US20170240617A1 - Formulations of antibody molecules to influenza virus - Google Patents

Formulations of antibody molecules to influenza virus Download PDF

Info

Publication number
US20170240617A1
US20170240617A1 US15/440,381 US201715440381A US2017240617A1 US 20170240617 A1 US20170240617 A1 US 20170240617A1 US 201715440381 A US201715440381 A US 201715440381A US 2017240617 A1 US2017240617 A1 US 2017240617A1
Authority
US
United States
Prior art keywords
seq
antibody molecule
sequence
formulation
variable region
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/440,381
Other languages
English (en)
Inventor
Susan Sloan
Bi Xu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Visterra Inc
Original Assignee
Visterra Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Visterra Inc filed Critical Visterra Inc
Priority to US15/440,381 priority Critical patent/US20170240617A1/en
Assigned to Visterra, Inc. reassignment Visterra, Inc. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: XU, Bi, SLOAN, SUSAN
Publication of US20170240617A1 publication Critical patent/US20170240617A1/en
Priority to US16/518,536 priority patent/US20200181243A1/en
Priority to US17/091,756 priority patent/US12202885B2/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/108Orthomyxoviridae (F), e.g. influenza virus
    • C07K16/1018
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39591Stabilisation, fragmentation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/02Inorganic compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/12Carboxylic acids; Salts or anhydrides thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/16Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
    • A61K47/18Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
    • A61K47/183Amino acids, e.g. glycine, EDTA or aspartame
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/16Antivirals for RNA viruses for influenza or rhinoviruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]

Definitions

  • Influenza is an infectious disease caused by RNA viruses of the family Orthomyxoviridae (the influenza viruses). Influenza viruses are classified based on core protein into three genera A, B and C that are further divided into subtypes determined by the viral envelope glycoproteins haemagglutinin (HA) and neuraminidase (NA). Influenza A viruses infect a range of mammalian and avian species, whereas type B and C infections are largely restricted to humans. Only types A and B cause human disease of any concern.
  • Antigenic drift enables the virus to evade immune recognition, resulting in repeated influenza outbreaks during interpandemic years.
  • Major changes in the HA antigen (“antigenic shift”) are caused by reassortment of genetic material from different influenza A subtypes. Antigenic shifts resulting in new pandemic strains are rare events, occurring through reassortment between animal and human subtypes, for example in co-infected pigs.
  • the disclosure is based, at least in part, on the discovery of human anti-HA antibodies comprising functional and structural properties disclosed herein, e.g., antibodies that bind a conserved region or epitope on influenza virus and uses thereof.
  • a binding agent e.g., an antibody molecule
  • a binding agent is broad spectrum, and binds more than one HA, e.g., an HA from one or both of Group 1 or Group 2 strains of influenza A viruses and/or one or more strains of influenza B viruses. Therefore, in an embodiment, a binding agent, e.g., an antibody molecule, disclosed herein can treat or prevent infection by a Group 1 influenza virus and a Group 2 influenza virus.
  • a binding agent e.g., an antibody molecule, disclosed herein can treat or prevent infection by an influenza A virus and an influenza B virus.
  • the binding agents e.g., antibody molecules, share sufficient structural similarity with antibodies or variable regions disclosed herein, such that they possess functional attributes of the antibodies disclosed herein.
  • the structural similarity can be in terms of a three dimensional structure or a linear amino acid sequence, or both.
  • the disclosure features a formulation, e.g., a pharmaceutical formulation, comprising an anti-HA antibody molecule described herein, e.g., an antibody molecule comprising one, two, or three heavy chain (HC) CDRs and/or one, two, or three light chain (LC) CDRs of Ab 044, a buffering agent, and a tonicity agent.
  • an anti-HA antibody molecule described herein e.g., an antibody molecule comprising one, two, or three heavy chain (HC) CDRs and/or one, two, or three light chain (LC) CDRs of Ab 044, a buffering agent, and a tonicity agent.
  • HC heavy chain
  • LC light chain
  • the antibody molecule is present at a concentration of about 5 mg/mL to about 150 mg/mL, e.g., about 10 mg/mL to about 100 mg/mL, about 15 mg/mL to about 75 mg/mL, about 20 mg/mL to about 60 mg/mL, about 20 mg/mL to about 50 mg/mL, about 20 mg/mL to about 30 mg/mL, about 15 mg/mL to about 25 mg/mL, about 25 mg/mL to about 35 mg/mL, about 25 mg/mL to about 50 mg/mL, about 5 mg/mL to about 20 mg/mL, about 8 mg/mL to about 16 mg/mL, about 5 mg/mL to about 50 mg/mL, about 50 mg/mL to about 100 mg/mL, about 40 mg/mL to about 110 mg/mL, about 100 mg/mL to about 150 mg/mL, about 5 mg/mL to about 25 mg/mL, about 10 mg/mL to about 30 mg/mL
  • the antibody molecule is present at a concentration of about 10 to about 40 mg/mL, e.g., about 20 mg/mL to about 30 mg/mL, e.g., about 25 mg/mL. In an embodiment, the antibody molecule is present at a concentration of about 25 mg/mL. In another embodiment, the antibody molecule is present at a concentration of about 40 mg/mL to about 60 mg/mL, e.g., about 50 mg/mL. In an embodiment, the antibody molecule is present at a concentration of about 50 mg/mL. In another embodiment, the antibody molecule is present at a concentration of about 20 mg/mL to about 60 mg/mL, e.g., about 25 mg/mL to about 50 mg/mL.
  • the antibody molecule is present at a concentration of about 5 to about 10 mg/mL, e.g., about 8 mg/mL. In an embodiment, the antibody molecule is present at a concentration of about 8 mg/mL. In another embodiment, the antibody molecule is present at a concentration of about 10 mg/mL to about 20 mg/mL, e.g., about 16 mg/mL. In an embodiment, the antibody molecule is present at a concentration of about 16 mg/mL. In another embodiment, the antibody molecule is present at a concentration of about 5 mg/mL to about 20 mg/mL, e.g., about 8 mg/mL to about 16 mg/mL.
  • the antibody molecule is present at a concentration of about 25 to about 150 mg/mL, e.g., about 50 mg/mL to about 100 mg/mL, e.g., about 50 mg/mL.
  • the antibody molecule comprises a heavy chain immunoglobulin variable region segment comprising:
  • the antibody molecule comprises a light chain immunoglobulin variable region segment comprising:
  • the antibody molecule comprises:
  • the antibody molecule comprises a heavy chain immunoglobulin variable region segment that comprises SEQ ID NO: 25, or an amino acid sequence that differs by no more than 1, 2, 3, 4, or 5 amino acids therefrom.
  • the antibody molecule comprises a light chain immunoglobulin variable region segment that comprises SEQ ID NO: 52, or an amino acid sequence that differs by no more than 1, 2, 3, 4, or 5 amino acids therefrom.
  • the antibody molecule comprises:
  • a light chain immunoglobulin variable region segment that comprises SEQ ID NO: 52, or an amino acid sequence that differs by no more than 1, 2, 3, 4, or 5 amino acids therefrom.
  • the antibody molecule comprises:
  • the buffering agent is present at a concentration of about 5 mM to about 150 mM, e.g., about 10 mM to about 100 mM, about 20 mM to about 75 mM, about 30 mM to about 50 mM, about 10 mM to about 50 mM, about 50 mM to about 100 mM, about 100 mM to about 150 mM, about 10 mM to about 30 mM, about 20 mM to about 40 mM, about 30 mM to about 50 mM, about 40 mM to about 60 mM, about 50 mM to about 70 mM, about 60 mM to about 80 mM, about 70 mM to about 90 mM, or about 80 mM to about 100 mM, e.g., about 150 mM or less, about 100 mM or less, about 75 mM or less, about 50 mM or less, about 25 mM or less, or about 10 mM or
  • the buffering agent is present at a concentration of about 20 mM to about 60 mM, e.g., about 30 to about 50 mM, e.g., about 40 mM. In an embodiment, the buffering agent is present at a concentration of about 40 mM.
  • the buffering agent is a citrate buffer, a phosphate buffer, or a citrate-phosphate buffer.
  • the buffering agent comprises citrate-sodium phosphate.
  • the formulation comprises citrate-sodium phosphate at a concentration of about 20 mM to about 60 mM, e.g., about 30 to about 50 mM, e.g., about 40 mM.
  • the buffering agent provides a pH of about 5.5 to about 7, e.g., about 6 to about 6.5, e.g., about 5.5, about 6, about 6.5, or about 7.
  • the buffering agent comprises citrate-sodium phosphate and provides a pH of about 6 to about 6.5, e.g., about 6 or about 6.5.
  • the tonicity agent is present at a concentration of about 10 mM to about 500 mM, about 50 mM to about 200 mM, e.g., about 60 mM to about 190 mM, about 70 mM to about 180 mM, about 80 mM to about 170 mM, about 90 mM to about 160 mM, about 100 mM to about 150 mM, about 145 mM to about 155 mM, about 140 mM to about 160 mM, about 135 mM to about 165 mM, about 130 mM to about 170 mM, about 120 mM to about 180 mM, about 110 mM to about 190 mM, about 100 mM to about 200 mM, about 50 mM to about 100 mM, about 100 mM to about 150 mM, or about 150 mM to about 120 mM, e.g., about 200 mM or less, about 150 mM or
  • the tonicity agent is present at a concentration of about 50 to about 200 mM, about 75 mM to about 150 mM, about 120 mM to about 180 mM, e.g., about 140 to about 160 mM, e.g., about 150 mM.
  • the tonicity agent comprises sodium chloride. In an embodiment, the tonicity agent comprises sodium chloride and is present at a concentration of about 140 to about 160 mM, e.g., about 150 mM.
  • the tonicity agent provides a tonicity (or osmolarity) of about 250 mOsm/L to about 350 mOsm/L, about 260 mOsm/L to about 340 mOsm/L, about 270 mOsm/L to about 330 mOsm/L, about 280 mOsm/L to about 320 mOsm/L, about 285 mOsm/L to about 310 mOsm/L, or about 290 mOsm/L to about 300 mOsm/L, e.g., about 250 mOsm/L, about 260 mOsm/L, about 270 mOsm/L, about 280 mOsm/L, about 290 mOsm/L, about 300 mOsm/L, about 310 mOsm/L, about 320 mOsm/L, about 330 mOsm
  • the formulation has a pH of about 5.5 to about 7, e.g., about 6 to about 6.5, e.g., about 5.5, about 6, about 6.5, or about 7.
  • the formulation comprises:
  • an antibody molecule described herein at a concentration about 10 to about 40 mg/mL, e.g., about 20 to about 30 mg/mL, e.g., a concentration of about 25 mg/mL;
  • a buffering agent e.g., citrate-sodium phosphate, at a concentration about 20 mM to 60 mM, e.g., about 30 to about 50 mM, e.g., about 40 mM; and
  • a tonicity agent e.g., sodium chloride
  • pH of the formulation is about 5.5 to about 6.5, e.g., about 6 or about 6.5.
  • the formulation comprises: about 25 mg/mL of an antibody molecule described herein, about 40 mM citrate-sodium phosphate, about 150 mM sodium chloride, at a pH of about 6.
  • the formulation further comprises a surfactant, e.g., a nonionic surfactant.
  • a surfactant e.g., a nonionic surfactant.
  • the surfactant is present at a concentration of about 0.005% to about 0.1% (w/v), e.g., about 0.01% to about 0.05%, about 0.015% to about 0.04%, about 0.02% to about 0.03%, about 0.01% to about 0.03%, about 0.02% to about 0.04%, about 0.01% to about 0.025%, about 0.025% to about 0.1%, about 0.005% to about 0.05%, or about 0.05% to about 0.1%, e.g., about 0.1% or less, about 0.075% or less, about 0.05% or less, about 0.025% or less, or about 0.01% or less, e.g., about 0.005%, about 0.01%, about 0.015%, about 0.02%, about 0.025%, about 0.03%, about 0.035%, about 0.04%, about 0.05%, about 0.06%, about 0.07%, about 0.08%, about 0.09%, or about 0.1%.
  • the surfactant is present at a concentration of about 0.01% to about 0.05%, e.g., about 0.025%.
  • the surfactant is polysorbate 80 (TWEEN® 80). In an embodiment, the surfactant is polysorbate 80 and is present a concentration of about 0.01% and about 0.05%, e.g., about 0.025%.
  • the formulation comprises:
  • an antibody molecule described herein at a concentration of about 10 to about 40 mg/mL, e.g., about 20 to about 30 mg/mL, e.g., about 25 mg/mL;
  • a buffering agent e.g., citrate-sodium phosphate, at a concentration of about 20 mM to about 60 mM, e.g., about 30 to about 50 mM, e.g., a concentration of about 40 mM;
  • a tonicity agent e.g., sodium chloride, at a concentration of about 75 mM to about 150 mM, about 120 mM to 180 mM, e.g., about 140 to about 160 mM, e.g., a concentration of about 150 mM;
  • a surfactant e.g., polysorbate 80, at a concentration of about 0.01% to about 0.04%, e.g., about 0.025%,
  • pH of the pharmaceutical composition is about 5.5 to about 6.5, e.g., about 6 or about 6.5.
  • the formulation comprises about 25 mg/mL of an antibody molecule described herein, about 40 mM citrate-sodium phosphate, about 150 mM sodium chloride, about 0.025% polysorbate 80, at a pH of about 6.
  • the formulation comprises about 25 mg/mL of an antibody molecule described herein, about 40 mM citrate-sodium phosphate, about 150 mM sodium chloride, about 0.025% polysorbate 80, at a pH of about 6.5.
  • the formulation comprises about 25 mg/mL of an antibody molecule described herein, about 40 mM citrate-sodium phosphate, about 75 mM sodium chloride, about 0.025% polysorbate 80, at a pH of about 6.5.
  • the formulation further comprises a stabilizing agent.
  • the stabilizing agent is present at a concentration of about 0.1% to about 10% (w/v), e.g., about 0.2% to about 5%, about 0.5% to about 1.5%, about 0.5% to about 1%, about 1% to about 2%, e.g., about 5% or less, about 4% or less, about 3% or less, about 2% or less, about 1% or less, about 0.5% or less, or about 0.2% or less, e.g., about 0.6%, about 0.8%, about 1%, about 1.5%, about 2%, about 3%, about 4%, or about 5%.
  • the stabilizing agent is an amino acid.
  • the amino acid is glycine, histidine, arginine, methionine, proline, lysine, glutamic acid, or a combination thereof.
  • the formulation comprises one, two or all of: glycine, histidine, or arginine.
  • the amino acid is glycine.
  • the formulation comprises glycine, which is present at a concentration of about 0.5% to about 2%, e.g., about 1%.
  • the formulation comprises:
  • an antibody molecule described herein at a concentration of about 10 to about 40 mg/mL, e.g., about 20 to about 30 mg/mL, e.g., about 25 mg/mL;
  • a buffering agent e.g., citrate-sodium phosphate, at a concentration of about 20 mM to about 60 mM, e.g., about 30 to about 50 mM, e.g., about 40 mM;
  • a tonicity agent e.g., sodium chloride, at a concentration of about 75 mM to about 150 mM, about 120 mM to about 180 mM, e.g., about 140 to about 160 mM, e.g., about 150 mM;
  • a surfactant e.g., polysorbate 80, at a concentration of about 0.01% to about 0.04%, e.g., about 0.025%;
  • a stabilizing agent e.g., glycine, at a concentration of about 0.5% to about 2%, e.g., about 1%,
  • pH of the pharmaceutical composition is about 5.5 to about 6.5, e.g., about 6 or about 6.5.
  • the formulation comprises about 25 mg/mL of an antibody molecule described herein, about 40 mM citrate-sodium phosphate, about 150 mM sodium chloride, about 0.025% polysorbate 80, about 1% glycine, at a pH of about 6.
  • the formulation further comprises a carbohydrate, e.g., a polyol or a sugar.
  • the carbohydrate is sucrose, trehalose, mannitol, dextran, sorbitol, inositol, glucose, fructose, lactose, xylose, mannose, maltose, raffinose, a combination thereof.
  • the formulation further comprises further comprising a polymer, e.g., a hydrophilic polymer.
  • a polymer e.g., a hydrophilic polymer.
  • the polymer is a polyethylene glycol (PEG), dextran, hydroxyl ethyl starch (HETA), or gelatin.
  • the formulation further comprises a preservative.
  • the preservative is benzyl alcohol, m-cresol, or phenol.
  • the level of high molecular weight (HMW) species in the formulation is less than about 5%, less than about 4%, less than about 3%, less than about 2%, or less than 1%, e.g., before storage, or after storage for at least about 1 week at 4° C., at least about 1 week at 45° C., at least about 2 weeks at 4° C., at least about 2 weeks at 45° C., at least about 3 weeks at 4° C., at least about 3 weeks at 45° C., at least about 4 weeks at 4° C., or at least about 4 weeks at 45° C.
  • the level of HMW species is less than about 2% before storage.
  • the level of HMW species is less than about 2% after storage for 2 weeks at 4° C.
  • the level of HMW species is less than about 5% after storage for 2 weeks at 45° C.
  • the level of low molecular weight (LMW) species in the formulation is less than about 5%, less than about 4%, less than about 3%, less than about 2%, or less than 1%, e.g., before storage or after storage for at least about 1 week at 4° C., at least about 1 week at 45° C., at least about 2 weeks at 4° C., at least about 2 weeks at 45° C., at least about 3 weeks at 4° C., at least about 3 weeks at 45° C., at least about 4 weeks at 4° C., or at least about 4 weeks at 45° C.
  • the level of LMW species is less than about 1% before storage. In an embodiment, the level of LMW species is less than about 1% after storage for 2 weeks at 4° C. In an embodiment, the level of LMW species is less about 2% after storage for 2 weeks at 45° C.
  • the level of HMW and LMW species in the formulation is less than about 8%, less than about 7%, less than about 6%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, or less than 1%, e.g., before storage, or after storage for at least about 1 week at 4° C., at least about 1 week at 45° C., at least about 2 weeks at 4° C., at least about 2 weeks at 45° C., at least about 3 weeks at 4° C., at least about 3 weeks at 45° C., at least about 4 weeks at 4° C., or at least about 4 weeks at 45° C.
  • the level of HMW and LMW species is less than about 2% before storage.
  • the level of HMW and LMW species is less than about 2% after storage for 2 weeks at 4° C.
  • the level of LMW species is less than about 6% after storage for 2 weeks at 45° C.
  • about 90% or more, about 92% or more, about 94% or more, about 95% or more, about 96% or more, about 97% or more, about 98% or more, or about 99% or more of the antibody molecules in the formulation are present as monomers, e.g., before storage, or after storage for at least about 1 week at 4° C., at least about 1 week at 45° C., at least about 2 weeks at 4° C., at least about 2 weeks at 45° C., at least about 3 weeks at 4° C., at least about 3 weeks at 45° C., at least about 4 weeks at 4° C., or at least about 4 weeks at 45° C.
  • about 98% or more of the antibody molecules in the formulation are present as monomers before storage.
  • about 98% or more of the antibody molecules in the formulation are present as monomers after storage for 2 weeks at 4° C.
  • about 94% or more of the antibody molecules in the formulation are present as monomers after storage for 2 weeks at 45° C.
  • the level of monomers, HMW species, or LMW species is determined by size exclusion chromatography (SEC), e.g., size exclusion-high performance liquid chromatography (SEC-HPLC).
  • SEC size exclusion chromatography
  • the monomeric nature of the antibody molecule is determined by a binding assay, a surface charge assay, a bioassay, or the ratio of HMW species to LMW species.
  • the purity of the antibody molecule in the formulation e.g., after storage for two 2 weeks at 4° C., is at least about 96%, at least about 97%, at least about 98%, or at least about 99%. In an embodiment, the purity of the antibody molecule in the formulation, e.g., after storage for two 2 weeks at 45° C., is at least about 90%, at least about 92%, at least about 94%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%.
  • the purity (or heterogeneity) of the antibody molecule is determined by detecting the intact heavy and light chains (e.g., in a reduced sample) or intact immunoglobulins (e.g., in a non-reduced sample) in the formulation.
  • the purity (or heterogeneity) of the antibody molecule in the formulation is determined by capillary electrophoresis-sodium dodecyl sulfate (CE-SDS) in a reduced sample. In an embodiment, the purity (or heterogeneity) of the antibody molecule in the formulation is determined by CE-SDS in a non-reduced sample. In an embodiment, the purity of the antibody molecule in the formulation, e.g., after storage for two 2 weeks at 4° C., is at least about 98% as determined by CE-SDS in a reduced sample.
  • CE-SDS capillary electrophoresis-sodium dodecyl sulfate
  • the purity of the antibody molecule in the formulation is at least about 96% as determined by CE-SDS in a reduced sample. In an embodiment, the purity of the antibody molecule in the formulation, e.g., after storage for two 2 weeks at 4° C., is at least about 97% as determined by CE-SDS in a non-reduced sample. In an embodiment, the purity of the antibody molecule in the formulation, e.g., after storage for two 2 weeks at 45° C., is at least about 92% as determined by CE-SDS in a non-reduced sample.
  • the activity of the antibody molecule is decreased by less than about 25%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, or less than about 2%, after storage, e.g., for at least about 1 week, at least about 2 weeks, or at least about 3 weeks, e.g., at 4° C. or 45° C. In an embodiment, the activity of the antibody molecule is decreased by less than about 25% after storage for about 2 weeks at 45° C. In an embodiment, the activity of the antibody molecule is determined by a hemagglutinin (HA) binding assay, e.g., an HA-binding ELISA.
  • HA hemagglutinin
  • the formulation is a liquid formulation (e.g., a frozen or non-frozen liquid formulation). In an embodiment, the formulation is stored as a frozen liquid. In another embodiment, the formulation is a lyophilized formulation.
  • the formulation is for use in treating or preventing influenza in a subject. In an embodiment, the formulation is for use in treating a subject having influenza. In another embodiment, the formulation is for use in preventing a subject from having influenza. In an embodiment, the formulation is for intravenous administration.
  • the disclosure features a device, e.g., an injection device, comprising a formulation described herein, e.g., a pharmaceutical formulation described herein.
  • the disclosure features a kit, comprising one or more containers comprising a formulation described herein, e.g., a pharmaceutical formulation described herein, and instructions for use of the formulation, e.g., for administration of the formulation to a subject, or for making a solution for administration to a subject.
  • a formulation described herein e.g., a pharmaceutical formulation described herein
  • instructions for use of the formulation e.g., for administration of the formulation to a subject, or for making a solution for administration to a subject.
  • the disclosure features a container (e.g., a vial or an intravenous (IV) solution bag) comprising an anti-HA antibody molecule described herein or a formulation (e.g., a pharmaceutical formulation described herein) comprising an anti-HA antibody molecule described herein.
  • a container e.g., a vial or an intravenous (IV) solution bag
  • IV intravenous
  • the container is a vial, e.g., a glass vial.
  • the container e.g., vial
  • the container comprises about 10 mg/mL to about 100 mg/mL, e.g., about 20 mg/mL to about 60 mg/mL (e.g., about 25 mg/mL to about 50 mg/mL) of the antibody molecule.
  • the container comprises about 10 mL to about 60 mL, e.g., about 20 mL to about 40 mL, of the formulation.
  • the container e.g., vial
  • the container is a first (or primary) container, e.g., for storing the antibody molecule or formulation.
  • the antibody molecule or formulation can be transferred into a second (or secondary) container before use.
  • the second (or secondary) container is suitable, or includes a solution that is suitable, for administration, e.g., intravenous administration.
  • the second (or secondary) container includes a solution suitable for intravenous administration.
  • the solution comprises saline, optionally, further comprises dextrose.
  • the solution e.g., saline
  • the solution does not comprise dextrose.
  • an amount equal to one dose of the antibody molecule can be transferred into a container suitable for IV administration.
  • 1 to 10 vials e.g., 1 to 8 vials, 1 to 6 vials, 1 to 4 vials, 1 to 2 vials, 6 to 8 vials, 4 to 8 vials, or 2 to 8 vials
  • 1 to 10 vials e.g., 1 to 8 vials, 1 to 6 vials, 1 to 4 vials, 1 to 2 vials, 6 to 8 vials, 4 to 8 vials, or 2 to 8 vials
  • an IV solution bag e.g., containing saline with or without dextrose.
  • the container is a container suitable for IV administration (e.g., an IV solution bag).
  • the amount of the antibody molecules in the container equals to the amount of the antibody molecules in 1 to 10 vials (e.g., 1 to 8 vials, 1 to 6 vials, 1 to 4 vials, 1 to 2 vials, 6 to 8 vials, 4 to 8 vials, or 2 to 8 vials) of the formulation as described above.
  • the container e.g., IV solution bag
  • the container comprises about 2000 mg to about 5000 mg, e.g., about 2300 mg to about 4600 mg, of the antibody molecule, e.g., in a solution suitable for IV administration (e.g., saline with or without dextrose).
  • a solution suitable for IV administration e.g., saline with or without dextrose.
  • the container suitable for IV administration is not a second (or secondary) container (e.g., is a first (or primary) container, e.g., where the antibody molecule is stored), and comprises about 5 mg/mL to about 25 mg/mL, e.g., about 8 mg/mL to about 16 mg/mL of the antibody molecule.
  • the container (e.g., IV solution bag) comprises about 100 mL to about 400 mL (e.g., about 200 mL to about 300 mL) of a solution (e.g., a solution suitable for IV administration) comprising the antibody molecule.
  • the container (e.g., IV solution bag) comprises about 2000 mg to about 5000 mg, e.g., about 2000 mg to about 4000 mg or about 2300 mg to about 4600 mg, of the antibody molecule.
  • the disclosure features a method of preparing a composition (e.g., a solution) for administration to a subject.
  • the method comprises combining a formulation described herein with a solution suitable for intravenous administration.
  • the solution comprises saline, optionally, further comprises dextrose. In an embodiment, the solution does not comprise dextrose. In an embodiment, about 2000 mg to about 5000 mg of the antibody molecule is combined with the solution. In another embodiment, about 2300 mg to about 4600 mg of the antibody molecule is combined with the solution. In yet another embodiment, about 2000 mg to about 4000 mg of the antibody molecule is combined with the solution. In an embodiment, the formulation is combined with the solution in an intravenous (IV) solution bag.
  • IV intravenous
  • the disclosure features a method of treating or preventing influenza, the method comprising administering to a subject having influenza, or at risk of having influenza, an effective amount of a formulation described herein, e.g., a pharmaceutical formulation described herein, thereby treating or preventing influenza.
  • a formulation described herein e.g., a pharmaceutical formulation described herein
  • the disclosure features a formulation described herein, e.g., a pharmaceutical formulation described herein, for use in treating or preventing influenza in a subject.
  • anti-HA antibody molecules or preparations, or isolated preparations thereof, can be included in a formulation (e.g., pharmaceutical formulation) described herein.
  • the antibody molecule comprises one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or all) of the following properties:
  • influenza A virus e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004, or an H7N9, e.g., A/Anhui/1/2013 or A/Shanghai/1/2013;
  • a Group 1 strain e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009
  • H5N1 strain e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004
  • H7N9 e.g., A/Anhui/1/2013 or A/Shangha
  • a Group 1 virus such as where the virus is an H1, H5, or H9 virus
  • a Group 2 virus such as where the virus is an H3 or H7 virus
  • H1N1 or H3N2 when administered at 50 mg/kg, 25 mg/kg, 10 mg/kg, 6 mg/kg, 5 mg/kg, 4 mg/kg, 3 mg/kg, 2 mg/kg, or 1 mg/kg;
  • (j) it is effective for prevention or treatment of infection, e.g., in humans or mice, with H5N1 or H7N9 when administered at 50 mg/kg, 25 mg/kg, 10 mg/kg, 6 mg/kg, 5 mg/kg, 4 mg/kg, 3 mg/kg, 2 mg/kg, or 1 mg/kg;
  • influenza B virus e.g., B/Wisconsin/1/2010
  • (m) it is effective for prevention or treatment of infection, e.g., in humans or mice, with an influenza B virus, e.g., B/Wisconsin/1/2010, when administered at 10 mg/kg, 6 mg/kg, 4 mg/kg, 3 mg/kg, 2 mg/kg, or 1 mg/kg;
  • an influenza B virus e.g., B/Wisconsin/1/2010
  • the concentration of antibody molecule required for 50% neutralization of influenza B virus e.g., B/Wisconsin/1/2010, virus is less than 10 ⁇ g/mL;
  • (p) it is effective for preventing or minimizing secondary infection (e.g., secondary bacterial infection) or effects thereof on a subject when administered at 50 mg/kg, 25 mg/kg, 10 mg/kg, 6 mg/kg, 5 mg/kg, 4 mg/kg, 3 mg/kg, 2 mg/kg, or 1 mg/kg;
  • secondary infection e.g., secondary bacterial infection
  • a reference anti-HA antibody molecule e.g., Ab 67-11, FI6, FI28, C179, F10, CR9114, or CR6261, e.g., as determined by a method described herein, e.g., a structural analysis (e.g., by X-ray crystallography or NMR spectroscopy) or a competition assay (e.g., by ELISA); or
  • the antibody molecule has one, two, or all of the following characteristics: (i) the antibody molecule prevents infection by at least 1, 2, 3, 4 or 5 influenza subtypes of Group 1, and by at least 1, 2, 3, 4 or 5 influenza subtypes of Group 2; (ii) the concentration of the antibody molecule required for 50% neutralization of influenza A virus is less than 10 ⁇ g/mL; or (iii) the antibody molecule binds an epitope that comprises or consists of the hemagglutinin trimer interface.
  • the antibody molecule treats or prevents infection by a Group 1 virus, such as where the virus is an H1, H2, H5, H6, H8, H9, H12, H11, H13, H16, or H17 virus; and treats or prevents infection by a Group 2 virus, such as where the virus is an H3, H4, H7, H10 or H15 virus.
  • the antibody molecule prevents infection by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11 influenza subtypes of Group 1, and by at least 1, 2, 3, 4, 5 or 6 influenza subtypes of Group 2.
  • the antibody molecule treats or prevents infection by one or more of H1N1, H2N2, H5N1, or H9N2, and also treats or prevents infection by one or more of H3N2, H7N7, or H7N9.
  • the antibody molecule binds, and in an embodiment, neutralizes: at least one strain from the Group 1 H1, e.g., H1a or H1b, cluster and at least one strain from the Group 2 H3 or H7 cluster. In an embodiment, the antibody molecule, binds, and in an embodiment, neutralizes: at least one strain from the Group 1 H1, e.g., H1a or H1b, cluster and at least one influenza B strain, e.g., B/Wisconsin/1/2010. In an embodiment, the antibody molecule binds, and in an embodiment, neutralizes: at least one strain from the Group 2 H3 or H7 cluster and at least one influenza B strain, e.g., B/Wisconsin/1/2010.
  • the antibody molecule binds, and in an embodiment, neutralizes: at least one strain from the Group 1 H1, e.g., H1a or H1b, cluster, at least one strain from the Group 2 H3 or H7 cluster, and at least one influenza B strain, e.g., B/Wisconsin/1/2010.
  • the antibody molecule treats or prevents infection by one or more of influenza B viruses, e.g., B/Wisconsin/1/2010.
  • the antibody molecule is not an anti-HA antibody molecule previously described in the art.
  • the antibody molecule is other than one or more or all of Ab 67-11 (U.S. Provisional Application No. 61/645,453, U.S. Application Publication No. 2013/0302348, and International Application Publication No. WO 2013/169377), FI6 (FI6, as used herein, refers to any specifically disclosed FI6 sequence in U.S. Application Publication Nos. 2010/0080813 or 2011/0274702, International Application Publication No. WO2013/011347, or Corti et al., Science 333:850-856, 2011; FIG. 4), FI28 (U.S. Application Publication No.
  • the antibody molecule neutralizes infection with H1N1 and H3N2 in vitro. In another embodiment, the antibody molecule neutralizes infection with H1N1 and H3N2 in vivo. In an embodiment, the antibody molecule neutralizes infection with H5N1 in vitro. In another embodiment, the antibody molecule neutralizes infection with H5N1 in vivo. In an embodiment, the antibody molecule neutralizes infection with H7N9 in vitro. In another embodiment, the antibody molecule neutralizes infection with H7N9 in vivo. In an embodiment, the antibody molecule neutralizes infection with an influenza B virus, e.g., B/Wisconsin/1/2010, in vitro. In another embodiment, the antibody molecule neutralizes infection with an influenza B virus, e.g., B/Wisconsin/1/2010, in vivo.
  • the concentration of the antibody molecule required for 50% neutralization of influenza A virus is 10 ⁇ g/mL or less, such as 9 ⁇ g/mL or less, 8 ⁇ g/mL or less, 7 ⁇ g/mL or less, 6 ⁇ g/mL or less, or 5 ⁇ g/mL or less.
  • the concentration of the antibody molecule required for 60% neutralization of influenza A virus, 50% neutralization of influenza A virus, or 40% neutralization of influenza A virus is 10 ⁇ g/mL or less, such as 9 ⁇ g/mL or less, 8 ⁇ g/mL or less, 7 ⁇ g/mL or less, 6 ⁇ g/mL or less, or 5 ⁇ g/mL or less.
  • the antibody molecule is effective for prevention or treatment of infection, e.g., in humans or mice, with H1N1 or H3N2, such as when administered at 50 mg/kg, 25 mg/kg, 10 mg/kg, 6.0 mg/kg, 5.0 mg/kg, 4.0 mg/kg, 3.0 mg/kg, 2.0 mg/kg, 1.0 mg/kg or less.
  • the antibody molecule is effective for prevention or treatment of infection, e.g., in humans or mice, with H5N1 or H7N9, such as when administered at 50 mg/kg, 25 mg/kg, 10 mg/kg, 6.0 mg/kg, 5.0 mg/kg, 4.0 mg/kg, 3.0 mg/kg, 2.0 mg/kg, 1.0 mg/kg or less.
  • the antibody molecule is effective for the treatment or prevention of a Group 1 virus, where the Group 1 virus is H1, H5, or H9
  • the anti-HA antibody molecule is effective for the treatment or prevention of a Group 2 virus, where the Group 2 virus is H3 or H7.
  • the concentration of the antibody molecule required for 50% neutralization of influenza B virus is 10 ⁇ g/mL or less, such as 9 ⁇ g/mL or less, 8 ⁇ g/mL or less, 7 ⁇ g/mL or less, 6 ⁇ g/mL or less, or 5 ⁇ g/mL or less.
  • the concentration of the antibody molecule required for 60% neutralization of influenza B virus, e.g., B/Wisconsin/1/2010, 50% neutralization of influenza B virus, e.g., B/Wisconsin/1/2010, or 40% neutralization of influenza B virus, e.g., B/Wisconsin/1/2010 is 10 ⁇ g/mL or less, such as 9 ⁇ g/mL or less, 8 ⁇ g/mL or less, 7 ⁇ g/mL or less, 6 ⁇ g/mL or less, or 5 ⁇ g/mL or less.
  • the antibody molecule comprises one or both of the following properties: (i) it fails to produce any escape mutants as determined by the failure of a viral titer to recover following at least 10, 9, 8, 7, 6, or 5 rounds of serial infections in cell culture with a mixture of the antibody molecule and an influenza virus (e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004, or an influenza B virus, e.g., B/Wisconsin/1/2010); or (ii) it produces fewer escape mutants than does a reference anti-HA antibody molecule, such as Ab 67-11, FI6, FI28, C179, F10, CR9114
  • the antibody molecule is a full length tetrameric antibody, a single chain antibody (scFv), a F(ab′) 2 fragment, a Fab fragment, or an Fd fragment.
  • the heavy chain of the antibody molecule is a ⁇ 1 heavy chain
  • the light chain of the antibody molecule is a ⁇ light chain or a ⁇ light chain.
  • the antibody molecule is an IgG1 antibody.
  • the antibody molecule binds an epitope that has one, two, three, four, five, or all of, the following properties a)-f): a) it includes one, two, or all of, H3 HA1 residues N38, 1278, and D291; b) it includes H3 HA2 residue N12; c) it does not include one, two or all of, H3 HA1 residues Q327, T328, and R329; d) it does not include one, two, three, four, or all of, H3 HA2 residues G1, L2, F3, G4, and D46; e) it includes one, two, or all of, H3 HA1 residues T318, R321, and V323; or f) it includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of, H3 HA2 residues A7, E11, I18, D19, G20, W21, L38, K39, T41, Q42, A43,
  • the antibody molecule has properties: a) and b). In an embodiment the antibody molecule has properties: c) and d). In an embodiment the antibody molecule has properties: a); and c) or d). In an embodiment the antibody molecule has properties: b); and c) or d). In an embodiment the antibody molecule has properties: c); and a) or b). In an embodiment the antibody molecule has properties: d); and a) or b). In an embodiment the antibody molecule has properties: a), b), c) and d). In an embodiment the antibody molecule has properties: a), b), c), d), e), and f).
  • the antibody molecule has a K D for H3 of equal to or less than 10 ⁇ 6 nM, wherein said K D is increased by at least 2, 5, 10, or 100 fold, by a mutation or mutations in any of: a) H3 HA1 residues N38, 1278, or D291; b) H3 HA2 residue N12; c) H3 HA1 residues T318, R321, or V323; or d) H3 HA2 residues A7, E11, I18, D19, G20, W21, L38, K39, T41, Q42, A43, I45, I48, N49, L52, N53, 156, or E57.
  • the antibody molecule has a K D for H3 of equal to or less than 10 ⁇ 6 nM, wherein said K D is increased by no more than 2, or 5 fold, by a mutation or mutations in any of: e) H3 HA1 residues Q327, T328, or R329; or f) H3 HA2 residues G1, L2, F3, G4, or D46.
  • the antibody molecule binds an epitope that has one, two, three, four, five, or all of, the following properties aa)-ff): aa) it includes one, two, or all of, H1 HA1 residues H31, N279, and 5292; bb) it includes H1 HA2 residue G12; cc) it does not include one or both of H1 HA1 residues Q328 and 5329; dd) it does not include one, two, three, four, or all of, H1 HA2 residues G1, L2, F3, G4, and D46; ee) it includes one, two, or all of, H1 HA1 residues T319, R322, and 1324 are bound by both Ab 044 and FI6; or ff) it includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of, H1 HA2 residues A7, E11, I18, D19, G20, W21, Q38, K39
  • the antibody molecule has properties: aa) and bb). In an embodiment, the antibody molecule has properties: cc) and dd). In an embodiment, the antibody molecule has properties: aa); and cc) or dd). In an embodiment, the antibody molecule has properties: bb); and cc) or dd). In an embodiment, the antibody molecule has properties: cc); and aa) or bb). In an embodiment, the antibody molecule has properties: dd); and aa) or bb). In an embodiment, the antibody molecule has properties: aa), bb), cc) and dd). In an embodiment, the antibody molecule has properties: aa), bb), cc), dd). In an embodiment, the antibody molecule has properties: aa), bb), cc), dd), ee), and ff).
  • the antibody molecule has a K D for H1 of equal to or less than 10 ⁇ 6 nM, wherein said K D is increased by at least 2, 5, 10, or 100 fold, by a mutation or mutations in any of: aa) H1 HA1 residues H31, N279, and 5292; bb) H1 HA2 residue G12; cc) H1 HA1 residues T319, R322, and 1324; or dd) H1 HA2 residues A7, E11, I18, D19, G20, W21, Q38, K39, T41, Q42, N43, 145, 148, T49, V52, N53, 156, and E57.
  • the antibody molecule has a K D for H1 of equal to or less than 10 ⁇ 6 nM, wherein said K D is increased by no more than 2, or 5 fold, by a mutation or mutations in any of: ee) H1 HA1 residues Q328 and S329; or ff) H1 HA2 residues G1, L2, F3, G4, and D46.
  • the antibody molecule has one, two, three or all of the following properties: a) and aa); b) and bb); c) and cc); or d) and dd), as described above. In an embodiment, the antibody molecule has properties c), cc), d), and dd), as described above.
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising at least, or more than, 60, 65, 70, 75, 80, 85, 87, 90, 95, 98 or 99 percent homology with a heavy chain variable region from Table 3, Table 4A, Table 4B, FIG. 2 , FIG. 5 or FIG. 7 ; and a light chain variable region comprising at least, or more than, 60, 65, 70, 75, 80, 85, 87, 90, 95, 98 or 99 percent homology with light chain variable region from Table 3, Table 4A, Table 4B, FIGS. 3A-3B , FIGS. 6A-6B or FIG. 7 .
  • the antibody molecule comprises a heavy chain variable region 25 (SEQ ID NO: 25), or a structurally or functionally related variable heavy chain region as described herein.
  • the antibody molecule comprises a light chain variable region 52 (SEQ ID NO: 52), 155 (SEQ ID NO: 155), or 45 (SEQ ID NO: 45), or a structurally or functionally related variable light chain region as described herein.
  • the antibody molecule comprises a heavy chain variable region 25 (SEQ ID NO: 25), or a structurally or functionally related variable heavy chain region as described herein; and a light chain variable region 52 (SEQ ID NO: 52), 155 (SEQ ID NO: 155), or 45 (SEQ ID NO: 45), or a structurally or functionally related variable light chain region as described herein.
  • the antibody molecule comprises a heavy chain variable region comprising one, two, or all of CDR1, CDR2, and CDR3, from heavy chain variable region 25 (SEQ ID NO: 25), or a structurally or functionally related variable heavy chain region as described herein.
  • the antibody molecule comprises a light chain variable region comprising one, two, or all of CDR1, CDR2, and CDR3, from light chain variable region 52 (SEQ ID NO: 52), 155 (SEQ ID NO:155), or 45 (SEQ ID NO:45), or a structurally or functionally related sequence as described herein.
  • the antibody molecule comprises a heavy chain variable region comprising one, two, or all of CDR1, CDR2, and CDR3, from heavy chain variable region 25 (SEQ ID NO: 25), or a structurally or functionally related variable heavy chain region as described herein; and a light chain variable region comprising one, two, or all of CDR1, CDR2, and CDR3, from light chain variable region 52 (SEQ ID NO: 52), 155 (SEQ ID NO: 155), or 45 (SEQ ID NO: 45), or a structurally or functionally related variable light chain region as described herein.
  • the antibody molecule comprises a heavy chain variable region from FIG. 2 or FIG. 5 or a structurally or functionally related variable heavy chain region as described herein. In an embodiment, the antibody molecule comprises a light chain variable region from FIGS. 3A-3B or FIGS. 6A-6B or a structurally or functionally related variable light chain region as described herein.
  • the antibody molecule comprises one, two, or all of, a CDR1, CDR2, and CDR3 from a heavy chain variable region from FIG. 2 or FIG. 5 , or a structurally or functionally related sequences as described herein. In an embodiment, the antibody molecule comprises one, two, or all of, a CDR1, CDR2, and CDR3 from a light chain variable region from FIGS. 3A-3B or FIGS. 6A-6B , or a structurally or functionally related sequences as described herein.
  • the antibody molecule comprises one, two or all of, HC CDR1, HC CDR2, and HC CDR3 and one, two or all of, LC CDR1, LC CDR2, and LC CDR3 from an antibody disclosed in Table 3, or a structurally or functionally related sequence as described herein.
  • the antibody molecule comprises the light chain LC45 (SEQ ID NO: 45). In yet another embodiment, the antibody comprises the light chain LC45, and the heavy chain HC25 (SEQ ID NO: 25) or HC24 (SEQ ID NO: 24). In an embodiment, the antibody molecule comprises the light chain LC45 (SEQ ID NO: 45) and the heavy chain HC25 (SEQ ID NO: 25). In yet another embodiment, the antibody molecule comprises light chain LC52 (SEQ ID NO: 52) and heavy chain HC25 (SEQ ID NO: 25).
  • the antibody molecule comprises one or both of: a) one or more framework regions (FRs) from heavy chain disclosed herein, e.g., one or more or all of FR1, FR2, FR3, or FR4, or FR sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from a heavy chain disclosed herein; and b) one or more framework regions (FRs) from light chain disclosed herein, e.g., one or more or all of FR1, FR2, FR3, or FR4, or FR sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from a light chain disclosed herein.
  • FRs framework regions
  • the antibody molecule comprises: (a) a heavy chain immunoglobulin variable domain comprising a sequence at least 60, 70, 80, 85, 87, 90, 95, 97, 98, or 99, e.g., 90%, homologous, to a heavy chain consensus sequence provided herein, e.g., the heavy chain consensus sequence provided in FIG. 2 or FIG. 5 , e.g., the heavy chain consensus sequence provided in FIG.
  • a light chain immunoglobulin variable domain comprising a sequence at least 60, 70, 80, 85, 87, 90, 95, 97, 98, or 99, e.g., 95%, homologous, to a light chain consensus sequence provided herein, e.g., the light chain consensus sequence provided in FIGS. 3A-3B or FIG. 6 , e.g., the light chain consensus sequence provided in FIGS. 3A-3B , SEQ ID NO: 62.
  • the antibody molecule disclosed herein comprises one or both of: (a) a heavy chain immunoglobulin variable domain comprising the sequence of SEQ ID NO: 161, or a sequence at least 87% identical to SEQ ID NO: 161; and (b) a light chain immunoglobulin variable domain comprising the sequence SEQ ID NO: 62, or a sequence at least 95% identical to SEQ ID NO: 62.
  • the antibody molecule comprises: (a) a heavy chain immunoglobulin variable domain comprising the sequence of SEQ ID NO:161, or a sequence at least 87% identical to SEQ ID NO: 161; and (b) a light chain immunoglobulin variable domain comprising the sequence SEQ ID NO: 62, or a sequence at least 95% identical to SEQ ID NO: 62, wherein said antibody molecule: (i) fails to produce any escape mutants as determined by the failure of a viral titer to recover following at least 10, 9, 8, 7, 6, or 5 rounds of serial infections in cell culture with a mixture of the antibody molecule and an influenza virus (e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region comprising the sequence of SEQ ID NO: 161, or a sequence that differs from SEQ ID NO: 161 by not more than 1, 2, 3, 4, 5, 6, 8, 10, 11, 12, 13, 14, 15 or 16, e.g., by no more than 2, 3, 4, or 5 amino acids, e.g., conservative amino acids; and (b) a light chain immunoglobulin variable domain comprising the sequence SEQ ID NO: 62, or a sequence that differs from SEQ ID NO: 62 that differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., conservative amino acids.
  • the 1, 2, 3, 4, 5, 6, 8, 10, 11, 12, 13, 14, 15 or 16 amino acid differences, e.g., conservative amino acid differences, in the heavy chain immunoglobulin variable region are in the FR regions of the heavy chain immunoglobulin variable domain.
  • the 1, 2, 3, 4 or 5 amino acid differences, e.g., conservative amino acid differences, in the light chain immunoglobulin variable domain are in the FR regions of the light chain immunoglobulin variable domain.
  • the amino acid differences in the heavy chain immunoglobulin variable region, or in the light chain immunoglobulin variable region are conservative amino acid changes.
  • the antibody molecule comprises one or both of: a) one or more framework regions (FRs) from heavy chain consensus sequence disclosed herein, e.g., one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from a heavy chain variable region consensus sequence disclosed herein; and b) one or more framework regions (FRs) from light chain consensus sequence disclosed herein, e.g., one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from a light chain variable region consensus disclosed herein.
  • FRs framework regions
  • the antibody molecule binds to an epitope, e.g., an epitope that overlaps with or is the same as, of an antibody disclosed herein, e.g., as determined by mutational analysis or crystal structure analysis.
  • the antibody molecule competes with a reference antibody molecule, e.g., an antibody molecule described herein, for binding to a substrate, e.g., an HA.
  • a reference antibody molecule e.g., an antibody molecule described herein
  • the HA can be from a Group 1 strain, e.g., HA1 or HA5, e.g., from an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004 Binding to the same epitope, or a portion thereof, can be shown by one or more of: a) mutational analysis, e.g., binding to HA, or binding affinity for HA, is decreased or abolished if a residue is mutated; b) analysis, e.g., comparison, of the crystal structure of the antibody molecule and HA and the crystal structure of a reference antibody and HA, e.g., to determine the touch points of each; c) competition of the two antibodies for binding to HA, e.g., HA
  • Competition between the antibody molecule and a reference antibody molecule can be determined by evaluating the ability of the antibody molecule or the reference antibody molecule to decrease binding of the other to a substrate, e.g., HA, e.g., HA1 or HA5, from, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004. Reduction of the ability to bind can be evaluated by methods in the art.
  • a substrate e.g., HA, e.g., HA1 or HA5
  • H1N1 strain e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009
  • H5N1 strain e.
  • Reduction of the ability to bind can be evaluated, e.g., by one or more of: a) BIAcore analysis; b) ELISA assay; or c) flow cytometry.
  • the antibody molecule can compete with the reference antibody such that binding of the reference antibody is decreased by 50% or more.
  • the antibody molecule binds to the same epitope, or a portion thereof, which the reference antibody molecule binds. In an embodiment, the antibody molecule does not bind to the same epitope, or a portion thereof, which the reference antibody molecule binds.
  • the antibody molecule comprises a structural or functional property of Ab 044.
  • the antibody molecule competes with a reference antibody molecule, e.g., an antibody molecule described herein, for binding to a substrate, e.g., an HA.
  • the reference antibody molecule can be: a) an antibody molecule comprising: i) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); and a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO:70); and ii) a light chain variable region segment comprising: a CDR1 comprising the sequence Q-S-I-T-F-D-Y
  • the antibody molecule binds to the same epitope, or a portion thereof, on HA, as does a reference antibody molecule, e.g., an antibody molecule disclosed herein.
  • the reference antibody molecule can be: a) an antibody molecule comprising: i) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); and a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70); and ii) a light chain variable region segment comprising: a CDR1 comprising the sequence Q-S-I-T-F-D
  • the an antibody molecule comprises one or both of: a heavy chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 25; and a light chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 52.
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 25; and a light chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 52, wherein, each HC CDR differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., 1 or 2, e.g., conservative amino acids, from the corresponding CDR of SEQ ID NO: 25 and each LC CDR differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., 1 or 2, e.g., conservative amino acids, from the corresponding CDR of SEQ ID NO: 52.
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 25; and a light chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 52, wherein the antibody molecule comprises 1, 2, 3, 4, 5, or all of: (i) a HC CDR1 comprising: S at the 1st position and A at the 3 rd position in HC CDR1; (ii) a HC CDR2 comprising one or both, e.g., one of: V at the 2 nd position; or N at the 7 th position and Q at the 16 th position in HC CDR2; (iii) a HC CDR3 comprising: R at the 3 rd position (and optionally, L at the 3 rd position); (iv) a LC CDR1 comprising one or both of, e
  • the antibody molecule comprises: (a) a heavy chain immunoglobulin variable region segment comprising SEQ ID NO: 25 (or a sequence that differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., conservative amino acids, therefrom); and (b) a light chain variable region segment comprising SEQ ID NO: 52 (or a sequence that differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., conservative amino acids, therefrom).
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom); a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70) (or a heavy chain
  • the antibody molecule comprises one or both of: a) LC CDR1-3, that collectively, differ from the Ab 044 LC CDR1-3 by no more than, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, e.g., 1, 2, 3, or 4, amino acids, e.g., conservative amino acids; and b) HC CDR1-3, that collectively, differ from the Ab 044 HC CDR1-3 by no more than, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, e.g., 1, 2, 3, or 4, amino acids, e.g., conservative amino acids.
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising SEQ ID NO: 25; and (b) a light chain variable region segment comprising SEQ ID NO: 52.
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S -Y- A -M-H (SEQ ID NO: 68) (or a sequence that differs by no more than, 1, 2, or 3, e.g., 1 or 2, amino acids, e.g., conservative amino acids, there from, optionally provided that at least 1 or 2 of the highlighted residue are not changed, e.g., both S and A are not changed); a CDR2 comprising the sequence V- V -S-Y-D-G- N -Y-K-Y-Y-A-D-S-V- O -G (SEQ ID NO: 69) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom, optionally provided that at least 1, 2, or 3 of the highlighted residues are not changed, e.g.,
  • a CDR of the light or heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR, (e.g., while other residues in that CDR might be changed, the highlighted residue or combination of residues, are not changed).
  • V or both N and Q , for heavy chain CDR2 are not changed.
  • a CDR of the light chain and a CDR of the heavy chain each includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of two CDRs in the antibody molecule includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • both are in the light chain.
  • both are in the heavy chain.
  • each of the three CDRs in the heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of the three CDRs in the light chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of the six CDRs in the heavy and light chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • the antibody molecule comprises one or more (e.g., 2, 3, 4, 5, or all) of the following properties: (a) both S and A in HC CDR1 are unchanged; (b) V or both N and Q or all three of V , N , and Q in HC CDR2 are unchanged; (c) R in HC CDR3 is unchanged; (d) One or both of I and D in LC CDR1 are unchanged; (e) 1, 2 or 3 of G , Y and L in LC CDR2 are unchanged; or (f) S in LC CDR3 is unchanged.
  • the antibody molecule comprises 1, 2, 3, 4, 5, or all 6 properties selected from (a) to (f).
  • the antibody molecule comprises a heavy chain having a one or more properties selected from (a), (b), and (c) and a light chain having one or more properties selected from (d), (e), and (f).
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising: a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70); and (b) a light chain variable region segment comprising a CDR1 comprising the sequence Q-S-I-T-F-D-Y-K-N-Y-L-A (SEQ ID NO: 145); a CDR2 comprising the sequence W-G-S-Y-L-E-S (SEQ ID NO:72); and a CDR3
  • the antibody molecule comprises one or both of: a) one or more framework regions (FRs) from SEQ ID NO: 25 e.g., the antibody molecule comprises one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from SEQ ID NO: 25; and b) one or more framework regions (FRs) from SEQ ID NO: 52.
  • FRs framework regions
  • the antibody molecule comprises one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from SEQ ID NO: 52.
  • the antibody molecule comprises: (a) a heavy chain immunoglobulin variable region segment that further comprises one or more or all of: an FR1 comprising the sequence Q-V-Q-L-L-E-T-G-G-G-L-V-K-P-G-Q-S-L-K-L-S-C-A-A-S-G-F-T-F- T (SEQ ID NO: 74) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2, amino acids, e.g., conservative amino acids, therefrom, optionally provided that T is not changed); an FR2 comprising the sequence W-V-R-Q-P-P-G-K-G-L-E- W -V-A (SEQ ID NO: 75) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2, amino acids, e.g., conservative amino acids, therefrom, optionally provided that
  • an FR4 comprising the sequence W-G-Q-G-T-T-L-T-V-S-S (SEQ ID NO: 77) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2, amino acids, e.g., conservative amino acids, therefrom) or W-G-Q-G-T-T-V-T-V-S-S (SEQ ID NO: 171) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2, amino acids, e.g., conservative amino acids, therefrom); and (b) a light chain immunoglobulin variable region segment comprising one or more or all of: an FR1 comprising the sequence D-I-Q-M-T-Q-S-P-S-S-L-S-A-S-V-G-D-R-V-T-I-T-C- R -S-S (SEQ ID NO: 77) (or a sequence
  • a FR of the light or heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR, (e.g., while other residues in that FR might be changed, the highlighted residue or combination of residues, are not changed).
  • one, two or three of I , R , or L for heavy chain FR3 is not changed.
  • a FR of the light chain and a FR of the heavy chain each includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • each of two FRs in the antibody molecule includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • both are in the light chain.
  • both are in the heavy chain.
  • each of FR2 and FR3 in the heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • each of FR1 and FR2 in the heavy and light chain includes one of the h ighlighted residues for that FR.
  • all of the highlighted residues in heavy chain FR1-4 are unchanged.
  • all of the highlighted residues in light chain FR1-4 are unchanged.
  • all of the highlighted residues in both heavy and light chain FR1-4 are unchanged.
  • sequence of FR1 of the heavy chain variable region segment is Q-V-Q-L-L-E-T-G-G-G-L-V-K-P-G-Q-S-L-K-L-S-C-A-A-S-G-F-T-F- T (SEQ ID NO: 74).
  • sequence of FR1 of the heavy chain variable region segment is E-V-Q-L-L-E-S-G-G-G-L-V-K-P-G-Q-S-L-K-L-S-C-A-A-S-G-F-T-F- T (SEQ ID NO: 183).
  • the antibody molecule comprises a structural or functional property of Ab 069.
  • the antibody molecule competes with a reference antibody molecule, e.g., an antibody molecule described herein, for binding to a substrate, e.g., an HA.
  • the reference antibody molecule can be: a) an antibody molecule comprising: i) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); and a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70); and ii) a light chain variable region segment comprising: a CDR1 comprising the sequence Q-S-I-T-F-E-Y
  • the antibody molecule binds to the same epitope, or a portion thereof, on HA, as does a reference antibody molecule, e.g. an antibody molecule disclosed herein.
  • the reference antibody molecule can be: a) an antibody molecule comprising: i) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); and a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70); and ii) a light chain variable region segment comprising: a CDR1 comprising the sequence Q-S-I-T-F-E-
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 25; and a light chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 155.
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 25; and a light chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 155, wherein each HC CDR differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., 1 or 2, e.g., conservative amino acids, from the corresponding CDR of SEQ ID NO: 25 and each LC CDR differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., 1 or 2, e.g., conservative amino acids, from the corresponding CDR of SEQ ID NO: 155.
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 25; and a light chain variable region comprising at least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 155, wherein the antibody molecule comprises 1, 2, 3, 4, 5, or all of: (i) a HC CDR1 comprising: S at the 1st position and A at the 3 rd position in HC CDR1; (ii) a HC CDR2 comprising one or both, e.g., one of: V at the 2nd position; or N at the 7 th position and Q at the 16 th position in HC CDR2; (iii) a HC CDR3 comprising: R at the 3 rd position (and optionally, L at the 3 rd position); (iv) a LC CDR1 comprising one or both of, e
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising SEQ ID NO: 25 (or a sequence that differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., conservative amino acids, therefrom); and (b) a light chain variable region segment comprising SEQ ID NO: 155 (or a sequence that differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., conservative amino acids, therefrom).
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising SEQ ID NO: 25; and (b) a light chain variable region segment comprising SEQ ID NO: 155.
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom); a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70) (or a heavy chain
  • the antibody molecule comprises one or both of: a) LC CDR1-3, that collectively, differ from the Ab 069 LC CDR1-3 by no more than, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, e.g., 1, 2, 3, or 4, amino acids, e.g., conservative amino acids; and b) HC CDR1-3, that collectively, differ from the Ab 069 HC CDR1-3 by no more than, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, e.g., 1, 2, 3, or 4, amino acids, e.g., conservative amino acids.
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S -Y- A -M-H (SEQ ID NO: 68) (or a sequence that differs by no more than, 1, 2, or 3, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom, optionally provided that at least 1 or 2 of the highlighted residues are not changed, e.g., both S and A are not changed); a CDR2 comprising the sequence V- V -S-Y-D-G- N -Y-K-Y-Y-A-D-S-V- Q -G (SEQ ID NO: 69) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom, optionally provided that at least 1, 2, or 3 of the highlighted residues are not changed, e.g.
  • a CDR of the light or heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR (e.g., while other residues in that CDR might be changed, the highlighted residue or combination of residues, are not changed).
  • a CDR of the light and a CDR of the heavy chain each includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of two CDRs in the antibody molecule includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR. In an embodiment, both are in the light chain. In an embodiment, both are in the heavy chain.
  • each of the three CDRs in the heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of the three CDRs in the light chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of the six CDRs in the heavy and light chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • the antibody molecule comprises one or more (e.g., 2, 3, 4, 5, or all) of the following properties: (a) both S and A in HC CDR1 are unchanged; (b) V or both N and Q or all three of V , N , and Q in HC CDR2 are unchanged; (c) R in HC CDR3 is unchanged; (d) one or both of I and E in LC CDR1 are unchanged; (e) 1, 2 or 3 of G , Y , and L in LC CDR2 are unchanged; or (f) S in LC CDR3 is unchanged.
  • the antibody molecule comprises 1, 2, 3, 4, 5, or all 6 properties selected from (a) to (f).
  • the antibody molecule comprises a heavy chain having a one or more properties selected from (a), (b), and (c) and a light chain having one or more properties selected from (d), (e), and (f).
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising: a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70); and (b) a light chain variable region segment comprising a CDR1 comprising the sequence Q-S-I-T-F-E-Y-K-N-Y-L-A (SEQ ID NO: 172); a CDR2 comprising the sequence W-G-S-Y-L-E-S (SEQ ID NO: 72); and a CDR3
  • the antibody molecule comprises one or both of: a) one or more framework regions (FRs) from SEQ ID NO: 25, e.g., one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from SEQ ID NO: 25; and b) one or more framework regions (FRs) from SEQ ID NO: 155, e.g., one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from SEQ ID NO: 155.
  • the antibody molecule comprises: (a) a heavy chain immunoglobulin variable region segment that further comprises one or more or all of: an FR1 comprising the sequence Q-V-Q-L-L-E-T-G-G-G-L-V-K-P-G-Q-S-L-K-L-S-C-A-A-S-G-F-T-F- T (SEQ ID NO:74) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2, amino acids, e.g., conservative amino acids, therefrom, optionally provided that T is not changed); an FR2 comprising the sequence W-V-R-Q-P-P-G-K-G-L-E- W -V-A (SEQ ID NO: 75) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2, amino acids, e.g., conservative amino acids, therefrom, optionally provided that W
  • the light chain immunoglobulin variable region segment comprises one or more or all of an FR1 comprising the sequence D-I-Q-M-T-Q-S-P-S-S-L-S-A-S-V-G-D-R-V-T-I-T-C- R -S-S (SEQ ID NO: 78) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom, optionally provided that R is not changed); an FR2 comprising the sequence W-Y-Q-Q-K-P-G-K-A-P-K-L-L-I-Y (SEQ ID NO: 79) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom); an FR3 comprising the sequence G-
  • a FR of the light or heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR (e.g., while other residues in that FR might be changed, the highlighted residue or combination of residues, are not changed).
  • one, two or three of I , R , or L for heavy chain FR3 is not changed.
  • a FR of the light chain and a FR of the heavy chain each includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • each of two FRs in the antibody molecule includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • both are in the light chain.
  • both are in the heavy chain.
  • each of FR2 and FR3 in the heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • each of FR1 and FR2 in the heavy and light chain includes one of the h ighlighted residues for that FR.
  • all of the highlighted residues in heavy chain FR1-4 are unchanged.
  • all of the highlighted residues in light chain FR1-4 are unchanged.
  • all of the highlighted residues in both heavy and light chain FR1-4 are unchanged.
  • the antibody molecule comprises a structural or functional property of Ab 032.
  • the antibody molecule competes with a reference antibody molecule, e.g., an antibody molecule described herein, for binding to a substrate, e.g., an HA.
  • the reference antibody molecule can be: a) an antibody molecule comprising: i) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); and a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70); and ii) a light chain variable region segment comprising: a CDR1 comprising the sequence Q-S-I-T-F-N-Y
  • the antibody molecule binds to the same epitope, or a portion thereof, on HA, as does a reference antibody molecule, e.g. an antibody molecule disclosed herein.
  • the reference antibody molecule can be: a) an antibody molecule comprising: i) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); and a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70); and ii) a light chain variable region segment comprising: a CDR1 comprising the sequence Q-S-I-T-F-N-
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 25; or a light chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 45.
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 25; and a light chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 45, wherein each HC CDR differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., 1 or 2, e.g., conservative amino acids, from the corresponding CDR of SEQ ID NO: 25 and each LC CDR differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., 1 or 2, e.g., conservative amino acids, from the corresponding CDR of SEQ ID NO: 45.
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 25; and a light chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 45, wherein the antibody molecule comprises 1, 2, 3, 4, 5, or all of: (i) a HC CDR1 comprising: S at the 1st position and A at the 3 rd position in HC CDR1; (ii) a HC CDR2 comprising one or both, e.g., one of: V at the 2 nd position; or N at the 7 th position and Q at the 16 th position in HC CDR2; (iii) a HC CDR3 comprising: R at the 3 rd position (and optionally, L at the 3 rd position); (iv) a LC CDR1 comprising: I at the 3 rd position
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising SEQ ID NO:25 (or a sequence that differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., conservative amino acids, therefrom); and (b) a light chain variable region segment comprising SEQ ID NO:155 (or a sequence that differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., conservative amino acids, therefrom).
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising SEQ ID NO: 25; and (b) a light chain variable region segment comprising SEQ ID NO: 155.
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom); a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70) (or a heavy chain
  • the antibody molecule comprises one or both of: a) LC CDR1-3, that collectively, differ from the Ab 032 LC CDR1-3 by no more than, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, e.g., 1, 2, 3, or 4, amino acids, e.g., conservative amino acids; and b) HC CDR1-3, that collectively, differ from the Ab 032 HC CDR1-3 by no more than, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, e.g., 1, 2, 3, or 4, amino acids, e.g., conservative amino acids.
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S -Y- A -M-H (SEQ ID NO: 68) (or a sequence that differs by no more than, 1, 2, or 3, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom, optionally provided that at least 1 or 2 of the highlighted residues are not changed, e.g., both S and A are not changed); a CDR2 comprising the sequence V- V -S-Y-D-G- N -Y-K-Y-Y-A-D-S-V- Q -G (SEQ ID NO: 69) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom, provided that, e.g., at least 1, 2, or 3 of the highlighted residues are not changed,
  • a CDR of the light or heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR (e.g., while other residues in that CDR might be changed, the highlighted residue or combination of residues, are not changed).
  • a CDR of the light and a CDR of the heavy chain each includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of two CDRs in the antibody molecule includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR. In an embodiment, both are in the light chain. In an embodiment, both are in the heavy chain.
  • each of the three CDRs in the heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of the three CDRs in the light chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of the six CDRs in the heavy and light chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • the antibody molecule comprises one or more (e.g., 2, 3, 4, 5, or all) of the following properties: (a) both S and A in HC CDR1 are unchanged; (b) V or both N and Q or all three of V , N , and Q in HC CDR2 are unchanged; (c) R in HC CDR3 is unchanged; (d) I in LC CDR1 is unchanged; (e) 1, 2 or 3 of G , Y , and L in LC CDR2 are unchanged; or (f) S in LC CDR3 is unchanged.
  • the antibody molecule comprises 1, 2, 3, 4, 5, or all 6 properties selected from (a) to (f).
  • the antibody molecule comprises a heavy chain having a one or more properties selected from (a), (b), and (c) and a light chain having one or more properties selected from (d), (e), and (f).
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising: a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70); and (b) a light chain variable region segment comprising a CDR1 comprising the sequence Q-S-I-T-F-N-Y-K-N-Y-L-A (SEQ ID NO: 71); a CDR2 comprising the sequence W-G-S-Y-L-E-S (SEQ ID NO:72); and a CDR3
  • the antibody molecule comprises one or both of: a) one or more framework regions (FRs) from SEQ ID NO: 25.
  • the antibody molecule comprises one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from SEQ ID NO: 25; and b) one or more framework regions (FRs) from SEQ ID NO: 45.
  • the antibody molecule comprises one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from SEQ ID NO: 45.
  • the antibody molecule comprises: (a) a heavy chain immunoglobulin variable region segment that further comprises one or more or all of: an FR1 comprising the sequence Q-V-Q-L-L-E-T-G-G-G-L-V-K-P-G-Q-S-L-K-L-S-C-A-A-S-G-F-T-F- T (SEQ ID NO: 74) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2, amino acids, e.g., conservative amino acids, therefrom, optionally provided that T is not changed); an FR2 comprising the sequence W-V-R-Q-P-P-G-K-G-L-E- W -V-A (SEQ ID NO: 75) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2, amino acids, e.g., conservative amino acids, therefrom, optionally provided that
  • the light chain immunoglobulin variable region segment comprises one or more or all of an FR1 comprising the sequence D-I-Q-M-T-Q-S-P-S-S-L-S-A-S-V-G-D-R-V-T-I-T-C- R -S-S (SEQ ID NO: 77) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom) or W-G-Q-G-T-T-V-T-V-S-S (SEQ ID NO:171) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom); and (b) the light chain immunoglobulin variable region segment comprises one or more or all of an FR1 comprising the sequence D-I-Q-M-T-Q-S-P-S-S-L
  • a FR of the light or heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR (e.g., while other residues in that FR might be changed, the highlighted residue or combination of residues, are not changed).
  • one, two or three of I , R , or L for heavy chain FR3 is not changed.
  • a FR of the light chain and a FR of the heavy chain each includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • each of two FRs in the antibody molecule includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • both are in the light chain.
  • both are in the heavy chain.
  • each of FR2 and FR3 in the heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • each of FR1 and FR2 in the heavy and light chain includes one of the h ighlighted residues for that FR.
  • all of the highlighted residues in heavy chain FR1-4 are unchanged.
  • all of the highlighted residues in light chain FR1-4 are unchanged.
  • all of the highlighted residues in both heavy and light chain FR1-4 are unchanged.
  • the antibody molecule comprises a structural or functional property of Ab 031.
  • the antibody molecule competes with a reference antibody molecule, e.g., an antibody molecule described herein, for binding to a substrate, e.g., an HA.
  • the reference antibody molecule can be: a) an antibody molecule comprising: i) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); and a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70); and ii) a light chain variable region segment comprising: a CDR1 comprising the sequence Q-S-I-T-F-N-Y
  • the antibody molecule binds to the same epitope, or a portion thereof, on HA, as does a reference antibody molecule, e.g. an antibody molecule disclosed herein.
  • the reference antibody molecule can be: a) an antibody molecule comprising: i) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); and a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70); and ii) a light chain variable region segment comprising: a CDR1 comprising the sequence Q-S-I-T-F-N-
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 24; and a light chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 45.
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 24; and a light chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 45, wherein, optionally, each HC CDR differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., 1 or 2, e.g., conservative amino acids, from the corresponding CDR of SEQ ID NO: 24 and each LC CDR differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., 1 or 2, e.g., conservative amino acids, from the corresponding CDR of SEQ ID NO: 45.
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 25; and a light chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with SEQ ID NO: 45, wherein the antibody molecule comprises 1, 2, 3, 4, 5, or all of: (i) a HC CDR1 comprising: S at the 1st position and A at the 3 rd position in HC CDR1; (ii) a HC CDR2 comprising one or both, e.g., one of: V at the 2 nd position; or N at the 7 th position and Q at the 16 th position in HC CDR2; (iii) a HC CDR3 comprising: R at the 3 rd position (and optionally, L at the 3 rd position); (iv) a LC CDR1 comprising: I at the 3 rd position
  • the antibody molecule comprises: (a) a heavy chain immunoglobulin variable region segment comprising SEQ ID NO: 24 (or a sequence that differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., conservative amino acids, therefrom); and (b) a light chain variable region segment comprising SEQ ID NO: 45 (or a sequence that differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., conservative amino acids, therefrom).
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising SEQ ID NO: 24; and (b) a light chain variable region segment comprising SEQ ID NO: 45.
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom); and a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70) (or
  • the antibody molecule comprises one or both of: a) LC CDR1-3, that collectively, differ from the Ab 031 LC CDR1-3 by no more than, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, e.g., 1, 2, 3, or 4, amino acids, e.g., conservative amino acids; and b) HC CDR1-3, that collectively, differ from the Ab 031 HC CDR1-3 by no more than, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, e.g., 1, 2, 3, or 4, amino acids, e.g., conservative amino acids.
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S -Y- A -M-H (SEQ ID NO: 68) (or a sequence that differs by no more than, 1, 2, or 3, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom, optionally provided that at least 1 or 2 of the highlighted residues are not changed, e.g., both S and A are not changed); a CDR2 comprising the sequence V- V -S-Y-D-G- N -Y-K-Y-Y-A-D-S-V- Q -G (SEQ ID NO: 69) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom, provided that, e.g., at least 1, 2, or 3 of the highlighted residues are not changed,
  • a CDR of the light or heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR (e.g., while other residues in that CDR might be changed, the highlighted residue or combination of residues, are not changed).
  • a CDR of the light and a CDR of the heavy chain each includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of two CDRs in the antibody molecule includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR. In an embodiment, both are in the light chain. In an embodiment, both are in the heavy chain.
  • each of the three CDRs in the heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of the three CDRs in the light chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • each of the six CDRs in the heavy and light chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that CDR.
  • the antibody molecule comprises one or more (e.g., 2, 3, 4, 5, or all) of the following properties: (a) both S and A in HC CDR1 are unchanged; (b) V or both N and Q or all three of V , N , and Q in HC CDR2 are unchanged; (c) R in HC CDR3 is unchanged; (d) I in LC CDR1 is unchanged; (e) 1, 2 or 3 of G , Y , and L in LC CDR2 are unchanged; (f) S in LC CDR3 is unchanged.
  • both S and A in HC CDR1 are unchanged
  • V or both N and Q or all three of V , N , and Q in HC CDR2 are unchanged
  • R in HC CDR3 is unchanged
  • I in LC CDR1 is unchanged
  • (e) 1, 2 or 3 of G , Y , and L in LC CDR2 are unchanged
  • S in LC CDR3 is unchanged.
  • the antibody molecule comprises 1, 2, 3, 4, 5, or all 6 properties selected from (a) to (f).
  • the antibody molecule comprises a heavy chain having a one or more properties selected from (a), (b), and (c) and a light chain having one or more properties selected from (d), (e), and (f).
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising a CDR1 comprising the sequence S-Y-A-M-H (SEQ ID NO: 68); a CDR2 comprising the sequence V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69); and a CDR3 comprising the sequence D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO:70); and (b) a light chain variable region segment comprising a CDR1 comprising the sequence Q-S-I-T-F-N-Y-K-N-Y-L-A (SEQ ID NO: 71); a CDR2 comprising the sequence W-G-S-Y-L-E-S (SEQ ID NO: 72); and a CDR3
  • the antibody molecule comprises one or both of: a) one or more framework regions (FRs) from SEQ ID NO: 24.
  • the antibody molecule comprises one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from SEQ ID NO: 24; and b) one or more framework regions (FRs) from SEQ ID NO: 45.
  • the antibody molecule comprises one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from SEQ ID NO: 45.
  • the antibody molecule comprises: (a) a heavy chain immunoglobulin variable region segment that further comprises one or more or all of: an FR1 comprising the sequence E-V-Q-L-L-E-S-G-G-G-L-V-K-P-G-Q-S-L-K-L-S-C-A-A-S-G-F-T-F- T (SEQ ID NO:82) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom, optionally provided that T is not changed); an FR2 comprising the sequence W-V-R-Q-P-P-G-K-G-L-E- W -V-A (SEQ ID NO:75) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom, optionally provided that W
  • FR4 comprising the sequence W-G-Q-G-T-T-L-T-V-S-S (SEQ ID NO:77) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom) or W-G-Q-G-T-T-V-T-V-S-S (SEQ ID NO:171) (or a sequence that differs by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids, therefrom); and (a) a light chain immunoglobulin variable region segment further comprises one or more or all of: an FR1 comprising the sequence D-I-Q-M-T-Q-S-P-S-S-L-S-A-S-V-G-D-R-V-T-I-T-C- R -S-S (SEQ ID NO:77) (or a sequence that differs
  • a FR of the light or heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR (e.g., while other residues in that FR might be changed, the highlighted residue or combination of residues, are not changed).
  • one, two or three of I , R , or L for heavy chain FR3 is not changed.
  • a FR of the light chain and a FR of the heavy chain each includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • each of two FRs in the antibody molecule includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • both are in the light chain.
  • both are in the heavy chain.
  • each of FR2 and FR3 in the heavy chain includes one of the highlighted residues, or one of the highlighted combinations of residues, for that FR.
  • each of FR1 and FR2 in the heavy and light chain includes one of the highlighted residues for that FR.
  • all of the highlighted residues in heavy chain FR1-4 are unchanged.
  • all of the highlighted residues in light chain FR1-4 are unchanged.
  • all of the highlighted residues in both heavy and light chain FR1-4 are unchanged.
  • the antibody molecule comprises: (a) the heavy chain immunoglobulin variable region segment comprises one or more or all of an FR1 comprising the sequence E-V-Q-L-L-E-S-G-G-G-L-V-K-P-G-Q-S-L-K-L-S-C-A-A-S-G-F-T-F- T (SEQ ID NO: 82); an FR2 comprising the sequence W-V-R-Q-P-P-G-K-G-L-E-W-V-A (SEQ ID NO: 75); an FR3 comprising the sequence R-F-T-I-S-R-D-N-S-K-N-T-L-Y-L-Q-M-N-S-L-R-A-E-D-T-A-V-Y-Y-C-A-K (SEQ ID NO: 76); and an FR4 comprising the sequence W-G-Q-G-T-T-L-T-V-L-
  • the antibody molecule comprises: (a) a heavy chain immunoglobulin variable region segment comprising SEQ ID NO: 24 (or a sequence that differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., conservative amino acids, therefrom); and (b) a light chain variable region segment comprising SEQ ID NO:45 (or a sequence that differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., conservative amino acids, therefrom).
  • the antibody molecule comprises a structural or functional property of one or both a heavy chain variable region and a light chain variable region disclosed herein.
  • the antibody molecule competes with a reference antibody molecule, e.g., an antibody molecule described herein, for binding to a substrate, e.g., an HA.
  • the reference antibody molecule can be: a) an antibody molecule comprising the heavy and light CDRs from: a heavy chain variable region from Table 3, Table 4A, Table 4B, FIG. 2 , FIG. 5 , or FIG. 7 ; and a light chain variable region from Table 3, Table 4A, Table 4B, FIGS. 3A-3B , FIGS. 6A-6B , or FIG. 7 ; b) an antibody molecule that comprises: (i) a heavy chain immunoglobulin variable region segment from Table 3, Table 4A, Table 4B, FIG. 2 , FIG.
  • the antibody molecule binds to the same epitope, or a portion thereof, on HA, as does a reference antibody molecule, e.g. an antibody molecule disclosed herein.
  • the reference antibody molecule can be: a) an antibody molecule comprising the heavy and light CDRs from: a heavy chain variable region from Table 3, Table 4A, Table 4B, FIG. 2 , FIG. 5 , or FIG. 7 ; and a light chain variable region from Table 3, Table 4A, Table 4B, FIGS. 3A-3B , FIGS. 6A-6B , or FIG. 7 ; b) an antibody molecule that comprises: (i) a heavy chain immunoglobulin variable region segment from Table 3, Table 4A, Table 4B, FIG. 2 , FIG.
  • the antibody molecule comprises one or both of: a heavy chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with a reference heavy chain from Table 3, Table 4A, Table 4B, FIG. 2 , FIG. 5 or FIG. 7 ; and a light chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with reference light chain from Table 3, Table 4A, Table 4B, FIGS. 3A-3B , FIGS. 6A-6B or FIG.
  • each HC CDR differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., 1 or 2, e.g., conservative amino acids, from the corresponding HC CDR from its reference heavy chain and each LC CDR differs by no more than 1, 2, 3, 4 or 5 amino acids, e.g., 1 or 2, e.g., conservative amino acids, from the corresponding CDR in its reference light chain.
  • the antibody molecule comprises: a heavy chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with a heavy chain from Table 3 and a light chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with the corresponding light chain from Table 3.
  • the antibody molecule comprises: a heavy chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with a heavy chain from Table 4A and a light chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with the corresponding light chain from Table 4A.
  • the antibody molecule comprises: a heavy chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with a heavy chain from Table 4B and a light chain variable region comprising least 60, 70, 80, 85, 90, 95, 98 or 99 percent homology with the corresponding light chain from Table 4B.
  • the antibody molecule comprises one or both of: a heavy chain variable region from Table 3, Table 4A, Table 4B, FIG. 2 , FIG. 5 , or FIG. 7 ; and a light chain variable region from Table 3, Table 4A, Table 4B, FIGS. 3A-3B , FIGS. 6A-6B , or FIG. 7 .
  • the antibody molecule comprises: a heavy chain variable region from Table 3 and the corresponding light chain from Table 3; a heavy chain from Table 4A and the corresponding light chain from Table 4A; or a heavy chain from Table 4B and the corresponding light chain from Table 4B.
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising a CDR1, a CDR2 and a CDR3 from a heavy chain sequence of Table 3, Table 4A, Table 4B, FIG. 2 , FIG. 5 , or FIG. 7 (or CDRs that, individually or collectively, differ therefrom by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids)); and (b) a light chain immunoglobulin variable region segment comprising a CDR1, a CDR2 and a CDR3 from a light chain sequence of Table 3, Table 4A, Table 4B, FIGS. 3A-3B , FIGS. 6A-6B , or FIG. 7 (or CDRs that, individually or collectively, differ therefrom by no more than, 1, 2, 3, 4, or 5, e.g., 1 or 2 amino acids, e.g., conservative amino acids).
  • the antibody molecule comprises one or both of: CDRs from a heavy chain of Table 3 and the light chain CDRs from the corresponding light chain from Table 3. In an embodiment, the antibody molecule comprises one or both of: CDRs from a heavy chain of Table 4A and the light chain CDRs from the corresponding light chain from Table 4A. In an embodiment, the antibody molecule comprises one or both of: CDRs from a heavy chain of Table 4B and the light chain CDRs from the corresponding light chain from Table 4B.
  • the antibody molecule comprises one or both of: (a) a heavy chain immunoglobulin variable region segment comprising a CDR1, a CDR2; and a CDR3 from a heavy chain sequence of FIG. 2 , FIG. 5 , or FIG. 7 ; and (b) a light chain immunoglobulin variable region segment comprising a CDR1, a CDR2 and a CDR3 from a light chain sequence of FIGS. 3A-3B , FIGS. 6A-6B , or FIG. 7 .
  • the antibody molecule comprises: (a) a heavy chain immunoglobulin variable region segment from FIG. 2 or FIG. 7 ; and (b) a light chain immunoglobulin variable region segment from FIGS. 3A-3B or FIG. 7 .
  • the heavy chain immunoglobulin variable region further comprises an Isoleucine-Aspartate (Ile-Asp) dipeptide at the N-terminus.
  • the light chain immunoglobulin variable region further comprises an Ile-Asp dipeptide at the N-terminus.
  • both the heavy chain immunoglobulin variable region and the light chain immunoglobulin variable region or an antibody featured in the disclosure further comprises an Ile-Asp dipeptide at the N-terminus.
  • the Ile-Asp dipeptide is absent from one or both the heavy and light chain.
  • the antibody molecule comprises one or both of: a) one or more framework regions (FRs) from heavy chain disclosed herein.
  • FRs framework regions
  • the antibody molecule comprises one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from heavy chain disclosed herein; and b) one or more framework regions (FRs) from light chain disclosed herein.
  • the antibody molecule comprises one or more or all of FR1, FR2, FR3, or FR4, or sequences that differ individually, or collectively, by no more than 1, 2, 3, 4, of 5 amino acid residues, e.g., conservative residues, from light chain disclosed herein.
  • the antibody molecule comprises:
  • a heavy chain immunoglobulin variable region segment comprising one or more or all of a CDR1 comprising the sequence G-F-T-F-[S/T]-[S/T]-Y-[A/G]-M-H (SEQ ID NO: 184), or a sequence that differs from SEQ ID NO: 184 by no more than 1 or 2 residues; a CDR2 comprising the sequence V-[I/V/L]-S-[Y/F]-D-G-[S/N]-[Y/N]-[K/R]-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 2) or a sequence that differs from SEQ ID NO: 2 by no more than 1 or 2 residues; or a CDR3 comprising the sequence D-[S/T]-[R/K/Q]-L-R-[S/T]-L-L-Y-F-E-W-L-S-[Q/S]-G-[Y/L
  • a light chain variable region segment comprising one or more or all of a CDR1 comprising the sequence [K/R]-S-S-Q-[S/T]-[V/L/I]-[T/S]-[Y/F/W]-[N/S/D]-Y-K-N-Y-L-A (SEQ ID NO: 185) or a sequence that differs from SEQ ID NO: 185 by no more than 1 or 2 residues, or comprising the sequence [K/R]-S-S-Q-[S/T]-[V/L/I]-[T/S]-[Y/F/W]-[N/S/D/Q/R/E]-Y-K-N-Y-L-A (SEQ ID NO: 186) or a sequence that differs from SEQ ID NO: 186 by no more than 1 or 2 residues or [K/R]-S-S-Q-[S/T]-[V/L/I]-[T/S]-[[V
  • the light chain variable region segment comprises: a CDR 1 comprising the sequence K-S-S-Q-S-V-T-Y-N-Y-K-N-Y-L-A (SEQ ID NO:83); a CDR2 comprising the sequence W-A-S-T-R-E-S (SEQ ID NO: 84); and a CDR3 comprising the sequence Q-Q-Y-Y-R-T-P-P-T (SEQ ID NO: 85);
  • the heavy chain variable region segment comprises one or more of the following: (a) CDRs other than the following: a CDR1 comprising the sequence S-Y-G-M-H (SEQ ID NO: 86); a CDR2 comprising the sequence V-I-S-Y-D-G-S-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 87); or a CDR3 comprising the sequence D-S-E-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO:88); or (b) FRs other than the following: an FR1 other than E-V-Q-L-L-E-S-G-G-G-L-V-K-P-G-Q-S-L-K-L-S-C-A-A-S-G-F-T-F- T (SEQ ID NO: 82); an FR2 other than W-
  • the heavy chain CDR sequences collectively, differ from the recited sequences by no more than 5, 4, 3, 2 or 1 amino acid residues; and the light chain CDR sequences, collectively, differ from the recited sequences by no more than 5, 4, 3, 2 or 1 amino acid residues.
  • the antibody molecule comprises:
  • HC heavy chain immunoglobulin variable region segment
  • LC light chain immunoglobulin variable region segment
  • the HC CDR1-3 and LC CDR1-3 collectively, comprise sequences that differ by 0, 1 or 2 amino acids from SEQ ID NOS: 68-73.
  • the antibody molecule comprises a heavy chain immunoglobulin variable region segment encoded by a nucleotide sequence described herein. In another embodiment, the antibody molecule comprises a light chain immunoglobulin variable region segment encoded by a nucleotide sequence described herein. In yet another embodiment, the antibody molecule comprises a heavy chain immunoglobulin variable region segment encoded by a nucleotide sequence described herein and a light chain immunoglobulin variable region segment encoded by a nucleotide sequence described herein.
  • the heavy chain immunoglobulin variable region segment is expressed from a recombinant vector, such as an expression vector, that comprises a nucleotide sequence that encodes a heavy chain immunoglobulin variable region segment.
  • the light chain immunoglobulin variable segment is expressed from a recombinant vector, such as an expression vector, that comprises a nucleotide sequence that encodes a light chain immunoglobulin variable region segment.
  • the heavy chain immunoglobulin variable region segment and light chain immunoglobulin variable region segment are expressed from a recombinant vector, such as an expression vector, that comprises a nucleotide sequence that encodes a heavy chain immunoglobulin variable region segment and a nucleotide sequence that encodes a light chain immunoglobulin variable region segment.
  • the nucleotide sequence encodes (a) a heavy chain immunoglobulin variable region segment comprising the amino acid sequence of: S-Y-A-M-H (SEQ ID NO: 68) in CDR1; V-V-S-Y-D-G-N-Y-K-Y-Y-A-D-S-V-Q-G (SEQ ID NO: 69) in CDR2; and D-S-R-L-R-S-L-L-Y-F-E-W-L-S-Q-G-Y-F-N-P (SEQ ID NO: 70) in CDR3; and (b) a light chain immunoglobulin variable region segment comprising the amino acid sequence of: Q-S-I-T-F-D-Y-K-N-Y-L-A (SEQ ID NO: 145) in CDR1; W-G-S-Y-L-E-S (SEQ ID NO: 72) in CDR2; and Q-Q-H-Y-R-T
  • the heavy chain immunoglobulin variable region segment is expressed from a cell (e.g., a host cell) containing a recombinant vector described herein, such as a recombinant vector comprising a nucleic acid sequence that encodes a heavy chain immunoglobulin variable region.
  • the light chain immunoglobulin variable region segment is expressed from a cell (e.g., a host cell) containing a recombinant vector described herein, such as a recombinant vector comprising a nucleic acid sequence that encodes a light chain immunoglobulin variable region.
  • the cell e.g., a host cell
  • the antibody molecule is made by a method comprising providing a cell (e.g., a host cell) comprising a nucleotide sequence expressing a heavy chain variable region segment and a nucleotide sequence expressing a light chain variable region segment, and expressing the nucleic acids in the cell.
  • a cell e.g., a host cell
  • nucleotide sequence expressing the heavy chain variable region segment and the nucleotide sequence expressing the light chain variable region segment are on the same recombinant vector (e.g., expression vector). In another embodiment, the nucleotide sequence expressing the heavy chain variable region segment and the nucleotide sequence expressing the light chain variable region segment are on separate recombinant vectors (e.g., expression vectors).
  • the antibody molecule is present in a pharmaceutical composition containing a pharmaceutically acceptable carrier.
  • the pharmaceutical composition is present in a container as described herein.
  • the disclosure features a method of treating or preventing infection with an influenza virus (e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004, or an influenza B virus, e.g., B/Wisconsin/1/2010), in a subject, e.g., a human subject.
  • the method includes administering a formulation described herein, e.g., a pharmaceutical formulation described herein, to a subject, e.g., human subject, in need thereof.
  • influenza A virus is an H1, H5, H9, H3 or H7 strain, such as an H1N1 strain, an H3N2 strain, an H5N1 strain, or an H7N9 strain of influenza A virus.
  • the formulation is administered at dose of about 2000 mg to about 5000 mg, e.g., about 2300 mg to about 4600 mg, about 2000 mg to about 2500 mg, about 2500 mg to about 3000 mg, about 3000 mg to about 3500 mg, about 3500 mg to about 4000 mg, about 4000 mg to about 4500 mg, about 4500 to about 5000 mg, of the antibody molecule.
  • the formulation is administered at a dose about 2300 mg or about 4600 mg, of the antibody molecule.
  • the formulation is administered intravenously, e.g., by infusion.
  • the administration results in, or correlates with, one or more of a reduction in the incidence or severity of a symptom or manifestation of an influenza infection, or the delay or onset of a symptom or manifestation of an influenza infection. In an embodiment, the administration results in, or correlates with, one or more of a reduction in the incidence or severity of a symptom or manifestation of a secondary infection, or the delay or onset of a symptom or manifestation of a secondary infection.
  • the subject e.g., a human subject
  • the method comprises, administering, or recommending the administration of, a second or additional therapy.
  • the antibody molecule is administered in combination with a second or additional agent or therapy.
  • the second or additional therapy comprises administration of a vaccine or an anti-viral therapy, e.g., an anti-NA or an anti-M2 therapy.
  • the second or additional therapy comprises a administration of a vaccine, e.g., a vaccine described herein or a mixture (a.k.a. a cocktail) of influenza peptides to stimulate the patient's immune system to prevent infection with particular strains of influenza A.
  • the second or additional agent comprises administering an anti-viral agent, a pain reliever, an anti-inflammatory, an antibiotic, a steroidal agent, a second therapeutic antibody molecule (e.g., an anti-HA antibody), an adjuvant, a protease or glycosidase (e.g., sialidase).
  • the second or additional agent comprises, acyclovir, ribavirin, amantadine, remantidine, a neuraminidase inhibitor (e.g., zanamivir (Relenza®), oseltamivir (Tamiflu®), laninamivir, peramivir), or rimantadine.
  • the second or additional agent comprises a second antibody molecule, e.g., Ab 67-11 (U.S. Provisional application No. 61/645,453, U.S. Application Publication No. 2013/0302348, and International Application Publication No. WO 2013/169377), FI6 (U.S. Application Publication No. 2010/0080813), FI28 (U.S. Application Publication No. 2010/0080813), C179 (Okuno et al., J. Virol. 67:2552-8, 1993), F10 (Sui et al., Nat. Struct. Mol. Biol.
  • a second antibody molecule e.g., Ab 67-11 (U.S. Provisional application No. 61/645,453, U.S. Application Publication No. 2013/0302348, and International Application Publication No. WO 2013/169377), FI6 (U.S. Application Publication No. 2010/0080813), FI28 (U.S. Application
  • the formulation described herein e.g., a formulation comprising Ab 044 can be used in combination of any of those antibodies.
  • the second or additional agent comprises a second or additional antibody molecule, e.g., an anti-HA antibody, e.g., an anti-HA antibody disclosed herein.
  • a second or additional antibody molecule e.g., an anti-HA antibody, e.g., an anti-HA antibody disclosed herein.
  • an anti-HA antibody e.g., an anti-HA antibody disclosed herein.
  • two or more of Ab 044, Ab 069, Ab 032, and Ab 031 can be administered.
  • Ab 044 can be administered in combination with Ab 069 or Ab 032.
  • two agents can be administered as part of the same dosage unit or administered separately.
  • Other exemplary agents useful for treating the symptoms associated with influenza infection are acetaminophen, ibuprofen, aspirin, and naproxen.
  • the formulation e.g., pharmaceutical formulation
  • the formulation, e.g., pharmaceutical formulation is administered prior to known exposure to influenza, or to particular influenza subtypes or strains.
  • the formulation, e.g., pharmaceutical formulation is administered prior to manifestation of effects or symptoms of influenza infection, or to one or more particular effects manifestation of effects or symptoms of influenza infection.
  • the formulation, e.g., pharmaceutical formulation is administered after known exposure to influenza, or to particular influenza subtypes or strains.
  • the formulation e.g., pharmaceutical formulation
  • the formulation is administered after manifestation of effects or symptoms of influenza infection, or after observation of one or more particular effects manifestation of effects or symptoms of influenza infection.
  • the formulation e.g., pharmaceutical formulation
  • a manifestation of an effect or a symptom of influenza infection e.g., inflammation, fever, nausea, weight loss, loss of appetite, rapid breathing, increase heart rate, high blood pressure, body aches, muscle pain, eye pain, fatigue, malaise, dry cough, runny nose, and/or sore throat.
  • the method further comprises, testing the subject, e.g., human subject, for the influenza virus, e.g., with a method disclosed herein.
  • the administration is responsive to a positive test for influenza.
  • the disclosure features a method of treating a subject, e.g., a human subject, infected with an influenza virus (e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004, or an influenza B virus, e.g., B/Wisconsin/1/2010) by administering a formulation, e.g., pharmaceutical formulation, described herein.
  • the influenza A virus is an H1, H5, H9, H3 or H7 strain, such as an H1N1 strain, an H3N2 strain, an H5N1 strain, or an H7N9 strain of influenza A virus.
  • the formulation e.g., pharmaceutical formulation
  • the formulation is administered instead of a vaccine for prevention of influenza.
  • the formulation e.g., pharmaceutical formulation
  • the disclosure features a method of detecting influenza (e.g., influenza A or influenza B) virions in a biological sample, such as by contacting the sample with a formulation, e.g., pharmaceutical formulation, comprising an anti-HA antibody molecule described herein, and then detecting the binding of the antibody molecule to the sample.
  • influenza virus e.g., influenza A or influenza B virus
  • the method of detecting the influenza virus is performed in vitro.
  • the disclosure features a method of (a) providing a sample from a patient; (b) contacting the sample with a formulation, e.g., pharmaceutical formulation, comprising an anti-HA antibody molecule described herein, and (c) determining whether the antibody molecule binds a polypeptide in the sample, where if the antibody molecule binds a polypeptide in the sample, then the patient is determined to be infected with an influenza virus (e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004, or an influenza B virus, e.g., B/Wisconsin/1/2010).
  • an influenza virus e.g.,
  • the patient is determined to be infected with an influenza virus (e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009, or an H5N1 strain, e.g., A/Indonesia/5/2005 or A/Vietnam/1203/2004, or an influenza B virus, e.g., B/Wisconsin/1/2010), and the patient is further administered a formulation or an antibody molecule, disclosed herein, with which the test was performed.
  • an influenza virus e.g., an influenza A virus, e.g., a Group 1 strain, e.g., an H1N1 strain, e.g., A/South Carolina/1/1918, A/Puerto Rico/08/1934, or A/California/04/2009
  • FIG. 1 is the heavy and light chain amino acid sequences (SEQ ID NOs:94 and 95, respectively) of the anti-HA antibody A18.
  • the constant domain sequence is indicated by italics.
  • the CDRs are indicated by underlining.
  • FIG. 2 is the variable heavy chain domain sequence of exemplary anti-HA antibodies.
  • the SEQ ID NOs for sequences shown are as follows: VH15 is SEQ ID NO: 15; VH16 is SEQ ID NO: 16; VH17 is SEQ ID NO: 17; VH18 is SEQ ID NO: 18; VH19 is SEQ ID NO: 19; VH21 is SEQ ID NO: 21; VH22 is SEQ ID NO: 22; VH20 is SEQ ID NO: 20; VH23 is SEQ ID NO: 23; VH24 is SEQ ID NO: 24; VH25 is SEQ ID NO: 25; VH26 is SEQ ID NO: 26; VH27 is SEQ ID NO: 27; and VH161 is SEQ ID NO: 161.
  • FIGS. 3A-3B depict the variable light chain domain sequence of exemplary anti-HA antibodies.
  • the SEQ ID NOs for sequences shown are as follows: VL28 is SEQ ID NO: 28; VL29 is SEQ ID NO: 29; VL30 is SEQ ID NO: 30; VL35 is SEQ ID NO: 35; VL31 is SEQ ID NO: 31; VL32 is SEQ ID NO: 32; VL33 is SEQ ID NO: 33; VL34-ID is SEQ ID NO: 34; VL36 is SEQ ID NO: 36; VL45 is SEQ ID NO: 45; VL46 is SEQ ID NO: 46; VL37 is SEQ ID NO: 37; VL38 is SEQ ID NO: 38; VL39 is SEQ ID NO: 39; VL40 is SEQ ID NO: 40; VL41 is SEQ ID NO: 41; VL42 is SEQ ID NO: 42; VL43 is SEQ ID NO: 43; VL44 is SEQ ID NO: 44; VL47 is S
  • FIG. 4 shows the amino acid sequences of the heavy chain variable regions of FI6 (SEQ ID NO: 175), FI370 (SEQ ID NO: 176), FI6 variant 1 (SEQ ID NO: 177), FI6 variant 3 (SEQ ID NO: 178), FI6/370 (SEQ ID NO: 179) and the amino acid sequence of kappa light chain variable region of FI6 (SEQ ID NO: 180).
  • FIG. 5 is the variable heavy chain domain sequence of exemplary anti-HA antibodies as shown in FIG. 2 and including an N-terminal ID dipeptide.
  • the SEQ ID NOs. for sequences shown are as follows: VH15-ID is SEQ ID NO: 96; VH16-ID is SEQ ID NO: 97; VH17-ID is SEQ ID NO: 98; VH18-ID is SEQ ID NO: 99; VH19-ID is SEQ ID NO: 100; VH21-ID is SEQ ID NO: 101; VH22-ID is SEQ ID NO: 102; VH20-ID is SEQ ID NO: 103; VH23-ID is SEQ ID NO: 104; VH24-ID is SEQ ID NO: 105; VH25-ID is SEQ ID NO: 106; VH26-ID is SEQ ID NO: 107; VH27-ID is SEQ ID NO: 108; and VH161-ID is SEQ ID NO: 109.
  • FIGS. 6A-6B depict the variable light chain domain sequence of exemplary anti-HA antibodies as shown in FIGS. 3A-3B and including an N-terminal ID dipeptide.
  • the SEQ ID NOs for sequences shown are as follows: VL28-ID is SEQ ID NO: 110; VL29-ID is SEQ ID NO: 111; VL30-ID is SEQ ID NO: 112; VL35-ID is SEQ ID NO: 113; VL31-ID is SEQ ID NO: 114; VL32-ID is SEQ ID NO: 115; VL33-ID is SEQ ID NO: 116; VL34-ID is SEQ ID NO: 117; VL36-ID is SEQ ID NO: 118; VL45-ID is SEQ ID NO: 119; VL46-ID is SEQ ID NO: 120; VL37-ID is SEQ ID NO: 121; VL38-ID is SEQ ID NO: 122; VL39-ID is SEQ ID NO: 123; V
  • FIG. 7 shows the variable light and heavy chain sequences of additional exemplary anti-HA antibodies.
  • the SEQ ID NOs for sequences shown are as follows: VL165 is SEQ ID NO: 165; VL166 is SEQ ID NO: 166; VL167 is SEQ ID NO: 167; VL168 is SEQ ID NO: 168; VL169 is SEQ ID NO: 169; VH164 is SEQ ID NO: 164; VH162 is SEQ ID NO: 162; VH163 is SEQ ID NO: 163.
  • FIGS. 8A-8G show the DSC profile for all of the 14 formulation samples tested in Example 2.
  • FIG. 9 depicts representative reduced CE-SDS electropherogram (Formulation #1, 45° C., 2 wks).
  • FIG. 10 depicts representative non-reduced CE-SDS electropherogram (Formulation #1, 45° C., 2 wks).
  • FIG. 11 depicts representative SEC chromatogram (Formulation #1, 45° C., 2 wks).
  • FIG. 12 depicts a representative IEF gel image.
  • the disclosure is based, at least in part, on the design and synthesis of antibody molecules that can bind an epitope that is conserved across multiple hemagglutinin subtypes of influenza viruses (e.g., influenza A and influenza B viruses).
  • formulations e.g., pharmaceutical formulations
  • formulations comprising the antibody molecules described herein are useful as broad spectrum therapy against disease caused by at least one influenza A strain belonging to Group 1 and one influenza A strain belonging to Group 2 to neutralize infectivity of viruses belonging to both Group 1 and Group 2 (at least one subtype of each).
  • formulations e.g., pharmaceutical formulations
  • the formulations are suitable for use in treating or preventing influenza viruses, at least in part, because the formulations (e.g., pharmaceutical formulations) have one or more desired properties such as improved stability (e.g., low degradation and/or aggregation) and maintained potency (e.g., HA binding).
  • the antibody molecules were designed by a rational structure-based approach to target a region on the virus that is not fully accessible to the human immune system and, therefore, not amenable to antibody selection through more classical screening approaches.
  • This rational-based approach to the design and development of broad-spectrum antibody molecules allows for the development of more efficacious vaccines for pandemic and seasonal influenza.
  • This approach also allows for the advance preparation of pandemic vaccines so that they are ready to be employed against specific virus subtypes (e.g., avian virus subtypes) that may mutate to become human-adapted and highly transmissible.
  • Vaccines e.g., seasonal vaccines
  • that utilize the approach described herein can generate a more potent immune response without the use of adjuvants and provide broad protection against viral strain variation.
  • an antibody molecule refers to a polypeptide that comprises sufficient sequence from an immunoglobulin heavy chain variable region and/or sufficient sequence from an immunoglobulin light chain variable region, to provide antigen specific binding. It comprises full length antibodies as well as fragments thereof, e.g., Fab fragments, that support antigen binding. Typically an antibody molecule will comprise heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3 sequence. Antibody molecules include human, humanized, CDR-grafted antibodies and antigen binding fragments thereof. In an embodiment, an antibody molecule comprises a protein that comprises at least one immunoglobulin variable region segment, e.g., an amino acid sequence that provides an immunoglobulin variable domain or immunoglobulin variable domain sequence.
  • the VH or VL chain of the antibody molecule can further include all or part of a heavy or light chain constant region, to thereby form a heavy or light immunoglobulin chain, respectively.
  • the antibody molecule is a tetramer of two heavy immunoglobulin chains and two light immunoglobulin chains.
  • An antibody molecule can comprise one or both of a heavy (or light) chain immunoglobulin variable region segment.
  • a heavy (or light) chain immunoglobulin variable region segment refers to an entire heavy (or light) chain immunoglobulin variable region, or a fragment thereof, that is capable of binding antigen. The ability of a heavy or light chain segment to bind antigen is measured with the segment paired with a light or heavy chain, respectively.
  • a heavy or light chain segment that is less than a full length variable region will, when paired with the appropriate chain, bind with an affinity that is at least 20, 30, 40, 50, 60, 70, 80, 90, or 95% of what is seen when the full length chain is paired with a light chain or heavy chain, respectively.
  • An immunoglobulin variable region segment may differ from a reference or consensus sequence.
  • to “differ,” means that a residue in the reference sequence or consensus sequence is replaced with either a different residue or an absent or inserted residue.
  • An antibody molecule can comprise a heavy (H) chain variable region (abbreviated herein as VH), and a light (L) chain variable region (abbreviated herein as VL).
  • an antibody comprises two heavy (H) chain variable regions and two light (L) chain variable regions or antibody binding fragments thereof.
  • the light chains of the immunoglobulin may be of types kappa or lambda.
  • the antibody molecule is glycosylated.
  • An antibody molecule can be functional for antibody dependent cytotoxicity and/or complement-mediated cytotoxicity, or may be non-functional for one or both of these activities.
  • An antibody molecule can be an intact antibody or an antigen-binding fragment thereof.
  • Antibody molecules include “antigen-binding fragments” of a full length antibody, e.g., one or more fragments of a full-length antibody that retain the ability to specifically bind to an HA target of interest.
  • binding fragments encompassed within the term “antigen-binding fragment” of a full length antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′) or F(ab′) 2 fragment, a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the VH and CH1 domains; (iv) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementar
  • the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules known as single chain Fv (scFv).
  • scFv single chain Fv
  • Antibody molecules include diabodies.
  • an antibody refers to a polypeptide, e.g., a tetrameric or single chain polypeptide, comprising the structural and functional characteristics, particularly the antigen binding characteristics, of an immunoglobulin.
  • a human antibody comprises two identical light chains and two identical heavy chains. Each chain comprises a variable region.
  • variable heavy (VH) and variable light (VL) regions can be further subdivided into regions of hypervariability, termed “complementarity determining regions” (“CDR”), interspersed with regions that are more conserved, termed “framework regions” (FR).
  • CDR complementarity determining regions
  • Human antibodies have three VH CDRs and three VL CDRs, separated by framework regions FR1-FR4. The extent of the FRs and CDRs has been precisely defined (see, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; and Chothia, C. et al. (1987) J. Mol. Biol.
  • Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the heavy and light immunoglobulin chains can be connected by disulfide bonds.
  • the heavy chain constant region typically comprises three constant domains, CHL CH2 and CH3.
  • the light chain constant region typically comprises a CL domain.
  • the variable region of the heavy and light chains contains a binding domain that interacts with an antigen.
  • the constant regions of the antibodies typically mediate the binding of the antibody to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • immunoglobulin comprises various broad classes of polypeptides that can be distinguished biochemically. Those skilled in the art will appreciate that heavy chains are classified as gamma, mu, alpha, delta, or epsilon ( ⁇ , ⁇ , ⁇ , ⁇ , ⁇ ) with some subclasses among them (e.g., ⁇ 1- ⁇ 4). It is the nature of this chain that determines the “class” of the antibody as IgG, IgM, IgA IgD, or IgE, respectively.
  • the immunoglobulin subclasses isotypes) e.g., IgG1, IgG2, IgG3, IgG4, IgA1, etc.
  • Light chains are classified as either kappa or lambda ( ⁇ , ⁇ ). Each heavy chain class may be bound with either a kappa or lambda light chain.
  • Suitable antibodies include, but are not limited to, monoclonal, monospecific, polyclonal, polyspecific, human antibodies, primatized antibodies, chimeric antibodies, bi-specific antibodies, humanized antibodies, conjugated antibodies (e.g., antibodies conjugated or fused to other proteins, radiolabels, or cytotoxins), Small Modular ImmunoPharmaceuticals (“SMIPsTM”), single chain antibodies, cameloid antibodies, and antibody fragments.
  • SMIPsTM Small Modular ImmunoPharmaceuticals
  • an antibody is a humanized antibody.
  • a humanized antibody refers to an immunoglobulin comprising a human framework region and one or more CDR's from a non-human, e.g., mouse or rat, immunoglobulin.
  • the immunoglobulin providing the CDR's is often referred to as the “donor” and the human immunoglobulin providing the framework often called the “acceptor,” though in an embodiment, no source or no process limitation is implied.
  • a humanized antibody comprises a humanized light chain and a humanized heavy chain immunoglobulin.
  • Immunoglobulin domain refers to a domain from the variable or constant domain of immunoglobulin molecules. Immunoglobulin domains typically contain two ⁇ -sheets formed of about seven ⁇ -strands, and a conserved disulfide bond (see e.g., A. F. Williams and A. N. Barclay (1988) Ann. Rev. Immunol. 6:381-405).
  • an “immunoglobulin variable domain sequence” refers to an amino acid sequence that can form the structure of an immunoglobulin variable domain.
  • the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain.
  • the sequence may omit one, two or more N- or C-terminal amino acids, internal amino acids, may include one or more insertions or additional terminal amino acids, or may include other alterations.
  • a polypeptide that comprises an immunoglobulin variable domain sequence can associate with another immunoglobulin variable domain sequence to form a target binding structure (or “antigen binding site”), e.g., a structure that interacts with the target antigen.
  • antibodies comprises intact monoclonal antibodies, polyclonal antibodies, single domain antibodies (e.g., shark single domain antibodies (e.g., IgNAR or fragments thereof)), multispecific antibodies (e.g., bi-specific antibodies) formed from at least two intact antibodies, and antibody fragments so long as they exhibit the desired biological activity.
  • Antibodies for use herein may be of any type (e.g., IgA, IgD, IgE, IgG, or IgM).
  • the antibody or antibody molecule can be derived from a mammal, e.g., a rodent, e.g., a mouse or rat, horse, pig, or goat. In an embodiment, an antibody or antibody molecule is produced using a recombinant cell. In some embodiments an antibody or antibody molecule is a chimeric antibody, for example, from mouse, rat, horse, pig, or other species, bearing human constant and/or variable regions domains.
  • a binding agent is an agent that bind, e.g., specifically binds, a target antigen, e.g., HA. Binding agents of the invention share sufficient structural relationship with anti-HA antibody molecules disclosed herein to support specific binding to HA, and in an embodiment, other functional properties of an anti-HA antibody molecule disclosed herein. In an embodiment, a binding agent will exhibit a binding affinity at of at least 10, 20, 30, 40, 50, 60, 70, 80, or 90% of an antibody molecule disclosed herein, e.g., an antibody molecule with which it shares, significant structural homology, e.g., CDR sequences. Binding agents can be naturally occurring, e.g., as are some antibodies, or synthetic.
  • a binding agents is a polypeptide, e.g., an antibody molecule, e.g., an antibody. While some binding agents are antibody molecules, other molecules, e.g., other polypeptides, can also function as binding agents. Polypeptide binding agents can be monomeric or multimeric, e.g., dimeric, trimeric, or tetrameric and can be stabilized by intra- or interchain bonds, e.g., disulfide bonds. They can contain natural or non-naturally occurring amino acid residues. In an embodiment, binding agents are antibody molecules, or other polypeptides, that present one or more CDRs of antibody molecules disclosed herein or that otherwise mimic the structure of an antibody molecule disclosed herein.
  • Binding agents can also comprise aptomers, nucleic acids or other molecular entities.
  • a binding agent can be developed in a variety of ways, e.g., by immunization, by rational design, screening of random structures, or a combination of those or other approaches. Typically a binding agent will act by making contact with substantially the same epitope as an antibody molecule disclosed herein, e.g., an antibody molecule with which it shares, significant structural homology, e.g., CDR sequences.
  • a binding agent can interact with amino acids, saccharides, or combinations thereof.
  • Polypeptides other than antibodies can be used as a scaffold to present sequence, e.g., one or more, or a complete set of heavy chain and/or light chain CDRs, disclosed herein.
  • Exemplary scaffolds include adnectin, zinc finger DNA-binding proteins. protein A, lipoclins, ankryin consensus repeat domain, thioredoxin, anticalins, centyrin, avimer domains, ubiquitin, peptidomimetics, stapled peptides, cystine-knot miniproteins, and IgNARs.
  • a binding agent is or comprises a nucleic acid, e.g., DNA, RNA or mixtures thereof.
  • a binding agent e.g., a nucleic acid, shows secondary, tertiary, or quaternary structure.
  • a binding agent, e.g., a nucleic acid forms a structure that mimics the structure of an antibody molecule disclosed herein.
  • a broad spectrum binding agent e.g., antibody molecule, as used herein, binds, a plurality of different HA molecules, and optionally neutralizes viruses comprising the different HA molecules. In an embodiment it binds a first HA and binds a second HA from influenza A Group 1, and optionally neutralizes viruses comprising the first or second HA molecules. In an embodiment, it binds a first HA from an influenza A Group 1 virus, and binds a second HA from an influenza A Group 2 virus, and optionally neutralizes viruses comprising the different HA molecules.
  • it binds a first HA from an influenza A Group 1 or 2 virus and binds a HA from an influenza B virus, and optionally neutralizes viruses comprising the different HA molecules. In an embodiment, it binds, and in an embodiment neutralizes, at least two different clades or clusters of virus, e.g., from different Groups. In an embodiment, it binds, and in an embodiment neutralizes, all or substantially all strains of Group 1 and/or Group 2 disclosed herein.
  • a binding agent e.g., antibody molecule
  • a binding agent e.g., antibody molecule
  • a binding agent, e.g., antibody molecule binds, and in an embodiment, neutralizes: at least one strain from the Group 2 H3 or H7 cluster and at least one influenza B strain.
  • a binding agent e.g., antibody molecule
  • binds and in an embodiment, neutralizes: at least one strain from the Group 1 H1, e.g., H1a or H1b, cluster, at least one strain from the Group 2 H3 or H7 cluster, and at least one influenza B strain.
  • binding agent e.g., antibody molecule
  • binding agent binds, and optionally neutralizes or mediate infection of particular hosts, e.g., avian, camel, canine, cat, civet, equine, human, mouse, swine, tiger, or other mammal or bird.
  • combination therapy refers to administration of a plurality of agents, e.g., wherein at least one binding agent, e.g., antibody molecule, disclosed herein is administered to a subject, e.g., a human subject.
  • the introduction of the agents into the subject can be at different times.
  • the agents are administered in overlapping regimens, or such that the subject is simultaneously exposed to both agents, or such that the response of the subject is better than would be seen with either agent administered alone.
  • an “escape mutant” is a mutated influenza strain that is resistant to neutralization by an anti-HA antibody molecule described herein.
  • an escape mutant is resistant to neutralization with a binding agent, e.g., antibody molecule, but its parent strain is neutralized by the binding agent, e.g., antibody molecule.
  • pandemic influenza refers to a new viral strain that arises due to human adaptation of an influenza strain by mutation or by emergence of a strain by reassortment of different strains of influenza A.
  • the resulting pandemic strain is significantly different from previous strains and most people will have little or no pre-existing immunity Symptoms and complications may be more severe and more frequent than those typical of seasonal influenza.
  • pandemic flu viruses include, e.g., the 2009 H1N1 ‘swine flu,’ the 1957-58 H2N2 ‘Asian flu’ and the 1968 H3N2 influenza strains.
  • an antibody molecule e.g., a antibody, a immunogen, or generally a polypeptide, obtained from a natural source
  • a polypeptide e.g., an antibody molecule, that is isolated includes preparations of a polypeptide having less than about 30%, 20%, 10%, 5%, 2%, or 1% (by dry weight) of cellular materials and/or contaminating materials.
  • purified and isolated when used in the context of a chemically synthesized species, e.g., an antibody molecule, or immunogen, refers to the species which is substantially free of chemical precursors or other chemicals which are involved in the syntheses of the molecule.
  • a preparation of binding agents, e.g., antibody molecules, as used herein, comprises a plurality of molecules of a binding agent, e.g., antibody molecule, described herein.
  • that binding agent e.g., antibody molecule
  • that binding agent is an antibody molecule which makes up at least 60, 70, 80, 90, 95, 98, 99, 99.5 or 99.9%, of the preparation, or of the active ingredients, or polypeptide ingredients, or antibody molecules, of the preparation, by weight or number.
  • the binding agent is an antibody molecule and the preparation contains no more than 30, 20, 10, 5, 2, 1, or 0.5%, by weight or number, of a contaminant, e.g., a reactant, solvent, precursor or other species, from the source, or used in the preparation, of the antibody molecule, e.g., a species from a cell, reaction mixture, or other system used to produce the antibody molecule.
  • a contaminant e.g., a reactant, solvent, precursor or other species
  • prevent infection means that a subject (e.g., a human) is less likely to be infected by influenza if the subject receives the antibody prior to (e.g., 1 day, 2 days, 1 week, 2 weeks, 3 weeks, or 1 month of more) before being exposed to influenza.
  • seasonal influenza is a strain that is identical or closely related to strains that have been circulating in the human population in recent years and therefore most people are at least partially immune to it. Such a strain is not likely to cause severe disease. Symptoms can include fever, cough, runny nose, and muscle pain, and in rare cases, death can result from complications, such as pneumonia. Outbreaks follow predictable seasonal patterns, annually, and usually in fall and winter and in temperate climates. Infection due to seasonal influenza is commonly referred to as the flu.
  • specific binding means that a binding agent, e.g., an antibody molecule, binds its antigen with a K D of equal to or less than 10 ⁇ 5 nM.
  • the antibody binds it's antigen with a K D of equal to or less than 10 ⁇ 6 , 10 ⁇ 7 , 10 ⁇ 8 , 10 ⁇ 9 , 10 ⁇ 10 , 10 ⁇ 11 , or 10 ⁇ 12 nM.
  • the term “therapeutically effective amount” refers to an amount of a therapeutic agent, e.g., a binding agent, e.g., an antibody molecule, which results in a positive outcome for the subject. In an embodiment, it can be statistically correlated with therapeutic effect or benefit, e.g., the lessening or prevention of a manifestation of an effect or a symptom, when administered to a population of subjects. In an embodiment, it is an amount that also provides a preselected, or reasonable, benefit/risk ratio. In an embodiment, it is an amount effective to reduce the incidence and/or severity of and/or to delay onset of one or more features, symptoms, or characteristics of a disease, disorder, or condition. A therapeutically effective amount is can be administered in a dosing regimen that may comprise one or multiple unit doses.
  • the term “treat infection” means that a subject (e.g., a human) who has been infected with an influenza and experiences symptoms of the influenza (e.g., the flu), will In an embodiment, suffer less severe symptoms and/or will recover faster when the antibody molecule is administered than if the antibody is never administered.
  • an assay to detect virus in the subject will detect less virus after effective treatment for the infection.
  • a diagnostic assay using an antibody molecule such as an antibody molecule described herein, will detect less or no virus in a biological sample of a patient after administration of an antibody molecule for the effective treatment of the viral infection.
  • treatment can, e.g., partially or completely alleviate, ameliorate, relive, inhibit, reduce the severity of, and/or reduces incidence and optionally, delay onset of, one or more manifestations of the effects or symptoms, features, and/or causes of a particular disease, disorder, and/or condition (e.g., influenza).
  • treatment is of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition.
  • treatment is of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition.
  • treatment is of a subject diagnosed as suffering from influenza.
  • sequence identity or “identity” between two sequences (the terms are used interchangeably herein) can be performed as follows.
  • the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
  • the optimal alignment is determined as the best score using the GAP program in the GCG software package with a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”.
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences.
  • binding agents e.g., antibody molecules, described herein can be formulated, e.g., as pharmaceutical compositions, such as for the treatment or prevention of influenza.
  • a pharmaceutical composition typically includes a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • a “pharmaceutically acceptable salt” refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S. M., et al. (1977) J. Pharm. Sci. 66:1-19). Examples of such salts include acid addition salts and base addition salts.
  • Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
  • Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N′-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
  • compositions comprising the antibody molecules described herein can be formulated according to methods known in the art.
  • Pharmaceutical formulation is a well-established art, and is further described in Gennaro (ed.), Remington: The Science and Practice of Pharmacy, 20 th ed., Lippincott, Williams & Wilkins (2000) (ISBN: 0683306472); Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7 th Ed., Lippincott Williams & Wilkins Publishers (1999) (ISBN: 0683305727); and Kibbe (ed.), Handbook of Pharmaceutical Excipients American Pharmaceutical Association, 3 rd ed. (2000) (ISBN: 091733096X).
  • compositions may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories.
  • liquid solutions e.g., injectable and infusible solutions
  • dispersions or suspensions tablets, pills, powders, liposomes and suppositories.
  • the form can depend on the intended mode of administration and therapeutic application.
  • compositions for the agents described herein are in the form of injectable or infusible solutions.
  • compositions can be administered by a parenteral mode (e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection).
  • parenteral administration e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection.
  • parenteral administration e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection.
  • parenteral administration e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection.
  • parenteral administration e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection.
  • IM intravenous, intramuscular
  • intraarterial intrathecal
  • intracapsular intraorbital
  • intracardiac intradermal
  • intraperitoneal transtracheal
  • subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid intraspinal, epidural and by intrasternal injection or by infusion.
  • compositions may be provided in a sterile injectable form (e.g., a form that is suitable for subcutaneous injection or intravenous infusion).
  • the pharmaceutical composition is provided in a liquid dosage form that is suitable for injection or topical application.
  • pharmaceutical compositions are provided as in dry form, e.g., as powders (e.g. lyophilized and/or sterilized preparations).
  • the Pharmaceutical composition can be provided under conditions that enhance stability, e.g., under nitrogen or under vacuum. Dry material can be reconstituted with an aqueous diluent (e.g., water, buffer, salt solution, etc.) prior to injection.
  • an aqueous diluent e.g., water, buffer, salt solution, etc.
  • the pharmaceutical composition containing an anti-HA antibody is administered intranasally. In another embodiment, the pharmaceutical composition containing an anti-HA antibody is administered by inhalation, such as by oral or by nasal inhalation.
  • the pharmaceutical composition is suitable for buccal, oral or nasal delivery, e.g., as a liquid, spray, or aerosol, e.g., by topical application, e.g., by a liquid or drops, or by inhalation).
  • a pharmaceutical preparation comprises a plurality of particles, suitable, e.g., for inhaled or aerosol delivery.
  • the mean particle size of 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 microns.
  • a pharmaceutical preparation is formulated as a dry powder, suitable, e.g., for inhaled or aerosol delivery.
  • a pharmaceutical preparation is formulated as a wet powder, through inclusion of a wetting agent, e.g., water, saline, or other liquid of physiological pH.
  • a pharmaceutical preparation is provided as drops, suitable, e.g., for delivery to the nasal or buccal cavity.
  • the pharmaceutical composition is disposed in a delivery device, e.g., a syringe, a dropper or dropper bottle, an inhaler, or a metered dose device, e.g., an inhaler.
  • a delivery device e.g., a syringe, a dropper or dropper bottle, an inhaler, or a metered dose device, e.g., an inhaler.
  • the pharmaceutical composition is disposed in a container, e.g., an intravenous (IV) solution bag.
  • IV intravenous
  • a pharmaceutical composition contains a vector, such as an adenovirus-associated virus (AAV)-based vector, that encodes a heavy chain of an anti-HA antibody molecule, and a light chain of an anti-HA antibody molecule, described herein.
  • AAV adenovirus-associated virus
  • the composition containing the vector can be administered to a subject, such as a patient, such as by injection, e.g., IM injection.
  • Genes encoding the anti-HA antibody under control of, for example, cytomegalovirus (CMV) promoters are expressed in the body, and the recombinant anti-HA antibody molecule is introduced into the circulation. See e.g., Balazs et al., Nature 30:481:81-84, 2011.
  • CMV cytomegalovirus
  • compositions typically should be sterile and stable under the conditions of manufacture and storage.
  • a pharmaceutical composition can also be tested to insure it meets regulatory and industry standards for administration.
  • the composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
  • Sterile injectable solutions can be prepared by incorporating an agent described herein in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating an agent described herein into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • typical methods of preparation are vacuum drying and freeze-drying that yields a powder of an agent described herein plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • a pharmaceutical composition may be provided, prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
  • a bulk preparation will contain at least 2, 5, 10, 20, 50, or 100 unit doses.
  • a unit dose is typically the amount introduced into the patient in a single administration. In an embodiment, only a portion of a unit dose is introduced. In an embodiment, a small multiple, e.g., as much as 1.5, 2, 3, 5, or 10 times a unit dose is administered.
  • the amount of the active ingredient is generally equal to a dose which would be administered to a subject and/or a convenient fraction of such a dose such as, for example, one-half or one-third of such a dose.
  • a formulation of a binding agent e.g., an antibody molecule
  • the pH of the formulation is generally pH 5.5-7.0.
  • the formulation is a liquid formulation. In some embodiments, the formulation is stored as a liquid. In other embodiments, the formulation is a lyophilized formulation. In certain embodiments, the formulation is prepared as a liquid and then is dried, e.g., by lyophilization or spray-drying, prior to storage. A dried formulation can be used as a dry compound, e.g., as an aerosol or powder, or reconstituted to its original or another concentration, e.g., using water, a buffer, or other appropriate liquid.
  • a “reconstituted” formulation is one which has been prepared by dissolving a lyophilized protein formulation in a diluent such that the protein is dispersed in the reconstituted formulation.
  • the reconstituted formulation in suitable for administration (e.g. parenteral administration) to a patient to be treated with the protein of interest and, in certain embodiments of the invention, may be one which is suitable for subcutaneous administration.
  • the “diluent” of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a reconstituted formulation.
  • Exemplary diluents include sterile water, bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
  • a “lyoprotectant” is a molecule which, when combined with a protein of interest, significantly prevents or reduces chemical and/or physical instability of the protein upon lyophilization and subsequent storage.
  • exemplary lyoprotectants include sugars such as sucrose or trehalose; an amino acid such as monosodium glutamate or histidine; a methylamine such as betaine; a lyotropic salt such as magnesium sulfate; a polyol such as trihydric or higher sugar alcohols, e.g.
  • the lyoprotectant is a non-reducing sugar, such as trehalose or sucrose.
  • the lyoprotectant is added to the pre-lyophilized formulation in a “lyoprotecting amount” which means that, following lyophilization of the protein in the presence of the lyoprotecting amount of the lyoprotectant, the protein essentially retains its physical and chemical stability and integrity upon lyophilization and storage.
  • a “bulking agent” is a compound which adds mass to the lyophilized mixture and contributes to the physical structure of the lyophilized cake (e.g. facilitates the production of an essentially uniform lyophilized cake which maintains an open pore structure).
  • Exemplary bulking agents include mannitol, glycine, polyethylene glycol and xorbitol.
  • the anti-HA antibody molecule purification process is designed to permit transfer of an anti-HA antibody molecule into a formulation suitable for storage as a liquid. In other embodiments, the anti-HA antibody molecule purification process is designed to permit transfer of an anti-HA antibody molecule into a formulation for long-term storage as a frozen liquid and subsequently for freeze-drying.
  • the formulation is lyophilized with the protein at a specific concentration.
  • the lyophilized formulation can then be reconstituted as needed with a suitable diluent (e.g., water) to resolubilize the original formulation components to a desired concentration, generally the same or higher concentration compared to the concentration prior to lyophilization.
  • the lyophilized formulation may be reconstituted to produce a formulation that has a concentration that differs from the original concentration (e.g., before lyophilization), depending upon the amount of water or diluent added to the lyophilate relative to the volume of liquid that was originally freeze-dried.
  • Suitable formulations can be identified by assaying one or more parameters of antibody integrity. The assayed parameters are generally the percentage of HMW species or the percentage of LMW species.
  • the percentage of HMW species or LMW species is determined either as a percentage of the total protein content in a formulation or as a change in the percentage increase over time (e.g., during storage).
  • the total percentage of HMW species in an acceptable formulation is not greater than 10% (e.g., not greater than 5%, not greater than 4%, not greater than 3%, not greater than 2%, or not greater than 1%) HMW species after storage as a lyophilate or liquid at 2° C. to 50° C. (e.g., at 4° C. to 45° C., at 4° C. to 25° C., at 4° C.
  • the total percentage of HMW species is not greater than 5%. In another embodiment, the total percentage of HMW species is not greater than 3%.
  • the stability profile is less than 10% HMW/LMW at 2° ⁇ 8° C. for a refrigerated product, and 25° C. for a room-temperature product.
  • HMW species or LMW species are assayed in a formulation stored as a lyophilate after the lyophilate is reconstituted. 45° C. is an accelerated condition that is generally used for testing stability and determining stability for short-term exposures to non-storage conditions, e.g., as may occur during transfer of a product during shipping.
  • the assayed parameter is the percentage change in HMW species or LMW species
  • the percent of total protein in one or both species after storage is compared to the percent total protein in one or both species prior to storage (e.g., upon preparation of the formulation). The difference in the percentages is determined.
  • the change in the percentage of protein in HMW species or LMW species in liquid formulations is not greater than 10%, e.g., not greater than about 8%, not greater than about 7%, not greater than about 6%, not greater than about 5%, not greater than about 4%, or not greater than about 3% after storage at 2° C. ⁇ 8° C.
  • HMW species e.g., 4° C.
  • 25° C. for about one week, two weeks, one month, three months, six months, nine months, or twelve months, eighteen, or twenty-four months.
  • the increase of HMW species is not more than 2%, typically not more than 1%, per year.
  • about is meant ⁇ 20% of a cited numerical value.
  • about 10% means 8% to 12%.
  • Formulations stored as lyophilized product generally have less than about 5%, less than about 4%, less than about 3%, or less than about 2% HMW species or less than about 5%, less than about 4%, less than about 3%, or less than about 2% LMW species after reconstitution following storage at 2° C. ⁇ 8° C. (e.g., 4° C.) or 25° C. for about for about one week, two weeks, one month, three months, six months, nine months, or twelve months, eighteen, or twenty-four months.
  • 2° C. ⁇ 8° C. e
  • Formulations of anti-HA antibody molecules can be stored as a liquid for, e.g., at least two weeks, at least one month, at least two months, at least three months, at least four months, at least six months, at least nine months, at least one year, or at least two years.
  • Formulations of anti-HA antibody molecules can be stored as a lyophilate for, e.g., at least two years, at least three years, at least four years, or at least five years.
  • the formulation is in a form of, or is stored as, a frozen lipid.
  • Anti-HA antibody molecule concentrations in formulations are generally between about 0.1 mg/mL and about 250 mg/mL, e.g., between about 0.5 mg/mL and about 100 mg/mL, about 0.5 mg/mL and about 1.0 mg/mL, about 0.5 mg/mL and about 45 mg/mL, about 1 mg/mL and about 10 mg/mL, about 5 mg/mL and 20 mg/mL, about 8 mg/mL and about 16 mg/mL, about 10 mg/mL and about 40 mg/mL, about 10 mg/mL and about 50 mg/mL, about 20 mg/mL and 60 mg/mL, about 25 mg/mL and 50 mg/mL, about 50 mg/mL and about 100 mg/mL, about 100 mg/mL and about 200 mg/mL, or about 200 mg/mL and about 250 mg/mL.
  • “about” means ⁇ 20% of the lower-cited numerical value of the range and +20% of the upper-cited numerical value of the range. In the context of ranges, e.g., about 10 mg/mL to about 100 mg/mL, this means, between 8 mg/mL to 120 mg/mL.
  • antibody concentrations in formulations can be, for example, between 1 mg/mL and 100 mg/mL, e.g., 2 mg/mL and 80 mg/mL, 5 mg/mL and 60 mg/mL, 10 mg/mL and 50 mg/mL, 15 mg/mL and 40 mg/mL, 20 mg/mL and 30 mg/mL anti-HA antibody molecule described herein, e.g., Ab 044.
  • Such antibody formulations can be used as therapeutic agents. Accordingly, the concentration of anti-HA antibody molecule in a formulation is sufficient to provide such dosages in a volume of the formulation that is tolerated by a subject being treated and is appropriate for the method of administration.
  • the concentration of antibody is generally at least 25 mg/mL or greater, e.g., 100 mg/mL or greater, e.g., 100 mg/mL to 500 mg/mL, 100 mg/mL to 250 mg/mL, or 100 mg/mL to 150 mg/mL.
  • concentrations can be achieved, for example, by reconstituting a lyophilized formulation in an appropriate volume of diluent (e.g., sterile water for injection, buffered saline).
  • the reconstituted formulation has a concentration of between 25 mg/mL and 500 mg/mL, e.g., between about 100 mg/mL and 500 mg/mL (e.g., 100 mg/mL, 125 mg/mL, 150 mg/mL, 175 mg/mL, 200 mg/mL, 250 mg/mL, 275 mg/mL, 300 mg/mL, 350 mg/mL, 375 mg/mL, 400 mg/mL, 425 mg/mL, 450 mg/mL, 475 mg/mL and 500 mg/mL).
  • 100 mg/mL and 500 mg/mL e.g., 100 mg/mL, 125 mg/mL, 150 mg/mL, 175 mg/mL, 200 mg/mL, 250 mg/mL, 275 mg/mL, 300 mg/mL, 350 mg/mL, 375 mg/mL, 400 mg/mL, 425 mg/mL, 450 mg/mL, 475 mg/mL
  • the formulation is generally somewhat concentrated (e.g., between about 25 mg/mL and 500 mg/mL, e.g., between about 100 mg/mL and 500 mg/mL) so as to provide a sufficient dose in a limited volume of aerosol for inspiration. In some cases, low concentrations (e.g., between about 0.05 mg/mL and 1 mg/mL) are used. Methods are known in the art to adapt the dosage delivered to the method of delivery, e.g., a jet nebulizer or a metered aerosol.
  • the pH of a formulation as described herein is generally between about pH 5.0 to about 7.0, for example, about pH 5.5 to about 6.5, about pH 5.5 to about 6.0, about pH 6.0 to about 6.5, pH 5.5, pH 6.0, or pH 6.5.
  • a buffer that can maintain a solution at pH 5.5 to 6.5 is used to prepare a formulation, e.g., a buffer having a pKa of about 6.0.
  • Suitable buffers include, without limitation, 2-morpholinoethanesulfonic acid (MES), phosphate, and citrate (e.g., citrate-sodium phosphate).
  • the concentration of the buffer is between about 5 mM and about 100 mM, e.g., about 25 mM to about 50 mM. In some cases, citrate-sodium phosphate buffer is used at a concentration of about 40 nM.
  • Other buffers can include, histidine buffer, acetate, or succinate, e.g., for a desired pH other than about 6.0, e.g., below 6.0. In other cases, histidine buffer is used at a concentration of up to 60 nM, e.g., about 5 mM or about 10 mM. In other cases, acetate or succinate buffer is used at a concentration of about 5 mM or about 10 mM.
  • Tonicity agents include, e.g., sodium chloride, potassium chloride, or dextrose.
  • the tonicity agent is generally used at a concentration of about 50 mM to about 200 mM.
  • the tonicity agent can be used at a concentration of about 50 mM to about 200 mM, e.g., about 60 mM to about 190 mM, about 70 mM to about 180 mM, about 80 mM to about 170 mM, about 90 mM to about 160 mM, about 100 mM to about 150 mM, about 145 mM to about 155 mM, about 140 mM to about 160 mM, about 135 mM to about 165 mM, about 130 mM to about 170 mM, about 120 mM to about 180 mM, about 110 mM to about 190 mM, about 100 mM to about 200 mM, about 50 mM to about 100 mM, about 100 mM to about 150 mM, or about 150 mM to about 120 mM, e.g., about
  • the tonicity agent is used at a concentration of about 50 to about 200 nM, about 75 mM to about 150 mM, about 120 mM to about 180 mM, e.g., about 140 to about 160 mM, e.g., about 150 mM.
  • the tonicity agent comprises sodium chloride.
  • the tonicity agent comprises sodium chloride and is used at a concentration of about 140 to about 160 mM, e.g., about 150 mM.
  • the tonicity agent used in the formulation can generally provide a tonicity (or osmolarity) of about 250 mOsm/L to about 350 mOsm/L, about 260 mOsm/L to about 340 mOsm/L, about 270 mOsm/L to about 330 mOsm/L, about 280 mOsm/L to about 320 mOsm/L, about 285 mOsm/L to about 310 mOsm/L, or about 290 mOsm/L to about 300 mOsm/L, e.g., about 250 mOsm/L, about 260 mOsm/L, about 270 mOsm/L, about 280 mOsm/L, about 290 mOsm/L, about 300 mOsm/L, about 310 mOsm/L, about 320 mOsm/L, about 330 m
  • the tonicity agent provides a tonicity (or osmolality) of about 240 mOsm/kg to about 340 mOsm/kg, about 250 mOsm/kg to about 330 mOsm/kg, about 260 mOsm/kg to about 320 mOsm/kg, about 270 mOsm/kg to about 310 mOsm/kg, about 280 mOsm/kg to about 300 mOsm/kg, or about 285 mOsm/kg to about 295 mOsm/kg, e.g., about 240 mOsm/kg, about 250 mOsm/kg, about 260 mOsm/kg, about 270 mOsm/kg, about 280 mOsm/kg, about 290 mOsm/kg, about 300 mOsm/kg, about 310 mOsm/kg, about 320 mOsm
  • isotonic is meant that the formulation of interest has essentially the same osmotic pressure as human blood. Isotonic formulations will generally have an osmotic pressure, e.g., from about 250 to 350 mOsm/L. Isotonicity can be measured using a vapor pressure or ice-freezing type osmometer, for example.
  • a surfactant is included in the formulation.
  • surfactants include, without limitation, nonionic surfactants such as polysorbates (e.g., polysorbate-20, polysorbate-40, polysorbate-60, polysorbate-65, polysorbate-80, or polysorbate-85); poloxamers (e.g., poloxamer 188); TritonTM; sodium dodecyl sulfate (SDS); sodium laurel sulfate; sodium octyl glycoside; lauryl-sulfobetaine, myristyl-sulfobetaine, linoleyl-sulfobetaine, stearyl-sulfobetaine, lauryl-sarcosine, myristyl-sarcosine, linoleyl-sarcosine, stearyl-sarcosine, linoleyl-betaine, myristyl-betaine, cetyl-betaine
  • lauroamidopropyl myristarnidopropyl-, palmidopropyl-, or isostearamidopropyl-dimethylamine; sodium methyl cocoyl-, or disodium methyl ofeyl-taurate; and the MonaquatTM series (Mona Industries, Inc., Paterson, N.J.), polyethyl glycol, polyp ropyl glycol, and copolymers of ethylene and propylene glycol (e.g. pluronics, PF68).
  • MonaquatTM series Mona Industries, Inc., Paterson, N.J.
  • polyethyl glycol polyp ropyl glycol
  • copolymers of ethylene and propylene glycol e.g. pluronics, PF68.
  • the amount of surfactant added is such that it reduces aggregation of the reconstituted protein to an acceptable level as assayed using, e.g., SEC-HPLC of HMW species or LMW species, and minimizes the formation of particulates after reconstitution of a lyophilate of an anti-HA antibody molecule formulation.
  • the addition of surfactant has also been shown to reduce the reconstitution time of a lyophilized formulation of anti-HA antibody molecules, and aid in de-gassing the solution.
  • the surfactant can be present in the formulation (liquid or prior to lyophilization) in an amount from about 0.001% to 0.5%, e.g., from about 0.005% to 0.05%, about 0.005% to about 0.2%, and about 0.01% to 0.2%.
  • Cryoprotectants are known in the art and include, e.g., sucrose, trehalose, and glycerol.
  • a cryoprotectant exhibiting low toxicity in biological systems is generally used.
  • the cryoprotectant is included in the formulation at a concentration of about 0.5% to 15%, about 0.5% to 2%, about 2% to 5%, about 5% to 10%, about 10% to 15%, and about 5% (weight/volume).
  • Histidine buffer which can be used as a buffer in an anti-HA antibody molecule formulation, may have cryoprotectant properties.
  • a histidine buffer is used in conjunction with a cryoprotectant such as a sugar, e.g., sucrose.
  • a formulation of the invention can specifically exclude the use of histidine in any substantial amount, e.g., neither the buffer nor the cryoprotectant component of the formulation is a histidine.
  • the viscosity of a formulation is generally one that is compatible with the route of administration of the formulation.
  • the viscosity of the formulation is between 1 cP and 2 cP, or similar to water (about 1 cP).
  • the viscosity of the formulation is between about 5 cP and about 40 cP.
  • the viscosity of the formulation is 1 cP, 2 cP, 3 cP, 4 cP, 5 cP, 10 cP, 15 cP, 20 cP, 25 cP, 30 cP, 35 cP, or 40 cP.
  • Formulations are stored as sterile solutions or sterile lyophilates. Prevention of the action of microorganisms in formulations can also be achieved by including at least one antibacterial and/or antifungal agent in a formulation, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In some cases, a lyophilate is reconstituted with bacteriostatic water (e.g., water containing 0.9% benzyl alcohol).
  • bacteriostatic water e.g., water containing 0.9% benzyl alcohol.
  • a “preservative” is a compound which can be added to the diluent to essentially reduce bacterial action in the reconstituted formulation, thus facilitating the production of a multi-use reconstituted formulation, for example.
  • potential preservatives include octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride (a mixture of alkylbenzyldimethylammonium chlorides in which the alkyl groups are long-chain compounds), and benzethonium chloride.
  • preservatives include aromatic alcohols such as phenol, butyl and benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m-cresol.
  • the formulation is isotonic.
  • any component known in the art that contributes to the solution osmolarity/tonicity can be added to a formulation (e.g., salts, sugars, polyalcohols, or a combination thereof).
  • Isotonicity is generally achieved using either a component of a basic formulation (such as sucrose) in an isotonic concentration or by adding an additional component such as, a sugar, a polyalcohol such as manitol or sorbitol, or a salt such as sodium chloride.
  • a salt is used in an anti-HA antibody molecule formulation, e.g., to achieve isotonicity or to increase the integrity of the anti-HA antibody molecule of the formulation. Salts suitable for use are discussed, supra.
  • the salt concentration can be from 0 mM to about 300 mM. In one example, the salt is used at a concentration of 150 nM in the formulation.
  • the formulation is prepared with Tween (e.g., Tween® 20, Tween® 80) to decrease interfacial degradation.
  • Tween e.g., Tween® 20, Tween® 80
  • the Tween concentration can be from about 0.001% to about 0.05%.
  • Tween-80 is used at a concentration of 0.025% in the formulation.
  • the formulation is prepared with glycine.
  • the glycine concentration in the formulation can be from about 0.01% to about 5%. In one example, glycine is used at a concentration of 1% in the formulation. In another example, glycine is used at a concentration of 2% in the formulation. In some cases both Tween and arginine are added to the anti-HA antibody molecule formulations described herein.
  • the formulation may be prepared with at least one of: sucrose, histidine, or arginine. If sucrose is included in the formulation, it can be added to a concentration of between about 1% and about 10%. In one example, sucrose is found in the formulation at a concentration of 2%. If histidine is included in the formulation, it can be added to a concentration of between about 0.5% to about 5%. In one example, histidine is found in the formulation at a concentration of 1%. In another example, histidine is found in the formulation at a concentration of 2%. If arginine is included in the formulation, it can be added to a concentration of between about 0.5% to about 5%. In one example, arginine is found in the formulation at a concentration of 1%. In another example, arginine is found in the formulation at a concentration of 2%.
  • an anti-HA antibody molecule formulation comprises 25 mg/mL anti-HA antibody molecule described herein (e.g., Ab 044), 40 mM citrate-sodium phosphate, 150 mM sodium chloride, 0.025% Tween-80, at pH 6.0.
  • an anti-HA antibody molecule formulation comprises 25 mg/mL anti-HA antibody molecule described herein (e.g., Ab 044), 40 mM citrate-sodium phosphate, 150 mM sodium chloride, 0.025% Tween-80, at pH 6.5.
  • an anti-HA antibody molecule formulation comprises 25 mg/mL anti-HA antibody molecule described herein (e.g., Ab 044), 40 mM citrate-sodium phosphate, 1% glycine, 75 mM sodium chloride, 0.025% Tween-80, at pH6.5.
  • an anti-HA antibody molecule formulation comprises 25 mg/mL anti-HA antibody molecule described herein (e.g., Ab 044), 40 mM citrate-sodium phosphate, 150 mM sodium chloride, at pH 6.0.
  • an anti-HA antibody molecule formulation comprises 25 mg/mL anti-HA antibody molecule described herein (e.g., Ab 044), 40 mM citrate-sodium phosphate, 75 mM sodium chloride, 0.025% Tween-80, at pH 6.5.
  • formulations containing antibodies are stored as liquid. Accordingly, it is desirable that the formulation be relatively stable under such conditions, including, at 4° C. or in room temperature.
  • One method of determining the suitability of a formulation is to subject a sample formulation to agitation or storage (e.g., at 4° C., 25° C., or 45° C.) for a period of time (e.g., one week, two weeks, or four weeks), determining the amount of LMW species and/or HMW species that accumulate after the agitation or storage and comparing it to the amount of LMW species or HMW species present in the sample prior to the agitation or storage procedure. An increase in the LMW or HMW species indicates decreased stability.
  • formulations containing antibodies are frozen for storage. Accordingly, it is desirable that the formulation be relatively stable under such conditions, including, under freeze-thaw cycles.
  • One method of determining the suitability of a formulation is to subject a sample formulation to at least two, e.g., three, four, five, eight, ten, or more cycles of freezing (at, for example ⁇ 20° C. or -80° C.) and thawing (for example by fast thaw in a 37° C.
  • Lyophilization Formulations can be stored after lyophilization. Therefore, testing a formulation for the stability of the protein component of the formulation after lyophilization is useful for determining the suitability of a formulation.
  • the method is similar to that described, supra, for freezing, except that the sample formulation is lyophilized instead of frozen, reconstituted to its original volume, and tested for the presence of LMW species and/or HMW species.
  • the lyophilized sample formulation is compared to a corresponding sample formulation that was not lyophilized. An increase in LMW or HMW species in the lyophilized sample compared to the corresponding sample indicates decreased stability in the lyophilized sample.
  • a lyophilization protocol includes loading a sample into a lyophilizer, a pre-cooling period, freezing, vacuum initiation, ramping to the primary drying temperature, primary drying, ramping to the secondary drying temperature, secondary drying, and stoppering the sample. Additional parameters that can be selected for a lyophilization protocol include vacuum (e.g., in microns) and condenser temperature. Suitable ramp rates for temperature are between about 0.1° C./min. to 2° C./min., for example 0.1° C./min. to 1.0° C./min., 0.1° C./min. to 0.5° C./min., 0.2° C./min.
  • Suitable shelf temperatures during freezing for a lyophilization cycle are generally from about ⁇ 55° C. to ⁇ 5° C., ⁇ 25° C. to ⁇ 5° C., ⁇ 20° C. to ⁇ 5° C., ⁇ 15° C. to ⁇ 5° C., ⁇ 10° C.
  • shelf temperatures can be different for primary drying and secondary drying, for example, primary drying can be performed at a lower temperature than secondary drying. In a non-limiting example, primary drying can be executed at 0° C. and secondary drying at 25° C.
  • an annealing protocol is used during freezing and prior to vacuum initiation.
  • the annealing time must be selected and the temperature is generally above the glass transition temperature of the composition.
  • the annealing time is about 2 to 15 hours, about 3 to 12 hours, about 2 to 10 hours, about 3 to 5 hours, about 3 to 4 hours, about 2 hours, about 3 hours, about 5 hours, about 8 hours, about 10 hours, about 12 hours, or about 15 hours.
  • the temperature for annealing is generally from about ⁇ 35° C. to about ⁇ 5° C., for example from about ⁇ 25° C. to about ⁇ 8° C., about ⁇ 20° C.
  • the annealing temperature is generally from ⁇ 35° C. to 5° C., for example from 25° C. to ⁇ 8° C., ⁇ 20° C. to ⁇ 10° C., ⁇ 25° C., ⁇ 20° C., ⁇ 15° C., 0° C., or 5° C.
  • a lyophilization cycle can run from 10 hours to 100 hours, e.g., 20 hours to 80 hours, 30 hours to 60 hours, 40 hours to 60 hours, 45 hours to 50 hours, 50 hours to 65 hours.
  • Non-limiting examples of the temperature range for storage of an antibody formulation are about ⁇ 20° C. to about 50° C., e.g., about ⁇ 15° C. to about 30° C., about ⁇ 15° C. to about 20° C., about 5° C. to about 25° C., about 5° C. to about 20° C., about 5° C. to about 15° C., about 2° C. to about 12° C., about 2° C. to about 10 C, about 2° C. to about 8° C., about 2° C.
  • samples are stable under temperature changes that may transiently occur during storage and transportation conditions that can be anticipated for such compositions.
  • a formulation is spray-dried and then stored.
  • Spray-drying is conducted using methods known in the art, and can be modified to use liquid or frozen spray-drying (e.g., using methods such as those from Niro Inc. (Madison, Wis.), Upperton Particle Technologies (Nottingham, England), or Buchi (Brinkman Instruments Inc., Westbury, N.Y.), or U.S. Application Pulication Nos. 2003/0072718 and 2003/0082276).
  • LMW species and HMW species are useful measures of antibody stability. Accumulation of either LMW or HMW in a formulation is indicative of instability of a protein stored as part of the formulation. Size exclusion chromatography with HPLC can be used to determine the presence of LMW and HMW species. Suitable systems for such measurements are known in the art, e.g., HPLC systems (Waters, Milford, Mass.).
  • a bioassay is a cell-based assay in which inhibition of an HA-dependent activity is examined in the presence of different concentrations of formulated nanobody molecule to demonstrate biological activity.
  • the present application also provides an article of manufacture that includes a formulation as described herein and provides instructions for use of the formulation.
  • the article of manufacture can include a container suitable for containing the formulation.
  • a suitable container can be, without limitation, a bottle, vial, syringe, test tube, nebulizer (e.g., ultrasonic or vibrating mesh nebulizers), i.v. solution bag, or inhaler (e.g., a metered dose inhaler (MDI) or dry powder inhaler (DPI)).
  • MDI metered dose inhaler
  • DPI dry powder inhaler
  • the container can be formed of any suitable material such as glass, metal, or a plastic such as polycarbonate, polystyrene, or polypropylene.
  • the container is of a material that does not absorb significant amounts of protein from the formulation and is not reactive with components of the formulation.
  • the container is a clear glass vial with a West 4432/50 1319 siliconized gray stopper or a West 4023 Durafluor stopper.
  • the container is a syringe.
  • the formulation comprises about 25 mg/mL of an antibody molecule described herein, about 40 mM citrate-sodium phosphate, about 150 mM sodium chloride, and about 0.025% polysorbate 80, at a pH of about 6, in a pre-filled syringe.
  • the syringe is suitable for use with an auto-injector device.
  • the container is a container suitable for storage of the formulation or antibody molecule, e.g., a vial.
  • the container is a container suitable for administration of the formulation or antibody molecule, e.g., an intravenous (IV) bag.
  • the antibody molecule or formulation in a first container e.g., suitable for storage
  • a second container e.g., suitable for administration
  • transfer includes dilution of the antibody molecule or formulation.
  • transfer occurs less than 4 hours, e.g., less than 3, 2, or 1 hours, prior to administration of the antibody molecule or formulation to a subject.
  • the container suitable for administration is a primary container and ready to use for administration (e.g., IV administration).
  • administration e.g., IV administration
  • the container is a vial, e.g., a glass vial.
  • the container (e.g., vial) comprises about 10 mg/mL to about 100 mg/mL, e.g., about 20 mg/mL to about 60 mg/mL (e.g., about 25 mg/mL to about 50 mg/mL) of the antibody molecule.
  • the container (e.g., vial) comprises about 10 mL to about 60 mL, e.g., about 20 mL to about 40 mL, of the antibody molecule or formulation.
  • the container (e.g., vial) is a first (or primary) container, e.g., for storing the antibody molecule or formulation.
  • the antibody molecule or formulation can be transferred into a second container before use.
  • the second container is suitable, or includes a solution that is suitable, for administration, e.g., intravenous administration.
  • the second container includes a solution suitable for intravenous administration.
  • the solution comprises saline, optionally, further comprises dextrose.
  • the solution e.g., saline
  • the solution does not comprise dextrose.
  • an amount equal to one dose of the antibody molecule can be transferred into a container suitable for IV administration.
  • 1 to 10 vials e.g., 1 to 8 vials, 1 to 6 vials, 1 to 4 vials, 1 to 2 vials, 6 to 8 vials, 4 to 8 vials, or 2 to 8 vials
  • an IV solution bag e.g., containing saline with or without dextrose.
  • the container is a container suitable for IV administration (e.g., an IV solution bag).
  • the amount of the antibody molecule in the container equals to 1 to 10 vials (e.g., 1 to 8 vials, 1 to 6 vials, 1 to 4 vials, 1 to 2 vials, 6 to 8 vials, 4 to 8 vials, or 2 to 8 vials) of the antibody molecule as described above.
  • the container (e.g., IV solution bag) comprises about 500 mg to about 16000 mg, e.g., about 500 mg to about 8000 mg, about 500 mg to about 5000 mg/mL, about 1000 mg to about 5000 mg, about 2000 mg to about 4000 mg, or about 2300 mg to about 4600 mg, e.g., about 2300 mg or about 4600 mg, of the antibody molecule or formulation.
  • the container e.g., IV solution bag
  • the container further comprises saline.
  • the container further comprises dextrose.
  • the container does not comprise dextrose.
  • the container suitable for IV administration is not a second (or secondary) container (e.g., is a first (or primary) container, e.g., where the antibody molecule is stored), and comprises about 5 mg/mL to about 25 mg/mL, e.g., about 8 mg/mL to about 16 mg/mL of the antibody molecule.
  • the container (e.g., IV solution bag) comprises about 100 mL to about 400 mL, e.g., about 200 mL to about 300 mL, of antibody molecule.
  • the container (e.g., IV solution bag) comprises about 2000 mg to about 5000 mg, e.g., about 2300 mg to about 4600 mg, of the antibody molecule.
  • the antibody molecule is administered from the container (e.g., IV solution bag) to the subject through an IV line.
  • container e.g., IV solution bag
  • the method comprises transferring an antibody molecule or a formulation disclosed herein to a container suitable for administration (e.g., an intravenous (IV) solution bag).
  • the method comprises contacting, e.g., combining (e.g., mixing or diluting) an antibody molecule or a formulation disclosed herein with a solution suitable for administration.
  • the container suitable for administration is an IV solution bag.
  • the solution suitable for administration is an IV solution, e.g., saline with or without dextrose.
  • about 2000 mg to about 5000 mg of the antibody molecule is contacted (e.g., combined) with the solution.
  • about 2300 mg to about 4600 mg or about 2000 mg to about 4000 mg of the antibody molecule is contacted (e.g., combined) with the solution.
  • nebulizers include, in non-limiting examples, jet nebulizers, ultrasonic nebulizers, and vibrating mesh nebulizers. These classes use different methods to create an aerosol from a liquid. In general, any aerosol-generating device that can maintain the integrity of the protein in these formulations is suitable for delivery of formulations as described herein.
  • Formulations to be used for administration to a subject must be sterile. This is accomplished using methods known in the art, e.g., by filtration through sterile filtration membranes, prior to, or following, formulation of a liquid or lyophilization and reconstitution. Alternatively, when it will not damage structure, components of the formulation can be sterilized by autoclaving and then combined with filter or radiation sterilized components to produce the formulation.
  • Influenza viruses are negative sense, single-stranded, segmented RNA envelope viruses. Two glycoproteins, a hemagglutinin (HA) polypeptide and a neuraminidase (NA) polypeptide, are displayed on the outer surface of the viral envelope. There are several Influenza A subtypes, labeled according to an H number (for the type of hemagglutinin) and an N number (for the type of neuraminidase). There are 17 different H antigens (H1 to H17) and nine different N antigens (N1 to N9).
  • Influenza strains are identified by a nomenclature based on the number of the strain's HA polypeptide and NA polypeptide subtypes, for example, H1N1, H1N2, H1N3, H1N4, H1N5, and the like.
  • HA is the major viral surface glycoprotein that mediates binding and entry of the virus into host cells and is a primary target of neutralizing antibody responses.
  • HA is a trimer of three identical monomers. Each monomer is synthesized as a precursor, HA 0 , that is proteolytically processed into two disulfide-bonded polypeptide chains, HA 1 and HA 2 .
  • the ectodomain of this protein has (i) a globular head domain possessing receptor binding activity and major antigenic determinants, (ii) a hinge region, and (iii) a stem region where a sequence critical for fusion, the fusion peptide, is located.
  • the viral replication cycle is initiated when the virion attaches via its surface hemagglutinin proteins to sialylated glycan receptors on the host cell and enters the cell by endocytosis.
  • the acidic environment in the endosome induces conformational changes in HA that expose the fusion peptide hidden within the stem region of the trimer.
  • the exposed fusion peptide mediates the fusion of the viral and target cell membranes resulting in the release of the viral ribonucleoprotein into the cell cytoplasm.
  • Influenza A hemagglutinin subtypes have been divided into two main groups and four smaller clades, and these are further divided into clusters.
  • Group 1 influenza A strains are divided into 3 clades: (i) H8, H9 and H12 (“the H9 cluster”); (ii) H1, H2, H5, H6 and H17 (“the H1a cluster”); and (iii) H11, H13 and H16 (“the H1b cluster”).
  • Group 2 strains are divided into 2 clades: (i) H3, H4 and H14 (“the H3 cluster”); and (ii) H7, H10 and H15 (“the H7 cluster”).
  • the H1b and the H1a clusters are classified together as the H1 cluster.
  • the different HA subtypes do not necessarily share strong amino acid sequence identity, but their overall 3D structures are similar.
  • HA polypeptide subtypes Of the 17 HA polypeptide subtypes, only 3 (H1, H2 and H3) have adapted for human infection. These subtypes have in common an ability to bind alpha 2,6 sialylated glycans. In contrast, their avian counterparts preferentially bind to alpha 2,3 sialylated glycans.
  • HA polypeptides that have adapted to infect humans have been characterized by an ability to preferentially bind to ⁇ 2,6 sialylated glycans in comparison with their avian progenitors that preferentially bind to ⁇ 2,3 sialylated glycans (see e.g., Skehel & Wiley, Annu Rev Biochem, 69:531, 2000; Rogers, & Paulson, Virology, 127:361, 1983; Rogers et al., Nature, 304:76, 1983; Sauter et al., Biochemistry, 31:9609, 1992).
  • HA polypeptides that mediate infection of humans preferentially bind to umbrella topology glycans over cone topology glycans (see e.g., U.S. 2011/0201547).
  • U.S. 2011/0201547 U.S. 2011/0201547.
  • the ability to infect human hosts correlates less with binding to glycans of a particular linkage, and more with binding to glycans of a particular topology, even though cone-topology glycans may be ⁇ 2,6 sialylated glycans.
  • Mature HA polypeptides include three domains, (i) a globular domain (a.k.a., the head domain) consists mainly of the HA1 peptide and contains the receptor (sialylated glycoproteins)-binding region, (ii) a stalk domain (HA1 and HA2) where the membrane fusion peptide resides, and (iii) a transmembrane domain (HA2) that anchors hemagglutinin to the viral envelope.
  • a set of amino acids in the interface of the HA1 and HA2 peptides is highly conserved across all influenza subtypes.
  • the HA1/HA2 membrane proximal region (MPER) including a canonical alpha-helix, is also highly conserved across influenza subtypes.
  • HA polypeptides interact with the surface of cells by binding to a glycoprotein receptor, known as the HA receptor. Binding of an HA polypeptide to an HA receptor is predominantly mediated by N-linked glycans on the HA receptors. HA polypeptides on the surface of flu virus particles recognize sialylated glycans that are associated with HA receptors on the surface of the cellular host. Following replication of viral proteins and genome by the cellular machinery, new viral particles bud from the host to infect neighboring cells.
  • vaccines are administered to subjects, e.g., humans, to prevent the flu, e.g., to prevent infection or to minimize the effects of an infection with influenza virus.
  • Traditional vaccines contain a cocktail of antigens from various strains of influenza and are administered to humans to prevent the human from getting infected with the virus.
  • HA is the main target of influenza A-neutralizing antibodies, and HA undergoes continuous evolution driven by the selective pressure of the antibody response, which is primarily directed against the membrane-distal receptor-binding subdomain of the HA polypeptide.
  • the subject is protected only from strains that are identical to, or closely related to, the strains from which the antigens in the cocktail were derived.
  • the human is still most vulnerable to infection by other strains of the flu that were not included in the cocktail.
  • One of the advantages of the antibodies provided herein is their ability to bind an epitope of HA that is conserved across multiple strains of influenza A, and in an embodiment, influenza B.
  • administration of an anti-HA antibody described herein will be more effective to protect an individual from infection from a broader spectrum of influenza (e.g., influenza A and, in an embodiment, influenza B) and conditions associate thereof (e.g., secondary infections, e.g., secondary bacterial infections).
  • the antibodies are effective in treating a subject after infection has occurred.
  • HAs exist in nature as homotrimers of proteolytically processed mature subunits. Each subunit of the trimer is synthesized as a precursor. A precursor molecule is proteolytically processed into two disulfide bonded polypeptide chains to form a mature HA polypeptide.
  • the mature HA polypeptide includes two domains: (1) a core HA-1 domain that extends from the base of the molecule through the fibrous stem to the membrane distal head region that contains the glycan receptor binding domain, returning to fibrous region ending in the cleavage site, and (2) HA-2 domain that includes the stem region and the transmembrane domain of HA.
  • HA-1 includes a glycan binding site.
  • the glycan binding site may be responsible for mediating binding of HA to the HA-receptor.
  • the HA-2 domain acts to present the HA-1 domain.
  • the HA trimer can be stabilized by polar and non-polar interactions between the three long HA alpha-helices of the stem of HA monomers.
  • HA sequences from all influenza subtypes share a set of amino acids in the interface of the HA-1 and HA-2 domains that are well conserved.
  • the HA-1/HA-2 interface membrane proximal epitope region (MPER) that includes the canonical ⁇ -helix and residues in its vicinity are also conserved across a broad spectrum of subtypes.
  • Ab 044 has high affinity for HA's from Group 1 and Group 2. It binds a conformational epitope that is broadly conserved across a plurality of influenza strains. Numerous amino acid residues distributed along the linear sequences of HA from different strains/subtypes contribute the Ab 044 conformational epitope. The interaction of Ab044 with H3 was analyzed by docking studies and residues bound by (or not bound by) Ab 044 were identified.
  • the Fv of Ab 044 was docked against HA of group I and II strains using ZDOCK.
  • the structure of the HA antigen was modeled using the SWISS MODEL homology modeling server keeping the solved crystal structure of H1N1 as the template.
  • ZDOCK uses shape complementarity along with desolvation and electrostatic energy terms (‘ZRANK’) to rank docked poses. To ensure the docked poses do not deviate significantly from the native complex, mapped epitope and paratope residues by alanine scanning are forced to be included in the binding interface.
  • ZDOCK is a Fast Fourier Transform based protein docking program. It was developed by Zhiping Weng at the University of Massachusetts Medical School. In ZDOCK, two PDB files are input and the output is the predicted structure of their complex. The program searches all possible binding modes in the translational and rotational space between the two proteins and evaluates each by an energy scoring function. The protein's structure is converted to a digital signal and a Fast Fourier Transform technique used to reduce computational time. ZDOCK is discussed in Pierce B G, Hourai Y, Weng Z. (2011) Accelerating Protein Docking in ZDOCK Using an Advanced 3D Convolution Library. PLoS One 6(9): e24657, Pierce B, Tong W, Weng Z.
  • SWISS-MODEL is a fully automated protein structure homology-modeling server. It is accessible via the ExPASy web server, or from the program DeepView (Swiss Pdb-Viewer). Swiss-Model is discussed in Arnold K., Bordoli L., Kopp J., and Schwede T. (2006).
  • the SWISS-MODEL Workspace A web-based environment for protein structure homology modelling. Bioinformatics, 22,195-201; Kiefer F, Arnold K, Kunzli M, Bordoli L, Schwede T (2009).
  • the SWISS-MODEL Repository and associated resources Nucleic Acids Research. 37, D387-D392; and Peitsch, M. C. (1995) Protein modeling by E-mail Bio/Technology 13: 658-660.
  • H3 residues that bind Ab 044 and H3 residues that bind FI6 are discussed below.
  • H3 HA1 The amino acid sequence of H3 HA1 is provided below, as SEQ ID NO: 173.
  • residues T318, R321, and V323 shown in solid boxes, are bound by both Ab 044 and FI6.
  • H3 HA21 The amino acid sequence of H3 HA21 is provided below, as SEQ ID NO: 174
  • Residue N12 shown in a dash box is bound by Ab 044 but not by FI6
  • Residues G1, L2, F3, G4, and D46 shown in dotted boxes are bound by FI6 but not by Ab 044
  • residues A7, E11, I18, D19, G20, W21, L38, K39, T41, Q42, A43, I45, I48, N49, L52, N53, I56, and E57, shown in solid boxes are bound by both Ab 044 and FI6.
  • H1 residues that bind Ab 044 and H1 residues that bind FI6 are discussed below.
  • H1 HA1 The amino acid sequence of H1 HA1 is provided below, as SEQ ID NO: 181.
  • Residues T319, R322, and 1324 shown in solid boxes, are bound by both Ab 044 and FI6.
  • H1 HA2 The amino acid sequence of H1 HA2 is provided below, as SEQ ID NO: 182.
  • Residues G12 shown in a dashed box is bound by Ab 044 but not by FI6.
  • Residues G1, L2, F3, G4, and D46 shown in dotted boxes are bound by FI6 but not by Ab 044.
  • Residues A7, E11, I18, D19, G20, W21, Q38, K39, T41, Q42, N43, 145, 148, T49, V52, N53, 156, and E57 shown in solid boxes, are bound by both Ab 044 and FI6.
  • FIG. 26 A three dimensional representation of H3 HA with the amino acids residues that are predicted to be part of Ab044 epitope but not part of FI6's epitope highlighted (that is, the highlighted amino acids are unique to Ab044's epitope) is shown in FIG. 26 of International Application Publication No. WO2013/170139.
  • FIG. 27 A three dimensional representation of H3 HA with the amino acid residues that are part of FI6's epitope but not predicted to be part of Ab044's epitope highlighted is shown in FIG. 27 of International Application Publication No. WO2013/170139.
  • the content of International Application Publication No. WO2013/170139 is incorporated by reference in its entirety.
  • Binding Agents e.g., Anti-HA Antibody Molecules
  • Formulations (e.g., pharmaceutical formulations) described herein include binding agents, e.g., antibody molecules, described herein.
  • Binding agents can bind to influenza A viruses from both Group 1 and Group 2, and in an embodiment also bind influenza B viruses.
  • the antibody molecules described herein can bind to an HA polypeptide on at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11 strains from Group 1, and can also bind to an HA polypeptide on at least 1, 2, 3, 4, 5, or 6 strains from Group 2.
  • the antibody molecules described herein can bind to an HA polypeptide on an influenza strain from at least 1, 2 or 3 clades from Group 1, and can also bind to an HA polypeptide on an influenza strain from one or both clades of Group 2.
  • the antibody molecules described herein inhibit cell entry and thus targeting an early step in the infection process.
  • the binding agents, and in particular, the antibody molecules disclosed herein can be effective to treat or prevent infection by seasonal or pandemic influenza strains.
  • the binding agents, and in particular the antibody molecules described herein can be characterized by their ability to prevent or treat a Group 1 or a Group 2 strain of influenza A viruses or, in an embodiment, a strain of influenza B viruses.
  • the binding agents, and in particular the antibody molecules disclosed herein are effective to prevent or treat infection by one or more strains of Group 1, one or more strains of Group 2, and also one or more strains of influenza B viruses.
  • the binding agents, and in particular the antibody molecules can be effective to treat the infection when administered the same day as the subject is exposed, or when administered, e.g., 1 day, 2 days, 3 days, 4 days or later after infection, or upon a first symptom experienced by the patient.
  • the antibody molecules described herein are effective to treat one or more influenza strains of Group 1, one or more influenza strains of Group 2, and also one or more influenza B strains, and specific isolates within these strains. Certain antibody molecules may be more effective for treatment of certain isolates than other isolates. Exemplary influenza strains and isolates are described in the below Table 1.
  • Affinity can also be in reference to a particular isolate of a given Group 1 or Group 2 strain for influenza A viruses or a strain for influenza B viruses.
  • Exemplary isolates are as provided in the above Table 1.
  • HA specific antibodies can inhibit infection by numerous methods, such as by blocking viral attachment to sialic acid residues on surface proteins on host cells, by interfering with the structural transition of HA that triggers fusion activity in the endosome, or by simultaneously inhibiting attachment and virus-cell fusion.
  • antibody molecules disclosed herein bind an epitope at the HA trimer interface. Structural changes at the trimer interface are important for fusion of the viral membrane and the endocytic membrane, and the antibody molecules described herein interfere with this critical step of infection.
  • Assays to measure fusogenic activity of HA are known in the art. For example, one fusion assay measures syncytia formation, which occurs in cell-cell fusion events. Cells that express and display an influenza viral strain HA can be used in the assay. Membrane-anchored hemagglutinin in these cells is induced to convert to the fusion conformation by a brief (e.g., 3 minute) exposure to low pH (e.g., pH 5).
  • a 2-3-hour incubation period follows to allow the cells to recover and fuse to form syncytia.
  • a nuclear stain can be used to aid in the visualization of these fusion products, and their count is used as a gauge of fusion activity.
  • a candidate anti-HA antibody can be added either before or after the low pH treatment to determine at which stage of the fusion process the antibody interferes.
  • fusion assay monitors content mixing.
  • host cells e.g., erythrocytes
  • a dye e.g., Lucifer yellow
  • fusion-inducing conditions e.g., low pH, such as pH less than 6 or pH less than 5. If the dye fails to mix with the contents of the host cells, then the conclusion can be made that fusion is inhibited. See e.g., Kemble et al., J. Virol. 66:4940-4950, 1992.
  • a fusion assay is performed by monitoring lipid mixing.
  • the lipid mixing assay can be performed by labeling host cells (e.g., erythrocytes) with a fluorescent dye (e.g., R18 (octadecylrhodamine)) or dye pairs (e.g., CPT-PC/DABS-PC) (for fluorescence resonance energy transfer), exposing the host cells and HA-expressing cells to fusion-inducing conditions, and assaying for fluorescence dequenching (FDQ).
  • FDQ fluorescence dequenching
  • Lipid mixing leads to dilution of the label into the viral envelope and a consequent dequenching. A lag in dequenching or the absence of dequenching is indicative of membrane fusion inhibition. See e.g., Kemble et al., J. Virol. 66:4940-4950, 1992; and Carr et al., Proc. Natl. Acad. Sci. 94:143
  • influenza strains will rarely if ever produce escape mutants when contacted with the formulations (e.g., pharmaceutical formulations) described herein.
  • Escape mutants can be identified by methods known in the art.
  • a formulation e.g., pharmaceutical formulation
  • One exemplary method includes infection of cells (e.g., MDCK cells) with a fixed amount of influenza A viral particles in the presence of the antibody at a concentration known to attenuate infection rates by 50%.
  • Viral progeny collected after each passaging is used to infect a fresh cell culture in the presence of the same or greater concentration of the antibody.
  • the HA nucleotide sequence extracted from 20 viral plaque picks is evaluated for enrichment for mutations that renders the viral isolate resistant to neutralization by the antibody (an escape mutant).
  • the antibody is determined to be resistant to escape mutations (see e.g., Throsby et al. (2008) PLoS One, volume 3, e3942).
  • an assay that measures minimum inhibitory concentration (MIC) of the neutralizing antibody can be used to identify escape mutants.
  • the MIC of an antibody molecule is the lowest concentration of an antibody molecule that can be mixed with virus to prevent infection of cell culture with influenza. If escape mutants arise within a viral population, then the MIC of a particular antibody will be observed to increase with increased rounds of propagation under the antibody selective pressure, as the proportion of the viral particles that carry the resistance mutation within the population increased. Influenza escape mutants rarely if ever evolve in response to an anti-HA antibody molecule described herein, and therefore the MIC will stay the same over time.
  • CPE Cytopathic Effect
  • a CPE assay monitors the ability of an antibody to neutralize (e.g., prevent infection by) an influenza strain.
  • a CPE assay provides the minimal concentration of antibody required in cell culture to neutralize the virus. If escape mutants arise, than the CPE of a particular antibody will increase over time, as the antibody becomes less effective at neutralizing the virus. Viral strains rarely if ever produce escape mutants in response to an anti-HA antibody molecule described herein, and therefore the CPE will stay essentially the same over time.
  • Quantitative polymerase chain reaction can also be used to monitor for the development of escape mutants.
  • qPCR is useful to monitor the ability of an antibody to neutralize (e.g., prevent infection by) an influenza strain. If an antibody effectively neutralizes a virus, then qPCR performed on cell culture samples will not detect presence of viral genomic nucleic acid. If escape mutants arise, than over time, qPCR will amplify more and more viral genomic nucleic acid. Escape mutants rarely if ever develop in response to an anti-HA antibody molecule described herein, and therefore qPCR will rarely if ever detect viral genomic nucleic acid, even after the passage of time.
  • the binding agents, particularly antibody molecules, described herein bind to two or more of the following: at least one HA polypeptide from a Group 1 influenza strain (e.g., an H1, H2, H5, H6, H8, H9 H12, H11, H13, H16 or H17 polypeptide); at least one HA polypeptide from a Group 2 influenza strain (e.g., an H3, H4, H14, H7, H10, or H15 polypeptide); and at least one HA polypeptide from a influenza B strain.
  • a Group 1 influenza strain e.g., an H1, H2, H5, H6, H8, H9 H12, H11, H13, H16 or H17 polypeptide
  • a Group 2 influenza strain e.g., an H3, H4, H14, H7, H10, or H15 polypeptide
  • a binding agent e.g., an antibody molecule
  • a Group 1 influenza strain e.g., an H1, H2, H5, H6, H8, H9 H12, H11, H13, H16 or H17 polypeptide
  • a binding agent e.g., an antibody molecule
  • a Group 2 influenza strain e.g., an H3, H4, H14, H7, H10, or H15 polypeptide
  • a binding agent e.g., an antibody molecule
  • a binding agent e.g., an antibody molecule
  • a binding agent e.g., an antibody molecule
  • a binding agent e.g., an antibody molecule
  • a binding agent e.g., an antibody molecule
  • a binding agent e.g., an antibody molecule
  • the antibody molecule binds to at least one HA polypeptide from a Group 1 influenza strain with a higher affinity than a reference anti-HA antibody, and to at least one HA polypeptide from a Group 2 influenza strain with a higher affinity than a reference anti-HA antibody. In another embodiment, the antibody molecule binds to at least one HA polypeptide from an influenza A strain with a higher affinity than a reference anti-HA antibody, and to at least one HA polypeptide from an influenza B strain with a higher affinity than a reference anti-HA antibody.
  • Exemplary reference HA antibodies include Ab 67-11 (U.S. Provisional Application No. 61/645,453, U.S. Application Publication No. 2013/0302348, and International Application Publication No.
  • FI6 refers to any specifically disclosed FI6 sequence in U.S. Published Application No. 2010/0080813, U.S. published application No. 2011/0274702, WO2013/011347 or Corti et al., Science 333:850-856, 2011, published online Jul. 28, 2011; FIG. 4), FI28 (U.S. Published Application No. 2010/0080813), and C179 (Okuno et al., J. Virol. 67:2552-1558, 1993), F10 (Sui et al., Nat. Struct. Mol. Biol. 16:265, 2009), CR9114 (Dreyfus et al., Science. 2012; 337(6100):1343-1348; published online Aug. 9, 2012), and CR6261 (Ekiert et al., Science 324:246-251, 2009).
  • Affinity, or relative affinity or aviditiy can be measured by methods known in the art, such as by ELISA assay (Enzyme Linked Immunosorbent Assay), Surface Plasmon Resonance (SPR, e.g., by a BiacoreTM Assay), or KinExA® assay (Sapidyne, Inc.). Relative binding affinity is expressed herein according to ELISA assay.
  • ELISA assay Enzyme Linked Immunosorbent Assay
  • SPR Surface Plasmon Resonance
  • KinExA® assay KinExA® assay
  • an anti-HA antibody that binds with “high affinity” to a Group 1 HA, to a Group 2 HA, and to a influenza B HA can bind a Group 1 HA with a Kd less than or equal to 200 pM, e.g., less than or equal to 100 pM, as measured by ELISA, can bind a Group 2 HA with a Kd less than or equal to 200 pM, e.g., less than or equal to 100 pM, as measured by ELISA, and can bind an influenza B HA with a Kd less than or equal to 200 pM, e.g., less than or equal to 100 pM, as measured by ELISA.
  • antibodies that have one or more CDR sequences and one or more framework (FR) sequences as shown in Table 2.
  • the anti-HA antibody comprises a heavy chain and/or a light chain as defined in Table 3 below.
  • the amino acid sequences of the variable heavy and light chains of Table 3 are provided in FIGS. 2, 3 , respectively, or in FIG. 7 .
  • Ab 157 22 22 29 29 20 Ab 159 22 22 35 35 21. Ab 160 17 17 36 36 22. Ab 186 17 17 37 37 23. Ab 187 17 17 38 38 24. Ab 188 17 17 39 39 25. Ab 189 17 17 40 40 26. Ab 190 17 17 41 41 27. Ab 191 17 17 42 42 28. Ab 192 17 17 43 43 29. Ab 193 17 17 44 44 30. Ab 194 19 19 37 37 31. Ab 195 19 19 38 38 32. Ab 196 19 19 39 39 33. Ab 197 19 19 40 40 34. Ab 198 19 19 41 41 35. Ab 199 19 19 42 42 36. Ab 200 19 19 43 43 37. Ab 202 17 17 17 45 45 38. Ab 203 18 18 45 45 39. Ab 204 19 19 19 45 45 40.
  • Ab 081 164 164 169 169 Ab A18 is also sometimes known as Ab 018 here
  • the anti-HA antibody comprises a heavy chain as defined in Table 4A below, and/or a light chain as defined in Table 4A below.
  • an antibody molecule described herein comprises a heavy chain sequence as defined in Table 4A and a light chain sequence as defined in Table 4A.
  • an antibody molecule described herein comprises a heavy chain sequence as defined herein, e.g., in Table 4A, where a dipeptide is fused to the N-terminus. Typically, the dipeptide is isoleucine-aspartic acid (Ile-Asp).
  • an antibody molecule described herein comprises a light chain sequence as defined herein, e.g., in Table 4A, where a dipeptide is fused to the N-terminus. Typically, the dipeptide is Ile-Asp.
  • an antibody molecule described herein comprises a heavy chain comprising an N-terminal Ile-Asp dipeptide and a light chain comprising an Ile-Asp dipeptide.
  • the Ile-Asp dipeptide occurs between the signal sequence and FR1.
  • Heavy chain and light chain variable sequences comprising an Ile-Asp dipeptide at the N-terminus are identified in Table 4B.
  • an antibody molecule described herein is other than an antibody known in the art.
  • the antibody is not Ab 67-11 (U.S. Provisional Application No. 61/645,453, U.S. Application Publication No. 2013/0302348, and International Application Publication No. WO 2013/169377),
  • FI6 FI6, as used herein, refers to any specifically disclosed FI6 sequence in U.S. Application Publication No. 2010/0080813, U.S. Application Publication No. 2011/0274702, WO2013/011347 or Corti et al., Science 333:850-856, 2011, published online Jul. 28, 2011; FIGS. 12A to 12C), FI28 (U.S. Application Publication No.
  • an antibody described herein is other than Ab 67-11 (U.S. Provisional Application No. 61/645,453, U.S. Application Publication No. 2013/0302348, and International Application Publication No. WO 2013/169377).
  • an antibody molecule described herein has a variable heavy chain immunoglobulin domain that is at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to a heavy chain disclosed herein, e.g., from Table 3, Table 4A, Table 4B, FIG. 2 , FIG. 5 or FIG. 7 , e.g.
  • the consensus sequences were determined through the analysis of biochemical and biophysical properties of several hundred computationally designed VH/VL combinations.
  • the consensus sequences represent the amino acid sequences in which each amino acid is the one that occurs most frequently at that site when multiple sequences comprising desirable biochemical and biophysical data are aligned.
  • An exemplary anti-HA binding antibody has one or more CDRs, e.g., all three HC CDRs and/or all three LC CDRs of a particular antibody disclosed herein, or CDRs that are, in sum, at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to such an antibody.
  • CDRs e.g., all three HC CDRs and/or all three LC CDRs of a particular antibody disclosed herein, or CDRs that are, in sum, at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to such an antibody.
  • the H1 and H2 hypervariable loops have the same canonical structure as those of an antibody described herein.
  • the L1 and L2 hypervariable loops have the same canonical structure as those of an antibody described herein.
  • the amino acid sequence of the HC and/or LC variable domain sequence is at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to the amino acid sequence of the HC and/or LC variable domain of an antibody described herein.
  • the amino acid sequence of the HC and/or LC variable domain sequence can differ by at least one amino acid, but no more than ten, eight, six, five, four, three, or two amino acids from the corresponding sequence of an antibody described herein. For example, the differences may be primarily or entirely in the framework regions.
  • amino acid differences are conservative amino acid differences (e.g., conservative amino acid substitutions).
  • conservative amino acid substitutions is one in which the amino acid residue is replaced with an amino acid residue comprising a similar side chain. Families of amino acid residues comprising similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
  • beta-branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • amino acid sequences of the HC and LC variable domain sequences can be encoded by a nucleic acid sequence that hybridizes under high stringency conditions to a nucleic acid sequence described herein or one that encodes a variable domain or an amino acid sequence described herein.
  • the amino acid sequences of one or more framework regions (e.g., FR1, FR2, FR3, and/or FR4) of the HC and/or LC variable domain are at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to corresponding framework regions of the HC and LC variable domains of an antibody described herein.
  • one or more heavy or light chain framework regions are at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% homologous, or at least 85%, 87%, 88%, 89%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99% identical, to the sequence of corresponding framework regions from a human germline antibody.
  • Nucleic acids encoding a binding agent, e.g., an antibody molecule, generated by a method described herein can be sequenced, and all or part of the nucleic acids can be cloned into a vector that expresses all or part of the nucleic acids.
  • the nucleic acids can include a fragment of the gene encoding the antibody, such as a single chain antibody (scFv), a F(ab′) 2 fragment, a Fab fragment, or an Fd fragment.
  • the disclosure also provides host cells comprising the nucleic acids encoding an antibody or fragment thereof as described herein.
  • the host cells can be, for example, prokaryotic or eukaryotic cells, e.g., mammalian cells, or yeast cells, e.g., Pichia (see e.g., Powers et al. (2001) J. Immunol. Methods 251:123-35), Hanseula, or Saccharomyces.
  • Antibody molecules can be produced in mammalian cells.
  • mammalian host cells for recombinant expression include Chinese Hamster Ovary (CHO) cells (including dhfr ⁇ CHO cells, described in Urlaub and Chasin (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp (1982) Mol. Biol.
  • lymphocytic cell lines e.g., NSO myeloma cells and SP2 cells, COS cells, K562, and a cell from a transgenic animal, e.g., a transgenic mammal.
  • the cell is a mammary epithelial cell.
  • the recombinant expression vectors may carry additional nucleic acid sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
  • the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see e.g., U.S. Pat. Nos. 4,399,216; 4,634,665; and 5,179,017).
  • Exemplary selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in dhfr ⁇ host cells with methotrexate selection/amplification) and the neo gene (for G418 selection).
  • DHFR dihydrofolate reductase
  • a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain is introduced into dhfr-CHO cells by calcium phosphate-mediated transfection.
  • the antibody heavy and light chain genes are each operatively linked to enhancer/promoter regulatory elements (e.g., derived from SV40, CMV, adenovirus and the like, such as a CMV enhancer/AdMLP promoter regulatory element or an SV40 enhancer/AdMLP promoter regulatory element) to drive high levels of transcription of the genes.
  • the recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification.
  • the selected transformant host cells are cultured to allow for expression of the antibody heavy and light chains and intact antibody molecule is recovered from the culture medium.
  • Standard molecular biology techniques are used to prepare the recombinant expression vector, to transfect the host cells, to select for transformants, to culture the host cells, and to recover the antibody from the culture medium.
  • some antibodies can be isolated by affinity chromatography with a Protein A or Protein G.
  • purified antibodies can be concentrated to about 100 mg/mL to about 200 mg/mL using protein concentration techniques that are known in the art.
  • Antibody molecules can also be produced by a transgenic animal.
  • U.S. Pat. No. 5,849,992 describes a method for expressing an antibody molecule in the mammary gland of a transgenic mammal.
  • a transgene is constructed that includes a milk-specific promoter and nucleic acid sequences encoding the antibody molecule of interest, e.g., an antibody described herein, and a signal sequence for secretion.
  • the milk produced by females of such transgenic mammals includes, secreted therein, the antibody of interest, e.g., an antibody described herein.
  • the antibody molecule can be purified from the milk, or for some applications, used directly.
  • Antibody molecules can also be expressed in vivo, following administration of a vector containing nucleic acids encoding the antibody heavy chain and the antibody light chain.
  • Vector mediated gene-transfer is then used to engineer secretion of the anti-HA antibody into circulation.
  • an anti-HA antibody heavy chain and an anti-HA antibody light chain as described herein are cloned into an adeno-associated virus (AAV)-based vector, and each of the anti-HA antibody heavy chain and the anti-HA antibody light chain are under control of a promoter, such as a cytomegalovirus (CMV) promoter.
  • AAV adeno-associated virus
  • CMV cytomegalovirus
  • Administration of the vector to a subject such as to a patient, e.g., a human patient, such as by intramuscular injection, results in expression of an anti-HA antibody, and secretion into the circulation.
  • Binding agents, e.g., antibody molecules, described herein, can be modified to have numerous properties, e.g., to have altered, e.g., extended half life, to be associated with, e.g., covalently bound to detectable moieties, e.g., labels, to be associated with, e.g., covalently bound to toxins, or to have other properties, e.g., altered immune fucntions.
  • Antibody molecules may include modifications, e.g., modifications that alter Fc function, e.g., to decrease or remove interaction with an Fc receptor or with C1q, or both.
  • the human IgG1 constant region can be mutated at one or more residues.
  • the antibody production system may be designed to synthesize antibody molecules in which the Fc region is glycosylated.
  • the Fc domain can be produced in a mammalian expression system that appropriately glycosylates the residue corresponding to asparagine 297.
  • the Fc domain can also include other eukaryotic post-translational modifications.
  • the Fc domain can be an XmAb® Fc (Xencor, Monrovia, Calif.).
  • the Fc domain, or a fragment thereof can have a substitution in an Fc ⁇ Receptor (Fc ⁇ R) binding region, such as the domains and fragments described in WO05/063815.
  • the Fc domain, or a fragment thereof has a substitution in a neonatal Fc Receptor (FcRn) binding region, such as the domains and fragments described in WO05047327.
  • the Fc domain is a single chain, or fragment thereof, or modified version thereof, such as those described in WO2008143954.
  • Other suitable Fc modifications are known and described in the art.
  • Antibody molecules can be modified, e.g., with a moiety that improves its stabilization and/or retention in circulation, e.g., in blood, serum, lymph, bronchoalveolar lavage, or other tissues, e.g., by at least 1.5, 2, 5, 10, or 50 fold.
  • an antibody molecule generated by a method described herein can be associated with a polymer, e.g., a substantially non-antigenic polymer, such as a polyalkylene oxide or a polyethylene oxide.
  • a polymer e.g., a substantially non-antigenic polymer, such as a polyalkylene oxide or a polyethylene oxide.
  • Suitable polymers will vary substantially by weight. Polymers comprising molecular number average weights ranging from about 200 to about 35,000 daltons (or about 1,000 to about 15,000, and 2,000 to about 12,500) can be used.
  • an antibody molecule generated by a method described herein can be conjugated to a water soluble polymer, e.g., a hydrophilic polyvinyl polymer, e.g. polyvinylalcohol or polyvinylpyrrolidone.
  • a water soluble polymer e.g., a hydrophilic polyvinyl polymer, e.g. polyvinylalcohol or polyvinylpyrrolidone.
  • a non-limiting list of such polymers include polyalkylene oxide homopolymers such as polyethylene glycol (PEG) or polypropylene glycols, polyoxyethylenated polyols, copolymers thereof and block copolymers thereof, provided that the water solubility of the block copolymers is maintained.
  • Additional useful polymers include polyoxyalkylenes such as polyoxyethylene, polyoxypropylene, and block copolymers of polyoxyethylene and polyoxypropylene (Pluronics); polymethacrylates; carbomers; branched or unbranched polysaccharides that comprise the saccharide monomers D-mannose, D- and L-galactose, fucose, fructose, D-xylose, L-arabinose, D-glucuronic acid, sialic acid, D-galacturonic acid, D-mannuronic acid (e.g.
  • polymannuronic acid or alginic acid
  • D-glucosamine D-galactosamine
  • D-glucose and neuraminic acid including homopolysaccharides and heteropolysaccharides such as lactose, amylopectin, starch, hydroxyethyl starch, amylose, dextrane sulfate, dextran, dextrins, glycogen, or the polysaccharide subunit of acid mucopolysaccharides, e.g. hyaluronic acid; polymers of sugar alcohols such as polysorbitol and polymannitol; heparin or heparan.
  • Binding agents e.g., antibody molecules, as disclosed herein, can by conjugated to another entity or moiety (e.g., to a cytotoxic or cytostatic moiety, a label or detectable moiety, or a therapeutic moiety).
  • another entity or moiety e.g., to a cytotoxic or cytostatic moiety, a label or detectable moiety, or a therapeutic moiety.
  • moieties include: a cytotoxic or cytostatic agent, e.g., a therapeutic agent, a drug, a compound emitting radiation, molecules of plant, fungal, or bacterial origin, or a biological protein (e.g., a protein toxin) or particle (e.g., a recombinant viral particle, e.g., via a viral coat protein), a detectable agent; a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • a cytotoxic or cytostatic agent e.g., a therapeutic agent, a drug, a compound emitting radiation, molecules of plant, fungal, or bacterial origin, or a biological protein (e.g., a protein toxin) or particle (e.g., a recombinant viral particle, e.g., via a viral coat protein), a detect
  • a binding agent e.g., an antibody molecule, as disclosed herein, can be functionally linked by any suitable method (e.g., chemical coupling, genetic fusion, covalent binding, noncovalent association or otherwise) to one or more other molecular entities.
  • Binding agents e.g., antibody molecules, disclosed herein can be conjugated with a detectable moiety, e.g., a label or imaging agent.
  • a detectable moiety e.g., a label or imaging agent.
  • moieties can include enzymes (e.g., horseradish peroxidase, beta-galactosidase, luciferase, alkaline phosphatase, acetylcholinesterase, glucose oxidase and the like), radiolabels (e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I and the like), haptens, fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors, fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-1-napthalenesulfonyl chloride,
  • a binding agent e.g., antibody molecule, disclosed herein
  • a detectable enzyme is derivatized with a detectable enzyme and is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product.
  • the detectable agent horseradish peroxidase is present, the addition of hydrogen peroxide and diaminobenzidine leads to a colored reaction product, which is detectable.
  • a binding agent, e.g., antibody molecule, disclosed herein ay also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin).
  • a prosthetic group e.g., streptavidin/biotin and avidin/biotin.
  • an antibody may be derivatized with biotin, and detected through indirect measurement of avidin or streptavidin binding.
  • the moiety comprises paramagnetic ions and NMR-detectable substances, among others.
  • a paramagnetic ion is one or more of chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III), erbium (III), lanthanum (III), gold (III), lead (II), and/or bismuth (III).
  • Binding agents e.g., antibody molecules, as disclosed herein, can be modified to be associated with, e.g., conjugated to, a therapeutic agent, e.g., an agent comprising anti-viral activity, anti-inflammatory activity, or cytotoxic activity, etc.
  • therapeutic agents can treat symptoms or causes of influenza infection (e.g., for example, anti-viral, pain-relief, anti-inflammatory, immunomodulatory, sleep-inducing activities, etc.).
  • binding agents e.g., antibody molecules, or formulations thereof, featured in the disclosure, can be used to treat a subject, e.g., a subject, e.g., a human subject, infected with, or at risk for becoming infected with, an influenza virus.
  • Any human is candidate to receive an antibody molecule disclosed herein for treatment or prevention of an infection by an influenza virus.
  • Humans at high risk of infection such as immunocompromised individuals, and humans who are at high risk of exposure to influenza virus are particularly suited to receive treatment with the antibody molecule.
  • Immunocompromised individuals include the elderly (65 years and older) and children (e.g., 6 months to 18 years old), and people with chronic medical conditions. People at high risk of exposure include heath care workers, teachers and emergency responders (e.g., firefighters, policemen).
  • the antibody molecules described herein can also be used to prevent or reduce (e.g., minimize) secondary infection (e.g., secondary bacterial infection) or a risk of comprising secondary infection associated with influenza, or any effects (e.g., symptoms or complications) thereof on a subject.
  • secondary infection e.g., secondary bacterial infection
  • any effects e.g., symptoms or complications
  • Opportunistic secondary bacterial infections e.g., secondary bacterial pneumonia, e.g., primarily with Streptococcus pneumonia
  • the antibody molecules described herein can be used to prevent or reduce (e.g., minimize) the complications from secondary, opportunistic infections (e.g., bacterial infections) in a subject.
  • An antibody molecule can be administered to a subject, e.g., a human subject, by a variety of methods.
  • the route of administration is one of: intravenous injection or infusion, subcutaneous injection, or intramuscular injection.
  • An antibody molecule can be administered as a fixed dose, or in a mg/kg dose.
  • the antibody molecule can be administered intravenously (IV) or subcutaneously (SC).
  • IV intravenously
  • SC subcutaneously
  • the antibody molecule can be administered at a fixed unit dose of between about 50-600 mg IV, e.g., every 4 weeks, or between about 50-100 mg SC (e.g., 75 mg), e.g., at least once a week (e.g., twice a week).
  • the antibody molecule is administered IV at a fixed unit dose of 50 mg to 10000 mg, e.g., 1000 mg to 5000 mg, 2000 mg to 5000 mg, 2000 mg to 3000 mg, 2300 to 4600 mg, or 4000 mg to 5000 mg, e.g., 50 mg, 60 mg, 80 mg, 100 mg, 120 mg, 130 mg, 140 mg, 150 mg, 160 mg, 180 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg, 1000 mg, 1100 mg, 1200 mg, 1300 mg, 1400 mg, 1500 mg, 1600 mg, 1700 mg, 1800 mg, 1900 mg, 2000 mg, 2100 mg, 2200 mg, 2300 mg, 2400 mg, 2500 mg, 2600 mg, 2700 mg, 2800 mg, 2900 mg, 3000 mg, 3100 mg, 3200 mg, 3300 mg, 3400 mg, 3500 mg, 3600 mg, 3700 mg, 3800 mg, 3900 mg, 4000 mg, 4100 mg, 4200 mg,
  • the antibody molecule is administered SC at a fixed unit dose of 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 100 mg, or 120 mg or more.
  • Administration of the SC dose can be once or twice or three times or more per week, or once every two, three, four, or five weeks, or less frequently.
  • An anti-HA antibody molecule disclosed herein can also be administered by inhalation, such as by intranasal or by oral inhalation, such as at a fixed unit dose of 50 mg, 60 mg, 80 mg, 100 mg, 120 mg, 130 mg, 140 mg, 150 mg, 160 mg, 180 mg, 200 mg, 300 mg, 400 mg, 500 mg, or 600 mg or more.
  • an anti-HA antibody is administered to a subject via vector-mediated gene transfer, such as through the delivery of a vector encoding the heavy chain and the light chain of an anti-HA antibody, and the antibody is expressed from the heavy chain and light chain genes in the body.
  • nucleic acids encoding a heavy chain and a light chain can be cloned in a AAV vector, such as a self-complementary AAV vector, the scAAV vector administered to a human by injection, such as by IM injection, and the antibody is expressed and secreted into the circulation of the human.
  • An antibody molecule can also be administered in a bolus at a dose of between about 1 and 50 mg/kg, e.g., between about 1 and 10 mg/kg, between about 1 and 25 mg/kg or about 25 and 50 mg/kg, e.g., about 50 mg/kg, 25 mg/kg, 10 mg/kg, 6.0 mg/kg, 5.0 mg/kg, 4.0 mg/kg, 3.0 mg/kg, 2.0 mg/kg, 1.0 mg/kg, or less.
  • a dose of between about 1 and 50 mg/kg e.g., between about 1 and 10 mg/kg, between about 1 and 25 mg/kg or about 25 and 50 mg/kg, e.g., about 50 mg/kg, 25 mg/kg, 10 mg/kg, 6.0 mg/kg, 5.0 mg/kg, 4.0 mg/kg, 3.0 mg/kg, 2.0 mg/kg, 1.0 mg/kg, or less.
  • Modified dose ranges include a dose that is less than about 3000 mg/subject, about 1500 mg/subject, about 1000 mg/subject, about 600 mg/subject, about 500 mg/subject, about 400 mg/subject, about 300 mg/subject, about 250 mg/subject, about 200 mg/subject, or about 150 mg/subject, typically for administration every fourth week or once a month.
  • the antibody molecule can be administered, for example, every three to five weeks, e.g., every fourth week, or monthly.
  • Dosing can be adjusted according to a patient's rate of clearance of a prior administration of the antibody. For example, a patient may not be administered a second or follow-on dose before the level of antibodies in the patient's system has dropped below a pre-determined level.
  • a sample from a patient e.g., plasma, serum, blood, urine, or cerebrospinal fluid (CSF)
  • CSF cerebrospinal fluid
  • a patient whose antibody levels are determined to be too high can be tested again after one or two or three days, or a week, and if the level of antibody in the patient samples has dropped below the pre-determined level, the patient may be administered a second or follow-on dose of antibody.
  • the antibody may be prepared with a carrier that will protect the drug against rapid release, such as a controlled release formulation, including implants, and microencapsulated delivery systems.
  • a controlled release formulation including implants, and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known. See, e.g., Controlled Drug Delivery (Drugs and the Pharmaceutical Sciences), Second Edition, J. Robinson and V. H. L. Lee, eds., Marcel Dekker, Inc., New York, 1987.
  • compositions can be administered with a medical device.
  • a needleless hypodermic injection device such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556.
  • Examples of well-known implants and modules are discussed in, e.g., U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medicaments through the skin; U.S. Pat. No.
  • the binding agent e.g., an antibody molecule
  • the binding agent is administered buccally, orally, or by nasal delivery, e.g., as a liquid, spray, or aerosol, e.g., by topical application, e.g., by a liquid or drops, or by inhalation.
  • An antibody molecule described herein can be administered with one or more additional therapeutic agents, e.g., a second drug, for treatment of a viral infection, or a symptom of the infection.
  • the antibody molecule and the one or more second or additional agents can be formulated together, in the same formulation, or they can be in separate formulations, and administered to a patient simultaneously or sequentially, in either order.
  • Dosage regimens are adjusted to provide the desired response, such as a therapeutic response or a combinatorial therapeutic effect.
  • a therapeutic response such as a therapeutic response or a combinatorial therapeutic effect.
  • any combination of doses (either separate or co-formulated) of an antibody molecule and a second or additional agent can be used in order to provide a subject with both agents in bioavailable quantities.
  • Dosage unit form or “fixed dose” as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier and optionally in association with another agent.
  • a pharmaceutical composition may include a “therapeutically effective amount” of an agent described herein.
  • an agent described herein.
  • a therapeutically effective amount of an agent may also vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the compound to elicit a desired response in the individual, such as amelioration of at least one infection parameter, or amelioration of at least one symptom of the infection, such as chills, fever, sore throat, muscle pain, headache, coughing, weakness, fatigue and general discomfort.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the composition are outweighed by the therapeutically beneficial effects.
  • administration of a binding agent e.g., antibody molecule, provided, e.g., as a pharmaceutical preparation
  • administration of a binding agent is by one of the following routes: oral, intravenous, intramuscular, intra-arterial, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by liquids, powders, ointments, creams, sprays, or drops), mucosal, nasal, buccal, enteral, sublingual; intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol.
  • routes is by one of the following routes: oral, intravenous, intramuscular, intra-arterial, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by liquids, powders, ointments, creams, sprays, or drops), muco
  • Binding agents e.g., antibody molecules, provided e.g., as formulations (e.g., pharmaceutical formulations), can be administered either alone or in combination with one or more other therapy, e.g., the administration of a second or additional therapeutic agent.
  • the combination can result in a lower dose of the antibody molecule or of the other therapy being needed, which, in an embodiment can reduce side effects. In an embodiment, the combination can result in enhanced delivery or efficacy of one or both agents.
  • the agents or therapies can be administered at the same time (e.g., as a single formulation that is administered to a patient or as two separate formulations administered concurrently) or sequentially in any order.
  • Such second or additional agents include vaccines, anti-viral agents, and/or additional antibodies.
  • the second or additional agent is not co-formulated with the binding agent, e.g., antibody molecule, though in others it is.
  • the binding agent e.g., antibody molecule
  • the second or additional agent are administered such that one or more of the following is achieved: therapeutic levels, or therapeutic effects, of one overlap the other; detectable levels of both are present at the same time; or the therapeutic effect is greater than what would be seen in the absence of either the binding agent, e.g., antibody molecule, or the second or additional agent.
  • each agent will be administered at a dose and on a time schedule determined for that agent.
  • the second or additional agent can be, for example, for treatment or prevention of influenza.
  • the binding agents e.g., antibody molecules, e.g., therapeutic antibodies, provided herein can be administered in combination with a vaccine, e.g., a vaccine described herein or a mixture (a.k.a. a cocktail) of influenza peptides to stimulate the patient's immune system to prevent infection with particular strains of influenza A.
  • the second or additional agent is an anti-viral agent (e.g., an anti-NA or anti-M2 agent), a pain reliever, an anti-inflammatory, an antibiotic, a steroidal agent, a second therapeutic antibody molecule (e.g., an anti-HA antibody), an adjuvant, a protease or glycosidase (e.g., sialidase), etc.
  • an anti-viral agent e.g., an anti-NA or anti-M2 agent
  • a pain reliever e.g., an anti-NA or anti-M2 agent
  • an anti-inflammatory e.g., an antibiotic
  • a steroidal agent e.g., an anti-HA antibody
  • an adjuvant e.g., an anti-HA antibody
  • a protease or glycosidase e.g., sialidase
  • Exemplary anti-viral agents include, e.g., vaccines, neuraminidase inhibitors or nucleoside analogs.
  • Exemplary anti-viral agents can include, e.g., zidovudine, gangcyclovir, vidarabine, idoxuridine, trifluridine, foscarnet, acyclovir, ribavirin, amantadine, remantidine, saquinavir, indinavir, ritonavir, alpha-interferons and other interferons, a neuraminidase inhibitor (e.g., zanamivir (Relenza®), oseltamivir (Tamiflu®), laninamivir, peramivir), rimantadine.
  • a neuraminidase inhibitor e.g., zanamivir (Relenza®), oseltamivir (Tamiflu®), laninamivir, peramivir
  • Exemplary second antibody molecules include, for example Ab 67-11 (U.S. Provisional Application No. 61/645,453, U.S. Application Publication No. 2013/0302348, and International Application Publication No. WO 2013/169377), FI6 (U.S. Application Publication No. 2010/0080813), FI28 (U.S. Application Publication No. 2010/0080813), C179 (Okuno et al., J. Virol. 67:2552-8, 1993), F10 (Sui et al., Nat. Struct. Mol. Biol.
  • Ab 044 can be used in combination of any of those antibodies.
  • two or more binding agents e.g., antibody molecules disclosed herein, can be administered in combination, e.g., Ab 044 can be administered in combination with Ab 032.
  • two agents can be administered as part of the same dosage unit or administered separately.
  • Other exemplary agents useful for treating the symptoms associated with influenza infection are acetaminophen, ibuprofen, aspirin, and naproxen.
  • the antibody molecule and the second or additional agent are provided as a co-formulation, and the co-formulation is administered to the subject. It is further possible, e.g., at least 24 hours before or after administering the co-formulation, to administer separately one dose of the antibody formulation and then one dose of a formulation containing a second or additional agent.
  • the antibody molecule and the second or additional agent are provided as separate formulations, and the step of administering includes sequentially administering the antibody molecule and the second or additional agent. The sequential administrations can be provided on the same day (e.g., within one hour of one another or at least 3, 6, or 12 hours apart) or on different days.
  • the antibody molecule and the second or additional agent are each administered as a plurality of doses separated in time.
  • the antibody molecule and the second or additional agent are generally each administered according to a regimen.
  • the regimen for one or both may have a regular periodicity.
  • the regimen for the antibody molecule can have a different periodicity from the regimen for the second or additional agent, e.g., one can be administered more frequently than the other.
  • one of the antibody molecule and the second or additional agent is administered once weekly and the other once monthly.
  • one of the antibody molecule and the second or additional agent is administered continuously, e.g., over a period of more than 30 minutes but less than 1, 2, 4, or 12 hours, and the other is administered as a bolus.
  • sequential administrations are administered.
  • the time between administration of the one agent and another agent can be minutes, hours, days, or weeks.
  • the use of an antibody molecule described herein can also be used to reduce the dosage of another therapy, e.g., to reduce the side-effects associated with another agent that is being administered.
  • a combination can include administering a second or additional agent at a dosage at least 10, 20, 30, or 50% lower than would be used in the absence of the antibody molecule.
  • the antibody molecule and the second or additional agent can be administered by any appropriate method, e.g., subcutaneously, intramuscularly, or intravenously.
  • each of the antibody molecule and the second or additional agent is administered at the same dose as each is prescribed for monotherapy.
  • the antibody molecule is administered at a dosage that is equal to or less than an amount required for efficacy if administered alone.
  • the second or additional agent can be administered at a dosage that is equal to or less than an amount required for efficacy if administered alone.
  • the formulations described herein e.g., formulations containing an antibody molecule described herein, include one or more second or additional agents, or are administered in combination with a formulation containing one or more second or additional agents.
  • a binding agent e.g., antibody molecule
  • a pharmaceutical preparation is administered by inhalation or aerosol delivery of a plurality of particles, e.g., particles comprising a mean particle size of 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 microns.
  • the formulation is used (e.g., administered) in combination with an immunogen or a vaccine.
  • immunogens and vaccines are described in International Application Publication No. WO 2013/170139, the content of which is incorporated by reference in its entirety.
  • a formulation e.g., pharmaceutical formulation
  • a formulation e.g., generated by the methods described herein
  • the kit can include one or more other components, e.g., containers, buffers or other diluents, delivery devices, and the like.
  • the kit includes materials for administering a formulation (e.g., pharmaceutical formulation) to a subject, such as for treatment or prevention of infection by influenza viruses.
  • a formulation e.g., pharmaceutical formulation
  • the kit can include one or more or all of: (a) a container that contains a formulation (e.g., pharmaceutical formulation) that includes an antibody molecule, optionally (b) a container that contains a second therapeutic agent, and optionally (c) informational material.
  • the kit includes materials for using an antibody molecule in a diagnostic assay, such as for detection of HA in a biological sample.
  • the kit can include one or more or all of: (a) a container that contains a formulation (e.g., pharmaceutical formulation) that includes an antibody molecule, optionally (b) a container that contains a reagents, e.g., labeled with a detectable moiety, to detect the antibody, e.g., for use in an ELISA or immunohistochemistry assay, and optionally (c) informational material.
  • the kit comprises a formulation, e.g., a binding agent (e.g., antibody molecule) comprising a detectable moiety.
  • the kit comprises a solid substrate, e.g., bead, dipstick, array, and the like, on which is disposed a formulation, e.g., a binding agent (e.g., antibody molecule).
  • a solid substrate e.g., bead, dipstick, array, and the like
  • a formulation e.g., a binding agent (e.g., antibody molecule).
  • the informational material can be descriptive, instructional, marketing or other material that relates to the methods described herein and/or the use of the agents for therapeutic benefit, or for a diagnostic assay.
  • the informational material of the kits is not limited in its form.
  • the informational material can include information about production of the antibody, concentration, date of expiration, batch or production site information, and so forth.
  • the informational material relates to methods of administering the formulation or antibody molecule, e.g., in a suitable dose, dosage form, or mode of administration (e.g., a dose, dosage form, or mode of administration described herein), to treat a subject who has an infection, e.g., viral infection or secondary infection (e.g., secondary bacterial infection).
  • an infection e.g., viral infection or secondary infection (e.g., secondary bacterial infection).
  • the informational material relates to methods for using the formulation or antibody molecule for a diagnostic assay, e.g., to detect the presence of influenza viruses in a biological sample.
  • the information can be provided in a variety of formats, including printed text, computer readable material, video recording, or audio recording, or information that provides a link or address to substantive material.
  • the formulation in the kit can include other ingredients, such as a solvent or buffer, a stabilizer, or a preservative.
  • the binding agent e.g., antibody molecule
  • the agents are provided in a liquid solution, the liquid solution typically is an aqueous solution.
  • reconstitution generally is by the addition of a suitable solvent.
  • the solvent e.g., sterile water or buffer, can optionally be provided in the kit.
  • the kit can include one or more containers for the formulation containing the binding agent.
  • the kit contains separate containers, dividers or compartments for the formulation and informational material.
  • the formulation can be contained in a bottle, vial, or syringe, and the informational material can be contained in a plastic sleeve or packet.
  • the separate elements of the kit are contained within a single, undivided container.
  • the formulation is contained in a bottle, vial or syringe that has attached thereto the informational material in the form of a label.
  • the kit includes a plurality (e.g., a pack) of individual containers, each containing one or more unit dosage forms (e.g., a dosage form described herein) of the binding agent (e.g., antibody molecule).
  • the containers can include a combination unit dosage, e.g., a unit that includes both the antibody molecule and the second or additional agent, such as in a desired ratio.
  • the kit can include a plurality of syringes, ampoules, foil packets, blister packs, or medical devices each containing, for example, a single combination unit dose.
  • the containers of the kits can be air tight, waterproof (e.g., impermeable to changes in moisture or evaporation), and/or light-tight.
  • the kit comprises two containers, one of which contains the formulation (e.g., pharmaceutical formulation) and the other of which contains an adjuvant.
  • the kit comprises two containers, one of which contains the formulation (e.g., pharmaceutical formulation) as a lyophilized powder and the other of which contains a liquid for resuspending the formulation (e.g., pharmaceutical formulation).
  • the kit further includes instructions for use of the formulation.
  • the kit may contain a notice as required by governmental agency regulating the manufacture, use, and sale of pharmaceuticals or biological products, the notice indicating that the formulation has been approved for manufacture, use, and/or sale for administration to humans.
  • the formulation may be supplied in a hermetically-sealed container.
  • the formulation may be provided as a liquid or as a lyophilized powder that can be reconstituted by the addition, e.g., of water or saline, to a concentration suitable for administration to a subject.
  • the kit optionally includes a device suitable for administering the formulation, e.g., a syringe or device for delivering particles or aerosols, e.g., an inhaler, a spray device, or a dropper or other suitable delivery device.
  • a device suitable for administering the formulation e.g., a syringe or device for delivering particles or aerosols, e.g., an inhaler, a spray device, or a dropper or other suitable delivery device.
  • the device can be provided pre-loaded with one or both of the agents or can be empty but suitable for loading.
  • binding agents e.g., antibody molecules
  • a biological sample e.g., a patient sample, such as a fluid sample, e.g., a blood, serum, saliva, mucous, or urine sample, or a tissue sample, such as a biopsy.
  • a fluid sample e.g., a blood, serum, saliva, mucous, or urine sample
  • a tissue sample such as a biopsy.
  • a patient sample is contacted with a binding agent, e.g., an antibody molecule, disclosed herein, and binding is detected.
  • Binding can be detected with a number of formats and means of detection, e.g., with an antigen capture assay, such as an ELISA assay or Western blot, or an immunohistochemistry assay.
  • the binding agent e.g., an antibody molecule
  • the binding agent is provided, e.g., coupled to an insoluble matrix, e.g., a bead or other substrate, and a detection molecule used to detect binding of HA.
  • Binding of binding agent, e.g., antibody molecule, to HA can be detected with a reagent comprising a detectable moiety, e.g., a reagent, e.g., an antibody, which binds the binding agent, e.g., antibody molecule.
  • a reagent e.g., an antibody
  • the binding agent e.g., antibody molecule
  • Suitable detectable moieties include enzymes (e.g., horseradish peroxidase, beta-galactosidase, luciferase, alkaline phosphatase, acetylcholinesterase, glucose oxidase and the like), radiolabels (e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I), haptens, fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors, fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin and the like), phosphorescent molecules, chemiluminescent molecules, chromophores, luminescent molecules, photoaffinity molecules, colored particles or affinity ligands, such as biotin, predetermined polypeptide epitope
  • a human is tested for presence of influenza virus be a method described herein, and if the test is positive, a binding agents, e.g., antibody molecules, e.g., an antibody, provided herein, is administered.
  • a binding agents e.g., antibody molecules, e.g., an antibody, provided herein
  • the binding agents e.g., antibody molecules, e.g., an antibody, provided herein can be used for cytology assays, such as to identify an HA in a cell.
  • the assay can be a colorimetric assay.
  • a biological sample from a normal (non-infected) individual is used as a control.
  • the diagnostic assay can be performed in vitro.
  • the diagnostic assay can also be performed to determine infection of cells in culture, e.g., of mammalian cells in culture.
  • the antibody molecules can be used in in vitro assays.
  • the diagnostic assays disclosed herein can detect the presence of influenza virus in patients infected with a variety of distinct strains of influenza.
  • a patient sample can be further tested with subtype specific antibodies, or other assays (e.g., RFLP (Restriction Fragment Length Polymorphism), PCR
  • a patient determined to be infected with influenza A can be further administered an antibody molecule disclosed herein, to treat the infection.
  • solid substrates e.g., beads, dipsticks, arrays, and the like, on which is disposed a binding agent, e.g., antibody molecule.
  • a binding agent e.g., antibody molecule
  • Anti-HA antibody molecules described herein are also disclosed in International Publication No. WO2013/170139, U.S. Pat. No. 8,877,200, U.S. Pat. No. 9,096,657, and U.S. Patent Application Publication No. US 2013/0302349. The contents of the aforesaid publications are incorporated by reference in their entirety.
  • Table 2 Consensus AA sequence of LC CDR1 Q[S/T][V/L/I][T/S][Y/F/W][N/S/D]YKNYLA 170 n.a.
  • Table 2 Consensus AA sequence of LC CDR1 Q[S/T][V/L/I][T/S][Y/F/W][N/S/D/Q/R/E]YKNYLA 5 n.a.
  • Table 2 Consensus AA sequence of HC FR4 WG[A/Q]G[T/A][T/M][L/V]TVSS 11 n.a.
  • Table 2 Consensus AA sequence of LC FR1 [E/D]I[V/Q]MTQSP[D/S][S/T][L/V][A/S][V/A][S/T][L/V/R]G [E/D]R[A/V][T/S]I[N/T/Q/D/R]C[K/R]SS 12 n.a.
  • Table 2 Consensus AA sequence of LC FR2 WYQQKPG[Q/K][P/A]PKLLIY 13 n.a.
  • Table 2 Consensus AA sequence of LC FR3 GVP[D/E/S]RFSGSGSGTDFTLTISSLQ[A/P]ED[V/F/K/D]A[V/T]YYC 14 n.a.
  • Table 2 Consensus AA sequence of LC FR4 FG[G/Q/T/S/N]GTK[L/V][D/E]IK 15 15
  • Table 3 AA sequence of HC VR of Ab A18; entire EVQLLESGGGLVKPGQSLKLSCAASGFTFTSYGMHWVRQPPGKGLEWVAVISYDGS VH15 Table HC domain is in FIG. 1; ID version is in FIG. YKYYADSVQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSRLRSLLYFEWLS 4A, 5; NT sequence is in Example 1 QGYFNPWGAGTTLTVSS FIG.
  • AA sequence of LC VR of Ab A18; entire EIVMTQSPDSLAVSLGERATINCKSSQSVTYNYKNYLAWYQQKPGQPPKLLIYWAS VL28 Table 4A LC domain is in FIG. 1; ID version is in FIG. TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK FIG. 3A 6A; NT sequence is in Example 1 16 16 Table 3 AA sequence of HC VR of Abs 014, 028; EVQLLESGGGLVKPGQSLKLSCAASGFTFSSYGMHWVRQPPGKGLEWVAVVSYDGS VH16 Table 4A ID version is in FIG.
  • NT sequence is in NKYYADSVQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDTKLRSLLYFEWLS
  • FIG. 2 Example 1 SGLLDYWGQGAMVTVSS 29 29 Table 3 AA sequence of LC VR of Abs 014, 154, EIVMTQSPDSLAVSLGERATINCKSSQSVTFSYKNYLAWYQQKPGQPPKLLIYWAS VL29 Table 4A 157; ID version is in FIG. 6A; NT sequence TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK FIG.
  • Example 1 30 30
  • Table 3 AA sequence of LC VR of Abs 028, 155; EIVMTQSPDSLAVSLGERATINCKSSQSVTFSYKNYLAWYQQKPGQPPKLLIYWAS VL30
  • Table 4A ID version is in FIG. 6A;
  • NT sequence is in TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK FIG.
  • FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • FIG. 3A 34 34 Table 3 AA sequence of LC VR of Abs 025, 026, EIVMTQSPDSLAVSLGERATINCKSSQSVTFSYKNYLAWYQQKPGQPPKLLIYWAS VL34 Table 4A 027, 086; ID version is in FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • FIG. 2 SGLLDYWGQGAMVTVSS 22 22 Table 3 AA sequence of HC VR of Abs 157, 159; EVQLLESGGGLVKPGQSLKLSCAASGFTFTTYAMHWVRQPPGKGLEWVAVVSYDGN VH22 Table 4A ID version is in FIG. 5 NKYYADSVQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSKLRSLLYFEWLS FIG.
  • FIG. 3A 37 37 Table 3 AA sequence of LC VR of Abs 186, 194; EIVMTQSPDSLAVSLGERATINCKSSQSVTFSYKNYLAWYQQKPGQPPKLLIYWAS VL37 Table 4A ID version is in FIG.
  • FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • FIG. 3A 41 41 Table 3 AA sequence of LC VR of Abs 190, 198; EIVMTQSPDSLAVSLGERATINCKSSQSVTFSYKNYLAWYQQKPGQPPKLLIYWAS VL41 Table 4A ID version is in FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • FIG. 3A 42 42 Table 3 AA sequence of LC VR of Abs 191, 199; EIVMTQSPDSLAVSLGERATINCKSSQSVTFSYKNYLAWYQQKPGQPPKLLIYWAS VL42 Table 4A ID version is in FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK FIG. 3A 43 43 Table 3 AA sequence of LC VR of Abs 192, 200; EIVMTQSPDSLAVSLGERATINCKSSQSVTFSYKNYLAWYQQKPGQPPKLLIYWAS VL43 Table 4A ID version is in FIG.
  • FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • FIG. 3A 44 44 Table 3 AA sequence of LC VR of Abs 193; ID EIVMTQSPDSLAVSLGERATINCKSSQSVTFSYKNYLAWYQQKPGQPPKLLIYWAS VL44 Table 4A version is in FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • NT sequence is in Example 1 46 46
  • FIG. 2 QGYFNPWGAGTTLTVSS 24 24 Table 3 AA sequence of HC VR of Abs A001, EVQLLESGGGLVKPGQSLKLSCAASGFTFTSYGMHWVRQPPGKGLEWVAVVSYDGN VH24 Table 4A A002, A003, A010, A011, 031, 037; ID YKYYADSVQGFFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSKLRSLLYFEWLS
  • FIG. 2 version is in FIG.
  • NT sequence is in QGYFNPWGAGTTLTVSS
  • Example 1 47 47 Table 3 AA sequence of LC VR of Abs A001, 004, EIVMTQSPDSLAVSLGERATINCKSSQSVTFSYKNYLAWYQQKPGQPPKLLIYWAS VL47 Table 4A 007, 016; ID version is in FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • NT sequence is in Example 1 49 49
  • Table 3 AA sequence of LC VR of Abs A003, 006, DIVMTQSPDTVAVTLGERATIDCKSSQTVTFNYKNYLAWYQQKPGQPPKLLIYWAS VL49
  • Table 4A A009, C18; ID version is in FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • FIG. 6A TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK
  • FIG. 3A 27 27 Table 3 AA sequence of HC VR of Abs 016, A017, EVQLLESGGGLVKPGQSLKLSCAASGFTFTSYAMHWVRQPPGKGLEWVAVVSYDGN VH27 Table 4A C18, A019, 034, 040; ID version is in FIG. 5 YKYYADSVQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSRLRTLLYFEWLS FIG.
  • FIG. 3B sequence is in Example 1 57 57 Table 3 AA sequence of LC VR of Ab 045; ID DIQMTQSPSSLSASVGDRVTITCRSSQSITFNYKNYLAWYQQKPGKAPKLLIYWGS VL57 Table 4A version is in FIG. 6B YLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYRTPPSFGQGTKVEIK FIG.
  • FIG. 3B 59 59 Table 3 AA sequence of LC VR of Ab 046; ID DIQMTQSPSSLSASVGDRVTITCRSSQSITFNYKNYLAWYQQKPGKAPKLLIYWGS VL59 Table 4A version is in FIG. 6B YLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYRTPPSFGQGTKVEIK FIG. 3B 55 55 Table 3 AA sequence of LC VR of Ab 047; ID DIQMTQSPSSLSASVGDRVTITCRSSQSITFNYKNYLAWYQQKPGKAPKLLIYWGS VL55 Table 4A version is in FIG.
  • FIG. 3B KLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYRTPPSFGQGTKVEIK
  • FIG. 3B 58 58 Table 3 AA sequence of LC VR of Ab 048; ID DIQMTQSPSSLSASVGDRVTITCRSSQSITFNYKNYLAWYQQKPGKAPKLLIYWGS VL58 Table 4A version is in FIG. 6B YLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYRTPPSFGQGTKVEIK
  • FIG. 6B KLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYRTPPSFGQGTKVEIK
  • FIG. 3B 54 Table 3 AA sequence of LC VR of Ab 049; ID DIQMTQSPSSLSASVGDRVTITCRSSQSITFNYKNYLAWYQQKPGKAPKLLIYWGS VL54 Table 4A version is in FIG. 6B HLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYRTPPSFGQGTKVEIK FIG. 3B 56 56 Table 3 AA sequence of LC VR of Ab 050; ID DIQMTQSPSSLSASVGDRVTITCRSSQSITFNYKNYLAWYQQKPGKAPKLLIYWGS VL56 Table 4A version is in FIG.
  • FIG. 3B 61 61 Table 3 AA sequence of LC VR of Ab 052; ID DIVMTQSPDTVAVTLGERATIDCKSSQTVTFNYKNYLAWYQQKPGQPPKLLIYWAS VL61 Table 4A version is in FIG. 6B TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDIK FIG. 3B 153 153 Table 3 AA sequence of LC VR of Ab 067; ID DIQMTQSPSSLSASVGDRVTITCRSSQSITFNYKNYLAWYQQKPGKAPKLLIYWGS VL153 Table 4A version is in FIG.
  • FIG. 3B YLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYRTPPSFGQGTKVEIK
  • FIG. 3B 154 154 Table 3 AA sequence of LC VR of Ab 068; ID DIQMTQSPSSLSASVGDRVTITCRSSQSITFNYKNYLAWYQQKPGKAPKLLIYWGS VL154 Table 4A version is in FIG. 6B YLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYRTPPSFGQGTKVEIK
  • FIG. 6B YLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYRTPPSFGQGTKVEIK
  • FIG. 3B 162 162 Table 3 AA sequence of HC VR of Ab 071 EVQLLESGGGLVKPGQSLKLSCAASGFTFTSYAMHWVRQPPGKGLEWVAVVSYDGN VL162 Table 4A YKYYADSVQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSRLRTLLYFEWLS FIG.
  • FIG. 7 QGYFNPWGQGTTLTVSS 161 HC161 Table 4A AA sequence of HC VR consensus; ID EVQLLESGGGLVKPGQSLKLSCAASGFTFSSYGMHWVRQPPGKGLEWVAVVSYDGS
  • FIG. 2 version is in FIG.
  • FIG. 5 version is in FIG.
  • FIG. 6A version is in FIGS.
  • FIG. 5 non-ID version is in FIG.
  • FIG. 6A non-ID version is in FIGS. 3A-3B I ASTESDGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDI K 99 18-ID Table 4B AA sequence of HC VR of Abs 002, 010, IDEVQLLESGGGLVKPGQSLKLSCAASGFTFTSYGMHWVRQPPGKGLEWVAVISYD
  • FIG. 6A non-ID version is in FIGS. 3A-3B I ASTESDGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDI K 99 18-ID Table 4B AA sequence of HC VR of Abs 002, 010, IDEVQLLESGGGLVKPGQSLKLSCAASGFTFTSYGMHWVRQPPGKGLEWVAVISYD
  • FIG. 6A version is in FIGS.
  • FIG. 6A 003; non-ID version is in FIGS. 3A-3B ASTESDGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYRTPPTFGGGTKLDI K 101 21-ID Table 4B AA sequence of HC VR of Abs 154,155; IDEVQLLESGGGLVKPGQSLKLSCAASGFTFTSYGMHWVRQPPGKGLEWVAVISYD
  • FIG. 5 non-ID version is in FIG.
  • FIG. 5 non-ID version is in FIG.
  • FIG. 5 version is in FIG.
  • FIG. 5 non-ID version is in FIG.
  • FIG. 6A version is in FIGS.
  • FIG. 5 A002, A003, A010, A011, 031, 037; non- GNYKYYADSVQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSRLRSLLYFEW ID version is in FIG.
  • FIG. 5 006, 012, 013, 032, 038, 043, 044, 045, 046, GNYKYYADSVQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDSRLRSLLYFEW 047, 048, 049, 050, 051, 052, 067, 068, 069, LSQGYFNPWGQGTTLTVSS 070, 073, 074, 075, 076, 077; non-ID version is in FIG.
  • FIG. 6A non-ID version is in FIGS.
  • FIG. 6A non-ID version is in FIGS. 3A-3B ASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQHYRTPPSFGTGTKLDI K 109 161-ID Table 4B AA sequence of HC VR consensus ID; non- IDEVQLLESGGGLVKPGQSLKLSCAASGFTFTSYGMHWVRQPPGKGLEWVAVISYD
  • FIG. 5 ID version is in FIG.
  • FIG. 6A non-ID version is in FIGS.
  • FIG. 6A non-ID version is in FIGS.
  • FIG. 6A non-ID version is in FIGS.
  • FIG. 6A non-ID version is in FIGS.
  • FIG. 6A non-ID version is in FIGS.
  • FIG. 6A version is in FIGS.
  • FIG. 6A 007 016 ASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQHYRTPPSFGTGTKLDI K 130 48-ID Table 4B AA sequence of LC VR of Abs 002, 005, IDDIMVTQSPDSLAVSLGERATINCKSSQTVTFNYKNYLAWYQQKPGQPPKLLIYW
  • FIG. 6A 008, A017; non-ID version is in FIGS.
  • FIG. 6B version is in FIGS.
  • FIG. 6B version is in FIGS.
  • FIG. 6B version is in FIGS.
  • FIG. 6B version is in FIGS.
  • FIG. 6B version is in FIGS.
  • FIG. 6B version is in FIGS.
  • FIG. 6B version is in FIGS.
  • FIG. 6B version is in FIGS.
  • FIG. 6B version is in FIGS.
  • FIG. 6B non-ID version is in FIGS.
  • FIG. 6B ID version is in FIGS.
  • EIVMTQSPDSLAVSLGERATINC 91 n.a. see text AA sequence of LC FR2 of Ab A18 et al. WYQQKPGQPPKLLIY 92 n.a. see text AA sequence of LC FR3 of Ab A18 et al. GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC 93 n.a. see text AA sequence of LC FR4 of Ab A18 et al. FGGGTKLDIK 171 n.a. see text AA sequence of HC FR4 of Ab 078 et al. WGQGTTVTVSS 172 n.a.
  • FIG. 4 AA sequence of HC VR of FI6 variant 1 QVQLVQSGGGVVQPGRSLRLSCVASGFTFSTYAMHWVRQAPGRGLEWVAVISYDGN YKYYADSVKGFRSISRDNSNNTLHLEMNTLRTEDTALYYCAKDSQLRSLLYFEWLS QGYFDPWGQGTLVTVTS 178 n.a.
  • FIG. 4 AA sequence of HC VR of FI6 variant 1 QVQLVQSGGGVVQPGRSLRLSCVASGFTFSTYAMHWVRQAPGRGLEWVAVISYDGN YKYYADSVKGFRSISRDNSNNTLHLEMNTLRTEDTALYYCAKDSQLRSLLYFEWLS QGYFDPWGQGTLVTVTS 178 n.a.
  • FIG. 4 AA sequence of HC VR of FI6 variant 1 QVQLVQSGGGVVQPGRSLRLSCVASGFTFSTYAMHWVRQAPGRGLEWVAVISYDGN YK
  • FIG.4 AA sequence of HC VR of FI6/370 QVQLVQSGGGVVQPGRSLRLSCVASGFTFSTYAMHWVRQAPGRGLEWVAVISYDGN YKYYADSVKGFRSISRDNSNNTLHLEMNTLRTEDTALYYCAKDSQLRSLLYFEWLS QGYFDPWGQGTLVTVTS 180 n.a.
  • FIG. 4 AA sequence of HC VR of FI6/370 QVQLVQSGGGVVQPGRSLRLSCVASGFTFSTYAMHWVRQAPGRGLEWVAVISYDGN YKYYADSVKGFRSISRDNSNNTLHLEMNTLRTEDTALYYCAKDSQLRSLLYFEWLS QGYFDPWGQGTLVTVTS 180 n.a.
  • FIG. 4 AA sequence of HC VR of FI6/370 QVQLVQSGGGVVQPGRSLRLSCVASGFTFSTYAMHWVRQAPGRGLEWVAVISYDGN YKYY
  • Human antibodies (IgG) targeting viral hemagglutinin (HA) were computationally designed. HA mediates viral binding to host cell surface receptor, and cell membrane fusion to the viral envelope, resulting in viral entry.
  • the antibody molecules described herein were designed to block HA's fusogenic activity.
  • All antibody constructs were based on human IgG1 structure ( ⁇ 1 heavy chain and ⁇ light chain). Point mutations in the V H (variable heavy domain) and V L (variable light domain) were computationally designed. These mutations are located within or outside the CDRs (Complementarity Determining Regions). The mutations were designed, e.g., to modify antigen binding properties (e.g., for stronger or weaker binding affinity), or to stabilize structure, or to improve expression properties, etc.
  • the heavy and light chain sequences of one antibody, called A18 is provided in FIG. 1 .
  • DNA sequences for the variable heavy chain and variable light chain for each of antibodies Ab A18, Ab 031, Ab 032, Ab 044, Ab 014 and Ab 028 are provided below.
  • VH16 (SEQ ID NO: 63) GAGGTACAGCTCCTCGAATCGGGAGGGGGACTGGTCAAACCCGGTCAATC GCTCAAACTCTCGTGTGCAGCGTCAGGTTTTACGTTCAGCTCATATGGGA TGCACTGGGTCCGCCAGCCTCCGGGAAAGGGACTGGAGTGGGTGGCAGTC GTGTCGTATGACGGGAGCAATAAGTACTACGCCGATTCAGTGCAAGGTCG GTTTACCATTTCGAGGGATAACAGCAAGAACACGCTCTCTACTTGCAGATGA ACTCACTTAGAGCGGAAGATACGGCTGTGTACTATTGCGCCAAAGACACA AAGCTGCGATCCCTGTTGTACTTCGAATGGTTGTCCTCGGGCTTGCTTGA CTATTGGGGGCAGGGCTTGTTTGTTTGA CTATTGGGGGCAGGGCCATGGTCACAGTATCCAGCGCGTCGACTAAGG GGCCC VL29: (SEQ ID NO: 64) GAGATCGTGATGACGCAGAGCCCCGATAGCC
  • Each of the above sequences can be modified to include an ATCGAT nucleotide sequence at the 5′ end, which will encode a variable heavy chain or light chain polypeptide comprising Ile-Asp at the amino terminus.
  • the solution volume in each Amicon Ultra Centrifugal filter was reduced to approximately 400 ⁇ L. After completion of the two buffer exchanges, it can be assumed that to the final solution contained less than 1.5% of the original solution composition.
  • the final retentate volume was reduced from 6.0 mL to approximately 400 ⁇ L, with a theoretical concentration of around 150 mg/ml assuming no protein was lost to the membrane or precipitated out.
  • the retentate was then filtered through a 0.22 ⁇ M membrane.
  • A280 and DSC were conducted to measure protein concentrations and the conformational stability of the antibody in each formulation, respectively.
  • Each sample was also divided into 4 portions in glass vials. The first 3 aliquots have 65 ⁇ L solution. The remaining sample is in the 4th aliquot, with sample volume ranged between 65 and 350 ⁇ L. The first 3 aliquots were stored at 5° C., 45° C., and ⁇ 70° C., respectively; the 4th portion was stored at 5° C. The 1st three aliquots was pulled on day 7 and frozen at ⁇ 70° C. and shipped on dry ice for analysis.
  • Table 5 shows formulation information, protein concentration, differential scanning calorimetry (DSC) peak temperatures, and the final volume after buffer exchange, while, Table 6 summarizes the size exclusion chromatography (SEC) results.
  • FIGS. 8A-8G show the DSC profile for all of the 14 formulation samples. Significant differences were observed between the formulations by DSC. A front shoulder was clearly observed for formulation #5, 7, 12, and 13 at approximately 70° C. for low pH samples (pH 5-5.5), indicating the anti-HA antibody molecule at lower pH denatured sooner as the temperature increased.
  • Table 6 shows the summary of the overall protein recovery of the concentration step and the Size Exclusion Chromatography (SEC) results of the 14 formulations stored at 3 temperatures.
  • the recovery of the concentration step (targeted 100 mg/ml) was calculated based on the amount of protein at the start and end of the process.
  • the results of the SEC analytics are expressed as a main peak, containing the HA antibody monomer, as well as peaks containing High Molecular Weight (HMW) and Low Molecular Weight (LMW) species, consisting of aggregates and breakdown products. Data show that all 42 samples tested consist to a very large proportion of monomeric species, as expressed by % Main Peak above 98%, when stored at 2-8° C.
  • % High Molecular Weight Species (% HMWS), and/or % Low Molecular Species (% LMWS) increased more in some of the formulation upon storage at 45° C. for 1 week (#1, 3, 4, 9, 10, 11, 12 and 14) in comparison with rest of the formulation buffers.
  • % HMWS % High Molecular Weight Species
  • % LMWS % Low Molecular Species
  • This Example summarizes the formulation development study for an exemplary anti-HA antibody molecule described herein, e.g., Ab 044, at 25 mg/ml.
  • a short-term thermal stressed stability study, a freeze/thaw study, and an agitation study were performed to screen out the desired formulation.
  • formulations were prepared at concentration of 25 mg/mL. Each formulation was divided into several portions for different storage conditions, which include 4° C. and 45° C. for 2 weeks, freeze/thaw for 1 and 3 cycles, and agitation for 16 hours at speed of 30 RPM by a cP Cole-Parmer. Appearance, SEC, CE-SDS, A280, IEF and potency analyses were conducted to evaluate the stability of these samples. Table 7 lists the composition of the 5 formulations. It was found that the antibody molecule was stable for up to 3 freeze/thaw cycles and overnight agitation. Among the 5 formulations, Formulation 1 and 4 were most stable. Formulation 1 was chosen as the final formulation for the antibody molecule based on the potential long term benefit of Tween-80.
  • Citric Acid JT Baker, Lot K42466 100 mM, Sodium Phosphate Dibasic Heptahydrate (Fisher, Lot 125720) 100 mM, and NaCl (JT Baker, Lot L10472) 1.0 N were prepared.
  • pH 6.0 buffer 100 mM was prepared by mixing Citric Acid 100 mM and Sodium Phosphate Dibasic Heptahydrate 100 mM at a proper ratio determined by a pH meter.
  • pH 6.5 buffer 100 mM was also prepared by mixing Citric Acid 100 mM and Sodium Phosphate Dibasic Heptahydrate 100 mM at a proper ratio determined by the pH meter.
  • the 5 formulations were prepared without Tween-80 according to Table 8 and were QS to a final volume of 125 mL with water in a graduated cylinder.
  • the pH values were further adjusted by 5N NaOH or 5N HCl to pH 6.0 or 6.5.
  • the antibody bulk drug substance (BDS) (4.5 mg/mL, 229.2 mL) was prepared by a sequence of Protein A affinity chromatography, anion exchange chromatography, and cation exchange chromatography.
  • the purified samples were formulated in the appropriate solutions using Ultrafiltration/Diafiltration.
  • the combined formulation sample #1 and #4 was divided into equal portions as Formulation #1 and Formulation #4, respectively.
  • Diluted Tween-80 JT Baker, Lot H35614) (3%) was spiked into the samples except Formulation #4 to reach a concentration of 0.025% Tween-80.
  • Table 11 lists capillary electrophoresis-SDS (CE-SDS) results for reduced samples.
  • the antibody molecule was stable over freeze/thaw and agitation based on the reduced CE-SDS results.
  • the combined (heavy chain and light chain) Main peak % area after storage at different conditions are listed.
  • Formulations #1 and #4 showed improved stability as compared to the other 3 formulations.
  • FIG. 9 shows a representative electropherogram of CE-SDS for a reduced sample.
  • Table 12 lists CE-SDS results for non-reduced samples.
  • the Main peak % area for IgG at different conditions are listed.
  • the antibody molecule was stable over freeze/thaw and agitation based on non-reduced CE-SDS.
  • Formulations #1 and #4 appeared to maintain stability better than the other 3 formulations as demonstrated by the % Purity difference between 4° C. and 45° C. storage for 2 weeks.
  • FIG. 10 shows a representative electropherogram of CE-SDS for a non-reduced sample.
  • Table 13 lists SEC-HPLC results as % peak area for monomer peak, high molecular weight (HMW) peak and low molecular weight (LMW) peak from samples stored for 2 weeks at 4° C. and 45° C. The peak area % differences at 4° C. and 45° C. are also listed for different formulations. Formulation #2 and #3 showed the most change upon stress at 45° C.
  • FIG. 11 shows a representative SEC chromatogram.
  • FIG. 12 shows a representative IEF gel image.
  • Formulation 1 was chosen as the final formulation for the antibody molecule based on the potential long term benefit of Tween-80.
  • the formulation contains 40 mM Citrate-Sodium Phosphate, 150 mM sodium chloride, 0.025% polysorbate-80, pH 6.0.
  • Example 4 Population Pharmacokinetic and Viral Dynamic Modeling of VIS410 in a Human Challenge Model
  • VIS410 A population pharmacokinetic (popPK) and influenza viral dynamic model were developed to support the VIS410 clinical program (e.g., using a formulation described herein), integrating data from a Phase 1 healthy volunteer and a Phase 2a human influenza challenge study.
  • VIS410 is also known as Ab 044 herein.
  • N 30, single IV doses 2-50 mg/kg
  • volunteers were inoculated intranasally with an attenuated influenza A (H1N1) strain, and received placebo or VIS410 24 h post-inoculation.
  • Frequent nasal viral load (qPCR and TCID 50 ), serum and nasal PK were measured.
  • a 3-compartment model adequately described PK with first-order distribution of VIS410 between nasal and central compartments (mean (% RSE) CL D serum-to-nasal 0.04 (19.5%) mL/h; and nasal-to-serum 1.95 (17.1%) mL/h).
  • Body weight was the only covariate that was retained in the popPK model.
  • Other covariates tested included gender, age and infection status, but were non-influential.
  • a 92% reduction in viral load AUC by qPCR was observed at the 2300 mg dose compared to placebo (p ⁇ 0.05).
  • VIS410 demonstrated PK generally typical of IgG1 mAbs, and potent antiviral activity compared to placebo in the H1N1 human challenge model.
  • a semi-mechanistic popPK model which links mAb nasal concentrations to influenza viral dynamics based on the VIS410 mechanism of action was successfully developed.
  • the model describes serum and nasal PK, with impact on viral load, and was used to support dose selection for future clinical development across a spectrum of populations. This approach may be extended to other mAbs targeted against influenza viral infections.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Virology (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Pulmonology (AREA)
  • Inorganic Chemistry (AREA)
  • Dermatology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
US15/440,381 2016-02-24 2017-02-23 Formulations of antibody molecules to influenza virus Abandoned US20170240617A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US15/440,381 US20170240617A1 (en) 2016-02-24 2017-02-23 Formulations of antibody molecules to influenza virus
US16/518,536 US20200181243A1 (en) 2016-02-24 2019-07-22 Formulations of antibody molecules to influenza virus
US17/091,756 US12202885B2 (en) 2016-02-24 2020-11-06 Formulations of antibody molecules to influenza virus

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662299162P 2016-02-24 2016-02-24
US15/440,381 US20170240617A1 (en) 2016-02-24 2017-02-23 Formulations of antibody molecules to influenza virus

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/518,536 Continuation US20200181243A1 (en) 2016-02-24 2019-07-22 Formulations of antibody molecules to influenza virus

Publications (1)

Publication Number Publication Date
US20170240617A1 true US20170240617A1 (en) 2017-08-24

Family

ID=58264606

Family Applications (3)

Application Number Title Priority Date Filing Date
US15/440,381 Abandoned US20170240617A1 (en) 2016-02-24 2017-02-23 Formulations of antibody molecules to influenza virus
US16/518,536 Abandoned US20200181243A1 (en) 2016-02-24 2019-07-22 Formulations of antibody molecules to influenza virus
US17/091,756 Active US12202885B2 (en) 2016-02-24 2020-11-06 Formulations of antibody molecules to influenza virus

Family Applications After (2)

Application Number Title Priority Date Filing Date
US16/518,536 Abandoned US20200181243A1 (en) 2016-02-24 2019-07-22 Formulations of antibody molecules to influenza virus
US17/091,756 Active US12202885B2 (en) 2016-02-24 2020-11-06 Formulations of antibody molecules to influenza virus

Country Status (7)

Country Link
US (3) US20170240617A1 (https=)
EP (1) EP3419663A1 (https=)
JP (2) JP7104629B2 (https=)
CN (1) CN109195629A (https=)
AU (2) AU2017222564A1 (https=)
CA (1) CA3015347A1 (https=)
WO (1) WO2017147248A1 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170137498A1 (en) * 2015-11-13 2017-05-18 Visterra, Inc. Compositions and methods for treating and preventing influenza
US9969794B2 (en) 2012-05-10 2018-05-15 Visterra, Inc. HA binding agents
US11230593B2 (en) 2019-03-25 2022-01-25 Visterra, Inc. Compositions and methods for treating and preventing influenza
US11634485B2 (en) 2019-02-18 2023-04-25 Eli Lilly And Company Therapeutic antibody formulation
CN116589569A (zh) * 2023-03-06 2023-08-15 中国农业科学院兰州兽医研究所 一种抗h7n9亚型流感病毒ha蛋白的纳米抗体及其噬菌体展示文库的构建方法和应用
CN116806155A (zh) * 2020-11-05 2023-09-26 布拉瓦多制药有限责任公司 用于针对病毒感染的粘膜保护的鼻内抗病毒疗法
US12202885B2 (en) 2016-02-24 2025-01-21 Visterra, Inc. Formulations of antibody molecules to influenza virus

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3733244A1 (en) 2013-10-02 2020-11-04 Medlmmune, LLC Neutralizing anti-influenza a antibodies and uses thereof
CN119161468A (zh) 2014-07-15 2024-12-20 免疫医疗有限责任公司 中和抗乙型流感抗体及其用途
CN113480640B (zh) 2015-06-01 2024-07-30 免疫医疗有限责任公司 中和抗流感结合分子及其用途
WO2017123685A1 (en) 2016-01-13 2017-07-20 Medimmune, Llc Method of treating influenza a
CN111393512B (zh) * 2020-03-24 2021-03-02 北京中科微盾生物科技有限责任公司 一种抑制流感病毒的多肽及其在制备预防和治疗流感病毒感染药物中的应用

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0417191A1 (en) * 1988-05-27 1991-03-20 Centocor Inc Formulation for antibody reagents.
US20130280248A1 (en) * 2003-10-01 2013-10-24 Kyowa Hakko Kirin Co., Ltd. Method of stabilizing antibody and stabilized solution-type antibody preparation
US20140014858A1 (en) * 2012-07-12 2014-01-16 Rafael R. Gattass Wavelength and power scalable waveguiding-based infrared laser system

Family Cites Families (136)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
IL63224A (en) 1980-07-17 1985-05-31 Scripps Clinic Res Synthetic peptide specific antigenic determinant and method of manufacturing antigenic materials therefrom
IL61904A (en) 1981-01-13 1985-07-31 Yeda Res & Dev Synthetic vaccine against influenza virus infections comprising a synthetic peptide and process for producing same
US4475196A (en) 1981-03-06 1984-10-02 Zor Clair G Instrument for locating faults in aircraft passenger reading light and attendant call control system
US4447233A (en) 1981-04-10 1984-05-08 Parker-Hannifin Corporation Medication infusion pump
US4439196A (en) 1982-03-18 1984-03-27 Merck & Co., Inc. Osmotic drug delivery system
US4625015A (en) 1982-08-23 1986-11-25 Scripps Clinic & Research Foundation Broad spectrum influenza antisera
ZA836080B (en) 1982-08-23 1984-04-25 Scripps Clinic Res Broad spectrum influenza antisera
US4447224A (en) 1982-09-20 1984-05-08 Infusaid Corporation Variable flow implantable infusion apparatus
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US4486194A (en) 1983-06-08 1984-12-04 James Ferrara Therapeutic device for administering medicaments through the skin
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
JP2518607B2 (ja) 1985-08-29 1996-07-24 雪印乳業株式会社 インフルエンザa型ウイルスha抗原に対するモノクロ―ナル抗体およびその作成方法
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
US6337070B1 (en) 1993-04-29 2002-01-08 Takara Shuzo Co., Ltd. Polypeptides for use in generating anti-human influenza virus antibodies
US5589174A (en) 1992-09-17 1996-12-31 Takara Shuzo Co., Ltd. Anti-human influenza virus antibody
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
JP2996864B2 (ja) 1994-03-30 2000-01-11 寳酒造株式会社 抗体可変領域dna
ES2245780T3 (es) 1994-05-18 2006-01-16 Nektar Therapeutics Metodos y composiciones para la formulacion de interferones como un polvo seco.
DE19643314A1 (de) 1996-10-21 1998-04-23 Boehringer Mannheim Gmbh Monoklonale Antikörper gegen das Epitop YPYDVPDYA, Verfahren zu deren Herstellung und Verwendung
FR2817869B1 (fr) 2000-12-07 2005-01-14 Technopharm Anticorps monoclonal humain dirige contre le virus influenza ou un fragment de celui-ci
US6723359B2 (en) 2001-10-18 2004-04-20 Firmenich Sa Spray-dried compositions and method for their preparation
WO2004029207A2 (en) 2002-09-27 2004-04-08 Xencor Inc. Optimized fc variants and methods for their generation
AU2004215133B2 (en) 2003-02-27 2010-10-14 Yeda Research And Development Co. Ltd. Nucleic acid molecules, polypeptides, antibodies and compositions containing same useful for treating and detecting influenza virus infection
US7566458B2 (en) 2003-06-16 2009-07-28 Medimmune, Llc Influenza hemagglutinin and neuraminidase variants
DK1692265T3 (da) 2003-11-04 2011-11-21 Univ Tulane Fremgangsmåde til hindring af en virus-celle-fusion ved hæmning af fusionsinitieringsområdets funktion i RNA-vira med klasse 1-membranfusogene envelopeproteiner
WO2005047327A2 (en) 2003-11-12 2005-05-26 Biogen Idec Ma Inc. NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO
WO2005063815A2 (en) 2003-11-12 2005-07-14 Biogen Idec Ma Inc. Fcϝ receptor-binding polypeptide variants and methods related thereto
US20060024670A1 (en) 2004-05-18 2006-02-02 Luke Catherine J Influenza virus vaccine composition and methods of use
CA2879182C (en) 2004-05-25 2017-02-14 Medimmune, Inc. Influenza hemagglutinin and neuraminidase variants
EP1828232A2 (en) 2004-12-22 2007-09-05 The Salk Institute For Biological Studies Compositions and methods for producing recombinant proteins
US7572620B2 (en) 2005-01-11 2009-08-11 Wisconsin Alumni Research Foundation H3 equine influenza A virus
EP1851238A4 (en) 2005-02-24 2008-12-31 Univ Massachusetts FLUID NUCLEIC ACIDS, POLYPEPTIDES AND USES THEREOF
US9084777B2 (en) * 2005-12-28 2015-07-21 Chugai Seiyaku Kabushiki Kaisha Stabilized antibody-containing formulations
CA2637837A1 (en) 2006-01-26 2007-08-09 Hx Diagnostics, Inc. Monoclonal antibodies binding to avian influenza virus subtype h5 haemagglutinin and uses thereof
US8222204B2 (en) 2006-05-03 2012-07-17 The Administrators of the Tulane Educational Fund and Autoimmune Technologies, LLC Influenza inhibiting compositions and methods
EP2024393A2 (en) 2006-05-15 2009-02-18 Sea Lane Biotechnologies,llc. Neutralizing antibodies to influenza viruses
JP2009540801A (ja) 2006-06-16 2009-11-26 ダウ・アグロサイエンス・エル・エル・シー トリインフルエンザ赤血球凝集素の新規なdna配列、ベクターおよびタンパク質
US20080241918A1 (en) 2006-08-14 2008-10-02 Ram Sasisekharan Hemagglutinin polypeptides, and reagents and methods relating thereto
US20090081193A1 (en) 2006-08-14 2009-03-26 Massachusetts Institute Of Technology Hemagglutinin polypeptides, and reagents and methods relating thereto
US20090269342A1 (en) 2006-08-14 2009-10-29 Massachusetts Institute Of Technology Hemagglutinin Polypeptides, and Reagents and Methods Relating Thereto
JP5161882B2 (ja) 2006-09-07 2013-03-13 クルセル ホランド ベー ヴェー インフルエンザウイルスh5n1を中和しうるヒト結合性分子およびその使用
US20100150941A1 (en) 2006-09-13 2010-06-17 Dso National Laboratories Hemagglutinin antibody and uses thereof
JP4625485B2 (ja) 2006-09-29 2011-02-02 財団法人大阪産業振興機構 高病原性トリインフルエンザウイルスに対するモノクローナル抗体
US8030029B2 (en) 2007-01-23 2011-10-04 Academia Sinica Flu vaccines and methods of use thereof
WO2008110937A2 (en) 2007-03-13 2008-09-18 Humabs Llc Antibodies against h5n1 strains of influenza a virus
BRPI0809435A2 (pt) 2007-03-27 2014-09-09 Sea Lane Biotechnologies, Llc Constructos e bibliotecas que compreendem sequências de cadeia leve substituida de anticorpos
JP5597128B2 (ja) 2007-05-11 2014-10-01 テマセック・ライフ・サイエンシズ・ラボラトリー・リミテッド H5トリインフルエンザの診断および監視に有用なh5亜型特異的結合タンパク質
MX2009012343A (es) 2007-05-14 2010-02-10 Biogen Idec Inc Regiones fc (sc fc) de cadena sencilla, polipeptidos de enlace que comprenden las mismas, y metodos relacionados con ello.
EP2716656B1 (en) 2007-06-15 2016-10-12 Xiamen University Monoclonal antibodies binding to avian influenza virus subtype H5 haemagglutinin and uses thereof
WO2008156763A2 (en) 2007-06-15 2008-12-24 The Board Of Trustees Of The Leland Stanford Junior University Human neutralizing monoclonal antibodies to h5n1 influenza a virus
SG183031A1 (en) 2007-09-13 2012-08-30 Temasek Life Sciences Lab Ltd Monoclonal antibodies specific to hemagglutinin and neuraminidase from influenza virus h5-subtype or n1-subtype and uses thereof
WO2009035412A1 (en) 2007-09-13 2009-03-19 Temasek Life Sciences Laboratory Limited Monoclonal antibodies specific to hemagglutinin from influenza virus h5-subtype and uses thereof
FR2921928B1 (fr) 2007-10-08 2011-03-04 Sanofi Pasteur Anticorps monoclonaux specifiques de l'hemagglutinine du virus grippal
EP2217064A4 (en) 2007-11-12 2012-10-03 Univ Pennsylvania NEW VACCINES FOR FIGHT AGAINST SEVERAL SUBTYPES OF INFLUENZA VIRUSES
WO2009073163A1 (en) 2007-12-03 2009-06-11 American Type Culture Collection (Atcc) Avian influenza antibodies, compositions, and methods thereof
EP3524619A1 (en) 2007-12-06 2019-08-14 Dana-Farber Cancer Institute, Inc. Antibodies against influenza virus and methods of use thereof
PE20091174A1 (es) * 2007-12-27 2009-08-03 Chugai Pharmaceutical Co Ltd Formulacion liquida con contenido de alta concentracion de anticuerpo
US7981428B2 (en) 2008-01-23 2011-07-19 Academia Sinica Flu vaccines and methods of use thereof
US8574830B2 (en) 2008-02-05 2013-11-05 Temasek Life Sciences Laboratory Limited Binding protein and epitope-blocking ELISA for the universal detection of H5-subtype influenza viruses
CA2717221C (en) 2008-03-12 2015-11-24 Xuguang Li (Sean) Reagents and methods for detecting influenza virus proteins
ITTO20080204A1 (it) 2008-03-17 2009-09-18 Pomona Biotechnologies Llc Anticorpi monoclonali atti a reagire con una pluralita di sottotipi del virus influenzale a
WO2009121004A2 (en) 2008-03-28 2009-10-01 Sea Lane Biotechnologies, Llc Neutralizing molecules to viral antigens
JP5586064B2 (ja) 2008-03-28 2014-09-10 国立大学法人北海道大学 抗h5亜型a型インフルエンザウイルスヘマグルチニンモノクローナル抗体
FI20080333A0 (fi) 2008-05-02 2008-05-02 Glykos Finland Oy Influenssaviruksen nukleiinihappoja ja peptidejä
ITTO20080398A1 (it) 2008-05-27 2009-11-28 Pomona Biotechnologies Llc Anticorpi monoclonali aventi proprieta' di cross-neutralizzazione omosubtipica per virus influenzali di tipo a sottotipo h1
AU2009254501B2 (en) 2008-06-05 2014-07-31 Ablynx N.V. Amino acid sequences directed against envelope proteins of a virus and polypeptides comprising the same for the treatment of viral diseases
WO2010006144A2 (en) 2008-07-11 2010-01-14 Medlmmune, Llc. Influenza hemagglutinin and neuraminidase variants
WO2010010467A2 (en) 2008-07-25 2010-01-28 Institute For Research In Biomedicine Neutralizing anti-influenza a virus antibodies and uses thereof
US8871207B2 (en) 2008-07-25 2014-10-28 Humabs, LLC Neutralizing anti-influenza A virus antibodies and uses thereof
US20120128684A1 (en) 2008-08-25 2012-05-24 Burnham Institute For Medical Research Conserved Hemagglutinin Epitope, Antibodies to the Epitope and Methods of Use
US20100061995A1 (en) 2008-09-08 2010-03-11 Damian Michael Carragher Immunotherapy To Treat Or Prevent Viral Infection
GB0818356D0 (en) 2008-10-07 2008-11-12 Istituto Superiore Di Sanito Antibodies
WO2010040281A1 (zh) 2008-10-09 2010-04-15 厦门大学 H5亚型禽流感病毒血凝蛋白的人源化抗体及其用途
BRPI0914092B1 (pt) 2008-10-22 2021-08-31 Institute For Research In Biomedicine Método de produção de um anticorpo a partir de células plasmáticas, método de produção de um anticorpo monoclonal a partir de células plasmáticas e método de produção de um anticorpo ou de um fragmento de anticorpo
WO2010074656A1 (en) 2008-12-24 2010-07-01 Temasek Life Sciences Laboratory Limited Monoclonal antibodies specific to the fusion peptide from hemagglutinin from influenza a viruses and uses thereof
JP5780762B2 (ja) 2008-12-25 2015-09-16 国立大学法人大阪大学 抗ヒトインフルエンザウイルス・ヒト型抗体
WO2010127252A2 (en) 2009-04-30 2010-11-04 Vanderbilt University Monoclonal antibodies to influenza h1n1 virus and uses thereof
AU2010247530B2 (en) 2009-05-11 2016-10-13 Janssen Vaccines & Prevention B.V. Human binding molecules capable of neutralizing influenza virus H3N2 and uses thereof
CN102482345A (zh) 2009-05-13 2012-05-30 航道生物技术有限责任公司 针对流感病毒的中和分子
IT1395961B1 (it) 2009-06-01 2012-11-02 Pomona Biotechnologies Llc Anticorpi monoclonali come medicamento per il trattamento terapeutico e/o profilattico delle infezioni da virus influenzale a (h1n1) di origine suina (s-oiv)
US9278998B2 (en) 2009-07-02 2016-03-08 Massachusetts Institute Of Technology Compositions and methods for diagnosing and/or treating influenza infection
US8784819B2 (en) 2009-09-29 2014-07-22 Ibio Inc. Influenza hemagglutinin antibodies, compositions and related methods
US9458226B2 (en) 2009-10-09 2016-10-04 Emory University Recombinant antibodies against H1N1 influenza
WO2011068143A1 (ja) 2009-12-03 2011-06-09 独立行政法人科学技術振興機構 H5亜型インフルエンザウイルスに対する抗体およびその利用
JP2013060367A (ja) 2010-01-15 2013-04-04 Osaka Univ 抗インフルエンザ抗体及びインフルエンザ検出用デバイス
AR080428A1 (es) * 2010-01-20 2012-04-11 Chugai Pharmaceutical Co Ltd Formulaciones liquidas estabilizadas contentivas de anticuerpos
WO2011094445A1 (en) 2010-01-27 2011-08-04 Massachusetts Institute Of Technology Engineered polypeptide agents for targeted broad spectrum influenza neutralization
JPWO2011093217A1 (ja) 2010-01-29 2013-06-06 富士レビオ株式会社 抗Pandemic(H1N1)2009抗体及びそれを用いた免疫測定方法
WO2011096302A1 (ja) 2010-02-02 2011-08-11 国立大学法人名古屋大学 薬剤耐性インフルエンザウイルス特異的抗体及びその用途
JP2011160681A (ja) 2010-02-05 2011-08-25 Japan Science & Technology Agency A型インフルエンザのヘマグルチニンに対する抗体およびその利用
WO2011111966A2 (en) 2010-03-08 2011-09-15 Celltrion, Inc. Human monoclonal antibodies derived from human b cells and having neutralizing activity against influenza a viruses
WO2011117848A1 (en) 2010-03-26 2011-09-29 Pomona Ricerca S.R.L. Full-length immunoglobulins of the igg isotvpe capable of recognizing a heterosubtvpe neutralizing epitope on the hemagglutinin stem region and their use as anti-influenza medicament
ES2687706T3 (es) 2010-06-17 2018-10-26 Trellis Bioscience, Llc Anticuerpos útiles en la inmunización pasiva contra la gripe
WO2012021786A2 (en) 2010-08-12 2012-02-16 Theraclone Sciences, Inc. Anti-hemagglutinin antibody compositions and methods of use thereof
US8992929B2 (en) 2010-08-23 2015-03-31 Temasek Life Sciences Laboratory Limited Monoclonal antibody specific to major neutralizing epitope of influenza H5 hemagglutinin
US9534042B2 (en) 2010-09-03 2017-01-03 Fujita Health University Influenza virus-neutralizing antibody and screening method therefor
WO2012040406A2 (en) 2010-09-21 2012-03-29 Massachusetts Institute Of Technology Influenza treatment and/or characterization; human-adapted ha polypeptides; vaccines
WO2012045001A2 (en) 2010-09-30 2012-04-05 Vanderbilt University Influenza virus antibodies and immunogens and uses therefor
BR112013007946B1 (pt) 2010-10-04 2022-07-12 Massachusetts Institute Of Technology Composições farmacêuticas e imunogênicas compreendendo polipeptídeos de hemaglutinina
US8900585B2 (en) 2010-10-20 2014-12-02 New York Blood Center, Inc. Influenza hemagglutinin-specific monoclonal antibodies for preventing and treating influenza virus infection
EP2646050B1 (en) 2010-12-02 2016-09-07 mAB-Factory GmbH Vaccine against influenza h5n1 viruses, medicament and treatment of h5n1 viral infections
AU2012205663B2 (en) 2011-01-10 2017-02-02 Emory University Antibodies directed against influenza
DK2731967T3 (en) 2011-07-14 2017-01-16 Janssen Vaccines & Prevention Bv HUMAN BINDING MOLECULES CAPABLE OF NEUTRALIZING INFLUENZA A VIRUS FROM PHYLOGENETIC GROUP 1 AND PHYLOGENETIC GROUP 2 AND INFLUENZA B VIRUS
HRP20190714T1 (hr) 2011-07-18 2019-06-14 Institute For Research In Biomedicine Neutralizirajuća protutijela anti-influenca a virusa i njihova uporaba
CN104114186B (zh) 2011-08-03 2017-05-03 儿童医疗中心有限公司 识别流行性感冒血凝素的受体‑结合袋状结构的广泛中和人类抗体
GB201115214D0 (en) 2011-09-02 2011-10-19 Health Prot Agency Influenza virus antibody compositions
WO2013044840A1 (zh) 2011-09-30 2013-04-04 中国科学院上海巴斯德研究所 高致病性禽流感的中和分子及其制备方法
MX350282B (es) 2011-09-30 2017-09-01 Celltrion Inc Molecula de union que tiene actividad neutralizadora del virus de la influenza a, producida a partir de celulas b humanas.
EP2768858B1 (en) 2011-10-18 2018-08-01 Emory University Antibodies directed against influenza
KR20130059721A (ko) 2011-11-29 2013-06-07 (주)셀트리온 인간 b 세포에서 생산된 인플루엔자 a 바이러스 중화 활성을 가지는 결합 분자
JP6325451B2 (ja) 2011-12-02 2018-05-16 アイム・セラピューティクス・べー・フェー A型インフルエンザに特異的な抗体
ES2686526T3 (es) 2011-12-05 2018-10-18 Trellis Bioscience, Llc Anticuerpos útiles en la inmunización pasiva contra la influenza
KR101749316B1 (ko) 2011-12-15 2017-06-21 (주) 에이프로젠 H1n1―감염된 환자들로부터 유도된 매우 잠재력 있는 넓은-스펙트럼 중화 단일클론 항체 및 이를 포함하는 바이러스의 치료용 조성물
WO2013114885A1 (en) 2012-01-31 2013-08-08 Osaka University Human monoclonal antibodies broadly protective against influenza b virus and methods of using the same
AU2013229488B2 (en) 2012-03-08 2017-12-07 Janssen Vaccines & Prevention B.V. Human binding molecules capable of binding to and neutralizing influenza B viruses and uses thereof
HK1207970A1 (en) 2012-05-10 2016-02-19 Massachusetts Institute Of Technology Agents for influenza neutralization
US9969794B2 (en) 2012-05-10 2018-05-15 Visterra, Inc. HA binding agents
US8613919B1 (en) * 2012-08-31 2013-12-24 Bayer Healthcare, Llc High concentration antibody and protein formulations
JP6518597B2 (ja) 2013-02-07 2019-05-22 マサチューセッツ インスティテュート オブ テクノロジー H5インフルエンザのヒトへの適応
EP3733244A1 (en) 2013-10-02 2020-11-04 Medlmmune, LLC Neutralizing anti-influenza a antibodies and uses thereof
RU2682049C2 (ru) 2014-01-27 2019-03-14 Дженентек, Инк. Лечение вируса гриппа а h7n9
PE20170261A1 (es) 2014-05-13 2017-04-12 Univ Pennsylvania Composiciones que comprenden virus adenoasociado (aav) que expresa constructos de anticuerpos duales y sus usos
TWI702229B (zh) 2014-12-19 2020-08-21 美商再生元醫藥公司 流行性感冒病毒血球凝集素之人類抗體
KR102668588B1 (ko) 2015-04-08 2024-05-22 다나-파버 캔서 인스티튜트 인크. 인간화된 인플루엔자 모노클로날 항체 및 그의 사용 방법
WO2017083627A1 (en) 2015-11-13 2017-05-18 Visterra, Inc. Compositions and methods for treating and preventing influenza
AU2016374416A1 (en) 2015-12-15 2018-06-14 Shionogi & Co., Ltd. Medicine for treating influenza characterized by comprising combination of cap-dependent endonuclease inhibitor with anti-influenza drug
CN109195629A (zh) 2016-02-24 2019-01-11 威特拉公司 流行性感冒抗体分子制剂
CN113924147A (zh) 2019-03-25 2022-01-11 威特拉公司 用于治疗和预防流感的组合物和方法
CN115551885A (zh) 2019-12-11 2022-12-30 威特拉公司 用于治疗和预防流感的组合物和方法

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0417191A1 (en) * 1988-05-27 1991-03-20 Centocor Inc Formulation for antibody reagents.
US20130280248A1 (en) * 2003-10-01 2013-10-24 Kyowa Hakko Kirin Co., Ltd. Method of stabilizing antibody and stabilized solution-type antibody preparation
US20140014858A1 (en) * 2012-07-12 2014-01-16 Rafael R. Gattass Wavelength and power scalable waveguiding-based infrared laser system

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9969794B2 (en) 2012-05-10 2018-05-15 Visterra, Inc. HA binding agents
US10800835B2 (en) 2012-05-10 2020-10-13 Visterra, Inc. HA binding agents
US12024552B2 (en) 2012-05-10 2024-07-02 Visterra, Inc. Ha binding agents
US20170137498A1 (en) * 2015-11-13 2017-05-18 Visterra, Inc. Compositions and methods for treating and preventing influenza
US10513553B2 (en) * 2015-11-13 2019-12-24 Visterra, Inc. Compositions and methods for treating and preventing influenza
US12202885B2 (en) 2016-02-24 2025-01-21 Visterra, Inc. Formulations of antibody molecules to influenza virus
US11634485B2 (en) 2019-02-18 2023-04-25 Eli Lilly And Company Therapeutic antibody formulation
US11230593B2 (en) 2019-03-25 2022-01-25 Visterra, Inc. Compositions and methods for treating and preventing influenza
CN116806155A (zh) * 2020-11-05 2023-09-26 布拉瓦多制药有限责任公司 用于针对病毒感染的粘膜保护的鼻内抗病毒疗法
CN116589569A (zh) * 2023-03-06 2023-08-15 中国农业科学院兰州兽医研究所 一种抗h7n9亚型流感病毒ha蛋白的纳米抗体及其噬菌体展示文库的构建方法和应用

Also Published As

Publication number Publication date
US20210054053A1 (en) 2021-02-25
JP2022110149A (ja) 2022-07-28
US20200181243A1 (en) 2020-06-11
JP2019512012A (ja) 2019-05-09
JP7104629B2 (ja) 2022-07-21
AU2024202246A1 (en) 2024-06-27
AU2017222564A1 (en) 2018-09-06
US12202885B2 (en) 2025-01-21
CN109195629A (zh) 2019-01-11
WO2017147248A1 (en) 2017-08-31
CA3015347A1 (en) 2017-08-31
EP3419663A1 (en) 2019-01-02

Similar Documents

Publication Publication Date Title
US12202885B2 (en) Formulations of antibody molecules to influenza virus
US12024552B2 (en) Ha binding agents
US11230593B2 (en) Compositions and methods for treating and preventing influenza
US20200231657A1 (en) Compositions and methods for treating and preventing influenza
AU2020403133A1 (en) Compositions and methods for treating and preventing influenza
HK40035221A (en) Novel ha binding agents
HK1208619B (en) Novel ha binding agents
BR112014028109B1 (pt) Novos agentes de ligação de ha

Legal Events

Date Code Title Description
AS Assignment

Owner name: VISTERRA, INC., MASSACHUSETTS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:SLOAN, SUSAN;XU, BI;SIGNING DATES FROM 20170222 TO 20170227;REEL/FRAME:041802/0294

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION