated with SQ catheters and allowed to recover for several days. They are then placed in infusion cages and acclimated for a week prior to initiating saline infusion.
  • BuPEG(33kDa) and sTNFR-I 4D/C105db are of comparable anti-arthritic activity in adjuvant arthritis in Lewis rats, although the sTNFR-I 4D/C105db is more potent in the WEHI-164 and L929 in vitro cytotoxicity assays, as well as the LPS/GalN model.
  • Type II collagen-induced arthritis in rats bears many resemblances to human rheumatoid arthritis
  • the purpose of this experiment is to demonstrate that systemic administration of truncated sTNFRs has a mitigating effect on the pathogenesis of type II collagen-induced arthritis in rats and mice.
  • Rat Protocol Female Lewis rats (Charles River Laboratories,
  • sTNFR-I 2.6D/C105db and sTNFR-I 2.6D/C106db, sTNFR-I 2.6D/N105 and sTNFR-I 4D/N105 are IV jugular implanted with AlzetTM mini-pumps (Alza Corp., Palo Alto,
  • Serum TNF- ⁇ levels measured by an ELISA (Genzyme, Cambridge, MA) are significantly decreased compared to controls +2 hours post a high dose LPS challenge.
  • Retro-orbital blood samples are collected weekly to day 21 post-initial administration, Samples are evaluated for IgM and IgG antibody production.
  • BuPEG(33kDa) has very weak, if any, antibody titers. Similar trends in immunogenicity are also observed in rats developing rat anti- sTNFR-I IgM antibodies through + 21 days. sTNFR-I 2.6D/N105-t-BuPEG (33kDa) do not generate rat anti- sTNFR-I IgM antibodies through + 21 days .
  • the objective of Part 1, Phase A of the study is to determine the pharmacokinetics and immunogenicity of either the sTNFR-I 4D/C105db (0.2 mg/kg bodyweight [BWj), sTNFR-I 3D/C105db (0.2 mg/kg BW) , or sTNFR-I 2.6D/C105db (0.2 mg/kg BW) , respectively, when administered IV twice to the healthy baboon, 21 days apart.
  • Part 1 study is divided in two phases.
  • Phase A is aimed at determining pharmacokinetics and immunogenicity of the different sTNF-RI constructs in the healthy baboon in response to two injections.
  • Twelve baboons are subdivided into three groups. While anesthetized, each group receives 0.2 mg/kg BW of either the sTNFR-I 4D/C105db, sTNFR-I 3D/C105db, or sTNFR-I 2.6D/C105db.
  • Three baboons are studied each session. Animals are followed for 21 days and then receive a second identical IV injection of protein and are studied for an additional 21 days. Pharmacokinetics and immunogenicity are determined at intervals thereafter.
  • Phase B of the study is aimed at evaluating efficacy of these preparations in a well established model of TNF ⁇ -mediated lethality (Espat et al., J. Surg. Res . , 2:153-158, 1995).
  • Lethal E. coli bacteremia is induced in 16 animals in groups of four, by administration of 5-10 x 10 10 cfu/kg of live E. coli .
  • a placebo group is compared to baboons pretreated IV with either a sTNFR-I 4D/C105db (0.2 mg/kg bodyweight [BW] ) , sTNFR-I 3D/C105db (0.2 mg/kg BW) , or sTNFR-I 2.6D/C105db administered at 1 mg/kg BW.
  • a catheter is placed percutaneously into the femoral artery which permits repeated systemic arterial blood sampling as well as continuous monitoring of heart rate and mean arterial blood pressure via a Datascope 2000 anesthesia monitor (Datascope, San Antonio, TX) cardiac monitor.
  • Arterial blood samples are collected at intervals, anti-coagulated with EDTA or heparin, and cooled on ice immediately after drawing.
  • the plasma fraction is separated by centrifugation at 4°C, and stored at -70°C until assayed. Core temperature is monitored via a rectal probe.
  • An indwelling urinary Foley-type catheter is placed to allow urine collection and to monitor urine output and creatinine clearance. Hemodynamic parameters are monitored every fifteen minutes.
  • mice receive 0.9% sodium chloride (4 ml/kg) as maintenance i . v. fluid.
  • animals receive additional fluid (10 ml/kg every 15 min) , if two of the following physiologic criteria are met: 1) mean arterial pressure dropped by more than 30%; 2) heart rate increase by more than 30%, and 3) urine output drop to ⁇ 1 ml/kg/hr. After baseline blood sampling and a waiting period of at least an hour to allow equilibration infusion of proteins is started.
  • recombinant proteins are infused via the cephalic vein and animals are observed for a period of eight hours after which time all catheters are removed and the animals are returned to their cages for 21 days.
  • the animals are briefly anesthetized with IM ketamine (lOmg/kg) and venous blood samples obtained.
  • the animals are re-anesthetized, received a second injection of the protein, and the entire procedure conducted on day zero is repeated for an additional 21 days, at which time the animals are euthanized.
  • Venous blood samples are obtained at -1, 0, 0.5, 1, 1.5, 2, 2.5, 3, 4, 5, 6, 7, 8, 24 hr, 48 hr, and on days 3,5,8,11,16, and 21. At 21 days, surviving animals are euthanized.
  • the presence of Papio antibodies to the administered recombinant proteins are determined by sandwich ELISA. Very briefly, the sTNFR-1 constructs are coated onto ELISA plates (1 ⁇ g/ml) and diluted baboon (1:50 to 1:100,000) plasma (100 ⁇ L) are added. After the samples are washed, an horse radish peroxidase (HRP) conjugated protein A is added (0.5 ⁇ g/ml), and the assays are visualized with TMB.
  • HRP horse radish peroxidase
  • Plasma half-lives differed significantly among the three constructs. The disappearance curves are determined using a model-independent method and the apparent half-lives are generally evaluated between 8 and 172 hours. In naive animals, the plasma half-life is longest in baboons treated with the 4.0 domain construct (29 hrs) and declines sequentially in baboons treated with the sTNFR-I 3D/C105db (24.7 hrs) and sTNFR- I 2.6D/C105db (21.5 hrs). The difference, although statistically significant, is only 26%.
  • Antibody responses generally develop around the eighth day following administration of the constructs and are present through the 21 day study period. Furthermore, antibody responses tend to become stronger during the response to the second injection of the protein constructs.
  • the antibodies that are detected in the plasma of the baboons are evaluated in a selected number of animals for direct cytotoxicity in the ME-180 cell line and neutralizing capacity in an L-929 assay. No cytotoxicity nor neutralization is seen with antibodies generated to any of the three constructs.
  • animals that develop the strongest antibody responses also have the most rapid increase in the clearance of the constructs following their second administration.
  • antibody responses may reduce the biological half-life and thus, therapeutic efficacy of the constructs, and dose adjustments may be required.
  • therapeutic efforts to modify such constructs to reduce immunogenicity without significantly affecting half- life or efficacy, are aimed primarily at reducing the need for increasing dose adjustments, rather than the risk of adverse reactions.
  • TNF ⁇ bioactivity and provide excess neutralizing capacity.
  • the specific aim of the Part II study in baboons is to determine whether repeated exposure (i.e. 3 separate injections) of animals to various sTNF-RI constructs results in further immunogenicity and decreased half-lives. Additionally, this study is designed to compare the immunogenicity and pharmacokinetics of several sTNF-RI constructs, including the sTNFR-I 2.6D/C105db and sTNFR-I 4D/C105db, and the sTNFR-I 2.6D/N105-t-BuPEG(33kDa) and sTNFR-I 4D/N105-t-BuPEG(33kDa) . Finally, this study is designed to evaluate the clinical significance of the antibody response and alter clearance on the subsequent response to a TNF ⁇ -mediated injury challenge (E. coli bacteremia) .
  • TNF ⁇ -mediated injury challenge E. coli bacteremia
  • baboons are administered I.V. 0.2 mg/kg of the various constructs (sTNFR-I 4D/C105db, sTNFR-I 2.6D/C105db, sTNFR-I 2.6D/N105-t- BuPEG(33kDa) , or sTNFR-I 4D/N105 ⁇ t-BuPEG (33kDa) , respectively).
  • sTNFR-I 4D/C105db sTNFR-I 2.6D/C105db
  • sTNFR-I 2.6D/N105-t- BuPEG(33kDa) sTNFR-I 4D/N105 ⁇ t-BuPEG (33kDa)
  • baboons receive 2.0 mg/kg BW of their respective constructs.
  • baboons are challenged with a lethal dose of E. coli as outlined in Part I above.
  • the major findings Part II are as follows:
  • sTNFR-I 4D/N105-t-BuPEG (33kDa) and sTNFR-I 2.6D/N105-t-BuPEG(33kDa) have longer half-life's than TNFR-I 4D/C105db and sTNFR-I 2.6D/C105db in the naive baboon, irrespective of the number of domains, half-lives range from 30-35 hours for the monopegylated sTNFR-I forms in comparison to 10-20 hours for the dimeric pegylated forms.
  • sTNFR-I 4D/N105- t-BuPEG(33kDa) and TNFR-I 4D/C105db have longer half- lives than 2.6D/N105-t-BuPEG(33kDa) and sTNFR-I 2.6D/C105db in the naive animal.
  • sTNFR-I 4D/C105db and sTNFR-I 2.6D/C105db are also immunogenic, with a modest trend towards reduced immunogenicity with sTNFR-I 2.6D/C105db.
  • only TNFR-I 4D/C105db exhibits reduced clearance with repeated administrations.
  • sTNFR-I 4D/N105-t- BuPEG(33kDa) and 2.6D/N105-t-BuPEG (33kDa) are neither antigenic, nor do their clearance rates change significantly with repeated administration.
  • serum obtained from baboons administered the 2.6D/N105-t-BuPEG(33kDa) on day + 21 (Table 9) do not "react" to either the sTNFR-I 4D/C105db, sTNFR-I 4D/N105 when these compounds are used on the ELISA plate as the capture antigen.
  • a positive reaction is an antibody response of >1:400 titre. Data from day * 42 and + 61 are shown in Tables 10 and 11. Importantly, there is a positive reaction in vitro with serum obtained from 1 baboon previously treated with the 2.6D/N105-t-BuPEG (33kDa) when tested against the sTNFR-I 4D/C105db capture antigen (Table 11) .
  • the objective of this study is to assess the immunogenicity of the different sTNF-RI forms which are repeatedly injected by the I.V. route in chimpanzees over a 1 month period.
  • the sTNF-RI forms tested in this study are: the sTNFR-I 2.6D/C105db, sTNFR-I 4D/C105db, sTNFR-I 4D/C105-t-BuPEG(33kDa) , sTNFR-I 2.6D/N105-t- BuPEG(33kDa) , and sTNFR-I 4D/N105-t-BuPEG (33kDa) .
  • the dose regimen/parameters of this study are as follows: Each Chimpanzee receives the test article as an intravenous bolus injection at 0.1 mg/kg, twice weekly on Mondays and Fridays for 4 weeks (8 doses total) .
  • the dose volume is variable depending on the concentration of the supplied test article.
  • a 5 mL serum sample is obtained from each animal on Day 0 prior to treatment. Additional serum samples are obtained just prior to drug administration on days 7, 14, 21, and 28.
  • the chimpanzee immunogenicity raw data are shown in Table 12. TABLE 12: Antibody Results I g G
  • serum obtained from chimpanzees administered the sTNFR-I 2.6D/N105-t- BuPEG(33kDa) do not "react" to either the sTNFR-I 4D/C105db, sTNFR-I 4D/N105 when these compounds are used on the ELISA plate as the capture antigen (Table 13) .
  • EAE is an acute or chronic relapsing inflammatory demyelinating disease of the CNS resulting from sensitization of genetically susceptible animals with neuroantigens such as myelin basic protein (MBP) .
  • MBP myelin basic protein
  • EAE is an art-accepted and often used animal model for acute human MS .
  • PBS phosphate buffered saline
  • CFA complete Freunds adjuvant
  • Mycobacterium tuberculosis H37Ra (Difco Lab MI) . Control rats receive 0.1ml of the PBS/CFA emulsion with no MBP in the footpad of the left hind limb.
  • Evaluation of clinical disease is based on a conventional 0-5 scoring system.
  • the spectrum of rating is: 0, normal; 0.5, partial loss of tail tone; 1, complete loss of tail tone, 2, dragging of one hind limb; 3 paralysis of both hind limbs; 4, morbid; and 5, death.
  • All injections of sTNFR-I constructs or vehicle are administered at 1 mg/kg S.C. every other day starting on day 9 post immunization. All animals are terminated on day 21.
  • Results are expressed in two forms, clinical severity score as a function of time, and the integrated clinical score for each rat over the entire course of the disease is calculated as the area under the curve of daily clinical score versus time.
  • the values of the treated groups for integrated clinical scoring are compared statistically against those of the control group using the Mann-Whitney test.
  • sTNFR-I 4D/C106db attenuates the clinical symptoms by approximately 73%, when compared to vehicle treated animals.
  • the sTNFR-I 4D/C105-t- BuPEG(33kda) also attenuate the clinical symptoms by approximately 85%.
  • the sTNFR-I 4D/C105-t-BuPEG (33kda) and sTNFR-I 2.6DN105-t-BuPEG (33kDa) are equally potent in attenuating the clinical symptoms (64 and 57%, respectively) .
  • TCC AAA TGC CGA AAG GAA ATG GGT CAG GTG GAG ATC TCT TCT TGC ACA 240

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Diabetes (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Toxicology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Hematology (AREA)
  • Neurology (AREA)
  • Environmental Sciences (AREA)
  • Cell Biology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Cardiology (AREA)
  • Rheumatology (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Dermatology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Biodiversity & Conservation Biology (AREA)
  • Oncology (AREA)
  • Endocrinology (AREA)
PCT/US1997/012244 1996-07-09 1997-07-09 Truncated soluble tumor necrosis factor type-i and type-ii receptors Ceased WO1998001555A2 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
JP50536998A JP2002514048A (ja) 1996-07-09 1997-07-09 短縮型可溶性腫瘍壊死因子i型およびii型レセプター
NZ333647A NZ333647A (en) 1996-07-09 1997-07-09 Truncated soluble tumor necrosis factor type-I and type-II receptors
EP97932603A EP0914431B1 (en) 1996-07-09 1997-07-09 Truncated soluble tumor necrosis factor type-i receptors
AU36013/97A AU3601397A (en) 1996-07-09 1997-07-09 Truncated soluble tumor necrosis factor type-i and type-ii receptors
BR9710350A BR9710350A (pt) 1996-07-09 1997-07-09 Stnfr truncado proteina de liga-Æo de necrose de tumor e polivalente polinucleot¡deo sequ-ncia de cido nucl-ico polinucleot¡deo vetor c-lula hospedeira procardiotica composi-Æo farmac-utica processos para pratar uma doen-a mediada por tnf e para preparar uma composi-Æo farmac-utica uso da prote¡na de liga-Æo de fator de necrose de tumor e kit
EA199900095A EA003900B1 (ru) 1996-07-09 1997-07-09 Усеченные рецепторы фактора некроза опухолей, фармацевтические композиции на их основе и способы применения указанных факторов и композиций
IL12787497A IL127874A0 (en) 1996-07-09 1997-07-09 Truncated soluble tumor necrosis factor type-I and type-II receptors
SK15-99A SK1599A3 (en) 1996-07-09 1997-07-09 Truncated soluble tumor necrosis factor type-i and type-ii receptors
CA2259156A CA2259156C (en) 1996-07-09 1997-07-09 Truncated soluble tumor necrosis factor type-i and type-ii receptors
DE69737814T DE69737814T2 (de) 1996-07-09 1997-07-09 Gekürzte lösliche typ-i-rezeptoren für tumor-nekrose-faktor
ES97932603T ES2288304T3 (es) 1996-07-09 1997-07-09 Receptores tipo i del factor de necrosis tumoral truncados y solubles.
PL97331240A PL189309B1 (pl) 1996-07-09 1999-01-05 Obcięty rozpuszczalny receptor czynnika martwicy nowotworu (sTNFR), wielowartościowa proteina wiążąca czynnik martwicy nowotworu (TNFbp), polinukleotyd posiadający sekwencję kodującą sTNFR, wektor oraz komórka gospodarza zawierające taki polinukleotyd, sposób wytwarzania sTNFR, kompozycja farmaceutyczna, sposób jej wytwarzania oraz zastosowanie sTNFR do wytwarzania środka leczniczego
NO990086A NO990086L (no) 1996-07-09 1999-01-08 Avkortete, l°selige tumornekrosefaktorreseptorer av type I og type II
AU11121/01A AU774307B2 (en) 1996-07-09 2001-01-08 Truncated soluble tumor necrosis factor type-1 and type-11 receptors
US09/882,735 US6989147B2 (en) 1996-07-09 2001-06-15 Truncated soluble tumor necrosis factor type-I and type-II receptors
US11/126,126 US7732587B2 (en) 1996-07-09 2005-05-10 Nucleic acids encoding truncated soluble tumor necrosis factor

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US2144396P 1996-07-09 1996-07-09
US60/021,443 1996-07-09
US3253496P 1996-12-06 1996-12-06
US60/032,534 1996-12-06
US3773797P 1997-01-23 1997-01-23
US60/037,737 1997-01-23
US3931497P 1997-02-07 1997-02-07
US60/039,314 1997-02-07
US3979297P 1997-03-04 1997-03-04
US60/039,792 1997-03-04

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US09214613 A-371-Of-International 1997-07-09
US09/882,735 Continuation US6989147B2 (en) 1996-07-09 2001-06-15 Truncated soluble tumor necrosis factor type-I and type-II receptors

Publications (2)

Publication Number Publication Date
WO1998001555A2 true WO1998001555A2 (en) 1998-01-15
WO1998001555A3 WO1998001555A3 (en) 1998-05-22

Family

ID=27533913

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US1997/012244 Ceased WO1998001555A2 (en) 1996-07-09 1997-07-09 Truncated soluble tumor necrosis factor type-i and type-ii receptors

Country Status (22)

Country Link
US (2) US6989147B2 (https=)
EP (1) EP0914431B1 (https=)
JP (2) JP2002514048A (https=)
KR (1) KR20000023695A (https=)
AT (1) ATE364695T1 (https=)
AU (2) AU3601397A (https=)
BG (1) BG64910B1 (https=)
BR (1) BR9710350A (https=)
CA (1) CA2259156C (https=)
CZ (1) CZ296835B6 (https=)
DE (1) DE69737814T2 (https=)
EA (1) EA003900B1 (https=)
ES (1) ES2288304T3 (https=)
IL (1) IL127874A0 (https=)
NO (1) NO990086L (https=)
NZ (1) NZ333647A (https=)
PL (1) PL189309B1 (https=)
SK (1) SK1599A3 (https=)
TR (1) TR199700610A2 (https=)
TW (1) TW555765B (https=)
WO (1) WO1998001555A2 (https=)
YU (1) YU299A (https=)

Cited By (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001058953A2 (en) 2000-02-11 2001-08-16 The Government Of The United States Of America As Represented By The Secretary, Department Of Health And Human Services Identification of a domain in the tumor necrosis factor receptor family that mediates pre-ligand receptor assembly and function
WO2002046225A3 (en) * 2000-12-06 2004-01-08 Applied Research Systems Use of sarp-1 for the treatment and/or prevention of scleroderma
EP1203583A4 (en) * 1999-06-21 2004-03-03 Santen Pharmaceutical Co Ltd REMEDIES FOR RHUMATOID POLYARTHRITIS
WO2004098595A1 (en) * 2003-05-12 2004-11-18 Altana Pharma Ag COMPOSITION COMPRISING ROFLUMILAST AND A TNFα ANTAGONIST
US7005413B1 (en) * 1995-12-22 2006-02-28 Amgen Inc. Combination therapy for conditions leading to bone loss
US7087224B2 (en) 2000-10-31 2006-08-08 Amgen Inc. Method of treating anemia by administering IL-1ra
EP1718304A1 (en) * 2004-02-20 2006-11-08 Boehringer Ingelheim International GmbH Pharmaceutical compositions based on anticholinergics and pegsunercept
WO2007059136A2 (en) 2005-11-14 2007-05-24 Amgen Inc. Rankl antibody-pth/pthrp chimeric molecules
EP1717315A3 (en) * 1997-04-16 2007-06-20 Amgen Inc. Osteoprotegerin binding proteins and receptors
WO2008054603A2 (en) 2006-10-02 2008-05-08 Amgen Inc. Il-17 receptor a antigen binding proteins
EP2002846A2 (en) 1996-12-06 2008-12-17 Amgen Inc. Combination therapy using an IL-1 inhibitor for treating IL-1 mediated diseases
EP2087908A1 (en) 2001-06-26 2009-08-12 Amgen, Inc. Antibodies to opgl
EP2105449A2 (en) 2000-02-23 2009-09-30 Amgen Inc. Antagonistic selective binding agents of osteoprotegerin binding protein
WO2009009186A3 (en) * 2007-04-13 2010-01-21 The Regents Of The University Of California Receptors useful for gas phase chemical sensing
US7700722B2 (en) 2002-06-20 2010-04-20 Amgen Inc. Compositions of pegylated soluble tumor necrosis factor receptors and methods of preparing
US7807795B2 (en) 1997-04-16 2010-10-05 Amgen Inc. Antibodies to osteoprotegerin binding proteins
EP2314316A1 (en) 2002-04-05 2011-04-27 Amgen, Inc Human anti-OPGL neutralizing antibodies as selective OPGL pathway inhibitors
EP2336177A1 (en) 2004-08-04 2011-06-22 Amgen, Inc Antibodies to DKK-1
EP2589610A1 (en) 2007-08-21 2013-05-08 Amgen, Inc Human c-fms antigen binding proteins
EP2492281A4 (en) * 2009-10-19 2013-09-11 Hanall Biopharma Co Ltd MODIFIED HUMAN TUMOR NECROSIS FACTOR RECEPTOR 1-POLYPEPTIDE OR FRAGMENT THEREOF, AND METHOD OF PREPARING THEREOF
WO2015087187A1 (en) 2013-12-10 2015-06-18 Rinat Neuroscience Corp. Anti-sclerostin antibodies
US9464139B2 (en) 2013-08-30 2016-10-11 Amgen Inc. GITR antigen binding proteins and methods of use thereof
WO2017156058A1 (en) 2016-03-08 2017-09-14 Janssen Biotech, Inc. Gitr antibodies, methods, and uses
US10072085B2 (en) 2010-01-15 2018-09-11 Kirin-Amgen, Inc. Method of treating psoriasis using an IL-17 receptor antibody formulation
US10307483B2 (en) 2016-10-21 2019-06-04 Amgen Inc. Pharmaceutical formulations and methods of making the same
US11167030B2 (en) 2007-11-30 2021-11-09 Abbvie Biotechnology Ltd Protein formulations and methods of making same
US20220106371A1 (en) * 2020-06-28 2022-04-07 Xintrum Pharmaceuticals, Ltd. Modified recombinant human nerve growth factor and method for preparing the same
US11607451B2 (en) 2005-06-14 2023-03-21 Amgen Inc. Self-buffering antibody formulations

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6660843B1 (en) 1998-10-23 2003-12-09 Amgen Inc. Modified peptides as therapeutic agents
US20040220103A1 (en) * 1999-04-19 2004-11-04 Immunex Corporation Soluble tumor necrosis factor receptor treatment of medical disorders
UA101670C2 (ru) 2008-07-23 2013-04-25 Ханми Сайенс Ко., Лтд. Полипептидный комплекс, содержащий непептидильный полимер, который имеет три функциональных конца
KR101273893B1 (ko) 2010-09-13 2013-06-14 한올바이오파마주식회사 변형된 인간 종양 괴사 인자 수용체-1 폴리펩티드 또는 그의 절편 및 그의 제조방법
KR101185310B1 (ko) 2010-12-23 2012-09-21 한올바이오파마주식회사 변형된 인간 종양 괴사 인자 수용체-1 폴리펩티드 또는 그의 절편 및 그의 제조방법
AU2015380301B2 (en) * 2015-01-28 2020-04-23 Dnx Biotech, Llc Compositions and methods of using a soluble TNF-alpha receptor modified for increased half-life

Family Cites Families (112)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
IN150740B (https=) 1978-11-24 1982-12-04 Hoffmann La Roche
US4760067A (en) 1979-08-15 1988-07-26 Merck & Co., Inc. Allylsulfoxide enzyme inhibitors
DE3175151D1 (en) 1980-05-21 1986-09-25 Teijin Ltd Reactive polymer and process for the preparation thereof
US4560649A (en) 1981-10-15 1985-12-24 Cornell Research Foundation Assaying for hLH or hCG with immobilized hormone receptors
JPH0751511B2 (ja) 1982-03-15 1995-06-05 味の素株式会社 インターロイキン2を含有してなる癌治療剤
ATE37983T1 (de) 1982-04-22 1988-11-15 Ici Plc Mittel mit verzoegerter freigabe.
US4587046A (en) 1982-05-18 1986-05-06 The Regents Of The University Of California Drug-carrier conjugates
EP0098110B1 (en) 1982-06-24 1989-10-18 NIHON CHEMICAL RESEARCH KABUSHIKI KAISHA also known as JAPAN CHEMICAL RESEARCH CO., LTD Long-acting composition
US4966888A (en) 1985-07-08 1990-10-30 Cornell Research Foundation, Inc. hCG-hLH receptor and hCG-hLH receptor-hCG complex as antigens, antibodies thereto and contraceptive vaccine
US4522750A (en) 1984-02-21 1985-06-11 Eli Lilly And Company Cytotoxic compositions of transferrin coupled to vinca alkaloids
EP0154316B1 (en) 1984-03-06 1989-09-13 Takeda Chemical Industries, Ltd. Chemically modified lymphokine and production thereof
SE470099B (sv) 1984-05-17 1993-11-08 Jerker Porath Sulfonaktiverade tioeteradsorbenter för separation av t ex protein
US4578335A (en) 1984-05-21 1986-03-25 Immunex Corporation Interleukin 2 receptor
CA1283661C (en) 1984-06-20 1991-04-30 Franz Jansen Imidazolides, process for their preparation and application as intermediates for the synthesis of cytotoxic conjugates
US4675285A (en) 1984-09-19 1987-06-23 Genetics Institute, Inc. Method for identification and isolation of DNA encoding a desired protein
SE454885B (sv) 1984-10-19 1988-06-06 Exploaterings Ab Tbf Polymerbelagda partiklar med immobiliserade metalljoner pa sin yta jemte forfarande for framstellning derav
US4959314A (en) 1984-11-09 1990-09-25 Cetus Corporation Cysteine-depleted muteins of biologically active proteins
DE3675588D1 (de) 1985-06-19 1990-12-20 Ajinomoto Kk Haemoglobin, das an ein poly(alkenylenoxid) gebunden ist.
DE3676670D1 (de) 1985-06-26 1991-02-07 Cetus Corp Solubilisierung von proteinen fuer pharmazeutische zusammensetzungen mittels polymerkonjugierung.
US4766106A (en) 1985-06-26 1988-08-23 Cetus Corporation Solubilization of proteins for pharmaceutical compositions using polymer conjugation
US4917888A (en) 1985-06-26 1990-04-17 Cetus Corporation Solubilization of immunotoxins for pharmaceutical compositions using polymer conjugation
US4935233A (en) 1985-12-02 1990-06-19 G. D. Searle And Company Covalently linked polypeptide cell modulators
JPS62185029A (ja) 1986-02-07 1987-08-13 Ajinomoto Co Inc 修飾インタ−ロイキン−2
CA1283046C (en) 1986-05-29 1991-04-16 Nandini Katre Tumor necrosis factor formulation
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
IN165717B (https=) 1986-08-07 1989-12-23 Battelle Memorial Institute
US4931544A (en) 1986-09-04 1990-06-05 Cetus Corporation Succinylated interleukin-2 for pharmaceutical compositions
IL80005A (en) 1986-09-10 1992-11-15 Yeda Res & Dev Compositions for modulating the effect of tnf and il-1
US4965271A (en) 1986-12-31 1990-10-23 Hoechst Roussel Pharmaceuticals, Inc. Method of inhibiting the activity of leukocyte derived cytokines
US5359032A (en) 1987-08-26 1994-10-25 Biogen Inc. Interkeukin-1 inhibitor
IL90339A (en) 1989-05-18 1996-10-16 Yeda Res & Dev Anti-cytotoxic protein and its purification
IL83878A (en) * 1987-09-13 1995-07-31 Yeda Res & Dev Soluble protein corresponding to tnf inhibitory protein its preparation and pharmaceutical compositions containing it
US5512544A (en) 1987-09-13 1996-04-30 Yeda Research And Development Co. Ltd. Pharmaceutical compositions comprising an anticytokine
IL98078A0 (en) * 1991-05-07 1992-06-21 Yeda Res & Dev Pharmaceutical compositions comprising an anticytokyne
US4904584A (en) 1987-12-23 1990-02-27 Genetics Institute, Inc. Site-specific homogeneous modification of polypeptides
US5153265A (en) 1988-01-20 1992-10-06 Cetus Corporation Conjugation of polymer to colony stimulating factor-1
US4847325A (en) 1988-01-20 1989-07-11 Cetus Corporation Conjugation of polymer to colony stimulating factor-1
GB8806339D0 (en) 1988-03-17 1988-04-13 Hoffmann La Roche Monoclonal antibodies
GB8807803D0 (en) 1988-03-31 1988-05-05 Glaxo Group Ltd Biochemical product
US5256642A (en) 1988-04-01 1993-10-26 The Johns Hopkins University Compositions of soluble complement receptor 1 (CR1) and a thrombolytic agent, and the methods of use thereof
IL89790A (en) 1988-04-01 2002-05-23 Johns Hopking University Nucleic acid sequences that encode and cells that produce cr1 protein and methods of production and purification
US5214131A (en) 1988-05-06 1993-05-25 Sumitomo Pharmaceuticals Company, Limited Polyethylene glycol derivatives, modified peptides and production thereof
US5075222A (en) 1988-05-27 1991-12-24 Synergen, Inc. Interleukin-1 inhibitors
KR0148009B1 (ko) 1988-05-27 1998-08-01 그래고리 비. 아보트 인터루킨-1 억제제
JPH0240399A (ja) 1988-07-27 1990-02-09 Takeda Chem Ind Ltd 線維芽細胞増殖因子ムテインの複合体あるいは組成物
US5359037A (en) 1988-09-12 1994-10-25 Yeda Research And Development Co. Ltd. Antibodies to TNF binding protein I
IL94039A (en) 1989-08-06 2006-09-05 Yeda Res & Dev Antibodies to tbp - 1 and their use
US5811261A (en) 1988-09-12 1998-09-22 Yeda Research And Development Co. Ltd. Expression of the recombinant tumor necrosis factor binding protein I (TBP-I)
IL95064A0 (en) * 1990-07-12 1991-06-10 Yeda Res & Dev Molecular cloning of tnf binding protein
GB8824592D0 (en) 1988-10-20 1988-11-23 Royal Free Hosp School Med Purification process
GB8824869D0 (en) 1988-10-24 1988-11-30 Stevenson G T Synthetic antibody
US5681566A (en) 1988-10-24 1997-10-28 3I Research Exploitation Limited Antibody conjugates with two or more covalently linked FC regions
US5162430A (en) 1988-11-21 1992-11-10 Collagen Corporation Collagen-polymer conjugates
JPH04502011A (ja) 1988-11-23 1992-04-09 ジェネンテク,インコーポレイテッド ポリペプチド誘導体
AU645745B2 (en) 1988-12-22 1994-01-27 Xoma Corporation Hindered linking agents and methods
US5089261A (en) 1989-01-23 1992-02-18 Cetus Corporation Preparation of a polymer/interleukin-2 conjugate
US4902502A (en) 1989-01-23 1990-02-20 Cetus Corporation Preparation of a polymer/interleukin-2 conjugate
US5116964A (en) 1989-02-23 1992-05-26 Genentech, Inc. Hybrid immunoglobulins
US5198359A (en) 1989-03-07 1993-03-30 Boehringer Ingelheim International Gmbh Recombinant protein receptor for il-2
EP0386289A1 (en) 1989-03-07 1990-09-12 Taniguchi, Tadatsugu, Dr. Recombinant interleukin-2 receptor
US5122614A (en) 1989-04-19 1992-06-16 Enzon, Inc. Active carbonates of polyalkylene oxides for modification of polypeptides
JPH03164179A (ja) * 1989-04-21 1991-07-16 Boehringer Ingelheim Internatl Gmbh Tnfレセプター、tnf結合たん白質およびこれらをコードするdna
ATE289350T1 (de) * 1989-04-21 2005-03-15 Amgen Inc Tnf-rezeptor, tnf bindende proteine und dafür kodierende dnas
US5166322A (en) 1989-04-21 1992-11-24 Genetics Institute Cysteine added variants of interleukin-3 and chemical modifications thereof
US7264944B1 (en) * 1989-04-21 2007-09-04 Amgen Inc. TNF receptors, TNF binding proteins and DNAs coding for them
DE3922089A1 (de) 1989-05-09 1990-12-13 Basf Ag Neue proteine und ihre herstellung
ES2072330T5 (es) * 1989-05-18 2013-06-24 Yeda Research And Development Co., Ltd. Proteínas de unión II al Factor de Necrosis Tumoral, su purificación y anticuerpos frente a los mismos
IL95031A (en) * 1989-07-18 2007-03-08 Amgen Inc Method for the production of a human recombinant tumor necrosis factor inhibitor
US6143866A (en) * 1989-07-18 2000-11-07 Amgen, Inc. Tumor necrosis factor (TNF) inhibitor and method for obtaining the same
US5605690A (en) 1989-09-05 1997-02-25 Immunex Corporation Methods of lowering active TNF-α levels in mammals using tumor necrosis factor receptor
US5395760A (en) 1989-09-05 1995-03-07 Immunex Corporation DNA encoding tumor necrosis factor-α and -β receptors
NZ235148A (en) 1989-09-05 1991-12-23 Immunex Corp Tumour necrosis factor receptor protein and dna sequences
AU630497B2 (en) 1989-09-05 1992-10-29 Immunex Corporation Tumor necrosis factor-alpha and -beta receptors
ATE194384T1 (de) 1989-09-12 2000-07-15 Hoffmann La Roche Tnf-bindende proteine
US5350836A (en) * 1989-10-12 1994-09-27 Ohio University Growth hormone antagonists
US5234903A (en) 1989-11-22 1993-08-10 Enzon, Inc. Chemically modified hemoglobin as an effective, stable non-immunogenic red blood cell substitute
BR9007883A (pt) 1989-11-29 1992-09-29 Synergen Inc Producao de inibidor de interleucina-1 humana recombinante
CA2032191C (en) * 1989-12-13 1999-05-18 David Wallach Expression of the recombinant tumor necrosis factor binding protein i (tbp-i)
US5136021A (en) 1990-02-27 1992-08-04 Health Research, Inc. TNF-inhibitory protein and a method of production
US5171264A (en) 1990-02-28 1992-12-15 Massachusetts Institute Of Technology Immobilized polyethylene oxide star molecules for bioapplications
US6552170B1 (en) 1990-04-06 2003-04-22 Amgen Inc. PEGylation reagents and compounds formed therewith
US6458360B1 (en) 1990-04-25 2002-10-01 The Johns Hopkins University Soluble complement regulatory molecules
GB2246569A (en) 1990-06-15 1992-02-05 Charing Cross Sunley Research Tumour necrosis factor - alpha binding protein
WO1992001002A1 (en) 1990-07-11 1992-01-23 Teijin Limited Tumor necrosis factor activity inhibitor and production thereof
GB9015908D0 (en) 1990-07-19 1990-09-05 Celltech Ltd Multivalent immunoglobulin
CA2087163A1 (en) 1990-07-20 1992-01-21 Hubert Agback Heterobifunctional reagents and conjugates with oxaalkylene units for amphiphilic bridge structures
DE69120821T2 (de) 1990-08-31 1997-01-23 The Regents Of The University Of Minnesota, Minneapolis, Minn. Polyethylenglykol-Derivate für Festphasenanwendungen
GB9022648D0 (en) * 1990-10-18 1990-11-28 Charing Cross Sunley Research Polypeptide and its use
US5252714A (en) 1990-11-28 1993-10-12 The University Of Alabama In Huntsville Preparation and use of polyethylene glycol propionaldehyde
ATE190629T1 (de) 1991-01-18 2000-04-15 Amgen Inc Methoden zur behandlung von durch den tumor nekrose faktor ausgelösten krankheiten
ATE241011T1 (de) 1991-02-27 2003-06-15 Micromet Ag Serin-reiche peptidlinker
DK0575545T3 (da) * 1991-03-15 2003-09-15 Amgen Inc Pegylering af polypeptider
WO1992016555A1 (en) 1991-03-18 1992-10-01 Enzon, Inc. Hydrazine containing conjugates of polypeptides and glycopolypeptides with polymers
EP0594772B1 (en) 1991-07-04 1996-08-28 Immunodex K/S Water-soluble, polymer-based reagents and conjugates comprising moieties derived from divinyl sulfone
IL99120A0 (en) * 1991-08-07 1992-07-15 Yeda Res & Dev Multimers of the soluble forms of tnf receptors,their preparation and pharmaceutical compositions containing them
US5569779A (en) 1991-12-23 1996-10-29 Albemarle Corporation Polyfunctional michael addition products
US5447851B1 (en) * 1992-04-02 1999-07-06 Univ Texas System Board Of Dna encoding a chimeric polypeptide comprising the extracellular domain of tnf receptor fused to igg vectors and host cells
AU677789B2 (en) 1992-07-02 1997-05-08 Collagen Corporation Biocompatible polymer conjugates
US5382657A (en) 1992-08-26 1995-01-17 Hoffmann-La Roche Inc. Peg-interferon conjugates
DE4230297C1 (de) 1992-09-10 1994-03-17 Kernforschungsz Karlsruhe Verwendung eines Gießharzes und Verfahren zu dessen Herstellung
KR100232688B1 (ko) 1992-09-15 1999-12-01 스코트 쥐. 홀퀴스트 종양 괴사 인자 길항제를 함유하는 tnf-의존성 염증 치료용 제약 조성물
US6270766B1 (en) 1992-10-08 2001-08-07 The Kennedy Institute Of Rheumatology Anti-TNF antibodies and methotrexate in the treatment of arthritis and crohn's disease
EP0622394A1 (en) 1993-04-30 1994-11-02 S.A. Laboratoires S.M.B. Reversible modification of sulfur-containing molecules with polyalkylene glycol derivatives and their use
ES2153384T3 (es) 1993-07-30 2001-03-01 Kennedy Inst Of Rheumatology Metodo para tratar la esclerosis multiple.
GB9317618D0 (en) 1993-08-24 1993-10-06 Royal Free Hosp School Med Polymer modifications
US5446090A (en) 1993-11-12 1995-08-29 Shearwater Polymers, Inc. Isolatable, water soluble, and hydrolytically stable active sulfones of poly(ethylene glycol) and related polymers for modification of surfaces and molecules
JPH09508140A (ja) * 1994-07-22 1997-08-19 エフ・ホフマン−ラ ロシュ アーゲー キメラtnf結合タンパク質を含有する医薬組成物
DE4441446A1 (de) * 1994-11-22 1996-05-23 Ulrich Theis Verfahren zur Übergabe von Wäschestücken und vorzugsweise zur Durchführung des Verfahrens dienende Muldenmangel
TW313568B (https=) 1994-12-20 1997-08-21 Hoffmann La Roche
US7429646B1 (en) * 1995-06-05 2008-09-30 Human Genome Sciences, Inc. Antibodies to human tumor necrosis factor receptor-like 2
US5747639A (en) 1996-03-06 1998-05-05 Amgen Boulder Inc. Use of hydrophobic interaction chromatography to purify polyethylene glycols

Cited By (63)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7005413B1 (en) * 1995-12-22 2006-02-28 Amgen Inc. Combination therapy for conditions leading to bone loss
EP2002846A2 (en) 1996-12-06 2008-12-17 Amgen Inc. Combination therapy using an IL-1 inhibitor for treating IL-1 mediated diseases
EP1717315A3 (en) * 1997-04-16 2007-06-20 Amgen Inc. Osteoprotegerin binding proteins and receptors
US7807795B2 (en) 1997-04-16 2010-10-05 Amgen Inc. Antibodies to osteoprotegerin binding proteins
US7923008B2 (en) 1997-04-16 2011-04-12 Amgen Inc. Methods for decreasing osteoclast formation or bone resorption using an antibody to osteoprotegerin binding protein
EP1203583A4 (en) * 1999-06-21 2004-03-03 Santen Pharmaceutical Co Ltd REMEDIES FOR RHUMATOID POLYARTHRITIS
AU2006203490B9 (en) * 2000-02-11 2011-01-20 The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, National Institutes Of Health Identification of a domain in the tumor necrosis factor receptor family that mediates pre-ligand receptor assembly and function
WO2001058953A2 (en) 2000-02-11 2001-08-16 The Government Of The United States Of America As Represented By The Secretary, Department Of Health And Human Services Identification of a domain in the tumor necrosis factor receptor family that mediates pre-ligand receptor assembly and function
US7148061B2 (en) 2000-02-11 2006-12-12 The United States Of America As Represented By The Department Of Health And Human Services Identification of a novel domain in the tumor necrosis factor receptor family that mediates pre-ligand receptor assembly and function
US9051392B2 (en) 2000-02-11 2015-06-09 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Inhibitors of pre-ligand assembly doman and function of the tumor necrosis factor receptor family
WO2001058953A3 (en) * 2000-02-11 2002-02-21 Us Health Identification of a domain in the tumor necrosis factor receptor family that mediates pre-ligand receptor assembly and function
AU2006203490B2 (en) * 2000-02-11 2010-07-01 The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, National Institutes Of Health Identification of a domain in the tumor necrosis factor receptor family that mediates pre-ligand receptor assembly and function
EP2305715A2 (en) 2000-02-23 2011-04-06 Amgen, Inc Monoclonal antibody to osteoprotegerin binding protein
EP3184545A1 (en) 2000-02-23 2017-06-28 Amgen, Inc Antagonistic selective binding agents of osteoprotegerin binding protein
EP3613775A1 (en) 2000-02-23 2020-02-26 Amgen Inc. Antagonistic selective binding agents of osteoprotegerin binding protein
EP2105449A2 (en) 2000-02-23 2009-09-30 Amgen Inc. Antagonistic selective binding agents of osteoprotegerin binding protein
EP2330197A2 (en) 2000-02-23 2011-06-08 Amgen, Inc Antagonistic selective binding agents of osteoprotegerin binding protein
JP2017031196A (ja) * 2000-10-31 2017-02-09 アムジエン・インコーポレーテツド 組換えエリスロポエチンと部分的に組合されたil−1インヒビターおよびtnfアンタゴニストの貧血治療用途
US7087224B2 (en) 2000-10-31 2006-08-08 Amgen Inc. Method of treating anemia by administering IL-1ra
JP2008231106A (ja) * 2000-10-31 2008-10-02 Amgen 組換えエリスロポエチンと部分的に組合されたil−1インヒビターおよびtnfアンタゴニストの貧血治療用途
US7867481B2 (en) 2000-10-31 2011-01-11 Amgen Inc. Method of treating anemia by administering IL-1ra
EP1806144A3 (en) * 2000-12-06 2008-04-23 Laboratoires Serono SA Use of SARP-1 for the treatment and/or prevention of scleroderma
AU2002226366B2 (en) * 2000-12-06 2007-03-22 Laboratoires Serono Sa Use of SARP-1 for the treatment and/or prevention of scleroderma
US7655628B2 (en) 2000-12-06 2010-02-02 Merck Serono Sa Method for treating liver cirrhosis or interstitial pulmonary fibrosis
WO2002046225A3 (en) * 2000-12-06 2004-01-08 Applied Research Systems Use of sarp-1 for the treatment and/or prevention of scleroderma
US7341995B2 (en) 2000-12-06 2008-03-11 Laboratoires Serono Sa Use of SARP-1 for the treatment and/or prevention of scleroderma
CN1323716C (zh) * 2000-12-06 2007-07-04 应用研究系统Ars股份公司 Sarp-1在治疗和/或预防硬皮病中的应用
EP2087908A1 (en) 2001-06-26 2009-08-12 Amgen, Inc. Antibodies to opgl
EP3492100A1 (en) 2001-06-26 2019-06-05 Amgen Inc. Antibodies to opgl
EP2314316A1 (en) 2002-04-05 2011-04-27 Amgen, Inc Human anti-OPGL neutralizing antibodies as selective OPGL pathway inhibitors
EP1578355A4 (en) * 2002-06-20 2011-04-06 Amgen Inc IMPROVED COMPOSITIONS OF PEGYLATED SOLUBLE TUMOR NUCLEAR FACTOR RECEPTORS AND MANUFACTURING METHOD
US7700722B2 (en) 2002-06-20 2010-04-20 Amgen Inc. Compositions of pegylated soluble tumor necrosis factor receptors and methods of preparing
WO2004098595A1 (en) * 2003-05-12 2004-11-18 Altana Pharma Ag COMPOSITION COMPRISING ROFLUMILAST AND A TNFα ANTAGONIST
EP1718304A1 (en) * 2004-02-20 2006-11-08 Boehringer Ingelheim International GmbH Pharmaceutical compositions based on anticholinergics and pegsunercept
EP2336177A1 (en) 2004-08-04 2011-06-22 Amgen, Inc Antibodies to DKK-1
US11607451B2 (en) 2005-06-14 2023-03-21 Amgen Inc. Self-buffering antibody formulations
WO2007059136A2 (en) 2005-11-14 2007-05-24 Amgen Inc. Rankl antibody-pth/pthrp chimeric molecules
EP2816060A1 (en) 2005-11-14 2014-12-24 Amgen Inc. Rankl antibody-PTH/PTHRP chimeric molecules
EP2366715A2 (en) 2005-11-14 2011-09-21 Amgen Inc. Rankl Antibody-PTH/PTHRP Chimeric Molecules
US11858999B2 (en) 2006-10-02 2024-01-02 Amgen K-A, Inc. IL-17 receptor A antigen binding proteins
US10208122B2 (en) 2006-10-02 2019-02-19 Amgen K-A, Inc. IL-17 receptor A antigen binding proteins
WO2008054603A2 (en) 2006-10-02 2008-05-08 Amgen Inc. Il-17 receptor a antigen binding proteins
US11180564B2 (en) 2006-10-02 2021-11-23 Amgen K-A, Inc. IL-17 Receptor A antigen binding proteins
US8957013B2 (en) 2007-04-13 2015-02-17 The Regents Of The University Of California Receptors useful for gas phase chemical sensing
WO2009009186A3 (en) * 2007-04-13 2010-01-21 The Regents Of The University Of California Receptors useful for gas phase chemical sensing
EP2592093A1 (en) 2007-08-21 2013-05-15 Amgen, Inc Human c-fms antigen binding proteins
EP3330292A1 (en) 2007-08-21 2018-06-06 Amgen, Inc Human c-fms antigen binding proteins
EP2589610A1 (en) 2007-08-21 2013-05-08 Amgen, Inc Human c-fms antigen binding proteins
US11191834B2 (en) 2007-11-30 2021-12-07 Abbvie Biotechnology Ltd Protein formulations and methods of making same
US11167030B2 (en) 2007-11-30 2021-11-09 Abbvie Biotechnology Ltd Protein formulations and methods of making same
EP2492281A4 (en) * 2009-10-19 2013-09-11 Hanall Biopharma Co Ltd MODIFIED HUMAN TUMOR NECROSIS FACTOR RECEPTOR 1-POLYPEPTIDE OR FRAGMENT THEREOF, AND METHOD OF PREPARING THEREOF
US11505612B2 (en) 2010-01-15 2022-11-22 Amgen K-A, Inc. Method of treating diseases using an IL-17 receptor antibody formulation
US10072085B2 (en) 2010-01-15 2018-09-11 Kirin-Amgen, Inc. Method of treating psoriasis using an IL-17 receptor antibody formulation
US10808033B2 (en) 2010-01-15 2020-10-20 Amgen K-A, Inc. IL-17 receptor antibody formulation
EP3427751A1 (en) 2013-08-30 2019-01-16 Amgen, Inc Gitr antigen binding proteins
US9464139B2 (en) 2013-08-30 2016-10-11 Amgen Inc. GITR antigen binding proteins and methods of use thereof
WO2015087187A1 (en) 2013-12-10 2015-06-18 Rinat Neuroscience Corp. Anti-sclerostin antibodies
WO2017156058A1 (en) 2016-03-08 2017-09-14 Janssen Biotech, Inc. Gitr antibodies, methods, and uses
US10730950B2 (en) 2016-03-08 2020-08-04 Janssen Biotech, Inc. GITR antibodies, methods, and uses
US11491223B2 (en) 2016-10-21 2022-11-08 Amgen Inc. Pharmaceutical formulations and methods of making the same
US10307483B2 (en) 2016-10-21 2019-06-04 Amgen Inc. Pharmaceutical formulations and methods of making the same
US12214013B2 (en) 2016-10-21 2025-02-04 Amgen Inc. Methods of treatment of arthritis and/or psoriasis with pharmaceutical formulations of etanercept
US20220106371A1 (en) * 2020-06-28 2022-04-07 Xintrum Pharmaceuticals, Ltd. Modified recombinant human nerve growth factor and method for preparing the same

Also Published As

Publication number Publication date
AU3601397A (en) 1998-02-02
EA003900B1 (ru) 2003-10-30
ATE364695T1 (de) 2007-07-15
EP0914431B1 (en) 2007-06-13
US20030054439A1 (en) 2003-03-20
WO1998001555A3 (en) 1998-05-22
CZ499A3 (cs) 2000-01-12
US6989147B2 (en) 2006-01-24
AU1112101A (en) 2001-04-05
EP0914431A2 (en) 1999-05-12
YU299A (en) 1999-11-22
BG64910B1 (bg) 2006-08-31
US20050250696A1 (en) 2005-11-10
JP2009280612A (ja) 2009-12-03
CA2259156A1 (en) 1998-01-15
US7732587B2 (en) 2010-06-08
PL189309B1 (pl) 2005-07-29
EA199900095A1 (ru) 2000-02-28
DE69737814T2 (de) 2008-03-06
BR9710350A (pt) 1999-08-17
DE69737814D1 (de) 2007-07-26
AU774307B2 (en) 2004-06-24
KR20000023695A (ko) 2000-04-25
CZ296835B6 (cs) 2006-06-14
ES2288304T3 (es) 2008-01-01
JP2002514048A (ja) 2002-05-14
NZ333647A (en) 2000-09-29
CA2259156C (en) 2010-09-07
NO990086L (no) 1999-03-09
PL331240A1 (en) 1999-07-05
TR199700610A3 (tr) 1998-01-21
SK1599A3 (en) 2001-02-12
NO990086D0 (no) 1999-01-08
TW555765B (en) 2003-10-01
TR199700610A2 (xx) 1998-01-21
IL127874A0 (en) 1999-10-28
BG103091A (en) 2000-05-31

Similar Documents

Publication Publication Date Title
EP0914431B1 (en) Truncated soluble tumor necrosis factor type-i receptors
US6306820B1 (en) Combination therapy using a TNF binding protein for treating TNF-mediated diseases
US6294170B1 (en) Composition and method for treating inflammatory diseases
AU736876B2 (en) Combination therapy using an IL-1 inhibitor for treating IL-1 mediated diseases
US6096728A (en) Composition and method for treating inflammatory diseases
AU724960B2 (en) Composition comprising interleukin-1 inhibitor and controlled release polymer
AU5187600A (en) Composition comprising interleukin-1 inhibitor and controlled release polymer
AU771793B2 (en) Combination therapy using a TNF binding protein for treating TNF-mediated diseases
EP1352656A2 (en) Combination therapy using a TNF binding protein for treating TNF-mediated diseases
MXPA99005224A (en) Combination therapy using a tnf binding protein for treating tnf-mediated diseases
AU5400701A (en) Combination therapy using an il-1 inhibitor for treating il-1 mediated diseases

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 97197728.3

Country of ref document: CN

AK Designated states

Kind code of ref document: A2

Designated state(s): AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GE GH HU IL IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU AM AZ BY KG KZ MD RU TJ TM

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH KE LS MW SD SZ UG ZW AT BE CH DE DK ES FI FR GB GR IE IT LU MC NL PT

DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: PV1999-4

Country of ref document: CZ

ENP Entry into the national phase

Ref document number: 2259156

Country of ref document: CA

Ref document number: 2259156

Country of ref document: CA

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 333647

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: PA/a/1999/000364

Country of ref document: MX

Ref document number: 1599

Country of ref document: SK

WWE Wipo information: entry into national phase

Ref document number: 1997932603

Country of ref document: EP

Ref document number: 09214613

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 1019997000152

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 199900095

Country of ref document: EA

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

WWP Wipo information: published in national office

Ref document number: 1997932603

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: PV1999-4

Country of ref document: CZ

WWP Wipo information: published in national office

Ref document number: 1019997000152

Country of ref document: KR

WWR Wipo information: refused in national office

Ref document number: 1019997000152

Country of ref document: KR

WWG Wipo information: grant in national office

Ref document number: PV1999-4

Country of ref document: CZ

WWG Wipo information: grant in national office

Ref document number: 1997932603

Country of ref document: EP