WO1997033996A2 - Human bikunin - Google Patents

Human bikunin Download PDF

Info

Publication number
WO1997033996A2
WO1997033996A2 PCT/US1997/003894 US9703894W WO9733996A2 WO 1997033996 A2 WO1997033996 A2 WO 1997033996A2 US 9703894 W US9703894 W US 9703894W WO 9733996 A2 WO9733996 A2 WO 9733996A2
Authority
WO
WIPO (PCT)
Prior art keywords
protein
placental bikunin
bikunin
sequence
human
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US1997/003894
Other languages
English (en)
French (fr)
Other versions
WO1997033996A9 (en
WO1997033996A3 (en
Inventor
Paul P. Tamburini
Gary Davis
Katherine A. Delaria
Christopher W. Marlor
Daniel K. Muller
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bayer AG
Bayer Corp
Original Assignee
Bayer AG
Bayer Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to BR9708021A priority Critical patent/BR9708021A/pt
Priority to HU9902698A priority patent/HU226419B1/hu
Priority to HK00105468.2A priority patent/HK1026232B/xx
Priority to PL97328822A priority patent/PL188387B1/pl
Priority to IL126115A priority patent/IL126115A/en
Priority to JP53280497A priority patent/JP3469584B2/ja
Priority to SI9730747T priority patent/SI0891426T1/sl
Priority to NZ331540A priority patent/NZ331540A/en
Priority to EP97915029A priority patent/EP0891426B1/en
Priority to DE69735996T priority patent/DE69735996T2/de
Application filed by Bayer AG, Bayer Corp filed Critical Bayer AG
Priority to AU22077/97A priority patent/AU716923B2/en
Publication of WO1997033996A2 publication Critical patent/WO1997033996A2/en
Publication of WO1997033996A3 publication Critical patent/WO1997033996A3/en
Publication of WO1997033996A9 publication Critical patent/WO1997033996A9/en
Priority to US09/144,428 priority patent/US6583108B1/en
Anticipated expiration legal-status Critical
Priority to US09/974,026 priority patent/US7019123B2/en
Priority to US11/390,775 priority patent/US7452859B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/81Protease inhibitors
    • C07K14/8107Endopeptidase (E.C. 3.4.21-99) inhibitors
    • C07K14/811Serine protease (E.C. 3.4.21) inhibitors
    • C07K14/8114Kunitz type inhibitors
    • C07K14/8117Bovine/basic pancreatic trypsin inhibitor (BPTI, aprotinin)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/55Protease inhibitors
    • A61K38/57Protease inhibitors from animals; from humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/02Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/81Protease inhibitors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/81Protease inhibitors
    • C07K14/8107Endopeptidase (E.C. 3.4.21-99) inhibitors
    • C07K14/811Serine protease (E.C. 3.4.21) inhibitors
    • C07K14/8114Kunitz type inhibitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • compositions of the invention relate to the field of proteins which inhibit serine protease activity.
  • the invention also relates to the field of nucleic acid constructs, vectors and host cells for producing serine protease inhibiting proteins, pharmaceutical compositions containing the protein, and methods for their use.
  • Blood loss is a serious complication of major surgeries such as open heart surgery and other complicated procedures. Cardiac surgery patients account for a significant proportion of transfused donor blood. Blood transfusion carries risks of disease transmission and adverse reactions. In addition, donor blood is expensive and demands often exceed supply. Pharmacological methods for reducing blood loss and the resultant need for transfusion have been described (reviewed by Scott et al., Ann. Thorac. Surg. 50: 843-851, 1990).
  • Aprotinin a bovine serine protease inhibitor of the Kunitz family is the active substance in the medicament Trasylol®.
  • Aprotinin (Trasylol®) has been reported as being effective in reducing perioperative blood loss (Royston et al., Lancet ⁇ : 1289-1291, 1987; Dietrich et al., Thorac. Cardiovasc. Surg. 37: 92-98, 1989; Fraedrich et al., Thorac. Cardiovasc. Surg.37: 89-91, 1989); W. van
  • Aprotinin is known to inhibit several serine proteases including trypsin, chymotrypsin, plasmin and kallikrein, and is used therapeutically in the treatment of acute pancreatitis, various states of shock syndrome, hyperfibrinolytic hemorrhage and myocardial infarction (Trapnell et al., (1974) Brit J. Surg. 61: 177; J. McMichan et al., (1982) Circulatory Shock 9: 107; Auer et al., (1979)Acta Neurochir. 49: 207; Sher (1977) Am J. Obstet. Gynecol. 129: 164; Schneider (1976) , Artzneim.-Firsch.
  • Trasylol® reduces blood loss in vivo through inhibition of kallikrein and plasmin. It has been found that aprotinin (3-58, Argl5, Alal7, Ser42) exhibits improved plasma kallikrein inhibitory potency as compared to native aprotinin itself (WO 89/10374).
  • aprotinin is of bovine origin, there is a finite risk of inducing anaphylaxis in human patients upon re-exposure to the drug.
  • a human functional equivalent to aprotinin by virtue of a lower risk of anaphylaxis, would be most useful and desirable to have.
  • an object of the present invention is to identify human proteins with functional activity similar to aprotinin. It was also an object of the instant invention to identify human proteins, that would be less charged, yet exhibit the same, highly similar, or improved protease specificities as found for aprotinin, especially with respect to the potency of plasmin and kallikrein inhibition. Such inhibitors could then be used repeatedly as medicaments in human patients with reduced risk of adverse immune response and reduced nepruOtoxi ⁇ ty.
  • the instant invention provides for a purified human serine protease inhibitor which can specifically inhibit kallikrein, that has been isolated from human placental tissue via affinity chromatography.
  • the instant invention provides a newly identified human protein herein called human placental bikunin that contains two serine protease inhibitor domains of the Kunitz class.
  • the instant invention embodies a protein having the amino acid sequence: ADRERSIHDF CLVSKWGRC RASMPRWWYN VTDGSCQLFV YGGCDGNSNN 50
  • ACMLRCFRQQ ENPPLPLGSK VWLAGAVS 179 (SEQIDNO: 1)
  • ADRERSIHDF CLVSKWGRC RASMPRWWYN VTDGSCQLFV YGGCDGNSNN 50 YLTKEECLKK CATVTENATG DLATSRNAAD SSVPSAPRRQ DSEDHSSDMF 100 NYEEYCTANA VTGPCRASFP RWYFDVERNS CNNFIYGGCR GNKNSYRSEE 150 ACMLRCFRQQ ENPPLPLGSK 170
  • the biological activity of the protein of the instant invention is that it can bind to and substantially inhibit the biological activity of trypsin, human plasma and tissue kallikreins, human plasmin and Factor Xlla.
  • the present invention provides for a native human placental bikunin protein, in glycosylated form.
  • the instant invention encompasses native human bikunin protein which has been formed such that it contains at least one cysteine-cysteine disulfide bond.
  • the protein contains at least one intra-chain cysteine- cysteine disulfide bond formed between a pair of cysteines selected from the group consisting of CYS11-CYS61, CYS20-CYS44, CYS36-CYS57, CYS106- CYS156, CYS115-CYS139, and CYS131-CYS152, wherein the cysteines are numbered according to the amino acid sequence of native human placental bikunin.
  • the protein of the instant invention may fold into the proper three-dimensional conformation, such that the biological activity of native human bikunin is maintained, where none, one or more, or all of the native intra-chain cysteine-cysteine disulfide bonds are present.
  • the protein of the instant invention is properly folded and is formed with all of the proper native cysteine-cysteine disulfide bonds.
  • Active protein of the instant invention can be obtained by purification from human tissue, such as placenta, or via synthetic protein chemistry techniques, as illustrated by the Examples below. It is also understood that the protein of the instant invention may be obtained using molecular biology techniques, where self-replicating vectors are capable of expressing the protein of the instant invention from transformed cells.
  • Such protein can be made as non-secreted, or secreted forms from transformed cells.
  • certain signal peptide sequences may be added to the NH2-terminal portion of the native human bikunin protein.
  • the instant invention thus provides for the native human bikunin protein with at least a portion of the native signal peptide sequence intact.
  • the invention provides for native human bikunin with at least part of the signal peptide, having the amino acid sequence:
  • the instant invention provides for a native human placental bikunin protein with part of the leader sequence intact, having the amino acid sequence of SEQ ID NO: 52 with an intact leader segment having the amino acid sequence:
  • the instant invention provides for bikunin protein with part of the leader sequence intact, having the amino acid sequence of SEQ ID NO: 52 with the intact leader segment having the amino acid sequence:
  • the amino acid numbered +1 is assigned to the NH2-terminus of the amino acid sequence for native human placental bikunin.
  • functional protein fragments can be derived from native human placental bikunin, which will maintain at least part of the biological activity of native human placental bikunin, and act as serine protease inhibitors.
  • the protein of the instant invention comprises a fragment of native human placental bikunin, which contains at least one functional Kunitz-like domain, having the amino acid sequence of native human placental bikunin amino acids 7-159, hereinafter called "bikunin (7- 159)".
  • the instant invention embodies a protein having the amino acid sequence:
  • amino acid numbering corresponds to that of the amino acid sequence of native human placental bikunin.
  • Another functional variant of this embodiment can be the fragment of native human placental bikunin, which contains at least one functional Kunitz-like domain, having the amino acid sequence of native human placental bikunin amino acids 11-156, bikunin (11- 156)
  • the instant invention provides for a protein having the amino acid sequence of a first Kunitz-like domain consisting of the amino acid sequence of native human placental bikunin amino acids 7-64, hereinafter called "bikunin (7-64)".
  • the instant invention encompasses a protein which contains at least one Kunitz-like domain having the amino acid sequence: IHDFCLVSKWGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNN 50
  • amino acid numbering corresponds to that of the amino acid sequence of native human placental bikunin.
  • Another form of the protein of the instant invention can be a first Kunitz-like domain consisting of the amino acid sequence of native human placental bikunin amino acids 11-61, "bikunin (11- 61)" having the amino acid sequence:
  • the instant invention also provides for a protein having the amino acid sequence of a Kunitz-like domain consisting of the amino acid sequence of native human placental bikunin amino acids 102-159, hereinafter called "bikunin (102-159)".
  • a protein having the amino acid sequence of a Kunitz-like domain consisting of the amino acid sequence of native human placental bikunin amino acids 102-159, hereinafter called "bikunin (102-159)".
  • the instant invention encompasses a protein which contains at least one Kunitz-like domain having the amino acid sequence:
  • ACMLRCFRQ 159 (SEQ ID NO: 6)
  • amino acid numbering corresponds to that of the amino acid sequence of native human placental bikunin.
  • Another form of this domain can be a Kunitz-like domain consisting of the amino acid sequence of native human placental bikunin amino acids 106-156, "bikunin (106-156)" having the amino acid sequence:
  • fragments of the native human bikunin protein can be made which will retain at least some of the native protein biological activity. Such fragments can also be combined in different orientations or multiple combinations to provide for alternative proteins which retain some of, the same, or more biological activity of the native human bikunin protein.
  • biologically active protein of the instant invention may comprise one or more of the instant Kunitz-like domains in combination with additional Kunitz-like domains from other sources.
  • Biologically active protein of the instant invention may comprise one or more of the instant Kunitz-like domains in combination with additional protein domains from other sources with a variety of biological activities.
  • the biological activity of the protein of the instant invention can be combined with that of other known protein or proteins to provide for multifunctional fusion proteins having predictable biological activity.
  • the instant invention encompasses a protein which contains at least one amino acid sequence segment the same as, or functionally equivalent to the amino acid sequence of either SEQ ID NO: 5 or SEQ ID NO: 7.
  • An open reading frame which terminates at an early stop codon can still code for a functional protein.
  • the instant invention encompasses such alternative termination, and in one embodiment provides for a protein of the amino acid sequence:
  • the instant invention provides for substantially purified, or recombinantly produced native human bikunin protein with an intact segment of the leader sequence, and at least a portion of the native transmembrane region intact.
  • native human bikunin with an intact leader sequence, and with at least part of the t ⁇ .nsmembrane domain (underlined), having an amino acid sequence selected from: 1)EST •MLR AEADGVSRLL GSLLLSGVLA -1 2)PCR MACjLCGL RRSRAFLALL GSLLLSGVLA -1 3) ⁇ cDNA MAQLCGL RRSRAFLALL GSLLLSGVLA -1
  • ADRERSIHDF CLVSKWGRC RASMPRWWYN VTDGSCQLFV YGGCDGNSNN 50 2) ADRERSIHDF CLVSKWGRC RASMPRWWYN VTDGSCQLFV YGGCDGNSNN 50 3) ADRERSIHDF CLVSKWGRC RASMPRWWYN VTDGSCQLFV YGGCDGNSNN 50
  • a protein of the instant invention comprises one of the amino acid sequence of SEQ ID NO: 45, 47 or 49 wherein the protein has been cleaved in the region between the end of the last Kunitz domain and the transmembrane region.
  • the instant invention also embodies the protein wherein the signal peptide is deleted.
  • the instant invention provides for a protein having the amino acid sequence of SEQ ID NO: 52 continuous with a transmembrane amino acid sequence: EST VWLAGLFVM VLILFLGASM VYLIRVARRN 200 EST QERALRTVWS SGDDKEQLVK NTYVL 225
  • one embodiment of the instant invention provides for a nucleic acid sequence which encodes for a human bikunin having the consensus DNA sequence of Figure 3 (SEQ ID NO: 9), which translates into the amino acid sequence for native human placental bikunin sequence of Figure 3 (SEQ ID NO: 10).
  • the instant invention provides for a consensus nucleic acid sequence of Figure 4C (SEQ ID NO: 51) which encodes for an amino acid sequence of Figure 4D (SEQ ID NO: 45).
  • the instant invention provides for a nucleic acid sequence which encodes for native human placental bikunin having the DNA sequence of Figure 4F (SEQ ID NO: 48) which encodes for the protein sequence of SEQ ID NO: 49.
  • the instant invention provides for a nucleic acid sequence of Figure 4E (SEQ ID NO: 46) which encodes for a protein sequence of SEQ ID NO: 47.
  • allelic mutations and conservative substitutions made in the nucleic acid sequence can be made which will still result in a protein amino acid sequence encompassed by the instant invention.
  • One of skill in the art can recognize that certain natural allelic mutations of the protein of the instant invention, and conservative substitutions of amino acids in the protein of the instant invention will not significantly alter the biological activity of the protein, and are encompassed by the instant invention.
  • the instant invention also provides for pharmaceutical compositions containing human placental bikunin and fragments thereof that are useful for the reduction of perioperative blood loss in a patient undergoing surgery.
  • the present invention also provides methods for reducing perioperative blood loss in a patient undergoing surgery, wherein an effective amount of the disclosed human serine protease inhibitors of the present invention in a biologically compatible vehicle is administered to the patient.
  • the present invention also provides for variants of placental bikunin, and the specific Kunitz domains described above, that contain amino acid substitutions that alter the protease specificity.
  • Preferred sites of substitution are indicated below as positions Xaa 1 through Xaa ⁇ 2 in the amino acid sequence for native placental bikunin.
  • Substitutions at Xaa through Xaa 16 are also preferred for variants of bikunin (7-64), while substitutions at Xaa 1 ⁇ through Xaa ⁇ are preferred for variants of bikunin (102-159).
  • the present invention embodies protein having an amino acid sequence:
  • Xaa - Xaa 32 each independently represents a naturally occurring amino acid residue except Cys, with the proviso that at least one of the amino acid residues Xaa -Xaa ⁇ l is different from the corresponding amino acid residue of the native sequence.
  • naturally occurring amino acid residue is intended to indicate any one of the 20 commonly occurring amino acids, i.e., Ala, Arg, Asn, Asp, Cys, Gin, Glu, Gly, His, He, Leu, Lys, Met, Phe, Pro, Ser, Thr, Trp, Tyr and Val.
  • Examples of preferred variants of placental bikunin include those wherein Xaa* is an amino acid residue selected from the group consisting of His, Glu, Pro; Ala, Val or Lys, in particular wherein Xaa is His or Pro; or wherein Xaa 2 is an amino acid residue selected from the group consisting of Val, Thr, Asp, Pro, Arg, Tyr, Glu, Ala, Lys, in particular wherein Xaa 2 is Val or Thr; or wherein Xaa3 is an amino acid residue selected from the group consisting of Arg, Pro, He, Leu, Thr, in particular wherein Xaa ⁇ is Arg or Pro; or wherein Xaa 4 is an amino acid residue selected from the group consisting of Arg, Lys and Ser, Gin, in particular wherein Xaa 4 is Arg or Lys; or wherein Xaa ⁇ is an amino acid residue selected from the group consisting of Ala, Gly, Asp, Thr, in particular wherein Xa
  • Figure 1 depicts the nucleotide sequence of EST R35464 (SEQ ID NO: 12) and the translation of this DNA sequence (SEQ ID NO: 13) which yielded an open reading frame with some sequence similarity to aprotinin.
  • the translation product contains 5 of the 6 cysteines in the correct spacing that is characteristic for Kunitz-like inhibitor domains (indicated in bold).
  • the position normally occupied by the remaining cysteine (at codon 38) contained instead a phenylalanine (indicated by an asterisk).
  • Figure 2 depicts the nucleotide sequence of EST R74593 (SEQ ID NO: 14), and the translation of this DNA sequence (SEQ ID NO: 15) which yielded an open reading frame with homology to the Kunitz class of serine protease inhibitor domains.
  • the translation product contained 6 cysteines in the correct spacing that is characteristic for Kunitz-like inhibitor domains (indicated in bold). However, this reading frame sequence includes stop codons at codon 3 and 23.
  • Figure 3 depicts a deduced nucleic acid sequence of human placental bikunin (SEQ ID NO: 9) labeled “consensus” and matched with the translated protein amino acid sequence labeled “translated” (SEQ ID NO: 10). Also as comparison are shown the nucleic acid sequence for ESTs H94519 (SEQ ID NO: 16), N39798 (SEQ ID NO: 17), R74593 (SEQ ID NO: 14) and R35464 (SEQ ID NO: 12). The underlined nucleotides in the consensus sequence correspond to the site of PCR primers described in the Examples. Underlined amino acids in the translated consensus sequence are residues whose identity have been confirmed by amino acid sequencing of purified native human placental bikunin. Nucleotide and amino acid code are standard single letter code, "N" in the nucleic acid code indicates an unassigned nucleic acid, and "*" indicates a stop codon in the amino acid sequence.
  • Figure 4A depicts the original overlay of a series of ESTs with some nucleic acid sequence homology to ESTs encoding human placental bikunin, or portions thereof. Shown for reference are the relative positions of bikunin (7-64) and bikunin (102-159), labeled KID1 and KTD2 respectively.
  • Figure 4B depicts a subsequent more comprehensive EST overlay incorporating additional ESTs.
  • Numbers on the upper X-axis refer to length in base pairs, starting at the first base from the most 5' EST sequence. The length of each bar is in proportion to the length in base pairs of the individual ESTs including gaps. The EST accession numbers are indicated to the right of their respective EST bars.
  • Figure 4C depicts the corresponding alignment of the oligonucleotide sequences of each of the overlapping ESTs shown schematicaUy in Figure 4B.
  • the upper sequence (SEQ ID NO: 51) labeled bikunin represents the consensus oligonucleotide sequence derived from the overlapping nucleotides at each position.
  • the numbers refer to base-pair position within the EST map.
  • the oligonucleotides in EST R74593 that are bold underlined (at map positions 994 and 1005) are base insertions observed in R74593 that were consistently absent in each of the other overlapping ESTs.
  • Figure 4D depicts the amino acid translation of the consensus oligonucleotide sequence for bikunin depicted in Figure 4C (SEQ ID NO: 45).
  • Figure 4E depicts the nucleotide sequence (SEQ ID NO: 46) and corresponding amino acid translation (SEQ ID NO: 47) of a placental bikunin encoding sequence that was derived from a human placental cDNA library by PCR-based amplification.
  • Figure 4F depicts the nucleotide sequence (SEQ ID NO: 48) and corresponding amino acid translation (SEQ ID NO: 49) of a native human placental bikunin encoding clone that was isolated from a human placental lambda cDNA library by colony hybridization.
  • Figure 4G compares the alignment of the amino acid translated oligonucleotide sequences for placental bikunin obtained by EST overlay (SEQ ID NO: 45), PCR based cloning (SEQ ID NO: 47), and conventional lambda colony hybridization (SEQ ID NO: 49).
  • Figure 5 shows a graph of purification of human placental bikunin from placental tissue after Superdex 75 Gel-Filtration.
  • the plot is an overlay of the protein elution profile as measured by OD 280 nm (solid line), activity of eluted protein in a trypsin inhibition assay (% inhibition shown by circles), and activity of eluted protein in a kallikrein inhibition assay (% inhibition shown by squares).
  • Figure 6 shows a graph which plots the purification of human placental bikunin from placental tissue using C18 Reverse-Phase Chromatography.
  • the plot is an overlay of the protein elution profile as measured by OD 215 nm (solid line), activity of eluted protein in a trypsin inhibition assay (% inhibition shown by circles), and activity of eluted protein in a kallikrein inhibition assay (% inhibition shown by squares).
  • Figure 7 depicts a silver stained SDS-PAGE gel of highly purified placental bikunin (lane 2), and a series of molecular size marker proteins (lane 1) of the indicated sizes in kilodaltons. Migration was from top to bottom.
  • Figure 8 shows the amount of trypsin inhibitory activity present in the ceU-free fermentation broth from the growth of yeast strains SC101 (panel 8A) or WHL341 (panel 8B) that were stably transformed with a plasmid (pS604) that directs the expression of placental bikunin (102-159).
  • Figure 9 shows both a silver stained SDS-PAGE (left panel) and a
  • FIG 10 is a photograph which shows a silver stained SDS-PAGE of highly purified placental bikunin (102-159) (lane 2) and a series of molecular size marker proteins (lane 1) of the indicated sizes in Kilodaltons. Migration was from top to bottom.
  • FIG 11 is a photograph which shows the results of Northern blots of mRNA from various human tissues that was hybridized to a 32p labeled cDNA probe encoding either placental bikunin (102-159) (panel HA) or encoding placental bikunin (1-213) (panel 11B). Migration was from top to bottom. The numbers to the right of each blot refer to the size in kHobases of the adjacent RNA markers. The organs from which mRNA was derived is described under each lane of the blot.
  • Figure 12 depicts an immunoblot of placental derived placental bikunin with rabbit antiserum raised against either synthetic reduced placental bikunin (7-64) (panel A) or 102-159 (panel B).
  • Figure 13 depicts a Coomassie Blue stained 10-20% Tridne SDS-PAGE gel of 3 micrograms of highly purified placental bikunin (1-170) derived from a baculovirus / Sf9 expression system (lane 2). Lane 1 contains molecular size markers. Migration was from top to bottom.
  • Figure 14 depicts a comparison of the effect of increasing concentrations of either Sf9-derived human placental bikunin (1-170) (fiHed circles), synthetic placental bikunin (102-159) (open drcles), or aprotinin (open squares) on the activated partial thromboplastin time of human plasma. Clotting was initiated with CaCl2. The concentration of proteins are plotted versus the -fold prolongation in clotting time. The uninhibited clotting time was 30.8 seconds.
  • the present invention encompasses a newly identified human protein herein called human placental bikunin that contains two serine protease inhibitor domains of the Kunitz class.
  • the instant invention also encompasses pharmaceutical compositions containing placental bikunin and fragments thereof that are useful for the reduction of perioperative blood loss in a patient undergoing surgery, or with major trauma.
  • the present invention also provides methods for reducing perioperative blood loss " in a patient undergoing surgery or due to major trauma, wherein an effective amount of the disclosed human serine protease inhibitors of the present invention, in a biologically compatible vehicle, is administered to the patient.
  • a preferred application for placental bikunin, isolated domains, and other variants is for the reduction of blood loss resulting from trauma or surgery that has the potential for loss of large volumes of blood.
  • the methods are thus useful in reducing blood loss in normal patients, i.e., those not suffering from inborn or other pre- operative defidendes in coagulation factors.
  • the reduction in blood loss is seen as a reduction in blood loss during surgery , as reduced post surgical drainage or both.
  • Preferred surgical applications indude but are not limited to use in thoradc and abdominal surgery, total and partial hip replacement surgeries and surgeries to treat a patient having an epithelial lesion of the eye.
  • Preferred thoracic surgical procedures include but are not limited to aortocoronary bypass, exdsion of cardiac and aortic aneurysms, and surgery for esophageal varices, and coronary artery bypass surgery.
  • Preferred abdominal surgeries indude but are not limited to liver transplants, radical prostatectomy, surgery for diverticulitis of colon, tumor debulking, surgery on the abdominal aorta and surgery for duodenal ulcers, and repair of liver or spleen trauma.
  • Preferred use for the treatment of trauma include but are not limited to the use in stabilization of severely injured patients at acddent sites suffering from e.g., limb loss or major thoradc /abdominal wounds.
  • placental bikunin, isolated domains, or other variant In case of use for the reduction of blood loss resulting from surgery it is preferred to administer the placental bikunin, isolated domains, or other variant prior to and during surgery, whereas in case of use in trauma settings the placental bikunin variant, isolated domain or other variant is to be administered as rapidly as possible foUowing injury, and should be contained on emergency vehides traveling to the acddent sites.
  • Factor XQ also known as Hageman Factor
  • zymogen form 80 kD
  • zymogen form 80 kD
  • tissue and plasma kallikrein activated by tissue and plasma kallikrein. Once activated, it participates in the intrinsic pathway of blood coagulation which is activated when blood or plasma contacts a "foreign" or anionic surface.
  • Factor Xlla can then deave and activate a number of other plasma proteases including Factor XI, prekallikre ⁇ v and CI of the complement system.
  • Factor XII may be involved in causing hypotensive reactions since activated kallikrein can cleave kininogen releasing bradykinin (see Colman, (1984) /. Clin. Invest., 73, 1249).
  • Sepsis is a disease that results from bacterial infection due to bacterial endotoxin or lipopolysaccharide (LPS).
  • Exposure of Factor XII to LPS results in the activation of Factor XQ.
  • Patients with sepsis frequently have symptoms of intravascular coagulation which may also be due to activation of Factor XII by LPS.
  • Septic shock can result from bacterial infection and is associated with fever, low systemic vascular resistance, and low arterial pressure.
  • the proteins of the instant invention are also a novel human Kunitz type inhibitor of kaUikrein, an activator of Factor XII.
  • Another object of the current invention is to present a method for the prophylactic or therapeutic treatment of systemic inflammatory reactions such as septic shock, adult respiratory distress syndrome (ARDS), preeclampsia, multiple organ failure and disseminated intravascular coagulation (DIC).
  • ARDS adult respiratory distress syndrome
  • DIC disseminated intravascular coagulation
  • the therapeutic or prophylactic administration of the peptides of the instant invention would result in the modulation of these inflammatory conditions and be benefidal to the patient.
  • Plasmin plays an important role in extracellular matrix degradation and the activation of matrix-metaUo protease (MMP) cascades.
  • MMP matrix-metaUo protease
  • Neovascularization is essential to support tumor growth and metastasis is a process which mediates the spreading of tumors and which is assodated with extremely poor patient prognosis.
  • aprotinin reduced tumor growth and invasion, with increased tumor necrosis when administered to hamsters bearing a highly invasive fibrosarcoma or to mice bearing a similarly malignant mammary carcinoma (Latner et al., (1974), Br. J. Cancer 30: 60-67; Latner and Turner, (1976), Br. J. Cancer 33: 535-538). Furthermore, administration of 200,000 KIU of aprotinin i.p.
  • aprotinin blocks the invasive potential of cancer cell lines (Liu G., et al., Int J. Cancer (1995), 60: 501-506).
  • the proteins of the instant invention are also potent inhibitors of plasmin and kaUikrien, they are contemplated for use as anti-cancer agents. For example they are contemplated for use in blocking primary tumor growth by restricting neovascularization, primary tumor invasion and in blocking metastasis through inhibition of tissue infiltration.
  • the compounds may be administered locally to tumors or systemically. In a preferred mode of treatment, the protein would be administered perioperatively during tumor debulking to minimize the risk of metastasis.
  • the blood sparing properties of the compound would be additionaUy advantageous in providing a clearer surgical field of view.
  • Another preferred mode of administration would be as a combination therapy with either MMP inhibitors or chemotherapy.
  • An additional preferred mode of administration would be as a locally administered gene therapy designed to achieve selective expression of placental bikunin within the tumor cells, or their associated stroma and vascular beds.
  • vasular- dependent solid tumors such as breast, colon, lung, prostate and ovarian carcinomas which exhibit a high metastatic potential
  • those for which local delivery of a high concentration of the protein is feasible such as lung cancers through pulmonary delivery, colon cardnomas through hepatic delivery to liver metastasis, or skin cancers such as head and neck carcinomas or melanomas through subcutaneous delivery.
  • the proteins of the present invention are of human origin they would be less likely to be assodated with aUergic or anaphylactic reactions of the kind observed by Guthrie et al., supra, upon reuse.
  • proteins of the present invention are contemplated for use in the reduction of thromboembolic complications assodated with activation of the intrinsic pathway of coagulation. This would indude prevention of pulmonary emboUsm in late stage cancer patients, a frequent cause of death (Donati MB., (1994), Haemostasis 24: 128-131).
  • Edema of the brain and spinal cord is a complication resulting from traumatic brain or spinal cord injury, stroke, cerebral ischemia, cerebral and sub-arachnoid hemhorrhage, surgery (induding open heart surgery), infectious diseases such as encephalitis and meningitis, granulomatous diseases such as Sarcoid and focal or diffuse carcinomas, and is a contributor to the high level of morbidity and death foUowing these events.
  • Bradykinin is known to disrupt the blood brain barrier experimentaHy (Greenwood J., (1991), Neuroradiology, 33: 95-100; Whittle et al., (1992), Acta Neurochir., 115: 53-59), and infusion of bradykinin into the internal carotid artery induced brain edema in spontaneously hypertensive rats (SHR) subjected to common carotid artery occlusion (Kamiya, (1990), Nippon Oca Daigaku Zasshi. 57: 180-191). Elevated levels of bradykinin are found in extraceUular fluids foUowing trauma in a model involving traumatized rat spinal chord (Xu et al., (1991), J.
  • Bradykinin is released from high molecular weight kininogen by serine proteases including kaUikrein (Coleman (1984) J. Clin Invest, 73: 1249), and the serine protease inhibitor aprotinin was found to block the magnitude of brain edema resulting from cerebralsd-emia in SHR rats (Kamiya, (1990), Nippon Ika Daigaku Zasshi.
  • placental bikunin and fragments thereof are contemplated as medicaments for the prevention of edema in patients at risk for this condition, particularly those of high risk of mortality or brain injury.
  • Patients would receive an administration of placental bikunin either as an infusion or bolus injection, intravenously or intracraniaUy. Additional doses of placental bikunin could be administered intermittently over the following one to three weeks.
  • Dose levels would be designed to attain circulating concentrations in excess of those required to neutralize elevations in plasma levels or bradykinin and other vasoactive peptides formed through the action of serine proteases, and suffident to reduce edema. Since the protein is of human origin, repeated administration in this course of therapy would not lead to development of an immune reaction to the protein. Placental bikunin and fragments thereof would be contemplated for monotherapy or prophylacsis as weU as for use in combination with other medicaments such as neurotherapeutics and neuroprotectants.
  • protease inhibitors of the present invention are contemplated according to their capadty to inhibit human kalUkrein, as medicaments for the treatment of arthritis and anemia in humans.
  • NIDDM non-insulin diabetic
  • TGFb has been shown to stimulate differentiation of mouse myoblasts in culture (Wells and Strickland, Development, (1994), 120: 3639-3647)), a process that is inhibited by TGFb.
  • TGFb exists as an inactive pro-polypeptide which is activated by limited proteolysis.
  • the mechanism of aprotinin action has been proposed to involve inhibition of proteases which process pro-TGFb to the mature active form.
  • TGFb has been shown to be up-regulated in various fibrotic lesions and has long thought to be a potential target for anti-fibrotic therapies. In a rat model of pulmonary fibrosis for example, TGF-b concentrations paralleled the extent of bleomydn-induced inflammation.
  • plasmin levels in the alveolar macrophage coincided with mature TGF-b levels, and the addition of the plasmin inhibitor a-2-antiplasmin abrogated the post translational activation of pro-TGFb by the macrophage (Khal et al., (1996), Am. J. Respir. CeU Mol. Biol. 15: 252-259.)
  • the data suggest that plasmin contributes to the formation of active TGFb by alveolar macrophage, and that this process plays a pathologic role in the bleomydn-induced lung inflammation.
  • placental bikunin and fragments thereof are contemplated as therapeutics for various fibrotic disorders, including pulmonary, hepatic, renal and dermal (scleroderma) fibrosis.
  • AerosUized aprotinin was shown to protect >50% of mice infected with lethal doses of either influenza virus or paramyxovirus (Ovcharenko and 2-hirnov, Antiviral Research, (1994), 23: 107-118). A suppression of the development of fatal hemorrhagic bronchopneumonia and a normalization of body weight gain were also noted with aerosUized aprotinin treatment. In light of these observations, placental bikunin and fragments thereof are contemplated as therapeutics for various respiratory related influenza-Uke diseases.
  • human placental bikunin, isolated domains, and other variants of the invention are contemplated for use in the medical/therapeutic applications suggested for native aprotinin or aprotinin analogues with other inhibitory profiles, in particular those which necessitate usage of large doses.
  • placental bikunin (1-170) is a potent inhibitor of factor XIa and a moderate inhibitor of factor Xa.
  • Factor XIa plays an essential role in the intrinsic pathway of coagulation, serving to interconvert inactive factor IX into active factor IXa.
  • Placental Bikunin inhibits two key enzymes of the intrinsic pathway, kaUikrein and factor XIa.
  • placental bikunin (1-170) is a potent inhibitor of the activated partial thromboplastin time, which is. a measure of the speed of coagulation driven by the intrinsic pathway.
  • Placental bikunin (1- 170) is an extremely weak inhibitor of the tissue factor Vila complex, suggesting that it is not important in the regulation of the extrinsic coagulation cascade.
  • placental bikunin is contemplated as a medicament for diseases in which activation of the intrinsic pathway of coagulation contributes significantly to the disease mechanism. Examples of such diseases would include post-traumatic shock and disseminated intravascular coagulation.
  • a significant advantage of the Kunitz domains of the present invention- is that they are human proteins, and also less positively charged than Trasylol® (Example 1), thereby reducing the risk of kidney damage on administration of large doses of the proteins.
  • the protein of the instant invention can thus be administered to human patients with significantly reduced risk of undesired immunological reactions as compared to administration of si ⁇ lar doses of Trasylol®. Furthermore, it was found that bikunin (102-159), bikunin (7-64), and bikunin (1-170) are significantly more potent inhibitors of plasma kalUkrein than Trasylol® in vitro (Example 3, 4 and 10). Thus bikunin and fragments thereof are expected to be more effective in vivo at lowering blood loss in patients.
  • the amount of serine protease inhibitor administered should be sufficient to provide a supra normal plasma level.
  • the proteins of the instant invention may be used in place of Trasylol® whUe taking into account the differences in potency.
  • the use of Trasylol® is outlined in the Physidans Desk Reference, (1995), listing for Trasylol® supplement A. Briefly, with the patient in a supine position, the loading dose of placental bikunin, isolated domain or other variant is given slowly over about 20 to 30 minutes, after induction of anesthesia but prior to sternotomy.
  • a total dose of between about 2x10 6 KIU (kalUkrein inhibitory units) and 8 X10 6 KIU will be used, depending on such factors as patient weight and the length of the surgery.
  • Preferred loading doses are those that contain a total of 1 to 2 miUion kaUikrein inhibitory units (KIU).
  • KIU miUion kaUikrein inhibitory units
  • the constant infusion dose is in the range of about 250,000 to 500,000 KIU per hour.
  • the pump prime dose is added to the priming fluid of the cardiopulmonary bypass circuit, by replacement of an aUquot of the priming fluid prior to the institution of the cardiopulmonary bypass.
  • Preferred pump prime doses are those that contain a total of about one to two miUion KIU.
  • the proteins of the instant invention are employed in pharmaceutical compositions formulated in the manner known to the art. Such compositions contain active ingredient(s) plus one or more pharmaceuticaUy acceptable carriers, dUuents, fUlers, binders, and other excipients, depending on the administration mode and dosage form contemplated.
  • therapeutically inert inorganic or organic carriers include, but are not limited to, lactose, corn starch or derivatives thereof, talc, vegetable oUs, waxes, fats, polyols such as polyethylene glycol, water, saccharose, alcohols, glycerin and the Uke.
  • compositions so formulated are selected as needed for administration of the inhibitor by any suitable mode known to those skiUed in the art.
  • Intravenous administration can be used to obtain acute regulation of peak plasma concentrations of the drug as might be needed.
  • the drug can be administered at a desired rate continuously by i.v. catheter.
  • Suitable vehicles indude sterile, non-pyrogenic aqueous diluents, such as sterile water for injection, sterile-buffered solutions or sterile saline. The resulting composition is administered to the patient prior to and/or during surgery by intravenous injection or infusion.
  • Improved half-Ufe and targeting of the drug to phagosomes such as neutrophUs and macrophage involved in inflammation may be aided by entrapment of the drug in liposomes. It should be possible to improve the selectivity of liposomal targeting by incorporating into the outside of the liposomes ligands that bind to macromolecules specific to target organs /tissues such as the GI tract and lungs. Alternatively, i.m. or s.c. deposit injection with or without encapsulation of the drug into degradable microspheres (e.g., comprising poly-DL-lactide-co-glycoUde) or protective formulations containing collagen can be used to obtain prolonged sustained drug release.
  • degradable microspheres e.g., comprising poly-DL-lactide-co-glycoUde
  • protective formulations containing collagen can be used to obtain prolonged sustained drug release.
  • an i.p. implanted reservoir and septum such as the percuseai system.
  • Improved convenience and patient compUance may also be achieved by use of either injector pens (e.g., the Novo Pin or Q-pen) or needle-free jet injectors (e.g., from Bioject, Mediject or Becton Dickinson).
  • injector pens e.g., the Novo Pin or Q-pen
  • needle-free jet injectors e.g., from Bioject, Mediject or Becton Dickinson
  • Precisely controUed release can also be achieved using implantable pumps with delivery to the desired site via a cannula. Examples include the subcutaneously implanted osmotic pumps available from ALZA such as the ALZET osmotic pump.
  • Nasal delivery may be achieved by incorporating the drug into bioadhesive particulate carriers ( ⁇ 200 mm) such as those comprising cellulose, polyacrylate or polycarbopbil, in conjunction with suitable absorption enhancers such as phosphoUpids or acylcarnitines.
  • bioadhesive particulate carriers ⁇ 200 mm
  • suitable absorption enhancers such as phosphoUpids or acylcarnitines.
  • CommerdaUy available systems indude those developed by Dan Biosys and Sdos Nova.
  • Pulmonary delivery represents a nonparenteral mode of administration of the drug to the circulation.
  • the lower airway epithelia are highly permeable to a wide range of proteins of molecular sizes up to about 20 kDa.
  • Micron-sized dry powders containing the medicament in a suitable carrier such as mannitol, sucrose or lactose may be deUvered to the distal alveolar surface using dry powder inhalers such as those of InhaleTM, DuraTM, Fisons (SpinhalerTM), and Glaxo (RotahalerTM), or Astra (TurbohalerTM) propellant based metered dose inhalers.
  • Solution formulations with or without liposomes may be deUvered using ultrasonic nebulizers.
  • Oral delivery may be achieved by incorporating the drug into tablets, coated tablets, drag ⁇ es, hard and soft gelatin capsules, solutions, emulsions, suspensions or enteric coated capsules designed to release the drug into the colon where digestive protease activity is low.
  • examples of the latter indude the OROS-CT/OsmetTM system of ALZA, and the PULSINCAPTM system of Scherer Drug Delivery Systems.
  • Other systems use azo-crosslinked polymers that are degraded by colon-specific bacterial azoreductases, or pH sensitive polyacrylate polymers that are activated by the rise in pH in the colon. The above systems may be used in conjunction with a wide range of avaUable absorption enhancers. Rectal delivery may be achieved by incorporating the drug into suppositories.
  • the preferred mode of administration of the placental bikunin variants of the present invention is parenterally, preferably by i.v. route through a central line.
  • the amount of the pharmaceutical composition to be employed wUl depend on the redpient and the condition being treated. The requisite amount may be determined without undue experimentation by protocols known to those skiUed in the art. Alternatively, the requisite amount may be calculated, based on a determination of the amount of target protease such as plasmin or kaUikrein which must be inhibited in order to treat the condition. As the active materials contemplated in this invention are deemed to be nontoxic, treatment preferably involves administration of an excess of the optimally required amount of active agent.
  • placental bikunin, isolated domains or other variants may be used to isolate natural substances such as its cognate proteases from human material using affinity based separation methods, as weU as to eUdt antibodies to the protease that can be further used to explore the tissue distribution and useful functions of Placental bikunin.
  • Mol Biol 215: 403-410 to search for similarities between a query sequence and aU the sequences in a data-base, protein or nudeic add in any combination
  • the data-base was examined for nudeotide sequences bearing homology to the sequence of bovine pre-pro-aprotinin, Trasylol®. This search of numerous dones was selectively narrowed to two particular clones which could possibly encode for a deduced amino acid sequence that would correspond to a human protein homologous in function to aprotinin.
  • the selected nucleic add sequences were R35464 (SEQ ID NO: 12) and R74593 (SEQ ID NO: 14) that were generated from a human placental nudeic add library.
  • the translated protein sequence in the longest open reading frame for R35464 was missing one of the 6 cysteines that are critical for formation of the Kunitz-domain covalent structure, meaning that the nucleic add sequence of R35464 could not yield a functional inhibitor.
  • the longest translated open reading frame from clone R74593 contained a stop codon 5' to the region encoding the Kunitz Uke sequence, meaning that this sequence, could not be translated to yield a functional secreted Kunitz domain. The significance of these sequences alone was undear. It was possible that they represented a) the products of pseudogenes, b) regions of untranslated mRNA, or c) the products of viable mRNA which had been sequenced incorrectly.
  • cDNA primers were designed to be capable of hybridizing to sequences located 5' and 3' to the segment of cDNA encoding our proposed Kunitz like sequences found within R35464 and R74593.
  • the primers used to ampUfy a fragment encoding the Kunitz Uke sequence of R74593 were CGAAGCTTCATCTCCGAAGCTCCAGACG (the 3'primer with a HindHI site; SEQ ID NO:33) and AGGATCTAGACAATAATTACCTGACCAAGGA (the 5'primer with an Xbal site; SEQ ID NO:34).
  • the new translation product ( Figure 4D) was identical to the original protein consensus sequence (SEQ ID NO: 1) between residues +1 to +175 (encoding the Kunitz domains), but contained a new C-terminal extension exhibiting a putative 24 residue long transmembrane domain (underlined in Figure 4D) foUowed by a short 31 residue cytoplasmic domain.
  • the predse sequence around the initiator methionine and signal peptide was somewhat tentative due to considerable heterogeneity amongst the overlapping ESTs in this region.
  • the following 5' PCR primer CACCTGATCGCGAGACCCC (SEQ ID NO: 36) designed to hybridize to a sequence within EST R34808 was used with the same 3' primer to EST 74593 to amplify (30 cycles) an approximately 780 base-pair cDNA product from the human placental cDNA library.
  • This product was gel purified, and doned into the TA vector (Invitrogen) for DNA sequencing by the dideoxy method (Sanger F., et al., (1977) Proc. Natl. Acad. Sci (USA), 74: 5463- 5467) with the following primers:
  • T7 TAATACGACTCACTATAGGG (SEQ ID NO: 38)
  • Figure 4E was gel purified and used to isolate a non-PCR based full length clone representing the bikunin sequence.
  • the PCR derived cDNA sequence was labeled with 32 P-CTP by High Prime (Boehringer Mannheim) and used to probe a placental cDNA Library (Stratagene, UnizapTM ⁇ Ubrary) using colony hybridization techniques. Approximately 2 X 10 6 phage plaques underwent 3 rounds of screening and plaque purification. Two clones were deemed full length (-1.5 kUobases) as determined by restriction enzyme analysis and based on comparison with the size of the EST consensus sequence (see above).
  • the initiator methionine was followed by a hydrophobic signal peptide which was identical to the signal peptide encoded in the PCR derived clone. Subsequently we expressed and purified a soluble fragment of placental bikunin, bikunin (1-170), from Sf9 cells (Example 9), and found it to be a functional protease inhibitor (Example 10). Furthermore, we isolated from human placenta a soluble fragment of placental bikunin which was also an active protease inhibitor (Example 7). Both the natural protein and the form of the protein expressed in Sf9 ceUs are probably glycosylated at the asparagine residue at position 30 based on the recoveries of PTH-amino acids during N- terminal sequencing (Examples 7 and 9).
  • Contact activation is a process which is activated by exposure of damaged vascular surfaces to components of the coagulation cascade.
  • Angiogenesis is a process that involves local activation of plasmin at endotheUal surfaces.
  • the amino add sequences for placental bikunin (7-64), bikunin (102-159), and fuU length placental bikunin (Figure 4F) were searched against the PIR (Vers.46.0) and PatchX (Vers.
  • the isolated native human bikunin had an identical N- terminus (sequenced for 50 amino add residues) as the sequence predicted by the translation of the consensus nudeic add sequence (Figure 3) amino add residues +1 to +50 (Example 7). This confirmed for the first time the existence of a novel native kalUkrein inhibitor isolated from human placenta.
  • sequence number 1) is Bikunin (7-64) (SEQ ID NO: 4); sequence 2) is Bikunin (102-159) (SEQ ID NO: 6); sequence 3) is Tissue factor pathway inhibitor precursor 1 (SEQ ID NO: 18); sequence 4) is Tissue fartor pathway inhibitor precursor 1 (SEQ ID NO: 19); sequence 5) is Tissue factor pathway inhibitor precursor (SEQ ID NO: 20); sequence 6) is Tissue factor pathway inhibitor precursor 2 (SEQ ID NO: 21); sequence 7) is Tissue factor pathway inhibitor precursor 2 (SEQ ID NO: 22); sequence 8) is Amyloid precursor protein homologue (SEQ ID NO: 23); sequence 9) is Aprotinin (SEQ ID NO: 24); sequence 10) is Inter- ⁇ -trypsin inhibitor precursor (SEQ ID NOs: 25); sequence 11) is Inter- ⁇ -trypsin inhibitor precursor (SEQ ID NOs: 26); sequence 12) is Amyloid precursor protein (SEQ ID NO: 27); sequence 13) is Collagen ⁇ -3(VI) precursor (SEQ ID NO: 28); and s
  • Placental Bikunin (7-64) and (102-159) each have the same number (six) and spadng of cysteine residues as is found in members of the Kunitz ensemble of serine protease inhibitors.
  • the precise bonding of cysteine residues to form the three intrachain disulfide bonds is known and invarient for aU previously known Kunitz family members (Laskowski, M et al., 1980, Ann. Rev. Biochem. 49:593-626).
  • placental bikunin, isolated domains or other variants of the present invention may be produced by standard soUd phase peptide synthesis using either t-Boc chemistry as described by Merrifield R.B. and Barany G., in: The peptides, Analysis, Synthesis, Biology, 2, Gross E. et al., Eds.
  • the invention also relates to DNA constructs that encode the Placental bikunin protein variants of the present invention.
  • These constructs may be prepared by synthetic methods such as those described in Beaucage S.L. and Caruthers M.H., (1981) Tetrahedron Lett, 22, ppl859-1862; Matteucd M.D and Caruthers M.H., (1981), J. Am. Chem. Soc. 103, p 3185; or from genomic or cDNA which may have been obtained by screening genomic or cDNA libraries with cDNA probes designed to hybridize with placental bikunin encoding DNA sequence. Genomic or cDNA sequence can be modified at one or more sites to obtain cDNA encoding any of the amino add substitutions or deletions described in this disdosure.
  • the instant invention also relates to expression vectors containing the DNA constructs encoding the placental bikunin, isolated domains or other variants of the present invention that can be used for the production of recombinant placental bikunin variants.
  • the cDNA should be connected to a suitable promoter sequence which shows transcriptional activity in the host cell of choice, possess a suitable terminator and a poly-adenylation signal.
  • the cDNA encoding the placental bikunin variant can be fused to a 5' signal peptide that wUl result in the protein encoded by the cDNA to undergo secretion.
  • the signal peptide can be one that is recognized by the host organism.
  • the signal peptide can also be the natural signal peptide present in fuU length placental bikunin.
  • the procedures used to prepare such vectors for expression of placental bikunin variants are weU known in the art and are for example described in Sambrook et al., Molecular Cloning: A laboratory Manual, Cold Spring Harbor, New York, (1989).
  • the instant invention also relates to transformed cells containing the
  • DNA constructs encoding the placental bikunin, isolated domains or other variants of the present invention that can be used for the production of recombinant placental bikunin variants A variety of combinations of expression vector and host organism exist which can be used for the production of the placental bikunin variants.
  • Suitable host ceUs indude baculovirus infected Sf9 insert cells, mammaUan ceUs such as BHK, CHO, Hela and C-127, bacteria such as E. coU, and yeasts such as Saccharomyces cervisiae.
  • E.coU expression could be carried out using the methods described in US patent 5,032,573.
  • Use of mammaUan and yeast systems are most preferred for the expression of larger placental bikunin variants containing both inhibitor domains such as the variant bikunin (7-159).
  • DNA encoding variants of placental bikunin that possess amino acid substitution of the natural amino sequence can be prepared for expression of recombinant protein using the methods of Kunkel T. A., (1985) Proc. Natl. Acad. Sd USA 82: 488-492. Briefly, the DNA to be mutagenized is cloned into a single stranded bacteriophage vector such as M13. An oligonucleotide spanning the region to be dianged and encoding the substitution is hybridized to the single stranded DNA and made double stranded by standard molecular biology techniques. This DNA is then transformed into an appropriate bacterial host and verified by dideoxynudeotide sequencing.
  • the correct DNA is then cloned into the expression plasmid.
  • the target DNA may be mutagenized by standard PCR techniques, sequenced, and inserted into the appropriate expression plasmid.
  • the following particular examples are offered by way of iUustration, and not Umitation, of certain aspects and preferred embodiments of the instant invention.
  • the fluorogenic substrate Tos- Gly-Pro-Lys-AMC was purchased from Bachem BioScience Inc (King of Prussia, PA).
  • PNGB, Pro-Phe-Arg-AMC, Ala-Ala-Pro-Met-AMC, bovine trypsin (type HI), human plasma kalUkrein, and human plasmin were from Sigma (St. Louis, MO).
  • aprotinin (Trasylol®) was from Bayer AG (Wuppertal, Germany). Pre-loaded Gin Wang resin was from Novabiochem (La Jolla, C A). Thioanisole, ethanedithiol and t-butyl methyl ether was from Aldrich (MUwaukee, WI).
  • the amount of trypsin inhibitory activity present in the refolded sample at various stages of purification was measured using GPK-AMC as a substrate.
  • Bovine trypsin 200 pmoles was incubated for 5 min at 37%C with bikunin (7- 64) or (102-159), from various stages of purification, in buffer A (50 mM Hepes, pH 7.5, 0.1 M NaCl, 2 mM CaCl2 and 0.01% triton X-100).
  • One unit of activity for the inhibitor is defined as the amount needed to achieve 50% inhibition in the assay using the conditions as described.
  • Placental bikunin (102-159) was synthesized on an Applied Biosystems model 420A peptide synthesizer using NMP-HBTU Fmoc chemistry.
  • the peptide was synthesized on pre loaded Gin resin with an 8-fold excess of amino acid for each coupling. Cleavage and deprotection was performed in 84.6% trifluoroacetic acid (TFA), 4.4% thioanisole, 2.2% ethanedithiol, 4.4% Uquified phenol, and 4.4% H2O for 2 hours at room temperature.
  • TFA trifluoroacetic acid
  • the crude peptide was predpitated, centrifuged and washed twice in t-butyl methyl ether.
  • the peptide was purified on a Dynamax 60A C18 reverse-phase HPLC column using a TFA/acetonitrUe gradient.
  • the solution was aUowed to stir for 24 hr at 25°C after which it was diluted 1:10 in buffer containing 50 mM Tris, pH 8.0, and 0.1 M NaCl.
  • the material was purified using a kallikrein affinity column made by covalently attaching 30 mg of bovine pancreatic kaUikrein (Bayer AG) to 3.5 mis of CNBr activated Sepharose (Pharmada) according to the manufacturers instructions.
  • the refolded material was loaded onto the affinity column at a flow rate of 1 ml/min and washed with 50 mM Tris, pH 8.0, and 0.1 M NaCl until absorbance at 280 nm of the wash could no longer be detected.
  • the column was eluted with 3 volumes each of 0.2 M acetic add, pH 4.0 and 1.7. Active fractions were pooled (see below) and the pH of the solution adjusted to 2.5. The material was directly appUed to a Vydac C18 reverse-phase column (5 micron, 0.46 x 25 cm) which had been equilibrated in 22.5% acetonitrile in 0.1% TFA. Separation was achieved using a Unear gradient of 22.5 to 40% acetonitrile in 0.1% TFA at 1.0 ml/min over 40 min. Active fractions were pooled, lyophUized, redissolved in 0.1% TFA, and stored at -20°C until needed.
  • c One Unit is defined as the amount of material required to inhibit 50% of trypsin activity in a standard assay.
  • the isoelectric points of the purified, refolded synthetic placental bikunin (102-159) was determined using a Multiphor II Electrophoresis System (Pharmada) run according to the manufacturers suggestions, together with pi standards, using a precast Ampholine® PAGplate (pH 3.5 to 9.5) and focused for 1.5 hrs. After staining, the migration distance from the cathodic edge of the gel to the different protein bands was measured. The pi of each unknown was determined by using a standard curve generated by a plot of the migration distance of standards versus the corresponding pi's. With this technique, the pi of placental bikunin (102-159) was determined to be 8.3, in agreement with the value predicted from the amino acid sequence. This is lower than the value of 10.5 established for the pi of aprotinin. (Tenstad et al., 1994, Acta Physiol. Scand. 152: 33-50).
  • Example 2 Example 2
  • Placental bikunin (7-64) was synthesized, refolded and purified essentially as described for placental bikunin (102-159) but with the following modifications: during refolding, the synthetic peptide was stirred for 30 hr as a solution in 20% DMSO at 25°C; purification by C18 RP-HPLC was achieved with a linear gradient of 25 to 45% acetonitrile in 0.1% TFA over 40 min (lml/min). Active fractions from the first C18 run were reapplied to the column and fractionated with a linear gradient (60 min, 1 ml/min) of 20 to 40% acetor ⁇ trUe in 0.1% TFA.
  • Placental bikunin (7- 64) was synthesized, refolded and purified essentially as described for placental bikunin (102-159) but with the foUowing modifications: during refolding, the synthetic peptide (0.27 mg/ml) was stirred for 30 hr as a solution in 20% DMSO at 25 C; purification by C18 RP-HPLC was achieved with a linear gradient of 22.5 to 50% acetonitrile in 0.1% TFA over 40 min (1 ml/min).
  • Bovine trypsin, human plasmin, and bovine pancreatic kaUikrein quantitation was carried out by active site titration using p- nitrophenyl p'-guanidinobenzoate HCI as previously described (Chase,T., and Shaw, E., (1970) Methods Enzmol., 19: 20-27).
  • Human kaUikrein was quantitated by active site titration using bovine aprotinin as a standard and PFR-AMC as a substrate assuming a 1:1 complex formation.
  • the K m for GPK- AMC with trypsin and plasmin under the conditions used for each enzyme was 29 ⁇ M and 726 ⁇ M, respectively; the K m for PFR-AMC with human plasma kaUikrein and bovine pancreatic kaUikrein was 457 ⁇ M and 81.5 ⁇ M, respectively; the K m for AAPR-AMC with elastase was 1600 ⁇ M.
  • Human tissue kaUikrein (Bayer, Germany) quantification was carried out by active site titration using p'nitrophenyl p'-guanidinobenzoate HCI as previously described (Chase, T., and Shaw, E., (1970) Methods Enzmol. 19: 20-27).
  • Inhibition Kinetics The inhibition of trypsin by placental bikunin (102- 159) or aprotinin was measured by the incubation of 50 pM trypsin with placental bikunin (102-159) (0-2 nM) or aprotinin (0-3 nM) in buffer A in a total volume of 1.0 ml. After 5 min. at 37°C, 15 ⁇ l of 2 mM GPK-AMC was added and the change in fluorescence (as above) was monitored.
  • the inhibition of human plasma kallikrein by placental bikunin (102-159) or aprotinin was determined using kallikrein (2.5 nM) and placental bikunin (102-159) (0-3 nM) or aprotinin (0-45 nM) in 50 mM Tris-HCl (pH 8.0), 50 mM NaCl, and 0.02% triton x-100. After 5 min. at 37°C 15 ⁇ l of 20 mM PFR-AMC was added and the change in fluorescence monitored.
  • Vi/V 0 1 - (E 0 + Io + Kj* - [(E 0 + Io + K i *)2 - 4 E 0 I 0 ]l/2)/2E 0 (2)
  • Vj/V 0 is the fractional enzyme activity (inhibited vs. uninhibited rate)
  • E 0 and ⁇ Q are the total concentrations of enzyme and inhibitor, respectively. Ki values were obtained by correcting for the effect of substrate according to the equation:
  • Ki KiV(l + [So]/K m ) (3)
  • elastase (19 nM) was incubated with placental bikunin (102-159) (150 nM) or aprotinin (0-7.5 ⁇ M) in buffer containing 0.1 M Tris-HCl (pH 8.0), and 0.05% triton X-100. After 5 min at 37%C, AAPM-AMC (500 ⁇ M or 1000 ⁇ M) was added and the fluorescence measured over a two-minute period. Ki values were determined from Dixon plots of the form 1/V versus [I] performed at two different substrate concentrations (Dixon et al., 1979).
  • the inhibition of human tissue kaUikrein by aprotinin, placental bikunin fragment (7-64) or placental bikunin fragment (102-159) was measured by the incubation of 0.35 nM human tissue kalUkrein with placental bikunin (7-64) (0- 40 nM) or placental bikunin (102-159) (0-2.5 nM), or aprotinin (0-0.5 nM) in a 1 ml reaction volume containing 50 mM Tris-HCl buffer pH 9.0, 50 mM NaCl, and 0.1% triton x-100. After 5 min.
  • Factor XIa The inhibition of Factor XIa (from Enzyme Research Labs, Southbend, IN) was measured by incubating FXIa (0.1 nM) with either 0 to 800 nM placental bikunin (7-64), 0 to 140 nM placental bikunin (102-159) or 0 to 40 uM aprotinin in buffer containing 50 mM Hepes pH 7.5, 100 mM NaCl, 2 mM CaC12, 0.01% triton x-100, and 1% BSA in a total volume of 1 ml. After 5 min at 37 C, 10 ul of 40 mM Boc-Glu(OBzl)-Ala-Arg-AMC (Bachem Biosdences, King of Prussia, PA) was added and the change in fluorescence monitored.
  • Placental bikunin (102-159) and aprotinin inhibit bovine trypsin and human plasmin to a comparable extent under the conditions employed.
  • Aprotinin inhibited elastase with a Ki of 8.5 ⁇ M.
  • Placental bikunin (102-159) inhibited elastase with a Ki of 323nM.
  • the K[ value for the placental bikunin (102-159) inhibition of bovine pancreatic kallikrein was 20-fold higher than that of aprotinin inhibition.
  • placental bikunin (102-159) is a more potent inhibitor of human plasma kalUkrein than aprotinin and binds with a 56-fold higher affinity.
  • placental bikunin (102-159) is greater than 50 times more potent than Trasylol® as an inhibitor of kaUikrein
  • smaUer amounts of human placental bikunin, or fragments thereof are needed than Trasylol® in order to maintain the effective patient doses of inhibitor in KIU.
  • the protein is human derived, and thus much less immunogenic in man than aprotinin which is derived from cows. This results in significant reductions in the risk of incurring adverse immunologic events upon re-exposure of the medicament to patients.
  • Table 4B below also shows the efficacy of refolded placental bikunin (7-64) as an inhibitor of various serine proteases in vitro.
  • Refolded placental bikunin (7-64) was prepared from protein that was certain to be completely deprotected prior to purification and refolding. Data is shown compared against data obtained for screening inhibition using either placental bikunin (102-159), or aprotinin (Trasylol®).
  • placental bikunin (7-64) was more potent than aprotinin at inhibiting human plasma kallikrein, and at least similar in efficacy as a plasmin inhibitor. These data show that placental bikunin (7-64) is at least as effective as aprotinin, using in vitro assays, and that one would expect better or simUar potency in vivo.
  • the DNA sequence encoding placental bikunin 102-159 was generated using synthetic oUgonudeotides.
  • the final DNA product consisted (5' to 3') of 15 nucleotides from the yeast ⁇ -mating factor propeptide sequence fused to the in-frame cDNA sequence encoding placental bikunin (102-159), foUowed by an in-frame stop codon.
  • the cDNA Upon cloning into a yeast expression vector pS604, the cDNA would direct the expression of a fusion protein comprising an N-terminal yeast ⁇ -mating factor propeptide fused to the 58 amino acid sequence of placental bikunin (102-159). Processing of this fusion protein at a KEX-2 deavage site at the junction between the ⁇ -mating factor and Kunitz domain was designed to Uberate the Kunitz domain at its native N- terminus.
  • a 5' sense oligonudeotide of the foUowing sequence and containing a HindHI site for cloning was synthesized:
  • a 3' antisense oligonucleotide of the foUowing sequence and containing both a BamHI site for doning and a stop codon was synthesized:
  • the oiigonudeotides were dissolved in 10 mM Tris buffer pH 8.0 containing 1 mM EDTA, and 12 ug of each oligo were added combined and brought to 0.25M NaCl. To hybridize, the oiigonudeotides were denatured by boUing for 5 minutes and aUowed to cool from 65 °C to room temp over 2 hrs. Overlaps were extended using the Klenow fragment and digested with Hind ⁇ i and BamHI. The resulting digested double stranded fragment was cloned into pUC19 and sequence confirmed. A clone containing the fragment of the correct sequence was digested with BamHI/Hindi ⁇ to Uberate the bikunin containing fragment with the foUowing + strand sequence:
  • Colonies 2.4 and 2.5 from transformation of yeast SC101 ( Figure 8) as weU as an aprotinin control were grown overnight in 50 ml of ura DO media at 30°C CeUs were peUeted and the supernatant concentrated 100-fold using a Centriprep 3 (Amicon, Beverly, MA) concentrator. Samples of each (30 ⁇ l) were subjected to SDS-PAGE on 10-20% tricine buffered gels (Novex, San Diego, CA) using the manufacturers procedures.
  • Duplicate gels were either developed with a sUver stain kit (Integrated Separation Systems, Nantick, MA) or transferred to nitroceUulose and developed with the purified polyclonal antibody eUdted to synthetic bikunin (102-159). AlkaUne-phosphatase conjugated goat anti-rabbit antibody was used as the secondary antibody according to the manufacturer's directions (Kirkegaard and Perry, Gaithersburg, MD).
  • Figure 8 shows the percent trypsin activity inhibited by twelve colonies derived from the transformation of each of strains SClOl and WHL341.
  • the results show that aU twelve colonies of yeast strain SClOl transformed with the trypsin inhibitor placental bikunin (102-159) had the abiUty to produce a substantial amount of trypsin inhibitory activity compared to the negative controls both of which showed no abiUty to inhibit trypsin.
  • the activity is therefore related to the expression of a specific inhibitor in the placental bikunin variant (102-159) transformed cells.
  • the yeast WHL341 samples contained minimal trypsin inhibitory activity. This may be correlated to the slow growth observed with this strain under the conditions employed.
  • Figure 9 shows the SDS-PAGE and western analysis of the yeast SClOl supematants.
  • Silver stained SDS-PAGE of supematants derived from recombinant yeasts 2.4 and 2.5 expressing placental bikunin (102-159) as well as from the yeast expressing aprotinin yielded a protein band running at approximated 6 kDa, corresponding to the size expected for each recombinant Kunitz inhibitor domain.
  • Western analysis showed that the 6 kDa bands expressed by stains 2.4. and 2.5 reacted with the pAb eUdted to placental bikunin (102-159).
  • yeast expression constructs for the production of placental bikunin 103-159 (N-terminus of EEY%), 101-159 (N-terminus of NYEEY%) and 98-159 (DMFNYEEY..) in order to modify the P' subsites surrounding the KEX-2 cleavage site.
  • yeast preferred codons rather than mammaUan preferred codons in preparing some of the constructs described below.
  • the constructs were essentiaUy prepared as described above for placental bikunin 102-159 (defined as construct #1) but with the foUowing modifications:
  • construct #1 3' antisense oUgonucleotide as used for construct #2, were manipulated as described for the production of an expression construct (construct #1 above) for the expression of placental bikunin 102-159.
  • construct #1 3' antisense oUgonucleotide as used for construct #2, were manipulated as described for the production of an expression construct (construct #1 above).
  • Yeast strain SClOl (MAT ⁇ , ura 3-52, sue 2) was transformed with the plasmids containing each of the above cDNAs, and proteins were expressed using the methods that were described above for the production of placental bikunin 102- 159 with human codon usage.
  • Approximately 250 ml of each yeast culture was harvested, and the supernatant from centrifugation (15 min x 3000 RPM) separately subjected to purification over 1 ml columns of kaUikrein-sepharose as described above.
  • the relative amount of trypsin inhibitory activity in the applysate, the amount of purified protein recovered and the N-terminal sequence of the purified protein were determined and are listed below in Table 7. Table 7
  • placental bikunin fragments of different lengths that contain the C-terminal Kunitz domain show wide variation in capacity to express functional secreted protein.
  • Constructs expressing fragments 101-159 and 103-159 yielded Uttle or low enzymic activity in the supematants prior to purification, and N-terminal sequencing of 0.05 ml aliquots of each purified fraction yielded undetectable amounts of inhibitor.
  • expression either of placental bikunin 102-159 or 98-159 yielded significant amounts of protease activity prior to purification.
  • N-terminal sequencing however showed that the purified protein recovered from expression of 102-159 was once again largely incorrectly processed, exhibiting an N-terminus consistent with processing of the majority of the pre-protein at a site within the yeast ⁇ -mating factor pro-sequence.
  • the purified protein recovered from expression of placental bikunin 98-159 however was processed entirely at the correct site to yield the correct N-terminus. Furthermore, nearly twice as much protein was recovered as compared to the recovery of placental bikunin 102- 159.
  • Placental bikunin 98-159 thus represents a preferred fragment length for t he production of the C-terminal Kunitz domain of placental bikunin by the ⁇ - mating factor pre-pro sequence/ KEX-2 processing system of S. cerevisiae, Example 6
  • the 58 amino acid peptide derived from the R74593 translation product can also be PCR ampUfied from either the R87894-R74593 PCR product cloned into the TA vectorTM (Invitrogen, San Diego, CA) after DNA sequencing or from human placental cDNA.
  • the amplified DNA product wiU consist of 19 nudeotides from the yeast ⁇ -mating factor leader sequence mated to the R74593 sequence which codes for the YEEY--CFRQ (58 residues) so as to make the translation product in frame, constructing an ⁇ -mating factor/Kunitz domain fusion protein.
  • the protein sequence also contains a kex 2 cleavage which wiU Uberate the Kunitz domain at its native N-terminus.
  • the 5' sense oligonucleotide which contains a Hindm site for cloning wUl contain the foUowing sequence: GCCAAGCTTG GATAAAAGAT ATGAAGAAT ACTGCACCGC CAACGCA ( SEQ ID NO : 30 )
  • the 3' antisense oUgonucleotide contains a BamHI site for doning as well as a stop codon and is of the foUowing sequence: GGGGATCCTC ACTGCTGGCG GAAGCAGCGG AGCAT ( SEQ ID NO : 31 )
  • the full 206 nudeotide cDNA sequence to be cloned into the yeast expression vector is of the foUowing sequence:
  • this DNA wUl be digested with HindHI, BamHI and doned into the yeast expression vector pMT15 (see US patent 5,164,482, incorporated by reference in the entirety) also digested with HindlH and BamHI.
  • the resulting plasmid vector is used to transform yeast strain SC 106 using the methods described in US patent 5,164,482.
  • the URA 3+ yeast transformants are isolated and cultivated under inducing conditions.
  • the yield of recombinant Placental bikunin variants is determined according to the amount of trypsin inhibitory activity that accumulated in the culture supematants- over time using the in vitro assay method described above.
  • Fermentation broths are centrifuged at 9000 rpm for 30 minutes. The supernatant is then fUtered through a 0.4 then a 0.2 ⁇ m filter, dUuted to a conductivity of 7.5 ms, and adjusted to pH 3 with citric add. The sample is then batch absorbed onto 200 ml of S-sepharose fast flow (Pharmada) in 50 mM sodium citrate pH 3 and stirred for 60 min. The gel is subsequently washed sequentially with 2 L of each of: 50 mM sodium citrate pH 3.0; 50 mM Tris-HCL pH 9.0; 20 mM HEPES pH 6.0.
  • the washed gel is transferred into a suitable column and eluted with a linear gradient of 0 to 1 M sodium chloride in 20 mM HEPES pH 6.0. Eluted fractions containing in vitro trypsin inhibitory activity are then pooled and further purified either by a) chromatography over a column of immobilized anhydrotrypsin (essentiaUy as described in Example 2); b) by chromatography over a column of immobiUzed bovine kaUikrein; or c) a combination of conventional chromatographic steps induding gel filtration and /or anion-exchange chromatography.
  • Bikunin protein was purified to apparent homogeniety from whole frozen placenta (Analytical Biological Services, Inc, WUmington, DE).
  • placenta (740 gm) was thawed to room temperature and cut into 0.5 to 1.0 cm pieces, placed on ice and washed with 600 ml PBS buffer. The wash was decanted and 240 ml of placenta pieces placed into a Waring blender. After adding 300 ml of buffer consisting of 0.1 M Tris (pH 8.0), and 0.1 M NaCl , the mixture was blended on high speed for 2 min, decanted into 750.0 ml centrifuge tubes, and placed on ice. This procedure was repeated until aU material was processed.
  • the combined slurry was centrifuged at 4500 x g for 60 minutes at 4°C.
  • the supernatant was filtered through cheese doth and the placental bikunin purified using a kaUikrein affinity column made by covalently attaching 70 mg of bovine pancreatic kalUkrein (Bayer AG) to 5.0 mis of CNBr activated Sepharose (Pharmada) according to manufacturers instruction.
  • the material was loaded onto the affinity column at a flow rate of 2.0 ml/min and washed with 0.1 M Tris (pH 8.0), 0.1 M NaCl until absorbance at 280 nm of the wash could no longer be detected.
  • the column was further washed with 0.1 M Tris (pH 8.0), 0.5 M NaCl and then eluted with 3 volumes of 0.2 M acetic acid, pH 4.0. Fractions containing kallikrein and trypsin inhibitory (see below) activity were pooled, frozen, and lyophUized. Placental bikunin was further purified by gel-filtration chromatography using a Superdex 75 10/30 (Pharmada) column attached to a Beckman System Gold HPLC system. Briefly, the column was equUibrated in 0.1 M Tris, 0.15 M NaCl, and 0.1% Triton X-100 at a flow rate of 0.5 ml/min.
  • the lyophUized sample was reconstituted in 1.0 ml of 0.1 M Tris, pH 8.0 and injected onto the gel-filtration column in 200 ⁇ l aliquots. Fractions were collected (0.5 ml) and assayed for trypsin and kaUikrein inhibitory activity. Active fractions were pooled, and the pH of the solution adjusted to 2.5 by addition of TFA. The material was directly applied to a Vydac C18 reverse-phase column (5 micron, 0.46 x 25 cm) which had been' equiUbrated in 20% acetonitrile in 0.1 %TFA.
  • Placental bikunin was quantified by active site titration against a known concentration of trypsin using GPK-AMC as a substrate to monitor the fraction of unbound trypsin.
  • the sample was then loaded onto a Hewlett-Packard miniature biphasic reaction column, and washed with 1 ml of 2% trifluoroacetic acid.
  • the sample was sequenced on a Hewlett-Packard Model G1005A protein sequendng system using Edman degradation. Version 3.0 sequencing methods and all reagents were supplied by Hewlett-Packard. Sequence was confirmed for 50 cydes.
  • Placental Bikunin was purified to apparent homogeniety by sequential kalUkrein affinity, gel-filtration, and reverse-phase chromatography (see purification table below):
  • 5uperdex 75 15.0 0.0085 0.13 3,191 24546 a One Unit is defined as that amount which inhibits 50% of trypsin activity in a standard assay.
  • the activity assodated with the first peak to elute from C18 (fraction 29) exhibited an amino acid sequence starting with amino add 1 of the predicted amino acid sequence of placental bikunin (ADRER...; SEQ ID NO: 1), and was identical to the predicted sequence for 50 cycles of sequencing (underlined amino adds in Figure 3). Cysteine residues within this sequence stretch were silent as expected for sequencing of oxidized protein. The cysteine residues at amino add positions 11 and 20 of mature placental bikunin were later identified from sequencing of the S-pyridylethylated protein whereupon FTH-pyridylethyl-cysteine was recovered at cydes 11 and 20.
  • Fraction 29 yielded one major sequence corresponding to that of placental bikunin starting at residue #1 (27 pmol at cyde 1) plus a minor sequence (2 pmol) also derived from placental bikunin starting at residue 6 (SIHD). This shows that the final preparation sequenced in fraction 29 is highly pure, and most likely responsible for the protease inhibitory activity associated with this fraction ( Figure 6).
  • placental bikunin on SDS- PAGE is consistent with that predicted from the fuU length coding sequence ( Figure 4F).
  • the purified protein reacted with an antibody elicited to placental bikunin (7-64) to yield a band with the same Mr (Figure 12A) as observed for the purified preparation detected on gels by silver stain ( Figure 7).
  • Figure 7 when the same preparation was reacted with an antibody elicited to synthetic placental bikunin (102-159), a band corresponding to the full length protein was not observed. Rather, a fragment that co-migrated with synthetic bikunin (102-159) of approximately 6 kDa was observed.
  • Table 6 shows the potency of in vitro inhibition of various serine proteases by placental bikunin. Data are compared with that obtained with aprotinin (Trasylol®).
  • placental bikunin isolated from a natural source (human placenta) is a potent inhibitor of trypsin-like serine proteases.
  • Each probe was labeled using ⁇ V-dCTP and a random priming labeUng kit from Boehringer Mannheim Biochemicals (Indiana), then used to hybridize to the multiple tissue northern according to the manufacturers specifications. Autoradiographs were generated using Biomax film with an 18 hr exposure time, and developed using a Umax Scanner and scanned using Adobe Photoshop.
  • placental bikunin is broadly expressed. Since the protein also contains a leader sequence it would have ample exposure to the human immune system, requiring that it become recognized as a self protein. Additional evidence for a broad tissue distribution of placental bikunin mRNA expression was derived from the fact that some of the EST entries with homology to placental bikunin (Figure 4B) were derived from human adult and infant brain, and human retina, breast, ovary, olfactory epitheUum, and placenta. It is concluded therefore that administration of the native human protein to human patients would be unUkely to elicit an immune response.
  • RT-PCR of total RNA from the foUowing human cells was determined: un-stimulated human umbiUcal vein endotheUal cells (HUVECs), HK-2 (line derived from kidney proximal tubule), TF-1 (erythroleukemia Une) and phorbolester (PMA)-stimulated human peripheral blood leukocytes.
  • Placental Bikunin (1-170) highly purified from a
  • oligonucleotide used for the mutagenesis had the sequence:
  • a stop codon (TAG) and Bgi ⁇ / Xmal site was simUarly engineered at the 3' end of the cDNA using the oUgonucleotide:
  • the stop codon was in frame with the sequence encoding placental bikunin and caused termination immediately following the Lysine at amino add residue 170, thus encoding a truncated placental bikunin fragment devoid of the putative transmembrane domain.
  • the product from digestion with Pstl and Bgi ⁇ was isolated and cloned into the BacPac ⁇ vector for expression of Placental bikunin fragment (1-170) which contains both Kunitz domains but which is truncated immediately N-terminal to the putative transmembrane segment.
  • Bikunin by Sf-9 insect ceUs was optimal at a multiplicity of infection of 1 to 1 when the medium was harvested at 72 h post infection. After harvesting, the baculovirus ceU culture supernatant (2L) was adjusted to pH 8.0 by the addition of Tris-HCl. Bikunin was purified by chromatography using a 5 ml bovine pancreatic kaUikrein affinity column as previously described in Example 7 for the purification of native placental bikunin from placenta.
  • Eluted material was adjusted to pH 2.5 with TFA and subjected to chromatography on a C18 reverse - phase column (1.0 x 25 cm) equUibrated in 10% acetonitrile in 0.1% TFA at a flow rate of 1 ml/min.
  • the bikunin was eluted with a linear gradient of 10 to 80% acetonitrile in 0.1% TFA over 40 min. Active fractions were pooled, lyophUized, redissolved in 50 mM Hepes (pH 7.5), 0.1 M NaCl, 2 mM CaC12, and 0.1% triton x-100, and stored at -20°C until needed.
  • the concentration of recombinant bikunin was determined by amino acid analysis.
  • ADRERSIHDFCLVSKWGRC 20 pmol 1 - 20 (SEQIDNO:64)
  • FNYeEYCTANAVTGPCRASF 16 pmol 100 - 119 (SEQIDNO:65)
  • N-terminii corresponding to each of the expected four fragments were recovered.
  • Sf9 expressed protein contained the entire ectodomain sequence of placental bikunin (1-170).
  • N-terminal sequencing (50 cycles) of an additional sample of undigested Placental Bikunin (1-170) resulted in an amino add sequence which at cycle 30 was devoid of any PTH-amino add (PTH-asparagine was expected).
  • a simUar result was obtained upon sequendng of the natural protein from human placenta (Example 7) and is consistent with this residue being glycosylated as predicted from the amino add sequence surrounding this asparagine residue.
  • cysteine residues within this region were also sUent consistent with their pulppation in disulfide bonding.
  • Example 10 Inhibition specificity of purified placental bikunin derived from Sf9 cells.
  • the in vitro specificity of recombinant bikunin was determined using the materials and methods as described in Examples 3, 4 and 7.
  • the inhibition of human tissue kalUkrein by bikunin was measured by the incubation of 0.35 nM human tissue kaUikrein recombinant bikunin in buffer containing 50 mM Tris (pH 9.0), 50 mM NaCl, and 0.01% triton x-100. After 5 min. at 37°C, 5 ⁇ l of 2 mM PFR-AMC was added and the change in fluorescence monitored.
  • tissue plasminogen activator tPA (single chain form from human melanoma cell culture from Sigma Chemical Co, St Louis, MO) was pre-incubated with inhibitor for 2 hr at room temperature in 20 mM Tris buffer pH 7.2 containing 150 mM NaCl, and 0.02% sodium azide.
  • Reactions were subsequently initiated by transfer to a reaction system comprising the foUowing initial component concentrations: tPA (7.5 nM), inhibitor 0 to 6.6 ⁇ M, DDe-Lpro-Larg-pNitroaniUne (ImM) in 28 mM Tris buffer pH 8.5 containing 0.004 % (v/v) triton x-100 and 0.005% (v/v) sodium azide. Formation of p-NitroaniUne was determined from the A405nm measured foUowing incubation at 37 C for 2hr.
  • APTT activated partial thromboplastin time

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Neurology (AREA)
  • Hematology (AREA)
  • Zoology (AREA)
  • Neurosurgery (AREA)
  • Diabetes (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Oncology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Cardiology (AREA)
  • Wood Science & Technology (AREA)
  • Epidemiology (AREA)
  • Plant Pathology (AREA)
  • Psychiatry (AREA)
  • Vascular Medicine (AREA)
  • Immunology (AREA)
  • Urology & Nephrology (AREA)
  • Physics & Mathematics (AREA)
PCT/US1997/003894 1996-03-11 1997-03-10 Human bikunin Ceased WO1997033996A2 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
HU9902698A HU226419B1 (en) 1996-03-11 1997-03-10 Human bikunin
HK00105468.2A HK1026232B (en) 1996-03-11 1997-03-10 Human bikunin
PL97328822A PL188387B1 (pl) 1996-03-11 1997-03-10 Białko o aktywności hamującej proteazę serynową, kompozycja farmaceutyczna, wyodrębniona sekwencja,samopowtarzający się wektor, zastosowanie białka o aktywności proteazy serynowej, sposób hamowania aktywności proteazy serynowej ex vivo i sposób wytwarzania białka
IL126115A IL126115A (en) 1996-03-11 1997-03-10 Significantly purified protein with suppressive activity for sirin protease and its pharmaceutical preparations
JP53280497A JP3469584B2 (ja) 1996-03-11 1997-03-10 ヒト ビクニン
SI9730747T SI0891426T1 (sl) 1996-03-11 1997-03-10 Humani bikunin
NZ331540A NZ331540A (en) 1996-03-11 1997-03-10 Human bikunin
DE69735996T DE69735996T2 (de) 1996-03-11 1997-03-10 Menschlicher bikunin
EP97915029A EP0891426B1 (en) 1996-03-11 1997-03-10 Human bikunin
BR9708021A BR9708021A (pt) 1996-03-11 1997-03-10 Proteína substancialmente purificada composição farmacêutica sequência de ácido nucleico isolada vetor de express o de protéina auto-replicante e processos para inibir a atividade de protéinas de serina tratar uma condição e preparar um medicamento de uma proteína
AU22077/97A AU716923B2 (en) 1996-03-11 1997-03-10 Human bikunin
US09/144,428 US6583108B1 (en) 1996-03-11 1998-08-31 Human bikunin
US09/974,026 US7019123B2 (en) 1996-03-11 2001-10-10 Human bikunin
US11/390,775 US7452859B2 (en) 1996-03-11 2006-03-27 Human bikunin

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US1310696P 1996-03-11 1996-03-11
US60/013,106 1996-03-11
US1979396P 1996-06-14 1996-06-14
US60/019,793 1996-06-14
US72525196A 1996-10-04 1996-10-04
US08/725,251 1996-10-04

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US72525196A Continuation-In-Part 1996-03-11 1996-10-04

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US09/144,428 Continuation-In-Part US6583108B1 (en) 1996-03-11 1998-08-31 Human bikunin

Publications (3)

Publication Number Publication Date
WO1997033996A2 true WO1997033996A2 (en) 1997-09-18
WO1997033996A3 WO1997033996A3 (en) 1997-11-13
WO1997033996A9 WO1997033996A9 (en) 1998-05-22

Family

ID=27359773

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US1997/003894 Ceased WO1997033996A2 (en) 1996-03-11 1997-03-10 Human bikunin

Country Status (27)

Country Link
US (3) US6583108B1 (https=)
EP (1) EP0891426B1 (https=)
JP (2) JP3469584B2 (https=)
KR (1) KR100356956B1 (https=)
AR (3) AR006188A1 (https=)
AT (1) ATE328083T1 (https=)
AU (1) AU716923B2 (https=)
BR (1) BR9708021A (https=)
CA (1) CA2247888A1 (https=)
CO (1) CO4600683A1 (https=)
DE (1) DE69735996T2 (https=)
DK (1) DK0891426T3 (https=)
ES (1) ES2263174T3 (https=)
HR (1) HRP970144B1 (https=)
HU (1) HU226419B1 (https=)
ID (1) ID16224A (https=)
IL (1) IL126115A (https=)
IN (1) IN192874B (https=)
MY (1) MY120693A (https=)
NZ (1) NZ331540A (https=)
PA (1) PA8426301A1 (https=)
PL (1) PL188387B1 (https=)
PT (1) PT891426E (https=)
SV (1) SV1997000018A (https=)
TR (1) TR199801794T2 (https=)
WO (1) WO1997033996A2 (https=)
YU (1) YU8997A (https=)

Cited By (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998033920A3 (en) * 1997-01-31 1998-11-05 Human Genome Sciences Inc Tissue factor pathway inhibitor-3
WO2000037099A3 (en) * 1998-12-22 2000-10-26 Bayer Ag Method for accelerating the rate of mucociliary clearance by using a kunitz-type serine protease inhibitor
US6489308B1 (en) 1999-03-05 2002-12-03 Trustees Of University Of Technology Corporation Inhibitors of serine protease activity, methods and compositions for treatment of nitric-oxide-induced clinical conditions
US6583108B1 (en) 1996-03-11 2003-06-24 Bayer Corporation Human bikunin
WO2005010046A1 (en) 2003-06-27 2005-02-03 Bayer Pharmaceuticals Corporation Use of molecular chaperones for the enhanced production of secreted, recombinant proteins in mammalian cells
EP1539985A4 (en) * 2001-11-05 2006-06-28 Curagen Corp THERAPEUTIC POLYPEPTIDES, NUCLEIC ACIDS ENCODING THESE POLYPEPTIDES, AND METHODS OF USE
WO2006086870A1 (en) * 2005-02-18 2006-08-24 Angiochem Inc. Aprotinin polypeptides for transporting a compound across the blood-brain barrier
WO2007079096A2 (en) 2005-12-29 2007-07-12 Dyax Corp. Protease inhibition
WO2008077478A1 (en) * 2006-12-22 2008-07-03 Bayer Schering Pharma Aktiengesellschaft Preparation and use of variants of the kunitz domain 2 of the human placental bikunin gene
US7704958B1 (en) 1999-03-05 2010-04-27 Bio Holding, Inc. Methods and compositions for inhibiting apoptosis using serine protease inhibitors
US7850970B2 (en) 2003-08-26 2010-12-14 The Regents Of The University Of Colorado Inhibitors of serine protease activity and their use in methods and compositions for treatment of bacterial infections
US8637454B2 (en) 2009-01-06 2014-01-28 Dyax Corp. Treatment of mucositis with kallikrein inhibitors
US8663629B2 (en) 1994-01-11 2014-03-04 Dyax Corp. Kallikrein-binding “kunitz domain” proteins and analogues thereof
US8710007B2 (en) 2002-06-07 2014-04-29 Dyax Corp. Prevention and reduction of blood loss
US8716225B2 (en) 2004-09-27 2014-05-06 Dyax Corp. Kallikrein inhibitors and anti-thrombolytic agents and uses thereof
US8822653B2 (en) 2010-01-06 2014-09-02 Dyax Corp. Plasma kallikrein binding proteins
US8969310B2 (en) 2005-07-15 2015-03-03 Angiochem Inc. Potentiation of anticancer agents
US9114144B2 (en) 2002-06-07 2015-08-25 Dyax Corp. Kallikrein-inhibitor therapies
US9687561B2 (en) 2012-08-14 2017-06-27 Angiochem Inc. Peptide-dendrimer conjugates and uses thereof
US20170189366A1 (en) * 2006-11-07 2017-07-06 Case Western Reserve University Method for treating disorders related to complement activation
US9914754B2 (en) 2008-12-05 2018-03-13 Angiochem Inc. Conjugates of neurotensin or neurotensin analogs and uses thereof
US9938353B2 (en) 2011-06-24 2018-04-10 The Regents Of The University Of Colorado, A Body Corporate Compositions, methods and uses for alpha-1 antitrypsin fusion molecules
US10370453B2 (en) 2011-01-06 2019-08-06 Dyax Corp. Plasma kallikrein binding proteins
US10478508B2 (en) 2012-01-10 2019-11-19 The Regents Of The University Of Colorado, A Body Corporate Compositions, methods and uses for alpha-1 antitrypsin fusion molecules
US10980892B2 (en) 2015-06-15 2021-04-20 Angiochem Inc. Methods for the treatment of leptomeningeal carcinomatosis
US11286307B2 (en) 2015-12-11 2022-03-29 Takeda Pharmaceutical Company Limited Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
US12528880B2 (en) 2020-01-13 2026-01-20 Takeda Pharmaceutical Company Limited Plasma kallikrein inhibitors and uses thereof for treating pediatric hereditary angioedema attack

Families Citing this family (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE69632435T2 (de) * 1995-07-24 2005-05-12 Mitsubishi Chemical Corp. Inhibitor des Hepatozytwachstumsfaktoraktivators
US20040235715A1 (en) * 1999-11-12 2004-11-25 Bayer Corporation Method of producing glycosylated bikunin
IL140993A0 (en) 2000-05-15 2002-02-10 Bayer Ag Trypsin substrate and diagnostic device, and method of using same
IL140994A (en) * 2000-05-15 2005-12-18 Bayer Ag Urinary trypsin inhibitor assay containing a chelating agent
US6955921B2 (en) * 2001-04-30 2005-10-18 Bayer Corporation Trypsin substrate and diagnostic device, and method of using same
WO2004060403A2 (en) 2003-01-06 2004-07-22 Angiochem Inc. Aprotinin and anglos as carriers across the blood-brain barrier
US8460243B2 (en) 2003-06-10 2013-06-11 Abbott Diabetes Care Inc. Glucose measuring module and insulin pump combination
US7722536B2 (en) 2003-07-15 2010-05-25 Abbott Diabetes Care Inc. Glucose measuring device integrated into a holster for a personal area network device
JP2007518426A (ja) * 2003-10-10 2007-07-12 マルチセル テクノロジーズ、インコーポレイテッド 不死化肝細胞
WO2005040222A1 (en) * 2003-10-16 2005-05-06 Bayer Healthcare Llc Monoclonal antibodies for detection of urinary trypsin inhibitors
EP1586587A1 (en) * 2004-04-16 2005-10-19 Exonhit Therapeutics SA Compositions and methods for detecting angiogenesis
WO2005119524A2 (en) 2004-06-04 2005-12-15 Therasense, Inc. Diabetes care host-client architecture and data management system
US20090016959A1 (en) * 2005-02-18 2009-01-15 Richard Beliveau Delivery of antibodies to the central nervous system
WO2007011693A2 (en) * 2005-07-14 2007-01-25 Medistem Laboratories, Inc. Compositions of placentally-derived stem cells for the treatment of cancer
US8093017B2 (en) * 2005-12-07 2012-01-10 Siemens Heathcare Diagnostics Inc. Detection of soluble adiponectin receptor peptides and use in diagnostics and therapeutics
CA2663545A1 (en) * 2006-09-19 2008-03-27 Phylogica Limited Neuroprotective peptide inhibitors of ap-1 signaling and uses thereof
US9365634B2 (en) 2007-05-29 2016-06-14 Angiochem Inc. Aprotinin-like polypeptides for delivering agents conjugated thereto to tissues
US8822409B2 (en) * 2007-06-20 2014-09-02 Phylogica Limited Compositions and uses thereof for the treatment of acute respiratory distress syndrome (ARDS) and clinical disorders associated with therewith
US20090075887A1 (en) * 2007-08-21 2009-03-19 Genzyme Corporation Treatment with Kallikrein Inhibitors
DE102007056231A1 (de) 2007-09-08 2009-03-12 Bayer Healthcare Ag Herstellung und Verwendung von Varianten humander Kunitz-Typ Protease-Inhibitoren (hKTPI)
MX355683B (es) * 2008-04-18 2018-04-26 Angiochem Inc Composiciones farmacéuticas de paclitaxel, análogos de paclitaxel o conjugados de paclitaxel, y métodos relacionados de preparación y uso.
WO2010043049A1 (en) 2008-10-15 2010-04-22 Angiochem Inc. Etoposide and doxorubicin conjugates for drug delivery
CA2740316A1 (en) 2008-10-15 2010-04-22 Angiochem Inc. Conjugates of glp-1 agonists and uses thereof
US8853353B2 (en) 2008-12-17 2014-10-07 Angiochem, Inc. Membrane type-1 matrix metalloprotein inhibitors and uses thereof
MX2011011023A (es) 2009-04-20 2012-01-20 Angiochem Inc Tratamiento de cancer de ovarios usando un agente anti-cancer conjugado con un analogo de angiopep-2.
RU2012103240A (ru) 2009-07-02 2013-08-10 Ангиокем Инк. Мультимерные пептидные конъюгаты и их применение
EP2371857A1 (en) * 2010-04-01 2011-10-05 CSL Behring GmbH Factor XII inhibitors for treating interstitial lung disease
US10136845B2 (en) 2011-02-28 2018-11-27 Abbott Diabetes Care Inc. Devices, systems, and methods associated with analyte monitoring devices and devices incorporating the same
PL3110434T3 (pl) 2014-02-24 2019-01-31 Takeda Gmbh Białka fuzyjne uti
US10428158B2 (en) 2014-03-27 2019-10-01 Dyax Corp. Compositions and methods for treatment of diabetic macular edema
US11725043B2 (en) 2020-03-05 2023-08-15 DiaMedica USA Inc. Ulinastatin polypeptides

Family Cites Families (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5223482A (en) 1986-11-17 1993-06-29 Scios Nova Inc. Recombinant Alzheimer's protease inhibitory amyloid protein and method of use
US5106833A (en) 1987-07-23 1992-04-21 Washington University Coagulation inhibitors
US5663143A (en) 1988-09-02 1997-09-02 Dyax Corp. Engineered human-derived kunitz domains that inhibit human neutrophil elastase
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
DK0401508T3 (da) * 1989-05-13 1995-05-15 Bayer Ag Proteaseinhibitorer, fremgangsmåde til deres fremstilling samt lægemidler med indhold deraf
DK408089D0 (da) 1989-08-18 1989-08-18 Novo Nordisk As Proteiner
DE69117545T2 (de) 1990-01-25 1996-10-31 Univ Washington Faktor X-LACI-Hybridprotein
AU1581692A (en) 1991-03-01 1992-10-06 Protein Engineering Corporation Inhibitors of human neutrophil elastase and human cathepsin g
RU2054180C1 (ru) 1991-08-21 1996-02-10 Жирнов Олег Петрович (н/п) Способ лечения вирусных респираторных инфекций
IL104325A (en) 1992-01-07 2000-10-31 Novo Nordisk As Variants of human kunitz-type protease inhibitor domain II of tissue factor pathway inhibitor (TFPI) pharmaceutical compositions containing them a DNA construct encoding them their expression vectors a cell containing said DNA constructs and methods for the production of all the above
IL104326A0 (en) 1992-01-07 1993-05-13 Novo Nordisk As Variant of human kunitz-type protease inhibitor
JPH07509229A (ja) 1992-07-13 1995-10-12 コルバス・インターナショナル、インコーポレイテッド ウシ膵トリプシン阻害因子から誘導される因子Xaの阻害因子
US5436153A (en) 1992-12-02 1995-07-25 Sprecher; Cindy A. Human amyloid protein precursor homolog and Kunitz-type inhibitor
WO1994012637A2 (en) 1992-12-02 1994-06-09 Zymogenetics, Inc. Novel human amyloid protein precursor homologue and kunitz-type inhibitors
JP2769083B2 (ja) 1993-02-22 1998-06-25 日清食品株式会社 エラスターゼ阻害活性を有する新規ペプチドおよびその製造方法
US5455338A (en) 1993-11-05 1995-10-03 Zymogenetics, Inc. DNA encoding novel human kunitz-type inhibitors and methods relating thereto
WO1995021601A2 (en) 1994-01-11 1995-08-17 Protein Engineering Corporation Kallikrein-inhibiting 'kunitz domain' proteins and analogues thereof
ATE277081T1 (de) 1994-01-11 2004-10-15 Dyax Corp Inhibitoren des humanplasmins, die sich von den kunitz domänen ableiten
US5795954A (en) 1994-03-04 1998-08-18 Genentech, Inc. Factor VIIa inhibitors from Kunitz domain proteins
WO1996003503A1 (en) 1994-07-21 1996-02-08 The Green Cross Corporation Process for producing urinary trypsin inhibitor and domains thereof, novel polypeptide related to the both, and process for producing the polypeptide
US5541228A (en) * 1994-10-14 1996-07-30 Bristol-Myers Squibb Co. Melatonergic agents
KR19990008458A (ko) 1995-05-08 1999-01-25 쉬어러 피터 알. 쿠니츠(kunitz) 타입 프로테아제 억제 물질
US5786328A (en) 1995-06-05 1998-07-28 Genentech, Inc. Use of kunitz type plasma kallikrein inhibitors
DE69632435T2 (de) 1995-07-24 2005-05-12 Mitsubishi Chemical Corp. Inhibitor des Hepatozytwachstumsfaktoraktivators
US5736364A (en) 1995-12-04 1998-04-07 Genentech, Inc. Factor viia inhibitors
JP3469584B2 (ja) 1996-03-11 2003-11-25 バイエル コーポレイション ヒト ビクニン
JP2001504709A (ja) 1997-01-31 2001-04-10 ヒューマン ジノーム サイエンシーズ,インコーポレイテッド 組織因子経路インヒビター3
US6294648B1 (en) * 1999-07-20 2001-09-25 Bayer Corporation Protein having proteinase inhibitor activity

Cited By (66)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8663629B2 (en) 1994-01-11 2014-03-04 Dyax Corp. Kallikrein-binding “kunitz domain” proteins and analogues thereof
US6583108B1 (en) 1996-03-11 2003-06-24 Bayer Corporation Human bikunin
US7452859B2 (en) 1996-03-11 2008-11-18 Aerovance, Inc. Human bikunin
US7019123B2 (en) 1996-03-11 2006-03-28 Bayer Corporation Human bikunin
US6548262B2 (en) 1997-01-31 2003-04-15 Human Genome Sciences, Inc. Methods of measuring tissue factor pathway inhibitor-3
US6262233B1 (en) * 1997-01-31 2001-07-17 Human Genome Sciences, Inc. Tissue factor pathway inhibitor-3
US6916629B2 (en) * 1997-01-31 2005-07-12 Human Genome Sciences, Inc. Tissue factor pathway inhibitor-3
WO1998033920A3 (en) * 1997-01-31 1998-11-05 Human Genome Sciences Inc Tissue factor pathway inhibitor-3
AU758832B2 (en) * 1998-12-22 2003-04-03 Bayer Aktiengesellschaft Method for accelerating the rate of mucociliary clearance
EP1374891A1 (en) * 1998-12-22 2004-01-02 Bayer Aktiengesellschaft Method for accelerating the rate of mucociliary clearance
WO2000037099A3 (en) * 1998-12-22 2000-10-26 Bayer Ag Method for accelerating the rate of mucociliary clearance by using a kunitz-type serine protease inhibitor
US7704958B1 (en) 1999-03-05 2010-04-27 Bio Holding, Inc. Methods and compositions for inhibiting apoptosis using serine protease inhibitors
US6489308B1 (en) 1999-03-05 2002-12-03 Trustees Of University Of Technology Corporation Inhibitors of serine protease activity, methods and compositions for treatment of nitric-oxide-induced clinical conditions
US8071551B2 (en) 1999-03-05 2011-12-06 BioHolding, Inc. Methods and compositions for treating diabetes
EP1539985A4 (en) * 2001-11-05 2006-06-28 Curagen Corp THERAPEUTIC POLYPEPTIDES, NUCLEIC ACIDS ENCODING THESE POLYPEPTIDES, AND METHODS OF USE
US10245307B2 (en) 2002-06-07 2019-04-02 Dyax Corp. Prevention and reduction of blood loss
US9114144B2 (en) 2002-06-07 2015-08-25 Dyax Corp. Kallikrein-inhibitor therapies
US11344610B2 (en) 2002-06-07 2022-05-31 Takeda Pharmaceutical Company Limited Prevention and reduction of blood loss
US9480733B2 (en) 2002-06-07 2016-11-01 Dyax Corp. Prevention and reduction of blood loss
US8710007B2 (en) 2002-06-07 2014-04-29 Dyax Corp. Prevention and reduction of blood loss
US7244616B2 (en) 2003-06-27 2007-07-17 Bayer Pharmaceuticals Corporation Use of molecular chaperones for the enhanced production of secreted, recombinant proteins in mammalian cells
US8772027B2 (en) 2003-06-27 2014-07-08 Bayer Pharmaceuticals Corporation Use of molecular chaperones for the enhanced production of secreted, recombinant proteins in mammalian cells
US7951588B2 (en) 2003-06-27 2011-05-31 Bayer Pharmaceuticals Corporation Use of molecular chaperones for the enhanced production of secreted, recombinant proteins in mammalian cells
EP2338911A1 (en) 2003-06-27 2011-06-29 Bayer Pharmaceuticals Corporation Use of molecular chaperones for the enhanced production of secreted, recombinant proteins in mammalian cells
US9284591B2 (en) 2003-06-27 2016-03-15 Bayer Healthcare Llc Use of molecular chaperones for the enhanced production of secreted, recombinant proteins in mammalian cells
US8765466B2 (en) 2003-06-27 2014-07-01 Bayer Pharmaceuticals Corporation Use of molecular chaperones for the enhanced production of secreted, recombinant proteins in mammalian cells
US8192985B2 (en) 2003-06-27 2012-06-05 Bayer Pharmaceuticals Corporation Use of molecular chaperones for the enhanced production of secreted, recombinant proteins in mammalian cells
EP2808341A1 (en) 2003-06-27 2014-12-03 Bayer Pharmaceuticals Corporation Use of molecular chaperones for the enhanced production of secreted, recombinant proteins in mammalian cells
US8409857B1 (en) 2003-06-27 2013-04-02 Bayer Pharmaceuticals Corporation Use of molecular chaperones for the enhanced production of secreted, recombinant proteins in mammalian cells
WO2005010046A1 (en) 2003-06-27 2005-02-03 Bayer Pharmaceuticals Corporation Use of molecular chaperones for the enhanced production of secreted, recombinant proteins in mammalian cells
EP2520654A1 (en) 2003-08-26 2012-11-07 The Regents of the University of Colorado Inhibitors of serine protease activity and their use in methods and compositions for treatment of bacterial infections
US9499606B2 (en) 2003-08-26 2016-11-22 The Regents Of The University Of Colorado, A Body Corporate Compositions of, and methods for, alpha-1 anti trypsin Fc fusion molecules
US8633305B2 (en) 2003-08-26 2014-01-21 Leland Shapiro Compositions of, and methods for, alpha-1 anti trypsin Fc fusion molecules
US9695229B2 (en) 2003-08-26 2017-07-04 The Regents Of The University Of Colorado, A Body Corporate Compositions of, and methods for, alpha-1 antitrypsin Fc fusion molecules
EP3192872A1 (en) 2003-08-26 2017-07-19 The Regents of the University of Colorado, a body corporate Inhibitors of serine protease activity and their use in methods and compositions for treatment of bacterial infections
US7850970B2 (en) 2003-08-26 2010-12-14 The Regents Of The University Of Colorado Inhibitors of serine protease activity and their use in methods and compositions for treatment of bacterial infections
US10913790B2 (en) 2003-08-26 2021-02-09 The Regents Of The University Of Colorado, A Body Corporate Compositions of, and methods for, alpha-1 anti trypsin Fc fusion molecules
US8716225B2 (en) 2004-09-27 2014-05-06 Dyax Corp. Kallikrein inhibitors and anti-thrombolytic agents and uses thereof
US9757437B2 (en) 2004-09-27 2017-09-12 Dyax Corp. Kallikrein inhibitors and anti-thrombolytic agents and uses thereof
US7557182B2 (en) 2005-02-18 2009-07-07 Angiochem Inc. Molecules for transporting a compound across the blood-brain barrier
AU2005327497B2 (en) * 2005-02-18 2012-04-12 Angiochem Inc. Aprotinin polypeptides for transporting a compound across the blood-brain barrier
WO2006086870A1 (en) * 2005-02-18 2006-08-24 Angiochem Inc. Aprotinin polypeptides for transporting a compound across the blood-brain barrier
US8828949B2 (en) 2005-02-18 2014-09-09 Angiochem, Inc. Aprotinin polypeptides for transporting a compound across the blood-brain barrier
US7902156B2 (en) 2005-02-18 2011-03-08 Angiochem Inc. Aprotinin polypeptides for transporting a compound across the blood-brain barrier
US8969310B2 (en) 2005-07-15 2015-03-03 Angiochem Inc. Potentiation of anticancer agents
US9713646B2 (en) 2005-07-15 2017-07-25 Angiochem Inc. Potentiation of anticancer agents
WO2007079096A2 (en) 2005-12-29 2007-07-12 Dyax Corp. Protease inhibition
EP1981519A4 (en) * 2005-12-29 2010-01-06 Dyax Corp PROTEASE INHIBITION
US8828703B2 (en) 2005-12-29 2014-09-09 Dyax Corp. Protease inhibition
US20170189366A1 (en) * 2006-11-07 2017-07-06 Case Western Reserve University Method for treating disorders related to complement activation
WO2008077478A1 (en) * 2006-12-22 2008-07-03 Bayer Schering Pharma Aktiengesellschaft Preparation and use of variants of the kunitz domain 2 of the human placental bikunin gene
US9914754B2 (en) 2008-12-05 2018-03-13 Angiochem Inc. Conjugates of neurotensin or neurotensin analogs and uses thereof
US8637454B2 (en) 2009-01-06 2014-01-28 Dyax Corp. Treatment of mucositis with kallikrein inhibitors
US8822653B2 (en) 2010-01-06 2014-09-02 Dyax Corp. Plasma kallikrein binding proteins
US10336832B2 (en) 2010-01-06 2019-07-02 Dyax Corp. Methods of inhibiting plasma kallikrein in edema patient
US11505620B2 (en) 2010-01-06 2022-11-22 Takeda Pharmaceutical Company Limited Methods of detecting plasma kallikrein
US12460016B2 (en) 2010-01-06 2025-11-04 Takeda Pharmaceutical Company Limited Plasma kallikrein binding proteins
US10370453B2 (en) 2011-01-06 2019-08-06 Dyax Corp. Plasma kallikrein binding proteins
US11401346B2 (en) 2011-01-06 2022-08-02 Takeda Pharmaceutical Company Limited Nucleic acids encoding plasma kallikrein binding proteins
US9938353B2 (en) 2011-06-24 2018-04-10 The Regents Of The University Of Colorado, A Body Corporate Compositions, methods and uses for alpha-1 antitrypsin fusion molecules
US12030958B2 (en) 2011-06-24 2024-07-09 The Regents Of The University Of Colorado Compositions and methods of use of alpha-1 antitrypsin fusion polypeptides
US10478508B2 (en) 2012-01-10 2019-11-19 The Regents Of The University Of Colorado, A Body Corporate Compositions, methods and uses for alpha-1 antitrypsin fusion molecules
US9687561B2 (en) 2012-08-14 2017-06-27 Angiochem Inc. Peptide-dendrimer conjugates and uses thereof
US10980892B2 (en) 2015-06-15 2021-04-20 Angiochem Inc. Methods for the treatment of leptomeningeal carcinomatosis
US11286307B2 (en) 2015-12-11 2022-03-29 Takeda Pharmaceutical Company Limited Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
US12528880B2 (en) 2020-01-13 2026-01-20 Takeda Pharmaceutical Company Limited Plasma kallikrein inhibitors and uses thereof for treating pediatric hereditary angioedema attack

Also Published As

Publication number Publication date
US7452859B2 (en) 2008-11-18
NZ331540A (en) 1999-10-28
AU716923B2 (en) 2000-03-09
KR100356956B1 (ko) 2003-03-15
PL188387B1 (pl) 2005-01-31
HUP9902698A2 (hu) 1999-11-29
IL126115A0 (en) 1999-05-09
CO4600683A1 (es) 1998-05-08
HRP970144B1 (en) 2004-10-31
DK0891426T3 (da) 2006-10-02
JP2001521367A (ja) 2001-11-06
US20060172946A1 (en) 2006-08-03
TR199801794T2 (xx) 2000-07-21
AU2207797A (en) 1997-10-01
IL126115A (en) 2007-03-08
US7019123B2 (en) 2006-03-28
JP3469584B2 (ja) 2003-11-25
JP2004000208A (ja) 2004-01-08
US20030194398A1 (en) 2003-10-16
IN192874B (https=) 2004-05-29
ATE328083T1 (de) 2006-06-15
BR9708021A (pt) 1999-07-27
KR19990087697A (ko) 1999-12-27
HUP9902698A3 (en) 2001-06-28
ID16224A (id) 1997-09-11
YU8997A (sh) 1999-09-27
PL328822A1 (en) 1999-02-15
CA2247888A1 (en) 1997-09-18
AR053063A2 (es) 2007-04-18
EP0891426A2 (en) 1999-01-20
AR006188A1 (es) 1999-08-11
EP0891426B1 (en) 2006-05-31
DE69735996D1 (de) 2006-07-06
ES2263174T3 (es) 2006-12-01
PA8426301A1 (es) 2000-05-24
DE69735996T2 (de) 2007-02-15
PT891426E (pt) 2006-10-31
HRP970144A2 (en) 1998-04-30
WO1997033996A3 (en) 1997-11-13
US6583108B1 (en) 2003-06-24
MY120693A (en) 2005-11-30
HU226419B1 (en) 2008-12-29
AR058982A1 (es) 2008-03-05
SV1997000018A (es) 1999-01-14

Similar Documents

Publication Publication Date Title
EP0891426B1 (en) Human bikunin
WO1997033996A9 (en) Human bikunin
AU675925B2 (en) A human kunitz-type protease inhibitor variant
US5935854A (en) Human amyloid protein precursor homolog and kunitz-type inhibitor
CA2127248A1 (en) Human kunitz-type protease inhibitor variants
US5621074A (en) Aprotinin analogs
IE913433A1 (en) Aprotinin analogues
EP1140150B1 (en) Method for accelerating the rate of mucociliary clearance by using a kunitz-type serine protease inhibitor
MX2008011350A (es) Dominios kunitz quimericos y su uso.
EP1752538A1 (en) Human bikunin
Brinkmann et al. Strong crossreaction of human anti-aprotinin antibodies from heart transplant patient with [Arg15] aprotinin
TW555764B (en) Human bikunin
CA2407668A1 (en) Human bikunin
US20070140979A1 (en) Method for accelerating the rate of mucociliary clearance
MXPA98007060A (en) Bikunina hum
HK1026232B (en) Human bikunin
HK1026232A1 (en) Human bikunin

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 97194556.X

Country of ref document: CN

AK Designated states

Kind code of ref document: A2

Designated state(s): AL AM AT AU AZ BB BG BR BY CA CH CN CZ DE DK EE ES FI GB GE HU IL IS JP KE KG KP KR KZ LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK TJ TM TR TT UA UG US US US UZ VN AM AZ BY KG KZ MD RU TJ TM

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH KE LS MW SD SZ UG AT BE CH DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG

DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
121 Ep: the epo has been informed by wipo that ep was designated in this application
COP Corrected version of pamphlet

Free format text: PAGES 1, 3-64, DESCRIPTION, REPLACED BY NEW PAGES 1, 3-64; PAGES 65-68, CLAIMS, REPLACED BY NEW PAGES 65-68; PAGES 7/41-26/41, 33/41, 34/41 AND 36/41-40/41, DRAWINGS, REPLACED BY NEW PAGES 7/41-26/41, 33/41, 34/41 AND 36/41-40/41; DUE TO LATE TRANSMITTAL BY THE RECEIVING OFFICE

WWE Wipo information: entry into national phase

Ref document number: 331540

Country of ref document: NZ

ENP Entry into the national phase

Ref document number: 2247888

Country of ref document: CA

Ref document number: 2247888

Country of ref document: CA

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: PA/a/1998/007060

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 09144428

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 1997915029

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 1998/01794

Country of ref document: TR

WWE Wipo information: entry into national phase

Ref document number: 1019980707163

Country of ref document: KR

WWP Wipo information: published in national office

Ref document number: 1997915029

Country of ref document: EP

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

WWP Wipo information: published in national office

Ref document number: 1019980707163

Country of ref document: KR

WWG Wipo information: grant in national office

Ref document number: 1019980707163

Country of ref document: KR

WWG Wipo information: grant in national office

Ref document number: 1997915029

Country of ref document: EP