US20130337537A1 - Coagulation factor-targeting to tlt-1 on activated platelets - Google Patents
Coagulation factor-targeting to tlt-1 on activated platelets Download PDFInfo
- Publication number
- US20130337537A1 US20130337537A1 US13/982,360 US201213982360A US2013337537A1 US 20130337537 A1 US20130337537 A1 US 20130337537A1 US 201213982360 A US201213982360 A US 201213982360A US 2013337537 A1 US2013337537 A1 US 2013337537A1
- Authority
- US
- United States
- Prior art keywords
- seq
- amino acids
- sequence
- amino acid
- tlt
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 0 *CCOCCO* Chemical compound *CCOCCO* 0.000 description 5
- YSZUKWLZJXGOTF-UHFFFAOYSA-N CCC.CCC Chemical compound CCC.CCC YSZUKWLZJXGOTF-UHFFFAOYSA-N 0.000 description 4
- QLOINXWNEAAEFU-YWBLLMJRSA-M CSC1CC(=O)N(CCC(=O)NCCCOCCC(=O)NCC(=O)CC2C(O)CC(OP(=O)(O)OC[C@H]3O[C@@H](N4C=CC(N)=NC4=O)C(O)[C@H]3O)(C(=O)O[Na])OC2C(O)[C@H](O)CO)C1=O Chemical compound CSC1CC(=O)N(CCC(=O)NCCCOCCC(=O)NCC(=O)CC2C(O)CC(OP(=O)(O)OC[C@H]3O[C@@H](N4C=CC(N)=NC4=O)C(O)[C@H]3O)(C(=O)O[Na])OC2C(O)[C@H](O)CO)C1=O QLOINXWNEAAEFU-YWBLLMJRSA-M 0.000 description 3
- ATUOYWHBWRKTHZ-UHFFFAOYSA-N CCC Chemical compound CCC ATUOYWHBWRKTHZ-UHFFFAOYSA-N 0.000 description 2
- ZCKKTPOPGDJHQI-IFOQGASTSA-M NC1=NC(=O)N([C@@H]2O[C@H](COP(=O)(O)OC3(C(=O)O[Na])CC(O)C(CC(=O)CNC(=O)CCOCCCNC(=O)CCN4C(=O)C=CC4=O)C(C(O)[C@H](O)CO)O3)[C@H](O)C2O)C=C1 Chemical compound NC1=NC(=O)N([C@@H]2O[C@H](COP(=O)(O)OC3(C(=O)O[Na])CC(O)C(CC(=O)CNC(=O)CCOCCCNC(=O)CCN4C(=O)C=CC4=O)C(C(O)[C@H](O)CO)O3)[C@H](O)C2O)C=C1 ZCKKTPOPGDJHQI-IFOQGASTSA-M 0.000 description 2
- BRGITHZCLQMLSD-JMJYEDESSA-M CC(=O)C[C@@]1(O)C(C[C@H](O)CO)O[C@@](O[C@@H]2C(O)[C@H](O[C@@H]3C(CO)O[C@@H](OC4[C@@H](O)[C@H](O)C(CO)O[C@@H]4O[C@@H]4C(O)[C@H](O[C@@H]5C(CO)O[C@@H](O[C@@H]6C(CO[C@@H]7OC(C)[C@@H](O)[C@@H](O)C7O)O[C@H](N[C@@H](CC(N)=O)C(=O)F)C(NC(C)=O)[C@H]6O)C(NC(C)=O)[C@H]5O)OC(CO[C@H]5OC(CO)[C@@H](O)[C@H](O)C5O[C@@H]5OC(CO)[C@@H](O[C@@H]6OC(CO)[C@H](O)[C@H](O)C6O)[C@H](O)C5NC(C)=O)[C@H]4O)C(NC(C)=O)[C@H]3O)OC(CO)[C@@H]2O)(C(=O)O)C[C@H]1O.COC1C[C@@H]([C@@H](O)CC(=O)CNC(=O)CCOCCCNC(=O)CCN2C(=O)CC(SC)C2=O)C(C[C@H](O)CO)O[C@H]1C(=O)O.[V]I Chemical compound CC(=O)C[C@@]1(O)C(C[C@H](O)CO)O[C@@](O[C@@H]2C(O)[C@H](O[C@@H]3C(CO)O[C@@H](OC4[C@@H](O)[C@H](O)C(CO)O[C@@H]4O[C@@H]4C(O)[C@H](O[C@@H]5C(CO)O[C@@H](O[C@@H]6C(CO[C@@H]7OC(C)[C@@H](O)[C@@H](O)C7O)O[C@H](N[C@@H](CC(N)=O)C(=O)F)C(NC(C)=O)[C@H]6O)C(NC(C)=O)[C@H]5O)OC(CO[C@H]5OC(CO)[C@@H](O)[C@H](O)C5O[C@@H]5OC(CO)[C@@H](O[C@@H]6OC(CO)[C@H](O)[C@H](O)C6O)[C@H](O)C5NC(C)=O)[C@H]4O)C(NC(C)=O)[C@H]3O)OC(CO)[C@@H]2O)(C(=O)O)C[C@H]1O.COC1C[C@@H]([C@@H](O)CC(=O)CNC(=O)CCOCCCNC(=O)CCN2C(=O)CC(SC)C2=O)C(C[C@H](O)CO)O[C@H]1C(=O)O.[V]I BRGITHZCLQMLSD-JMJYEDESSA-M 0.000 description 1
- MVFVJVUXOMTFMF-SUMSJKIESA-M CC(=O)NC1[C@@H](C)OC(CO)[C@H](O)[C@@H]1O[C@@H]1OC(CO)[C@H](O)[C@H](O)C1O.CO[C@]1(C(=O)O[Na])C[C@@H](O)[C@@H](CC(=O)CNC(=O)CCOCCCNC(=O)CCN2C(=O)CC(SC)C2=O)C([C@H](O)[C@H](O)CO)O1 Chemical compound CC(=O)NC1[C@@H](C)OC(CO)[C@H](O)[C@@H]1O[C@@H]1OC(CO)[C@H](O)[C@H](O)C1O.CO[C@]1(C(=O)O[Na])C[C@@H](O)[C@@H](CC(=O)CNC(=O)CCOCCCNC(=O)CCN2C(=O)CC(SC)C2=O)C([C@H](O)[C@H](O)CO)O1 MVFVJVUXOMTFMF-SUMSJKIESA-M 0.000 description 1
- ZGOBVMIAMFVJQT-IKLRBZJSSA-N CC(=O)NC1[C@H](O[C@@H]2C(CO[C@@H]3OC(C)C(O)[C@H](O)C3O)O[C@H](N[C@@H](CC(N)=O)C(=O)F)C(NC(C)=O)[C@H]2O)OC(CO)[C@@H](O)[C@@H]1O.CSC1CC(=O)N(CCC(=O)NCCCOCCC(=O)NCC(=O)C[C@@H]2C(O)C[C@](O[C@@H]3C(O)[C@H](O[C@]4(O)C(CO)O[C@@H](C(CO)OC5[C@@H](O)[C@H](O)CO[C@@H]5OCC5O[C@@H](O)C(O)[C@@H](O[C@H]6OC(CO)[C@@H](O)[C@H](O)C6O[C@@H]6OC(CO)[C@@H](O[C@@H]7OC(CO)[C@H](O)[C@H](O[C@]8(C(=O)O)CC(O)[C@@H](CC(C)=O)C([C@H](O)[C@H](O)CO)O8)C7O)[C@H](O)C6NC(C)=O)[C@@H]5O)C(NC(C)=O)[C@H]4O)OC(CO)[C@@H]3O)(C(=O)O)OC2[C@H](O)[C@H](O)CO)C1=O.[V] Chemical compound CC(=O)NC1[C@H](O[C@@H]2C(CO[C@@H]3OC(C)C(O)[C@H](O)C3O)O[C@H](N[C@@H](CC(N)=O)C(=O)F)C(NC(C)=O)[C@H]2O)OC(CO)[C@@H](O)[C@@H]1O.CSC1CC(=O)N(CCC(=O)NCCCOCCC(=O)NCC(=O)C[C@@H]2C(O)C[C@](O[C@@H]3C(O)[C@H](O[C@]4(O)C(CO)O[C@@H](C(CO)OC5[C@@H](O)[C@H](O)CO[C@@H]5OCC5O[C@@H](O)C(O)[C@@H](O[C@H]6OC(CO)[C@@H](O)[C@H](O)C6O[C@@H]6OC(CO)[C@@H](O[C@@H]7OC(CO)[C@H](O)[C@H](O[C@]8(C(=O)O)CC(O)[C@@H](CC(C)=O)C([C@H](O)[C@H](O)CO)O8)C7O)[C@H](O)C6NC(C)=O)[C@@H]5O)C(NC(C)=O)[C@H]4O)OC(CO)[C@@H]3O)(C(=O)O)OC2[C@H](O)[C@H](O)CO)C1=O.[V] ZGOBVMIAMFVJQT-IKLRBZJSSA-N 0.000 description 1
- ALKSOWJXMMXSHK-IYTGGZMGSA-P CC(C)N=CC=NC(C)C.CCO/C(C#N)=N/O.O=C1C=CC2=C(C3=CC=CC=C3C(=O)N3CCN(C(=O)COCC(=O)NCCSSCCNC(=O)CCCC(=O)O)CC3)C3=C(C=C(O)C=C3)OC2=C1.O=C1C=CC2=C(C3=CC=CC=C3C(=O)N3CCN(C(=O)COCC(=O)O)CC3)C3=C(C=C(O)C=C3)OC2=C1.O=C1CCCC(=O)O1.[Cl-].[Cl-].[H][C@@]1([C@H](O)[C@H](O)CO)O[C@](OP(=O)(O)OCC2O[C@@H](N3C=CC(N)=NC3=O)[C@H](O)[C@@H]2O)(C(=O)O)C[C@H](O)C1NC(=O)CNC(=O)CCCC(=O)NCCSSNC(=O)COCC(=O)N1CCN(C(=O)C2=CC=CC=C2C2=C3C=CC(=O)C=C3OC3=C2C=CC(O)=C3)CC1.[NH3+]CCSSCC[NH3+] Chemical compound CC(C)N=CC=NC(C)C.CCO/C(C#N)=N/O.O=C1C=CC2=C(C3=CC=CC=C3C(=O)N3CCN(C(=O)COCC(=O)NCCSSCCNC(=O)CCCC(=O)O)CC3)C3=C(C=C(O)C=C3)OC2=C1.O=C1C=CC2=C(C3=CC=CC=C3C(=O)N3CCN(C(=O)COCC(=O)O)CC3)C3=C(C=C(O)C=C3)OC2=C1.O=C1CCCC(=O)O1.[Cl-].[Cl-].[H][C@@]1([C@H](O)[C@H](O)CO)O[C@](OP(=O)(O)OCC2O[C@@H](N3C=CC(N)=NC3=O)[C@H](O)[C@@H]2O)(C(=O)O)C[C@H](O)C1NC(=O)CNC(=O)CCCC(=O)NCCSSNC(=O)COCC(=O)N1CCN(C(=O)C2=CC=CC=C2C2=C3C=CC(=O)C=C3OC3=C2C=CC(O)=C3)CC1.[NH3+]CCSSCC[NH3+] ALKSOWJXMMXSHK-IYTGGZMGSA-P 0.000 description 1
- POLCUAVZOMRGSN-UHFFFAOYSA-N CCCOCCC Chemical compound CCCOCCC POLCUAVZOMRGSN-UHFFFAOYSA-N 0.000 description 1
- NOCDQHKUAZVJRE-UHFFFAOYSA-N CCSC1CC(=O)N(CCOCCOCCN2C(=O)CC(SCC(NC)C(N)=O)C2=O)C1=O Chemical compound CCSC1CC(=O)N(CCOCCOCCN2C(=O)CC(SCC(NC)C(N)=O)C2=O)C1=O NOCDQHKUAZVJRE-UHFFFAOYSA-N 0.000 description 1
- UPTYFRXYTSDUJK-UHFFFAOYSA-N CNC(CSC1CC(=O)N(CCOCCOCCN2C(=O)CC(SCC(NC)C(N)=O)C2=O)C1=O)C(N)=O Chemical compound CNC(CSC1CC(=O)N(CCOCCOCCN2C(=O)CC(SCC(NC)C(N)=O)C2=O)C1=O)C(N)=O UPTYFRXYTSDUJK-UHFFFAOYSA-N 0.000 description 1
- NRBMXLWHXTVYEK-WPNWSOFVSA-M NC1=NC(=O)N([C@@H]2O[C@H](COP(=O)(O)OC3(C(=O)O[Na])CC(O)C(CC(=O)CNC(=O)CCOCCCNC(=O)OCC4C5=C(C=CC=C5)C5=C4/C=C\C=C/5)C(C(O)[C@H](O)CO)O3)[C@H](O)C2O)C=C1 Chemical compound NC1=NC(=O)N([C@@H]2O[C@H](COP(=O)(O)OC3(C(=O)O[Na])CC(O)C(CC(=O)CNC(=O)CCOCCCNC(=O)OCC4C5=C(C=CC=C5)C5=C4/C=C\C=C/5)C(C(O)[C@H](O)CO)O3)[C@H](O)C2O)C=C1 NRBMXLWHXTVYEK-WPNWSOFVSA-M 0.000 description 1
- CJCCJYNCAJZCQK-YGJGGNQKSA-M NCCCOCCC(=O)NCC(=O)CC1C(O)CC(OP(=O)(O)OC[C@H]2O[C@@H](N3C=CC(N)=NC3=O)C(O)[C@H]2O)(C(=O)O[Na])OC1C(O)[C@H](O)CO Chemical compound NCCCOCCC(=O)NCC(=O)CC1C(O)CC(OP(=O)(O)OC[C@H]2O[C@@H](N3C=CC(N)=NC3=O)C(O)[C@H]2O)(C(=O)O[Na])OC1C(O)[C@H](O)CO CJCCJYNCAJZCQK-YGJGGNQKSA-M 0.000 description 1
- JKHVDAUOODACDU-UHFFFAOYSA-N O=C(CCN1C(=O)C=CC1=O)ON1C(=O)CCC1=O Chemical compound O=C(CCN1C(=O)C=CC1=O)ON1C(=O)CCC1=O JKHVDAUOODACDU-UHFFFAOYSA-N 0.000 description 1
- UNHBCPXGRWGMCW-UHFFFAOYSA-N O=C1C=CC2=C(C3=CC=CC=C3C(=O)N3CCN(C(=O)COCC(=O)O)CC3)C3=C(C=C(O)C=C3)OC2=C1.O=C1C=CC2=C(C3=CC=CC=C3C(=O)N3CCNCC3)C3=C(C=C(O)C=C3)OC2=C1.O=C1COCC(=O)O1.[H]Cl Chemical compound O=C1C=CC2=C(C3=CC=CC=C3C(=O)N3CCN(C(=O)COCC(=O)O)CC3)C3=C(C=C(O)C=C3)OC2=C1.O=C1C=CC2=C(C3=CC=CC=C3C(=O)N3CCNCC3)C3=C(C=C(O)C=C3)OC2=C1.O=C1COCC(=O)O1.[H]Cl UNHBCPXGRWGMCW-UHFFFAOYSA-N 0.000 description 1
- QYRXTVRPAJHFMV-ZLVPHQGUSA-N [H][C@@]1([C@H](O)[C@H](O)CO)O[C@@](OC2[C@@H](O)[C@@H](CO)O[C@@H](OC3[C@@H](NC(C)=O)[C@@H](C)O[C@H](CO)[C@@H]3O)[C@@H]2O)(C(=O)O)C[C@H](O)C1NC(=O)CNC(=O)CCCC(=O)NCCSC1CC(=O)N(CCOCCOCCN2C(=O)CC(C)C2=O)C1=O Chemical compound [H][C@@]1([C@H](O)[C@H](O)CO)O[C@@](OC2[C@@H](O)[C@@H](CO)O[C@@H](OC3[C@@H](NC(C)=O)[C@@H](C)O[C@H](CO)[C@@H]3O)[C@@H]2O)(C(=O)O)C[C@H](O)C1NC(=O)CNC(=O)CCCC(=O)NCCSC1CC(=O)N(CCOCCOCCN2C(=O)CC(C)C2=O)C1=O QYRXTVRPAJHFMV-ZLVPHQGUSA-N 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/48—Hydrolases (3) acting on peptide bonds (3.4)
- A61K38/482—Serine endopeptidases (3.4.21)
- A61K38/4846—Factor VII (3.4.21.21); Factor IX (3.4.21.22); Factor Xa (3.4.21.6); Factor XI (3.4.21.27); Factor XII (3.4.21.38)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/36—Blood coagulation or fibrinolysis factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6815—Enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4703—Inhibitors; Suppressors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/745—Blood coagulation or fibrinolysis factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
- C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
- C12N9/6424—Serine endopeptidases (3.4.21)
- C12N9/6437—Coagulation factor VIIa (3.4.21.21)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
- C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
- C12N9/6424—Serine endopeptidases (3.4.21)
- C12N9/644—Coagulation factor IXa (3.4.21.22)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/96—Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
- C12Y304/21021—Coagulation factor VIIa (3.4.21.21)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
- C12Y304/21022—Coagulation factor IXa (3.4.21.22)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2299/00—Coordinates from 3D structures of peptides, e.g. proteins or enzymes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
Definitions
- the current invention relates to procoagulant proteins, polynucleotides that encode procoagulant fusion proteins, cells that express procoagulant fusion proteins, a process for preparing procoagulant proteins and uses of said procoagulant proteins.
- GPIaIIa and GPVI bind collagen
- GPIcIIa binds fibronectin
- GPIcIIa binds laminin
- GPIb-V-IX binds von Willebrand Factor (vWF) polymers.
- GPIIbIIIa is an example of a platelet receptor present on the surface of both resting and activated platelets. GPIIbIIIa exists on resting platelets in a closed and inactive conformation and during platelet activation assumes an open and active conformation capable of binding its ligands, including fibrinogen and fibrin.
- TREM-like transcript 1 (Washington et al., Blood, 104, 1042-1047 (2004), Gattis et al., Journal of Biological Chemistry, 281, 13396-13403 (2006)) to which the present application relates.
- the blood coagulation cascade is initiated when tissue factor (TF) bearing cells in the subendothelium are exposed to components circulating in the blood. Exposure of TF to circulating coagulation factor VIIa (FVIIa) triggers the formation of small amounts of thrombin, which serves as a procoagulant signal leading to further recruitment and activation of platelets adhered to the site of injury. The coagulation is further propagated and amplified on the surface of the activated platelets, eventually leading to a burst of thrombin generation, which in turn lead to activation and polymerization of fibrinogen to fibrin fibers, cross-linking and stabilizing the haemostatic clot.
- TF tissue factor
- FVIIa circulating coagulation factor VIIa
- a feature attributed to several of the components of the coagulation cascade is their ability to specifically associate with the phospholipid membrane of activated platelets.
- FVIIa as well as e.g. coagulation factors IX and X (FIX and FX, respectively) and their corresponding activated forms (FVIIa, FIXa and FXa, respectively), possess a ⁇ -carboxyglutamic acid rich region (Gla domain) which enables them to be directed and bind to the surface of activated platelets.
- Coagulation factor VIII (FVIII) is associated with activated platelets by binding via its light chain.
- FXI coagulation factor XI
- their interactions with platelet membranes are of varying affinity.
- the binding constant (K D ) for FVIIa to the platelet surface is in the low micromolar range.
- Improved platelet binding and localisation of the coagulation factors to the activated platelet surface may enhance their activity. A means of doing so is thus desirable.
- a coagulopathy such as human beings with haemophilia A, B or C
- various steps of the coagulation cascade are rendered dysfunctional due to, for example, the absence or insufficient presence of a functional coagulation factor.
- Such dysfunction of one part of coagulation results in insufficient blood coagulation leading to spontaneous bleeds e.g. in joints and potentially life-threatening bleeding.
- An object of the current invention is to provide a compound that is suitable for use as a procoagulant drug in such subjects.
- a second object of the current invention is to provide procoagulant molecules that have increased activity, compared to the coagulation factors from which they derive.
- a third object of the current invention is to provide molecules that up-regulate blood coagulation in a physiologically suitable microenvironment.
- a fourth object of the current invention is to provide procoagulant molecules that have longer half lives than the coagulation factor from which they derive.
- a fifth object of the current invention is to provide procoagulant molecules that do not give rise to a drop in platelet count.
- a further object of the current invention is to direct a coagulation factor to the surface of activated platelets.
- One particular object of the invention is to enhance the generation of FIXa and/or FXa on the surface of the activated platelet.
- the object is to enable the initiation of blood coagulation on the surface of activated platelets that are located intravascularly or extravascularly.
- WO06/096828 discloses chimeric proteins that comprise soluble tissue factor (sTF) and a phosphatidyl serine (PS) binding domain, such as Annexin V. PS is exposed on the surface of activated cells, such as monocytes, endothelial cells and cells undergoing apoptosis, as well as on activated and resting platelets.
- the chimeric proteins are both pro-coagulant and anti-coagulant; the latter due to the fact that, in higher doses, constructs compete with coagulation factors in binding to PS on activated platelets.
- the chimeric proteins of WO06/096828 have a different set of properties than the procoagulant proteins described herein.
- the procoagulant proteins of the present invention are specifically targeted to activated platelets, present at sites of injury. Proteins of the present invention are based upon the identification of particular receptors and component epitopes that appear on platelet membranes when platelets are no longer resting but are activated or in the process of being activated. Thus, the invention relates to a method of enhancing coagulation on the surface of activated platelets.
- Procoagulant proteins of the invention comprise (i) at least one coagulation factor, covalently attached to (ii) an antibody or a fragment thereof that is capable of binding (iii) a receptor, and/or a fragment or variant thereof, which is exposed on the surface of activated platelets and is exposed to a lesser degree (and in some assays not detectably exposed) on the surface of resting platelets.
- TLT-1 is an example of such a receptor and procoagulant proteins may, for example, bind, to TLT-1 (16-162), TLT-1 (20-125) or TLT-1 (126-162).
- the coagulation factor may be a serine protease in the zymogen form, e.g., FVII, FIX or FX or the corresponding activated form FVIIa, FIXa, and FXa, or a derivative of a serine protease; FV or a derivative thereof, FVIII or a derivative thereof or FXI or a derivative thereof.
- Coagulation factor and antibody or antibody fragment are optionally joined by means of a linker.
- Procoagulant proteins of the invention may be fusion proteins or chemical conjugates. Hence, the invention also relates to their manufacture.
- One process for preparing a composition that comprises at least a procoagulant protein of the invention involves chemically conjugating (i), a TLT-1 antibody or fragment thereof, with one reactive group (RS1) of a linker and reacting (ii), the coagulation factor, with another reactive group (RS2) of said linker.
- RS1 reactive group of a linker
- RS2 reactive group of a linker
- said linker may be a polymer, such as polyethylene glycol (PEG).
- PEG polyethylene glycol
- the current invention also provides the following: an isolated nucleotide sequence that encodes any one of the procoagulant proteins according to the current invention; a vector that comprises an isolated nucleotide sequence that, in turn, encodes any one of the procoagulant proteins according to the current invention; an isolated cell that comprises a nucleotide sequence that encodes any one of the procoagulant proteins of the current invention.
- Said nucleotide sequence may, in turn, be expressed by an intracellular vector.
- Said isolated cell may be a eukaryotic cell, such as a mammalian cell, such as a BHK or a CHO or a HEK cell.
- the invention relates to a procoagulant protein for use as a medicament and for the treatment of a coagulopathy.
- a therapeutically effective amount of said protein is parenterally administered, such as intravenously or subcutaneously administered, to an individual in need thereof.
- Such individual in need may have any congenital, acquired and/or iatrogenic coagulopathy.
- FIG. 1 Human TLT-1 nucleotide and amino acid sequences.
- the nucleotide- and amino acid sequences representing hTLT-1 are shown.
- nucleotide sequence position 1-45 encode the predicted signal peptide
- the nucleotide sequence at position 46-486 encode the extracellular domain of hTLT-1
- the nucleotide sequence position 487-555 encode the transmembrane region
- the nucleotide sequence at position 556-933 encode the intracellular domain of hTLT-1.
- FIG. 2 Nucleotide and amino acid sequences representing the extracellular domain of human TLT-1 containing a C-terminal His-6 tag.
- the nucleotide- and amino acid sequences representing the extracellular domain of hTLT-1 with a C-terminal His tag are shown.
- the underlined sequence (7-15) indicates the positions of a kozak sequence
- the nucleotide sequence at position 16-60 encodes the predicted signal peptide
- the nucleotide sequence at position 61-501 encode the extracellular domain of hTLT-1
- the nucleotide sequence at position 502-519 encodes the 6 ⁇ His tag (in bold).
- the restriction enzyme sites HindIII (nucleotide sequence at position 1-6) and EcoRI (nucleotide sequence at position 523-528) are also shown and the stop codon is marked with an asterisk (520-522).
- FIG. 3A-D The variable domain of 0012LC and 0012HC including Kabat numbering: 3 A) The variable domain of 0012LC; 3 B) The variable domain of 0012LC Kabat numbering; 3 C) The variable domain of 0012HC; 3 D) The variable domain of 0012HC—Kabat numbering.
- the nucleotide sequence at position 1-57 encodes the LC signal peptide sequence; the nucleotide sequences at position 58-396 encodes the variable domain of 0012LC.
- FIG. 3B the sequences in bold and grey represent positions of the 0012LC CDRs according to Kabat numbering.
- nucleotide sequence at position 1-54 encodes the 0012HC signal peptide
- nucleotide sequence at position 55-396 encodes the variable domain of 0012HC.
- sequences in bold and grey represent positions of the 0012HC CDRs according to Kabat numbering.
- FIG. 4 The variable domain of 0012LC together with constant region of human LC,kappa and a HPC4 tag (encoded by pTT-0012LC.HPC4).
- the nucleotide sequences at position 1-57 encodes the LC signal peptide
- the nucleotide sequence 58-396 encodes the variable domain of 0012LC
- the nucleotide sequence 397-714 encodes the constant region of human 0012LC
- kappa the nucleotide sequence 715-750 encodes a HPC4 tag.
- FIG. 5 The variable domain of 0012HC together with the constant region of human IgG4 (pTT-0012HC).
- the nucleotide sequence 1-54 encodes the HC signal peptide
- the nucleotide sequence 55-396 encodes the variable domain of 0012HC
- the nucleotide sequence 397-1377 encodes the constant region of human IgG4 (in bold).
- FIG. 6 Sequence coverage of HX analyzed peptides of TLT-1 in the presence and absence of mAb0023.
- the primary sequence of hTLT-1 is displayed above the HX analyzed peptides (shown as horizontal bars).
- Peptides showing similar exchange patterns both in the presence and absence of 0023 are displayed in white whereas peptides showing reduced deuterium incorporation upon 0023 binding are coloured black.
- FIG. 7 Sequence coverage of HX analyzed peptides of TLT-1 in the presence and absence of mAb0051.
- the primary sequence of hTLT-1 is displayed above the HX analyzed peptides (shown as horizontal bars).
- Peptides showing similar exchange patterns both in the presence and absence of 0051 are displayed in white whereas peptides showing reduced deuterium incorporation upon 0051 binding are coloured black.
- FIG. 8 Sequence coverage of HX analyzed peptides of TLT-1 in the presence and absence of mAb0062.
- the primary sequence of hTLT-1 is displayed above the HX analyzed peptides (shown as horizontal bars).
- Peptides showing similar exchange patterns both in the presence and absence of 0062 are displayed in white whereas peptides showing reduced deuterium incorporation upon 0062 binding are coloured black.
- FIG. 9 Sequence coverage of HX analyzed peptides of TLT-1 in the presence and absence of mAb0061 (mAb0012).
- the primary sequence of hTLT-1 is displayed above the HX analyzed peptides (shown as horizontal bars).
- Peptides showing similar exchange patterns both in the presence and absence of 0061 are displayed in white whereas peptides showing reduced deuterium incorporation upon 0061 binding are coloured black.
- FIG. 10 Sequence coverage of HX analyzed peptides of TLT-1 region 126-162. The primary sequence of hTLT-1 is displayed above the HX analyzed peptides (shown as horizontal bars). All peptides showed reduced deuterium incorporation upon mAb0061 (mAb0012) binding.
- FIG. 11A Effect of FVIIa-Fab1029 on TF-induced fibrin clot formation in human whole blood (HWB) from a normal donor measured by thromb-elastography (TEG). Clot formation in re-calcified HWB (curve HWB) is induced by 0.03 pM TF (Innovin®). The curve “Hemophilia” shows the delayed and inadequate clot formation when HWB is supplemented with 10 ⁇ g/ml anti-FVIII antibody.
- FIG. 11B Effect of FVIIa-Fab1029 on TF-induced fibrin clot formation in human whole blood (HWB) from a normal donor measured by thromb-elastography (TEG). R-time determined from the TEG traces of the experiment shown in FIG. 11A .
- HWB Citrated-stabilized human whole blood
- HWB Hemophilia-like conditions are obtained by incubation of HWB with 10 ⁇ g/ml anti-FVIII antibody (Sheep anti-Human Factor VIII; Hematologic Technologies Inc) for 30 min at room temp. Clot formation is measured by thrombelastography (5000 series TEG analyzer, Haemoscope Corporation, Niles, Ill., USA).
- concentrations (0; 0.25; 0.5; 1.0 nM) of FVIIa-Fab1029 or rFVIIa are added to hemophilia-like citrated HWB.
- Clotting is initiated when 340 ⁇ l of normal or hemophilia-like HWB is transferred to a thrombelastograph cup containing 20 ⁇ l 0.2 M CaCl 2 with 0.03 pM lipidated TF (Innovin®, Dade Behring GmbH (Marburg, Germany). The TEG trace is followed continuously for up to 120 min. The following TEG variables are recorded: R time (clotting time i.e.
- ⁇ -angle clot development measured as the angle between the R value and the inflection point of the TEG trace
- MA maximal amplitude of the TEG trace reflecting the maximal mechanical strength of the clot
- FIG. 12 Effect of FIX-Fab0135 on TF-induced fibrin clot formation in human whole blood (HWB) from a normal donor measured by thromb-elastography (TEG).
- HWB human whole blood
- TEG thromb-elastography
- Clot formation in re-calcified HWB (curve HWB) is induced by 0.03 pM TF (Innovin®).
- the curve “Hemophilia” shows the delayed and inadequate clot formation when HWB is supplemented with 10 ⁇ g/ml anti-FVIII antibody.
- Other curves show TEG traces obtained when the hemophilia A-like condition induced by the FVIII antibody is reverted by various concentrations (0.1; 0.2; 1.0; 5.0; 10 nM) of FIX-Fab0135.
- TEG curves obtained when FIX fusion protein is replaced by 1 nM rFVIIa or 10 nM rFIX are shown for
- FIG. 13 FIX-Fab0135 targeted to TLT-1 enriched phospholipid vesiches markedly promotes FX activation induced by FVIIa in absence of FVIII.
- Various concentrations (0.05-100 nM) of rFVIIa are incubated for 15 min in Hepes buffer ( ⁇ ) or in Hepes buffer containing 10 nM FIX ( ⁇ ); 10 nM FIXa ( ⁇ ) or 10 nM FIX-Fab0135 ( ⁇ ). This is then mixed and incubated for 3 min with 100 nM FX and TLT-1 enriched phospholipid vesicles at 1:4,000 dilution in absence or presence of 5 nM FVIII as indicated. The reaction is stopped with EDTA, and FXa generation is measured in a chromogenic assay.
- FIG. 14 TLT-1 expression on human platelets.
- the figure shows the TLT-1 number on platelets in whole blood gated on forward and side scatter in flow cytometry analysis.
- the mean fluorescence within the platelet gate was used to calculate the TLT-1 number using a standard curve obtained from beads with a definite number of binding sites for the detecting antibody.
- the platelets were activated with protease activated receptor-1 activating peptide SFLLRN (0.3-30 ⁇ M).
- protease activated receptor-1 activating peptide SFLLRN 0.3-30 ⁇ M.
- SFLLRN 30 ⁇ M
- Convulxin (Cvlxn) 100 ng/ml
- TLT-1 expression was measured by two different anti-TLT-1 antibodies mAb0136; left bar graph and mAb0123; right bar graph. Data are presented as mean ⁇ sem with the number of blood donors ranging from 2 to 4 in the different groups.
- FIG. 15 FVIIa-Fab9015 dose-dependently reduced bleeding time (left) and blood loss (right) in TLT-1 KOKI mice with antibody induced haemopilia compared to haemopilic mice receiving vehicle.
- a dose of 20 nmol/kg FVIIa-Fab9015 was significantly more effective compared to 20 nmol/kg rFVIIa.
- FIG. 16 Platelet counts in transient haemophilic TLT-1 KOKI mice dosed with FVIIa-Fab9015 (20 or 4 nmol/kg), rFVIIa (20 nmol/kg) or vehicle. The mice were dosed at ⁇ 5 min, bleeding was observed from 0 to 30 min, and platelet counts were observed for 120 min after induction of bleeding.
- FIG. 17A The bar-graph show peak amount thrombin generated by 25 nM of either rFVIIa (unfilled bar) or FVIIa-Fab9015 (filled bar).
- the thrombin generation was measured under induced haemophilia A conditions (sheep anti-human FVIII polyclonal antibodies) with a fixed platelet concentration of 150000 plts/ ⁇ l.
- the reaction was started with platelet activation through the addition of PAR-1 activating peptide SFLLRN (30 ⁇ M) and the GPIV agonist Convulxin (100 ng/ml).
- FIG. 17B The bar-graph show peak amount thrombin generated by 5 nM of either rFVIIa (unfilled bar) or FVIIa-Fab9015 (filled bar).
- the thrombin generation was measured under haemophilia A conditions with a fixed platelet concentration of 150000 plts/ ⁇ l.
- the reaction was started with platelet activation through the addition of PAR-1 activating peptide SFLLRN (30 ⁇ M) and the GPIV agonist Convulxin (100 ng/ml).
- FIG. 18 The figure shows that the effect of FVIIa-Fab9015 was dependent on platelet activation.
- 25 nM FVIIa-Fab9015 was added to human platelet rich plasma (150000 plts/ ⁇ l) made haemophilia A like though addition of sheep anti-human FVIII antibodies.
- Samples with unactivated platelets show poor thrombin generation (dotted line), PAR-1 activating peptide SFLLRN (10 ⁇ M) gives some increase in thrombin generation (broken line) and platelets activated with both SFLLRN (30 ⁇ M) and the GPVI agonist Convulxin (100 ng/ml) gives the largest thrombin generation (solid line).
- FIG. 19 The figure shows that the increase in thrombin generation with FVIIa-Fab9015 compared to rFVIIa was TLT-1 dependent.
- the original traces show thrombin generation in human platelet rich plasma (150000 plts/ ⁇ l) made haemophilc A like through the addition of sheep anti-human FVIII polyclonal antibodies.
- Thrombin generation was started by the addition of PAR-1 activating peptide SFLLRN (30 ⁇ M) and GPVI agonist Convulxin (100 ng/ml).
- FVIIa-Fab9015 solid line
- rFVIIa 5 dotted line
- FIG. 20 The figure shows that the increase in thrombin generation with FIX-Fab0155 compared to rFIX was TLT-1 dependent.
- the original traces show thrombin generation in FIX deficient plasma containing human platelets (150000 plts/ ⁇ l).
- Thrombin generation was started by the addition of PAR-1 activating peptide SFLLRN (30 ⁇ M) and GPVI agonist Convulxin (100 ng/ml).
- 1 nM FIX-Fab0155 solid line gives a significant larger thrombin peak than rFIX (grey line).
- Pre-incubation of soluble TLT-1 (100 nM) significantly reduced the thrombin generation capacity of FIX-Fab0155 (broken line) confirming TLT-1 dependency.
- FIG. 21 Autoactivation of FVII-Fab5001 fusion protein in the presence of soluble Tissue Factor (sTF). Proteolytic activity was measured in the presence of phospholipids (PC:PS) and sTF. Results are averages of two independent measurements and given in relative k cat /K m values compared to wtFVIIa.
- sTF soluble Tissue Factor
- FIG. 22A None of the TLT-1 antibodies (mAb0023, mAb0051, mAb0061, mAb0062) affect platelet aggregation.
- the figure shows original traces from light transmission measurements in platelet rich plasma where the platelets have been activated with SFLLRN (1 ⁇ M). The samples were pre-incubated with anti-TLT-1 antibody or irrelevant control antibody (10 nM) 3 min before platelet activation.
- FIG. 22B None of the TLT-1 antibodies (mAb0023, mAb0051, mAb0061, mAb0062) affects platelet aggregation.
- the figure shows original traces from light transmission measurements in platelet rich plasma in which the platelets have been activated with SFLLRN (10 ⁇ M). The samples have been pre-incubated with anti-TLT-1 antibody or irrelevant control antibody (10 nM) 3 min before platelet activation
- FIG. 23 Effect of FIX-mAb0145 on TF-induced fibrin clot formation in human whole blood (HWB) from a normal donor measured by thromb-elastography (TEG). The R time obtained from TEG traces with normal HWB and “hemophilia” blood supplemented with various concentrations of FIX-mAb0145 or rFIX are shown.
- FIG. 24 The bar-graph show peak amount thrombin generated by 25 nM of the FVIIa-Fab9015, FVIIa-Fab1029 and FVIIa-Fab1001. All three constructs showed increased potency compared to rFVIIa (25 nM).
- the thrombin generation was measured under induced haemophilia A conditions (sheep anti-human FVIII polyclonal antibodies) with a fixed platelet concentration of 150000 plts/ ⁇ l.
- the reaction was started with platelet activation through the addition of PAR-1 activating peptide SFLLRN (30 ⁇ M) and the GPIV agonist Convulxin (100 ng/ml).
- FIG. 25 The figure shows that increased potency of the FVIIa-Fab5001 compared to wild-type rFVIIa.
- the original traces show thrombin generation in factor VIII deficient plasma containing washed human platelets (150000 plts/ ⁇ l).
- thrombin generation was started by the addition of the PAR-1 activating peptide SFLLRN (30 ⁇ M) and the GPVI agonist Convulxin (100 ng/ml).
- FVIIa-Fab5001 25 nM
- solid line gives approximately a four fold larger thrombin peak than wild-type rFVIIa (25 nM) (dotted line).
- There was no enhancement of the potency with unactivated platelets (broken line).
- SEQ ID NO: 1 provides the nucleotide sequence of human (h)TLT-1.
- SEQ ID NO: 2 provides the amino acid sequence of hTLT-1.
- SEQ ID NO: 3 provides the nucleotide sequence of the extracellular domain of hTLT-1-His6.
- SEQ ID NO: 4 provides the amino acid sequence of the extracellular domain of hTLT-1-His6.
- SEQ ID NOs: 5 to 8 provide the amino acid sequences of hTLT-1 fragments: hTLT-1.20-125, hTLT-1.16-162, hTLT-1.126-162 and hTLT-1.129-142.
- SEQ ID NO: 9 provides the nucleotide sequence of the variable domain of mAb 0012 LC.
- SEQ ID NO: 10 provides the amino acid sequence of the variable domain of mAb0012 LC.
- SEQ ID NO: 11 provides the nucleotide sequence of the variable domain of 0012 HC.
- SEQ ID NO: 12 provides the amino acid sequence of the variable domain of 0012 HC.
- SEQ ID NO: 13 provides the nucleotide sequence of the heavy chain of mAb0012.
- SEQ ID NO: 14 provides the nucleotide sequence of the light chain of mAb0012 and Fab0012.
- SEQ ID NO: 15 provides the nucleotide sequence of the heavy chain of mAb0023.
- SEQ ID NO: 16 provides the nucleotide sequence of the light chain of mAb0023 and Fab0023.
- SEQ ID NO: 17 provides the nucleotide sequence of the heavy chain of mAb0051.
- SEQ ID NO: 18 provides the nucleotide sequence of the light chain of mAb0051 and Fab0051.
- SEQ ID NO: 19 provides the nucleotide sequence of the heavy chain of mAb0052.
- SEQ ID NO: 20 provides the nucleotide sequence of the heavy chain of mAb0062.
- SEQ ID NO: 21 provides the nucleotide sequence of the light chain of mAb0052, Fab0052 and mAb0062.
- SEQ ID NO: 22 provides the nucleotide sequence of the heavy chain of mAb0061.
- SEQ ID NO: 23 provides the nucleotide sequence of the heavy chain of mAb0082.
- SEQ ID NO: 24 provides the nucleotide sequence of the light chain of mAb0061, Fab0061, mAb0082 and Fab0082.
- SEQ ID NO: 25 provides the nucleotide sequence of Fab0012 VH-CH1.
- SEQ ID NO: 26 provides the nucleotide sequence of Fab0023 VH-CH1.
- SEQ ID NO: 27 provides the nucleotide sequence of Fab0051 VH-CH1.
- SEQ ID NO: 28 provides the nucleotide sequence of Fab0052 VH-CH1.
- SEQ ID NO: 29 provides the nucleotide sequence of Fab0061 VH-CH1.
- SEQ ID NO: 30 provides the nucleotide sequence of Fab0082 VH-CH1.
- SEQ ID NO: 31 provides the nucleotide sequence of hIgG4 hinge-CH2-CH3.
- SEQ ID NO: 32 provides the amino acid sequence of mAb0012, HC (mouse VH-human IgG4 CH1-CH2-CH3).
- SEQ ID NO: 33 provides the amino acid sequence of mAb0012, LC (mouse VL-human Kappa CL) and Fab0012, LC (mouse VL-human Kappa CL).
- SEQ ID NO: 34 provides the amino acid sequence of mAb0023, HC (mouse VH-human IgG4 CH1-CH2-CH3).
- SEQ ID NO: 35 provides the amino acid sequence of mAb0023, LC (mouse VL-human Kappa CL) and Fab0023, LC (mouse VL-human Kappa CL).
- SEQ ID NO: 36 provides the amino acid sequence of mAb0051, HC (mouse VH-human IgG4 CH1-CH2-CH3).
- SEQ ID NO: 37 provides the amino acid sequence of mAb0051, LC (mouse VL-human Kappa CL) and Fab0051, LC (mouse VL-human Kappa CL).
- SEQ ID NO: 38 provides the amino acid sequence of mAb0052, HC (mouse VH-human IgG4 CH1-CH2-CH3).
- SEQ ID NO: 39 provides the amino acid sequence of mAb0052, LC (mouse VL-human Kappa CL); Fab0052, LC (mouse VL-human Kappa CL); mAb0062, LC (mouse VL-human Kappa CL).
- SEQ ID NO: 40 provides the amino acid sequence of mAb0061, HC (mouse VH-human IgG4 CH1-CH2-CH3).
- SEQ ID NO: 41 provides the amino acid sequence of mAb0061, LC (mouse VL-human Kappa CL); Fab0061, LC (mouse VL-human Kappa CL) and mAb0082, LC (mouse VL-human Kappa CL); Fab0082, LC (mouse VL-human Kappa CL).
- SEQ ID NO: 42 provides the amino acid sequence of mAb0062, HC (mouse VH-human IgG4 CH1-CH2-CH3).
- SEQ ID NO: 43 provides the amino acid sequence of mAb0082, HC (mouse VH-human IgG4 CH1-CH2-CH3).
- SEQ ID NO: 44 provides the amino acid sequence of Fab0012, mouse VH-human IgG4 CH1.
- SEQ ID NO: 45 provides the amino acid sequence of Fab0023, mouse VH-human IgG4 CH1.
- SEQ ID NO: 46 provides the amino acid sequence of Fab0051, mouse VH-human IgG4 CH1.
- SEQ ID NO: 47 provides the amino acid sequence of Fab0052, mouse VH-human IgG4 CH1.
- SEQ ID NO: 48 provides the amino acid sequence of Fab0082, mouse VH-human IgG4 CH1.
- SEQ ID NOs: 49-58 provide the amino acid sequences of optional linkers L2-L10. Optional linkers are numbered and listed in Table 3.
- SEQ ID NO: 59 provides the amino acid sequence of purification tag HPC4.
- SEQ ID Nos: 60-145 provide the nucleic acid sequences of the primers used during the development of the expression constructs described in examples 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 17, 18, 19, 20, 24, 25.
- SEQ ID NO: 146 provides the amino acid sequence of Fab0061 VH-CH1.
- SEQ ID NO: 147 provides the amino acid sequence of hIgG4-hinge-CH2-CH3.
- SEQ ID NO: 148 provides the amino acid sequence of a His6 tag.
- SEQ ID NO: 149 provides the amino acid sequence of hTLT-1.18-188.
- SEQ ID NO: 150 provides the nucleic acid sequence of primer no. 1004.
- SEQ ID NO: 151 provides the nucleic acid sequence of primer no. 1005.
- SEQ ID NO: 152 provides the amino acid sequence of Fab0100 HC.
- SEQ ID NO: 153 provides the amino acid sequence of Fab0100 LC.
- SEQ ID NO: 154 provides the nucleic acid sequence of wild type human Factor FV.
- SEQ ID NO: 155 provides the amino acid sequence of wild type human Factor FV.
- SEQ ID NO: 156 provides the nucleic acid sequence of wild type human Factor FVII.
- SEQ ID NO: 157 provides the amino acid sequence of wild type human Factor FVII.
- SEQ ID NO: 158 provides the nucleic acid sequence of wild type human Factor FVIII.
- SEQ ID NO: 159 provides the amino acid sequence of wild type human Factor FVIII.
- SEQ ID NO: 160 provides the nucleic acid sequence of wild type human Factor FIX.
- SEQ ID NO: 161 provides the amino acid sequence of wild type human Factor FIX.
- SEQ ID NO: 162 provides the nucleic acid sequence of wild type human Factor FX.
- SEQ ID NO: 163 provides the amino acid sequence of wild type human Factor FX.
- SEQ ID NO: 164 provides the nucleic acid sequence of wild type human Factor FXI.
- SEQ ID NO: 165 provides the amino acid sequence of wild type human Factor FXI.
- SEQ ID NO: 166 provides the 0012LC.C36A-HPC4 DNA sequence.
- SEQ ID NO: 167 provides the 0012LC.C36A-HPC4 amino acid sequence.
- SEQ ID NO: 168 provides the 0012VH-CH1-HPC4 DNA sequence.
- SEQ ID NO: 169 provides the 0012VH-CH1-HPC4 amino acid sequence.
- SEQ ID NO: 170 provides the 0012VH.T60N-CH1-YGPPC DNA sequence.
- SEQ ID NO: 171 provides the 0012VH.T60N-CH1-YGPPC.
- SEQ ID NO: 172 provides the FIX-L4b-0012LC DNA sequence.
- SEQ ID NO: 173 provides the FIX-L4b-0012LC amino acid sequence.
- SEQ ID NO: 174 provides the amino acid sequence of 0003 Fab-LC: 0062Fab-LC-HPC4.
- SEQ ID NO: 175 provides the amino acid sequence of 0003 Fab-HC: 0062Fab-VH-CH1-YGPPC.
- SEQ ID NO: 176 provides the amino acid sequence of 0197-0000-0074 Fab-HC: 0197-0000-0051 Fab-VH-CH1-YGPPC.
- SEQ ID NO: 177 provides the amino acid sequence of 0074 Fab-LC: 0051Fab-LC-HPC4.
- SEQ ID NO: 178 provides the amino acid sequence of 0004 Fab-HC: 0023Fab-VH-CH 1-YGPPC.
- SEQ ID NO: 179 provides the amino acid sequence of 0004Fab-LC: 0023Fab-LC-HPC4.
- SEQ ID NO: 180 provides the amino acid sequence of human FVII-L4b-0062VH-CH1-HPC4.
- SEQ ID NO: 181 provides the amino acid sequence of human FVII 407C.
- SEQ ID NO: 182 provides the amino acid sequence of human FIX-L4b-0061LC.
- Procoagulant proteins of the current invention comprise at least one coagulation factor, or functional variant thereof, and an antibody, or a fragment thereof, that is capable of binding to a receptor that is only present (in the ubiquitous sense of the word) on a platelet undergoing the morphological and functional changes associated with activation or an activated platelet.
- a receptor that is only present (in the ubiquitous sense of the word) on a platelet undergoing the morphological and functional changes associated with activation or an activated platelet.
- receptors might originate from the alpha- or dense granules of resting platelets, one particular example of such a receptor is TREM-like transcript 1 (TLT-1).
- the procoagulant molecules may be fusion proteins.
- fusion protein herein refers to proteins that are created through the in-frame joining of two or more DNA sequences, which originally encode separate proteins or peptides, or fragments thereof. Translation of the fusion protein DNA sequence will result in a single protein sequence, which may have functional properties derived from each of the original proteins or peptides.
- DNA sequences encoding fusion proteins may be created artificially by standard molecular biology methods such as overlapping PCR or DNA ligation and the assembly is performed excluding the stop codon in the first 5′-end DNA sequence while retaining the stop codon in the 3′ end DNA sequence.
- the resulting fusion protein DNA sequence may be inserted into an appropriate expression vector that supports the heterologous fusion protein expression in standard host organisms such as bacteria, yeast, fungus, insect cells or mammalian cells.
- Fusion proteins may contain a linker or spacer peptide sequence that separates the protein or peptide parts which define the fusion protein.
- the linker or spacer peptide sequence may facilitate the correct folding of the individual protein or peptide parts and may make it more likely for the individual protein or peptide parts to retain their individual functional properties.
- Linker or spacer peptide sequences may be inserted into fusion protein DNA sequences during the in-frame assembly of the individual DNA fragments that make up the complete fusion protein DNA sequence, i.e., during overlapping PCR or DNA ligation.
- the procoagulant proteins of the invention may be conjugates of their constituent coagulation factor and antibody counterparts, such that coagulation factor and antibody are manufactured independently of one another and, thereafter, joined synthetically.
- TLT-1 TREM-like transcript 1
- TREMs Triggering receptors expressed on myeloid cells
- TLT-1 belongs to the same family of proteins, though the TLT-1 gene is expressed only in a single lineage, namely megakaryocytes and thrombocytes (platelets) and is exclusively found in the alpha-granules of megakaryocytes and platelets.
- TLT-1 is a transmembrane protein that is exposed on the surface of activated platelets upon alpha-granule release. To date, TLT-1 has not been found on the surface of resting platelets or on the surface of any other cell types.
- TLT-1 The extracellular portion of TLT-1 is known to be composed of a single, immunoglobulin-like (Ig-like) domain connected to the platelet cell membrane by a linker region called the stalk (Gattis et al., Jour Biol Chem, 2006, Vol. 281, No. 19, pp. 13396-13403).
- the Ig-like domain of human TLT-1 (hTLT-1) is composed of 105 residues and is attached to the membrane by the 37-amino acid stalk.
- the Ig-like domain of TLT-1 is expected to have considerable freedom of movement.
- TLT-1 The putative transmembrane segment of hTLT-1 is 20 amino acids long. TLT-1 also has a cytoplasmic Immune-receptor Tyrosine-based Inhibitory-Motif (ITIM), which may function as an intracellular signal transduction motif.
- ITIM cytoplasmic Immune-receptor Tyrosine-based Inhibitory-Motif
- TLT-1 The role of TLT-1 in platelet biology has not yet been fully elucidated; it has been shown that TLT-1 binds fibrinogen and it is believed that TLT-1 plays a role in regulating coagulation and inflammation at the site of an injury.
- a soluble form of TLT-1 containing the Ig-like domain has been reported (Gattis et al., Jour Biol Chem, 2006, Vol. 281, No. 19, pp. 13396-13403). The specific functions of soluble versus platelet-bound TLT-1 remain to be established.
- Giomerarelli at al. Thrombosis and Haemostasis (2007) 97, 955-963 reported the generation of anti-TLT-1 scFv molecules using phage display techniques. Some of the anti-TLT-1 scFv molecules were found to inhibit thrombin-mediated human platelet aggregation. Thus, anti-TLT-1 scFc molecules with such features may have anti-thrombotic properties, similar to anti-GPIIb/IIIa scFv molecules described by Schwartz et al. (FASEB Journal, (2004), 18, 1704-1706).
- the present invention relates to fusions proteins or conjugates comprising a coagulation factor attached to an anti-TLT-1 antibody, or antigen binding fragments thereof, including scFv.
- the anti-TLT-1 antibody or fragments thereof serve to target the linked clotting factor to the surface of activated platelets by binding to TLT-1 with the purpose of delivering a procoagulant activity at the activated platelet surface.
- inhibition of platelet aggregation is not a desirable property of the anti-TLT-1 antibody.
- anti-TLT-1 antibodies of the current invention are preferably not interfering with functions of TLT-1, and in particular do not inhibit platelet aggregation.
- a receptor such as TLT-1 comprises epitopes that are useful targets for the procoagulant proteins of the current invention.
- Procoagulant proteins may bind any part of TLT-1 that would be available for binding in vivo, such as surface accessible residues of the Ig-like domain, or part of the stalk.
- fusion proteins may bind one or more residues within TLT-1 (20-125), TLT-1 (16-162), TLT-1 (126-162) and/or TLT-1 (129-142) (numbers in parenthesis refer to amino acid residues in SEQ ID NO: 2).
- procoagulant proteins bind the stalk of TLT-1, such as one or more residues of TLT-1 (126-162) or TLT-1 (129-142). Procoagulant proteins that bind to the stalk of TLT-1 are unlikely to interfere with the function of the Ig-like domain.
- fusing the coagulation factor to the C-terminal of an antibody, or fragment thereof will position the coagulation factor even more favourably on the cell surface of activated platelets, relative to that of FVII and FVIIa.
- procoagulant proteins of the invention bind to TLT-1 without interfering platelet aggregation.
- procoagulant proteins of the invention bind to TLT-1 without competing with fibrinogen binding to TLT-1.
- TLT-1 may be from any vertebrate, such as any mammal, such as a rodent (such as a mouse, rat or guinea pig), a lagomorph (such as a rabbit), an artiodactyl (such as a pig, cow, sheep or camel) or a primate (such as a monkey or human being).
- TLT-1 is, preferably, human TLT-1.
- TLT-1 may be translated from any naturally occurring genotype or allele that gives rise to a functional TLT-1 protein.
- a non-limiting example of one human TLT-1 is the polypeptide sequence of SEQ ID NO: 2.
- SEQ ID NO: 2 includes the signal peptide (residues 1-15 (MGLTLLLLLLLGLEG) of SEQ ID NO: 2, and the mature TLT-1 polypeptide corresponds to residues 16-311 of SEQ ID NO: 2.
- Procoagulant proteins of the invention comprise an antibody, or a fragment thereof, that has been raised against TLT-1.
- the antibody or fragment thereof may or may not result in a change in the conformational structure of TLT-1.
- the antibody or fragment thereof may or may not result in intracellular signalling, as a result of binding to TLT-1.
- the antibody or fragment thereof is capable of binding to the stalk of TLT-1.
- the antibody or fragment thereof utilises a naturally occurring receptor, or portion thereof, in order to achieve the effect that is unique to and provided by the current invention.
- antibody herein refers to a protein, derived from a germline immunoglobulin sequence, that is capable of specifically binding to an antigen which is TLT-1 or a portion thereof.
- the term includes full length antibodies of any isotype (that is, IgA, IgE, IgG, IgM and/or IgY) and any fragment or single chain thereof.
- Full-length antibodies usually comprise at least four polypeptide chains: that is, two heavy (H) chains and two light (L) chains that are interconnected by disulfide bonds.
- IgG family which may be sub-divided into isotypes IgG1, IgG2, IgG3 and IgG4.
- IgG molecules are composed of two heavy chains, interlinked by two or more disulfide bonds, and two light chains, each attached to a heavy chain by a disulfide bond.
- a heavy chain may comprise a heavy chain variable region (VH) and up to three heavy chain constant (CH) regions: CH1, CH2 and CH3.
- a light chain may comprise a light chain variable region (VL) and a light chain constant region (CL).
- VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR).
- CDRs complementarity determining regions
- FR framework regions
- VH and VL regions are typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the hypervariable regions of the heavy and light chains form a domain that is capable of interacting with an antigen (TLT-1), whilst the constant region of an antibody may mediate binding of the immunoglobulin to host tissues or factors, including but not limited to various cells of the immune system (effector cells), Fc receptors and the first component (Clq) of the classical complement system.
- TLT-1 antigen
- effector cells effector cells
- Fc receptors Fc receptors and the first component (Clq) of the classical complement system.
- the antibody component of the procoagulant proteins may be a monoclonal antibody.
- Such an antibody may be a chimeric antibody, a CDR-grafted antibody, a human antibody, a humanised antibody or an antigen binding portion of any thereof.
- the experimental animal is a suitable mammal such as a goat, rabbit, rat or mouse.
- a monoclonal antibody is represented by a single molecular species having a single binding specificity and affinity for a particular epitope.
- Monoclonal antibodies (mAbs) for the procoagulant proteins of the invention can be produced by a variety of well-known techniques, including conventional monoclonal antibody methodology e.g., the standard somatic cell hybridization technique of Kohler and Milstein (1975) Nature 256: 495, or viral or oncogenic transformation of B lymphocytes.
- the preferred animal system for preparing hybridomas is the murine system.
- Hybridoma production in the mouse is a very well-established procedure. Immunization protocols and techniques for isolation of immunized splenocytes for fusion are known in the art. Fusion partners (e.g., murine myeloma cells) and fusion procedures are also known.
- splenocytes and/or lymph node cells from immunized mice can be isolated and fused to an appropriate immortalized cell line, such as a mouse myeloma cell line.
- the resulting hybridomas can be screened for the production of antigen-specific antibodies.
- the antibody secreting hybridomas can be replated, screened again, and if still positive for suitable IgG, the monoclonal antibodies can be subcloned at least twice by limiting dilution.
- the stable subclones can then be cultured in vitro to generate small amounts of antibody in tissue culture medium for characterization.
- Antibodies for the invention may be prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for the immunoglobulin genes of interest or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody of interest, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of immunoglobulin gene sequences to other DNA sequences.
- recombinant means such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for the immunoglobulin genes of interest or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody of interest, e.g., from a transfectoma, (
- the monoclonal antibody may be mAb0012 or a variant thereof.
- the monoclonal antibody may be mAb0023 or a variant thereof.
- the monoclonal antibody may be mAb0051 or a variant thereof.
- the monoclonal antibody may be mAb0061 or a variant thereof.
- the monoclonal antibody may be mAb0062 or a variant thereof.
- the monoclonal antibody may be mAb0082 or a variant thereof.
- Non-limiting examples of suitable monoclonal antibodies mAb ID HC LC 0012 SEQ ID NO: 32 SEQ ID NO: 33 0023 SEQ ID NO: 34 SEQ ID NO: 35 0051 SEQ ID NO: 36 SEQ ID NO: 37 0052 SEQ ID NO: 38 SEQ ID NO: 39 0061 SEQ ID NO: 40 SEQ ID NO: 41 0062 SEQ ID NO: 42 SEQ ID NO: 39 0082 SEQ ID NO: 43 SEQ ID NO: 41
- antigen-binding portion of an antibody refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen, such as TLT-1 or another target receptor, as described herein. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- the antibody component of the procoagulant proteins may therefore be a fragment of an antibody, such as a fragment of a monoclonal antibody.
- binding fragments encompassed within the term “antigen-binding portion” of an antibody include a Fab fragment, a F(ab′) 2 fragment, a Fab′ fragment, a Fd fragment, a Fv fragment, a ScFv fragment, a dAb fragment and an isolated complementarity determining region (CDR).
- Single chain antibodies such as scFv and heavy chain antibodies such as VHH and camel antibodies are also intended to be encompassed within the term “antigen-binding portion” of an antibody.
- These antibody fragments may be obtained using conventional techniques known to those of skill in the art, and the fragments may be screened for utility in the same manner as intact antibodies.
- a “Fab” fragment includes a variable domain and a constant domain of the light chain and a variable domain and the first constant domain (CH1) of the heavy chain.
- a Fab′ fragment includes one or more carboxy terminal disulphide linkages to the heavy or light chains.
- F(ab′) 2 antibody fragments comprise a pair of Fab fragments that are generally covalently linked near their carboxy termini by hinge cysteines. Other chemical couplings of antibody fragments are also known in the art.
- an “Fv” fragment is an antibody fragment that contains a complete antigen recognition and binding site, and generally comprises a dimer of one heavy and one light chain variable domain in tight association that can be covalent in nature, for example in a single chain variable domain fragment (scFv). It is in this configuration that the three hypervariable regions of each variable domain interact to define an antigen-binding site on the surface of the V H -V L dimer. Collectively, the six hypervariable regions or a subset thereof confer antigen binding specificity to the antibody. However, even a single variable domain comprising only three hypervariable regions specific for an antigen has the ability to recognize and bind antigen, although usually at a lower affinity than the entire binding site (Cai & Garen, Proc. Natl.
- VHH heavy chain variable domain
- Single-chain Fv or “scFv” antibody fragments comprise the V H and V L domains of an antibody, where these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains that enables the scFv to form the desired structure for antigen binding.
- diabodies refers to small antibody fragments with two antigen-binding sites, in which fragments comprise a heavy chain variable domain (V H ) connected to a light chain variable domain (V L ) in the same polypeptide chain (V H and V L ).
- V H heavy chain variable domain
- V L light chain variable domain
- V H and V L linker that is too short to allow pairing between the two variable domains on the same chain
- the variable domains are forced to pair with complementary domains of another chain, creating two antigen-binding sites.
- Diabodies are described more fully, for example, in EP 404,097; WO 93/11161; and Hollinger et al., 1993 , Proc. Natl. Acad. Sci. USA, 90:6444-6448.
- linear antibodies refers to antibodies as described in Zapata et al., 1995 , Protein Eng., 8(10):1057-1062. Briefly, these antibodies contain a pair of tandem Fd segments (V H -C H 1-V H -C H 1) that, together with complementary light chain polypeptides, form a pair of antigen binding regions. Linear antibodies can be bispecific or monospecific.
- a monobody can bind to an antigen in the absence of light chains and typically has three hypervariable regions, for example CDRs designated CDRH1, CDRH2, and CDRH3.
- a heavy chain IgG monobody has two heavy chain antigen binding molecules connected by a disulfide bond.
- the heavy chain variable domain comprises one or more hypervariable regions, preferably a CDRH3 or HVL-H3 region.
- hypervariable region refers to the amino acid residues of an antibody that are responsible for antigen-binding.
- the hypervariable region comprises amino acid residues from a “complementarity-determining region” or “CDR” (defined by sequence as residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and 31-35 (H1), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain; Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.
- CDR complementarity-determining region
- HVL residues can include, 26-32 (L1), 50-52 (L2) and 91-96 (L3) in the light chain variable domain and 26-32 (H1), 53-55 (H2) and 96-101 (H3) in the heavy chain variable domain.
- the TLT-1 binding portion of the procoagulant protein is a Fab fragment.
- Fab fragments shown in Table 2, are herein identified by means of the prefix “Fab” together with a 4-digit number.
- the Fab fragment may be Fab0003 or a variant thereof.
- the Fab fragment may be Fab0004 or a variant thereof.
- the Fab fragment may be Fab0012 or a variant thereof.
- the Fab fragment may be Fab0023 or a variant thereof.
- the Fab fragment may be Fab0051 or a variant thereof.
- the Fab fragment may be Fab0052 or a variant thereof.
- the Fab fragment may be Fab0061 or a variant thereof.
- the Fab fragment may be Fab0062 or a variant thereof.
- the Fab fragment may be Fab0074 or a variant thereof.
- the Fab fragment may be Fab0082 or a variant thereof.
- the Fab fragment may be Fab0084 or a variant thereof.
- an antibody for the invention may be a human antibody or a humanised antibody.
- the term “human antibody”, as used herein, is intended to include antibodies that have variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region is also derived from human germline immunoglobulin sequences.
- the human antibodies of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- the term “human antibody”, as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- Such a human antibody may be a human monoclonal antibody.
- Such a human monoclonal antibody may be produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, e.g., a transgenic mouse whose genome comprises a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- Human antibodies may be prepared by in vitro immunisation of human lymphocytes followed by transformation of the lymphocytes with Epstein-Barr virus.
- human antibody derivatives refers to any modified form of the human antibody, e.g., a conjugate of the antibody and another agent or antibody.
- humanized antibody herein refers to antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences. Additional framework region modifications may be made within the human framework sequences.
- Antibodies of the invention can be tested for binding to the target protein by, for example, standard ELISA or Western blotting.
- An ELISA assay can also be used to screen for hybridomas that show positive reactivity with the target protein.
- the binding specificity of an antibody may also be determined by monitoring binding of the antibody to cells expressing the target protein, for example, by flow cytometry.
- the specificity of an antibody of the invention for the target protein may be further studied by determining whether or not the antibody binds to other proteins. For example, where it is desired to produce an antibody that specifically binds TLT-1 or a particular part, e.g. epitope, of TLT-1, the specificity of the antibody may be assessed by determining whether or not the antibody also binds to other molecules or modified forms of TLT-1 that lack the part of interest.
- Polypeptide or antibody “fragments” according to the invention may be made by truncation of the corresponding monoclonal antibodies, e.g. by removal of one or more amino acids from the N and/or C-terminal ends of a polypeptide. Up to 10, up to 20, up to 30, up to 40 or more amino acids may be removed from the N and/or C terminal in this way. Fragments may also be generated by one or more internal deletions.
- epitope refers to the area or region on an antigen (Ag), which is a molecular structure on the surface of an activated platelet, to which the antibody (Ab) portion of the procoagulant protein is capable of specifically binding, i.e. the area or region that is in physical contact with the Ab.
- An antigen's epitope may comprise amino acid residues in the Ag that are directly involved in binding to a Ab (the immunodominant component of the epitope) and other amino acid residues, which are not directly involved in the binding, such as amino acid residues of the Ag which are effectively blocked by the Ab (in other words, the amino acid residue is within the “solvent-excluded surface” and/or the “footprint” of the Ab).
- epitope herein includes both types of binding sites within any particular region of a receptor, such as TLT-1, that specifically binds to an anti-TLT-1 antibody, or fragment thereof, unless otherwise stated (e.g., in some contexts the invention relates to antibodies that bind directly to particular amino acid residues).
- Receptors such as TLT-1 may comprise a number of different epitopes, which may include, without limitation, (1) linear peptide epitopes, (2) conformational epitopes which include of one or more non-contiguous amino acids located near each other in the mature receptor conformation; and (3) posttranslational epitopes, which include, either in whole or part, of molecular structures covalently attached to TLT-1, such as carbohydrate groups.
- the epitope for a given antibody (Ab)/antigen (Ag) pair can be defined and characterized at different levels of detail using a variety of experimental and computational epitope mapping methods.
- the experimental methods include mutagenesis, X-ray crystallography, Nuclear Magnetic Resonance (NMR) spectroscopy, Hydrogen deuterium eXchange Mass Spectrometry (HX-MS) and various competition binding methods.
- NMR Nuclear Magnetic Resonance
- HX-MS Hydrogen deuterium eXchange Mass Spectrometry
- the description of an epitope is intimately linked to the method by which it has been determined.
- the epitope for a given Ab/Ag pair will be defined differently depending on the epitope mapping method employed.
- the epitope for the interaction between the Ag and the Ab can be defined by the spatial coordinates defining the atomic contacts present in the Ag-Ab interaction, as well as information about their relative contributions to the binding thermodynamics.
- the epitope can be characterized by the spatial coordinates defining the atomic contacts between the Ag and Ab.
- the epitope can be characterized by the amino acid residues that it comprises as defined by a specific criterium, e.g. distance between atoms in the Ab and the Ag.
- the epitope can be characterized through function, e.g. by competition binding with other Abs.
- the epitope can also be defined more generically as comprising amino acid residues for which substitution by another amino acid will alter the characteristics of the interaction between the Ab and Ag.
- epitope In the context of an X-ray derived crystal structure defined by spatial coordinates of a complex between an Ab, e.g. a Fab fragment, and its Ag, the term epitope is herein, unless otherwise specified or contradicted by context, specifically defined as platelet receptor residues characterized by having a heavy atom (i.e. a non-hydrogen atom) within a distance of 4 ⁇ from a heavy atom in the Ab.
- a heavy atom i.e. a non-hydrogen atom
- Epitopes described on the amino acid level are said to be identical if they contain the same set of amino acid residues.
- Epitopes are said to overlap if at least one amino acid is shared by the epitopes.
- Epitopes are said to be separate (unique) if no amino acid residue is shared by the epitopes.
- Epitopes characterized by competition binding are said to be overlapping if the binding of the corresponding Ab's are mutually exclusive, i.e. if binding of one Ab excludes simultaneous binding of the other Ab.
- the epitopes are said to be separate (unique) if the Ag is able to accommodate binding of both corresponding Ab's simultaneously.
- Procoagulant proteins of the invention may be capable of binding to the same epitope as mAb0012. Procoagulant proteins may be capable of binding to the same epitope as mAb0023. Procoagulant proteins may be capable of binding to the same epitope as mAb0051. Procoagulant proteins may be capable of binding to the same epitope as mAb0061. Procoagulant proteins may be capable of binding to the same epitope as mAb0062. Procoagulant proteins may be capable of binding to the same epitope as mAb0082.
- the epitope may comprise one or more residues selected from the group consisting of K133, I134, G135, S136, L137, A138, N140, A141, F142, S143, D144, P145 and A146 of SEQ ID NO: 4 (corresponding to K133, I134, G135, S136, L137, A138, N140, A141, F142, S143, D144, P145 and A146 of SEQ ID NO: 2).
- the epitope may comprise one or more residues selected from the group consisting of V17, Q18, C19, H20, Y21, R22, L23, Q24, D25, V26, K27, A28, L63, G64, G65, G66, L67, L68, G89, A90, R91, G92, P93, Q94, I95 and L96 of SEQ ID NO: 5 (corresponding to V36, Q37, C38, H39, Y40, R41, L42, Q43, D44, V45, K46, A47, L82, G83, G84, G85, L86, L87, G108, A109, R110, G111, P112, Q113, 1114 and L115 of SEQ ID NO: 2).
- the epitope may comprise one or more residues selected from the group consisting of L36, P37, E38, G39, C40, Q41, P42, L43, V44, S45, S46, A47, V73, T74, L75, Q76, E77, E78, D79, A80, G81, E82, Y83, G84, C85, M86, R91, G92, P93, Q94, I95, L96, H97, R98, V99, S100 and L101 of SEQ ID NO: 5 (corresponding to L55, P56, E57, G58, C59, Q60, P61, L62, V63, S64, S65, A66, V92, T93, L94, Q95, E96, E97, D98, A99, G100, E101, Y102, G103, C104, M105, R110, G111, P112, Q113, I114, L115, H116, R117, V118, S119 and L120 of SEQ ID
- the epitope may comprise one or more residues selected from the group consisting of V17, Q18, C19, H20, Y21, R22, L23, Q24, D25, V26, K27, A28, R91, G92, P93, Q94, I95, L96, H97, R98, V99, S100 and L101 of SEQ ID NO: 5 (corresponding to V36, Q37, C38, H39, Y40, R41, L42, Q43, D44, V45, K46, A47, R110, G111, P112, Q113, I1114, L115, H116, R117, V118, S119 and L120 of SEQ ID NO: 2).
- the epitope may comprise one or more residues selected from the group consisting of E5, T6, H7, K8, I9, G10, S11, L12, A13, E14, N15, A16, F17, S18, D19 and P20 of SEQ ID NO: 7 (corresponding to E130, T131, H132, K133, I134, G135, S136, L137, A138, E139, N140, A141, F142, S143, D144 and P145 of SEQ ID NO: 2).
- the epitope may comprise one or more residues selected from the group consisting of K8, I9, G10, S11, L12, A13, N15, A16, F17, S18, D19, P20 and A21 of SEQ ID NO: 7 (corresponding to K133, I134, G135, S136, L137, A138, N140, A141, F142, S143, D144, P145 and A146 of SEQ ID NO: 2).
- the definition of the term “paratope” is derived from the above definition of “epitope” by reversing the perspective.
- the term “paratope” refers to the area or region on the Ab to which an Ag specifically binds, i.e. to which it makes physical contact to the Ag.
- the paratope may comprise one or more residues selected from the group consisting of H50, N52, Y56, H58, Y73, F79, S115, T116, V118 and Y120 of the anti-TLT-1 light (L) chain (SEQ ID NO: 33), and residues V20, F45, R49, Y50, W51, E68, T75, N77, S116, G117, V118 and T120 of the anti-TLT-1 heavy (H) chain (SEQ ID NO: 32).
- the term paratope is herein, unless otherwise specified or contradicted by context, specifically defined as Ag residues characterized by having a heavy atom (i.e. a non-hydrogen atom) within a distance of 4 ⁇ from a heavy atom in the platelet receptor.
- the epitope and paratope for a given antibody (Ab)/antigen (Ag) pair may be identified by routine methods. For example, the general location of an epitope may be determined by assessing the ability of an antibody to bind to different fragments or variants of TLT-1.
- the specific amino acids within TLT-1 that make contact with an antibody (epitope) and the specific amino acids in an antibody that make contact with TLT-1 (paratope) may also be determined using routine methods, such as those described in the examples.
- the antibody and target molecule may be combined and the Ab/Ag complex may be crystallised. The crystal structure of the complex may be determined and used to identify specific sites of interaction between the antibody and its target.
- Fusion proteins comprising an antibody or fragment thereof may also be defined in terms of their complementarity-determining regions (CDRs).
- CDRs complementarity-determining region
- the term “complementarity-determining region” or “hypervariable region” herein refers to the amino acid residues of an antibody that are responsible for antigen binding.
- the complementarity-determining regions or “CDRs” are generally comprised of amino acid residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light-chain variable domain and 31-35 (H1), 50-65 (H2) and 95-102 (H3) in the heavy-chain variable domain; (Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.
- a heavy chain variable domain may include amino acid insertions (residue 52a, 52b and 52c according to Kabat) after residue 52 of CDR H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82.
- the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.
- framework region or “FR” residues refer to those VH or VL amino acid residues that are not within the CDRs, as defined herein.
- the heavy chain of an antibody, or fragment thereof, for the procoagulant proteins of the invention comprises:
- the light chain of an antibody, or fragment thereof, for the procoagulant proteins of the invention comprises:
- the heavy chain of an antibody, or fragment thereof, for the procoagulant proteins of the invention comprises:
- the light chain of an antibody, or fragment thereof, for the procoagulant proteins of the invention comprises:
- the heavy chain of an antibody, or fragment thereof, for the procoagulant proteins of the invention comprises:
- the light chain of an antibody, or fragment thereof, for the procoagulant proteins of the invention comprises:
- the heavy chain of an antibody, or fragment thereof, for the procoagulant proteins of the invention comprises:
- the light chain of an antibody, or fragment thereof, for the procoagulant proteins of the invention comprises:
- the heavy chain of an antibody, or fragment thereof, for the procoagulant proteins of the invention comprises:
- the light chain of an antibody, or fragment thereof, for the procoagulant proteins of the invention comprises:
- Monoclonal antibodies, or fragments thereof, for the procoagulant proteins of the current invention may be glycosylation variants.
- Glycosylation variants of antibodies are variants in which the glycosylation pattern of an antibody is altered. By altering is meant deleting one or more carbohydrate moieties found in the antibody, adding one or more carbohydrate moieties to the antibody, changing the composition of glycosylation (glycosylation pattern), the extent of glycosylation.
- Antibodies are glycosylated at conserved positions in their constant regions (Jefferis and Lund, Chem. Immunol. 1997; 65:111-128; Wright and Morrison, Trends Biotechnol. 1997; 15:26-32).
- the oligosaccharide side chains of the immunoglobulins can affect a protein's function (Boyd et al., Mol. Immunol. 1996; 32:1311-1318), and the intramolecular interaction between portions of the glycoprotein can affect the conformation and presented three-dimensional surface of the glycoprotein.
- Oligosaccharides may also serve to target a given glycoprotein to certain molecules based upon specific recognition structures.
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- X is any amino acid except proline
- O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
- glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites).
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
- removal of glycosylation sites can be accomplished by amino acid alteration within the native glycosylation sites of the antibody.
- nucleic acid molecules encoding amino acid sequence variants of a TLT-1 antibody are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non-variant version of the TLT-1 antibody.
- glycosylation may also be altered without altering the amino acid sequence or the underlying nucleotide sequence. Glycosylation largely depends on the host cell used to express the antibody. Since the cell type used for expression of recombinant glycoproteins, e.g. antibodies, as potential therapeutics is rarely the native cell, significant variations in the glycosylation pattern of the antibodies can be expected (see, e.g. Hse et al., J. Biol. Chem. 1997; 272:9062-9070). In addition to the choice of host cells, factors which affect glycosylation during recombinant production of antibodies include growth mode, media formulation, culture density, oxygenation, pH, purification schemes and the like.
- glycosylation pattern achieved in a particular host organism including introducing or overexpressing certain enzymes involved in oligosaccharide production (U.S. Pat. Nos. 5,047,335; 5,510,261 and 5,278,299).
- Glycosylation, or certain types of glycosylation can be enzymatically removed from the glycoprotein, for example using endoglycosidase H (Endo H).
- Endo H endoglycosidase H
- the recombinant host cell can be genetically engineered, e.g. make defective in processing certain types of polysaccharides.
- glycosylation structure of antibodies can be readily analyzed by conventional techniques of carbohydrate analysis, including lectin chromatography, NMR, Mass spectrometry, HPLC, GPC, monosaccharide compositional analysis, sequential enzymatic digestion, and HPAEC-PAD, which uses high pH anion exchange chromatography to separate oligosaccharides based on charge.
- Methods for releasing oligosaccharides for analytical purposes are also known, and include, without limitation, enzymatic treatment, elimination using harsh alkaline environment to release mainly O-linked structures, and chemical methods using anhydrous hydrazine to release both N- and O-linked oligosaccharides.
- procoagulant proteins of the invention also comprise a coagulation factor component, whose function is to upregulate blood coagulation in the vicinity of the activated platelet.
- Coagulation factors of procoagulant fusion proteins or conjugates of the present invention may be in their inactive form or in their activated form.
- the coagulation factor may be a serine protease, in which case the inactive form of the coagulation factor corresponds to the zymogen form and the activated form corresponds to the catalytically active form.
- the coagulation factor may be a FVII polypeptide (FVII or FVIIa), a FVIII polypeptide (i.e. FVIII or FVIIIa), a FIX polypeptide (FIX or FIXa), a FX polypeptide (FX or FXa) or a FXI polypeptide (FXI or FXIa).
- FVII, FVIII, FIX, FX and FXI polypeptides of the present invention also includes variants, such as truncated variants, and derivatives of said coagulation factors.
- FVII, FIX, FX and FXI variants will include truncated des-Gla variants, i.e. variants of said coagulation factors lacking the Gla-domain responsible for interaction with phospholipid membranes of said coagulation factors.
- the FVII component may be able to bind to tissue factor and it is, preferably, able to cleave FIX or FX. If the coagulation factor is a FVIII polypeptide, the FVIII component is, preferably, able to bind to FIXa and support cleavage of FX. If the coagulation factor is a FIXa polypeptide, it is preferably able to cleave FX. If the coagulation factor is FXa, then it is preferably able to cleave prothrombin (FII). If the coagulation factor is a FXIa polypeptide then it is preferably able to cleave FIX.
- FII prothrombin
- the coagulation factor is a FV polypeptide.
- Factor V is synthesized by the liver and secreted Factor V circulates in plasma as a 330-kDa single-chain polypeptide that is the inactive procoagulant (Huang et al. (2008) Haemophilia 14: 1164-9).
- FV is composed of 2196 amino acids, including a 28 amino acids signal peptide. It is composed of six domains A1 (Aa 30-329), A2 (Aa 348-684), B (Aa 692-1573), A3 (Aa 1578-1907), C1 (Aa 1907-2061), and C2 (Aa 2066-2221).
- the A and C domains of the two proteins are approximately 40% homologous with the equivalent domains of FVIII, but the B domains are not conserved.
- FVIII FV activity is tightly regulated via site-specific proteolysis.
- Thrombin, and to a lesser extent Factor Xa (FXa) are primarily responsible for FV activation via proteolytic cleavages at positions Arg 709 -Ser 710 , Arg 1018 -Thr 1019 and Arg 1545 -Ser 1546 .
- Factor V is active as a cofactor for FXa of the thrombinase complex and the activated FXa enzyme requires calcium and FVa to convert prothrombin to thrombin on the cell surface membrane.
- the A3 domain in the light chain is involved in both FXa and phospholipid interactions.
- the two FVa chains link FXa to the phospholipid surface formed by the platelet plug at the site of injury and enable FXa to efficiently bind and cleave prothrombin to generate thrombin.
- Factor V is able to bind to activated platelets.
- FV Factor V deficiency
- Factor V polypeptide refers to wild type Factor V molecules as well as FV variants, FV derivatives and FV conjugates. Such variants, derivatives and conjugates may exhibit substantially the same, or improved, biological activity relative to wild-type human Factor V.
- Factor V may be plasma-derived or recombinantly produced, using well known methods of production and purification.
- the degree and location of glycosylation, gamma-carboxylation and other post-translational modifications may vary depending on the chosen host cell and its growth conditions.
- Factor V polypeptides may be tested using commercially available clotting assays, such as the in vitro Hemoclot Factor V Reagent assay (Aniara, Ohio, USA: Cat. No. ACK071K).
- the coagulation factor is a FVIIa polypeptide.
- Factor VII is a glycoprotein primarily produced in the liver. The mature protein is composed of 406 amino acid residues and is composed of four domains as defined by homology. There is an N-terminal Gla domain followed by two epidermal growth factor (EGF)-like domains and a C-terminal serine protease domain. FVII circulates in plasma as a single-chain molecule. Upon activation to activated FVII (FVIIa), the molecule is cloven between residues Arg152 and Ile153, resulting in a two-chain protein held together by a disulphide bond. The light chain contains the Gla and EGF-like domains, whereas the heavy chain is the protease domain. FVIIa requires binding to its cell-surface cofactor tissue factor to become fully biologically active.
- Fractor VII(a) encompasses the uncloven zymogen, Factor VII, as well as the cloven and thus activated protease, Factor VIIa.
- Factor VII(a) includes natural allelic variants of FVII(a) that may exist and occur from one individual to another.
- One wild type human Factor VIIa sequence is provided in SEQ ID NO: 157, as well as in Proc Natl Acad Sci USA 1986; 83:2412-2416.
- Factor VII(a) polypeptide refers to wild type Factor VIIa molecules as well as FVII(a) variants, FVII(a) derivatives and FVII(a) conjugates. Such variants, derivatives and conjugates may exhibit substantially the same, or improved, biological activity relative to wild-type human Factor VIIa.
- FVII(a) variant is intended to designate Factor FVII having the sequence of SEQ ID NO: 157, wherein one or more amino acids of the parent protein have been substituted by another amino acid and/or wherein one or more amino acids of the parent protein have been deleted and/or wherein one or more amino acids have been inserted in protein and/or wherein one or more amino acids have been added to the parent protein. Such addition can take place either at the N-terminal end or at the C-terminal end of the parent protein or both.
- the “analogue” or “analogues” within this definition still have FVII activity in its activated form.
- a variant is at least 90% identical with the sequence of SEQ ID NO: 157.
- a variant is at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% identical with the sequence of SEQ ID NO: 157.
- any reference to a specific position refers to the corresponding position in SEQ ID NO: 157.
- Non-limiting examples of FVII(a) variants that have substantially the same or increased proteolytic activity compared to recombinant wild type human Factor VII(a) include those disclosed in WO 01/83725, WO 02/22776, WO 02/077218, WO 03/027147, WO 03/037932, WO 04/029090, WO 05/024006, WO 07/031,559 and EP 05108713.8, U.S. Pat. No. 7,173,000 B2; and JP4451514 B2.
- improved biological activity refers to FVII(a) polypeptides that exhibit i) substantially the same or increased proteolytic activity compared to recombinant wild type human Factor VIIa in the presence and/or absence of tissue factor or ii) to FVII(a) polypeptides with substantially the same or increased TF affinity compared to recombinant wild type human Factor VIIa or iii) to FVII(a) polypeptides with substantially the same or increased half life in plasma compared to recombinant wild type human Factor VIIa, or iv) to FVII(a) polypeptides with substantially the same or increased affinity for the activated platelet.
- the biological activity of a FVIIa polypeptide may be measured using a variety of assays known to the person skilled in the art, such as the in vitro hydrolysis and in vitro proteolysis assays described in examples 26 and 27.
- Factor VII(a) may be plasma-derived or recombinantly produced, using well known methods of production and purification.
- the degree and location of glycosylation, gamma-carboxylation and other post-translational modifications may vary depending on the chosen host cell and its growth conditions.
- SEQ ID NO: 157 Wild type human coagulation Factor VII ANAFL ⁇ LRPGSL ⁇ R ⁇ CK ⁇ QCSF ⁇ AR ⁇ IFKDA ⁇ RTKLFWISYSDGD QCASSPCQNGGSCDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGG CEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCKIPILEKNAS KPQGRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCF KIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTNHDIA LLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGA TALELMVLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSC KGDSGGPHATHYRGTWYLTGIVSWGQGCAVGHFGVYTRVSQYIEWLQK LMRSEPRPGVLLRAPFP
- the coagulation factor is a FVIII polypeptide.
- Factor VIII is a large, complex glycoprotein that is primarily produced by hepatocytes.
- FVIII is composed of 2351 amino acids, including a signal peptide, and contains several distinct domains as defined by homology. There are three A-domains, a unique B-domain, and two C-domains. The domain order can be listed as NH2-A1-A2-BA3-C1-C2-COOH.
- FVIII circulates in plasma as two chains, separated at the B-A3 border. The chains are connected by bivalent metal ion-bindings.
- the A1-A2-B chain is termed the heavy chain (HC) while the A3-C1-C2 is termed the light chain (LC).
- Small acidic regions C-terminal of the A1 (the a 1 region) and A2 (the a 2 region) and N-terminal of the A3 domain (the a 3 region) play important roles in its interaction with other coagulation proteins, including thrombin and von Willebrand factor (vWF or VWF), the carrier protein for FVIII, in vivo.
- vWF or VWF von Willebrand factor
- Endogenous FVIII molecules circulate in vivo as a pool of molecules with B domains of various sizes, the shortest having C-terminal at position 740, i.e. at the C-terminal of A2-a 2 . These FVIII molecules with B-domains of different length all have full procoagulant activity.
- FVIII Upon activation with thrombin, FVIII is cloven C-terminal of A1-a 1 at position 372, C-terminal of A2-a 2 at position 740, and between a 3 and A3 at position 1689, the latter cleavage releases the a 3 region, with concomitant loss of affinity for vWF.
- the activated FVIII molecule is termed FVIIIa. Activation allows interaction of FVIIIa with phospholipid surfaces like activated platelets and activated factor IX (FIXa): the tenase complex is formed, allowing efficient activation of factor X (FX).
- Factor VIII(a) and FVIII(a) include both FVIII and FVIIIa.
- Factor VIII or “FVIII” herein refers to a human plasma glycoprotein that is a member of the intrinsic coagulation pathway and is essential to blood coagulation.
- Native FVIII is the human FVIII molecule derived from the full length sequence as shown in SEQ ID NO: 159 (amino acid 1-2332).
- FVIII(a) includes natural allelic variants of FVIII(a) that may exist and occur from one individual to another.
- FVIII molecules/variants may be B domain-truncated FVIII molecules wherein the remaining domains correspond closely to the sequences as set forth in amino acid numbers 1-740 and 1649-2332 of SEQ ID NO: 159.
- mutations may be introduced in order to, for example, reduce vWF binding capacity.
- Amino acid modifications, such as substitutions and deletions may be introduced into the molecule in order to modify the binding capacity of FVIII with various other components such as LRP, various receptors, other coagulation factors, cell surfaces, introduction and/or abolishment of glycosylation sites.
- Other mutations that do not abolish FVIII activity may also be accommodated in a FVIII molecule/variant that may be used for the purposes of the present invention.
- the B domain of FVIII spans amino acids 741-1648 of SEQ ID NO: 159.
- the B domain is cloven at several different sites, generating large heterogeneity in circulating plasma FVIII molecules.
- the exact function of the heavily glycosylated B domain is unknown. What is known is that the B domain is indispensable for FVIII activity in the coagulation cascade. Recombinant FVIII is thus frequently produced in the form of B domain-deleted/truncated variants.
- Endogenous full length FVIII is synthesized as a single-chain precursor molecule. Prior to secretion, the precursor is cloven into the heavy chain and the light chain.
- Recombinant B domain-deleted FVIII can be produced by means of two different strategies. Either the heavy chain without the B-domain and the light chain are synthesized individually as two different polypeptide chains (two-chain strategy) or the B domain-deleted FVIII is synthesized as a single precursor polypeptide chain (single-chain strategy) that is cloven into the heavy and light chains in the same way as the full-length FVIII precursor.
- the heavy and light chain moieties are often separated by a linker.
- the sequence of the linker is preferably derived from the FVIII B-domain.
- the linker must comprise a recognition site for the protease that cleaves the B domain-deleted FVIII precursor polypeptide into the heavy and light chain.
- amino acid 1644-1648 constitutes this recognition site.
- the thrombin cleavage site leading to removal of the linker on activation of B domain-deleted FVIII is located in the heavy chain.
- the size and amino acid sequence of the linker is unlikely to influence its removal from the remaining FVIII molecule by thrombin activation.
- Deletion/truncation of the B domain is an advantage for production of FVIII. Nevertheless, parts of the B domain can be included in the linker without reducing the productivity.
- the negative effect of the B domain on productivity has not been attributed to any specific size or sequence of the B domain.
- FVIII molecules for the present invention are capable of functioning in the coagulation cascade in a manner that is functionally similar, or equivalent, to FVIII, inducing the formation of FXa via interaction with FIXa on an activated platelet and supporting the formation of a blood clot.
- FVIII activity can be assessed in vitro using techniques well known in the art. Clot analyses, FX activation assays (often termed chromogenic assays), thrombin generation assays and whole blood thromboelastography are examples of such in vitro techniques, two of which are described in examples 28 and 29.
- FVIII molecules according to the present invention have FVIII activity that is at least that of native human FVIII.
- FVIII variant is intended to designate Factor FVIII having the sequence of SEQ ID NO: 159, wherein one or more amino acids of the parent protein have been substituted by another amino acid and/or wherein one or more amino acids of the parent protein have been deleted and/or wherein one or more amino acids have been inserted in protein and/or wherein one or more amino acids have been added to the parent protein. Such addition can take place either at the N-terminal end or at the C-terminal end of the parent protein or both.
- the “analogue” or “analogues” within this definition still have FVIII activity in its activated form.
- a variant is at least 90% identical with the sequence of SEQ ID NO: 159.
- a variant is at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% identical with the sequence of SEQ ID NO: 159.
- any reference to a specific position refers to the corresponding position in SEQ ID NO: 159.
- FVIII may be plasma-derived or recombinantly produced, using well known methods of production and purification.
- the degree and location of glycosylation, gamma-carboxylation and other post-translational modifications may vary depending on the chosen host cell and its growth conditions.
- the coagulation factor is a Factor IX polypeptide.
- Factor IX is, in its active form FIXa, a trypsin-like serine protease that serves a key role in haemostasis by generating, as part of the tenase complex, most of the factor Xa required to support proper thrombin formation during coagulation (reviewed in (Hoffman and Monroe, III 2001)).
- FIX Factor IX
- the circulating zymogen form is composed of 415 amino acids divided into four distinct domains comprising an N-terminal ⁇ -carboxyglutamic acid-rich (Gla) domain, two EGF domains and a C-terminal trypsin-like serine protease domain.
- Gla N-terminal ⁇ -carboxyglutamic acid-rich
- EGF EGF domain
- C-terminal trypsin-like serine protease domain Activation of FIX occurs by limited proteolysis at Arg 145 -Ala 146 and Argso-Val 181 releasing a 35-aa fragment, the so-called activation peptide (Schmidt and Bajaj 2003).
- the activation peptide is heavily glycosylated, containing two N-linked and up to four O-linked glycans.
- Fractor IX refers to a human plasma Factor IX glycoprotein that is a member of the intrinsic coagulation pathway and is essential to blood coagulation.
- Factor IX(a) includes natural allelic variants of FIX(a) that may exist and occur from one individual to another.
- Factor IX(a) may be plasma-derived or recombinantly produced using well known methods of production and purification. The degree and location of glycosylation, gamma-carboxylation and other post-translation modifications may vary depending on the chosen host cell and its growth conditions. Unless otherwise specified or indicated, Factor IX means any functional human Factor IX protein molecule in its normal role in coagulation, including any fragment, analogue and derivative thereof.
- wild type FIX is the full length human FIX molecule, as shown in SEQ ID NO: 161.
- FIX analogue is intended to designate Factor FIX having the sequence of SEQ ID NO: 161, wherein one or more amino acids of the parent protein have been substituted by another amino acid and/or wherein one or more amino acids of the parent protein have been deleted and/or wherein one or more amino acids have been inserted in protein and/or wherein one or more amino acids have been added to the parent protein. Such addition can take place either at the N-terminal end or at the C-terminal end of the parent protein or both.
- the “analogue” or “analogues” within this definition still have FIX activity in its activated form.
- a variant is at least 90% identical with the sequence of SEQ ID NO: 161.
- a variant is at least 95% identical with the sequence of SEQ ID NO: 161.
- any reference to specific positions refers to the corresponding position in SEQ ID NO: 161.
- Non-limiting examples of FIX(a) variants that have substantially the same activity, FVIII bypassing activity or increased proteolytic activity compared to recombinant wild type human Factor IX(a) include those disclosed in Milanov P, Ivanciu L, Abriss D, Quade-Lyssy P, Miesbach W, Alesci S, Tonn T, Grez M, Seifried E, Schuttrumpf (2012) J. Blood 119: 602-11 and US 2011/0217284 A1.
- Factor IX domains include the following amino acid residues: Gla domain being the region from reside Tyrl to residue Lys43; EGF1 being the region from residue Gln44 to residue Leu84; EGF2 being the region from residue Asp85 to residue Arg145; the Activation Peptide being the region from residue Ala146 to residue Arg180; and the Protease Domain being the region from residue Val181 to Thr414.
- the light chain refers to the region encompassing the Gla domain, EGF1 and EGF2, while the heavy chain refers to the Protease Domain.
- Factor IX may be plasma-derived or recombinantly produced, using well known methods of production and purification. The degree and location of glycosylation, gamma-carboxylation and other post-translational modifications may vary depending on the chosen host cell and its growth conditions.
- a commercially available assay kit known as ‘Hyphen BioMed Chromogenic Factor IX kit (Aniara)’ may be used to assess the activity level of the FIX polypeptide.
- Factor XIa activates Factor IX into Factor IXa, which together with activated Factor VIII:C, phospholipids and Ca 2+ , activates Factor X into Factor Xa.
- the amount of generated Factor Xa was measured at 405 nm by the amount of pNA released from the Factor Xa specific chromogenic substrate SXa-11.
- SEQ ID NO: 161 Wild type human coagulation Factor IX YNSGKL ⁇ FVQGNL ⁇ R ⁇ CM ⁇ KCSF ⁇ AR ⁇ VF ⁇ NT ⁇ RTT ⁇ FWKQYVD GDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGR CEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTS KLTRAEAVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAK PGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGE HNIEETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLN SYVTPICIADKEYNIFLKFGSGYVSGWGRVFHKGRSALVLQYLRVPL VDRATCLRSTKFTYNNMFCAGFHEGGRDSCQGDSGGPHVTEVEGTSF LTGIISWGEECAMKGKYGI
- the coagulation factor is a FX polypeptide.
- Coagulation factor X is a vitamin K-dependent coagulation factor with structural similarities to factor VII, prothrombin, factor IX (FIX), and protein C. It is synthesised with a 40-residue pre-pro-sequence containing a hydrophobic signal sequence (Aa 1-31) that targets the protein for secretion.
- the pro-peptide is important for directing ⁇ -carboxylation to the light chain of Factor X.
- the circulating human FX zymogen is composed of 445 amino acids divided into four distinct domains comprising an N-terminal gamma-carboxyglutamic acid rich (Gla) domain, two EGF domains, and a C-terminal trypsin-like serine protease domain.
- the mature two-chain form of FX is composed of a light chain (Aa41-179) and a heavy chain (Aa183-488) held together by a disulfide bridge (Cys 172 -Cys 342 ).
- the light chain contains 11 Gla residues, which are important for Ca 2+ -dependent binding of FX to negatively charged phospholipid membranes.
- Wild-type human coagulation factor X has two N-glycosylation sites (Asn 221 and Asn 231 ) and two O-glycosylation sites (Thr 199 and Thr 211 ) in the activation peptide.
- ⁇ -hydroxylation occurs at Asp 103 in the first EGF domain, resulting in ⁇ -hydroxyaspartic acid (Hya).
- Activation of FX occurs by limited proteolysis at Arg 234 -Ile 235 releasing a 52 amino acid activation peptide (Aa 183-234). In the extrinsic pathway, this occurs upon exposure of Tissue factor (TF) on the membrane of subendothelial cells to plasma and subsequent activation of FVIIa.
- TF Tissue factor
- FX deficiency is a rare autosomal recessive bleeding disorder with an incidence of 1:1,000,000 in the general population (Dewerchin et al. (2000) Thromb Haemost 83: 185-190). Although it produces a variable bleeding tendency, patients with a severe FX deficiency tend to be the most seriously affected among patients with rare coagulation defects. The prevalence of heterozygous FX deficiency is about 1:500, but is usually clinically asymptomatic.
- wild type FX is the full length human FX molecule, as shown in SEQ ID NO: 163.
- Fractor X polypeptide herein refers to any functional Factor X protein molecule capable of activating thrombin, including fragments, analogues and derivatives of SEQ ID NO: 163.
- FX analogue is intended to designate Factor FX having the sequence of SEQ ID NO: 163, wherein one or more amino acids of the parent protein have been substituted by another amino acid and/or wherein one or more amino acids of the parent protein have been deleted and/or wherein one or more amino acids have been inserted in protein and/or wherein one or more amino acids have been added to the parent protein. Such addition can take place either at the N-terminal end or at the C-terminal end of the parent protein or both.
- the “analogue” or “analogues” within this definition still have FX activity in its activated form.
- a variant is at least 90% identical with the sequence of SEQ ID NO: 163.
- a variant is at least 95% identical with the sequence of SEQ ID NO: 163.
- any reference to specific positions refers to the corresponding position in SEQ ID NO: 163.
- FX may be plasma-derived or recombinantly produced, using well known methods of production and purification.
- the degree and location of glycosylation, gamma-carboxylation and other post-translational modifications may vary depending on the chosen host cell and its growth conditions.
- the coagulation factor is a Factor XI polypeptide.
- Factor XI is the zymogen of a blood coagulation protease, factor XIa (FXIa), which contributes to hemostasis through activation of factor IX.
- the factor is produced by the liver (Emsley et al. (2010) Blood 115:2569-77).
- the protein is a 160-kDa disulfide-linked dimer of identical 607 amino acid subunits, each containing 4 90- or 91-amino acid repeats called apple domains (from the N-terminus: A1: Aa 20-103, A2: Aa 110-193, A3: Aa 200-283, A4: Aa 291-374) and a C-terminal trypsin-like catalytic domain.
- the protein is expressed with a signal peptide Aa1-18.
- the structure is different from those of the well-characterized vitamin K-dependent coagulation proteases.
- FXI circulates in blood as a complex with high molecular weight kininogen (HK).
- Prekallikrein the zymogen of the protease-kallikrein, is a monomeric homolog of FXI with the same domain structure that also circulates in complex with HK.
- the zymogen factor is activated into factor XIa by Factor XIIa (FXIIa), thrombin, and is also autocatalytic. Cleavage activation occurs at the activation loop containing the Arg369-Ile370 cleavage site. Since FXI deficiency causes relatively mild bleeding, FXI has a speculative role in early fibrin generation.
- FXIa is postulated to be part of a feedback loop that sustains thrombin generation through FIX activation to consolidate coagulation.
- FXIa activity is associated with a mild to moderate bleeding disorder. More than 180 other FXI gene mutations associated with FXI deficiency have been reported (http://www.factorxi.org, http://www.isth.org), including more than 100 single amino acid (missense) substitutions. Severe deficiency is prevalent in people of Jewish ancestry (Seligsohn et al. (2007) Thromb Haemost. 98:84-89).
- the carrier rate is approximately 5% in Ashkenazi Jews, with severe (homozygous) deficiency found in 1 in 450 persons.
- severe mutation at Glu117Stop results in a truncated protein and homozygotes lacks completely plasma FXI antigen.
- Factor XIa activates factor IX by selectively cleaving Arg 145 -Ala 146 and Arg 180 -Val 181 .
- FXI analogue is intended to designate Factor XI having the sequence of SEQ ID NO: 165, wherein one or more amino acids of the parent protein have been substituted by another amino acid and/or wherein one or more amino acids of the parent protein have been deleted and/or wherein one or more amino acids have been inserted in protein and/or wherein one or more amino acids have been added to the parent protein. Such addition can take place either at the N-terminal end or at the C-terminal end of the parent protein or both.
- the “analogue” or “analogues” within this definition still have FX activity in its activated form.
- a variant is at least 90% identical with the sequence of SEQ ID NO: 165.
- a variant is at least 95% identical with the sequence of SEQ ID NO: 165.
- any reference to a specific positions refers to the corresponding position in SEQ ID NO: 165.
- FXI may be plasma-derived or recombinantly produced, using well known methods of production and purification. The degree and location of glycosylation, and other post-translational modifications may vary depending on the chosen host cell and its growth conditions.
- identity refers to a relationship between the sequences of two or more polypeptides, as determined by comparing the sequences.
- identity also means the degree of sequence relatedness between polypeptides, as determined by the number of matches between strings of two or more amino acid residues. “Identity” measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e., “algorithms”). Identity of related polypeptides can be readily calculated by known methods. Such methods include, but are not limited to, those described in Computational Molecular Biology, Lesk, A.
- Preferred methods for determining identity are designed to give the largest match between the sequences tested. Methods of determining identity are described in publicly available computer programs. Preferred computer program methods for determining identity between two sequences include the GCG program package, including GAP (Devereux et al., Nucl. Acid. Res. 12, 387 (1984); Genetics Computer Group, University of Wisconsin, Madison, Wis.), BLASTP, BLASTN, and FASTA (Altschul et al., J. Mol. Biol. 215, 403-410 (1990)). The BLASTX program is publicly available from the National Center for Biotechnology Information (NCBI) and other sources (BLAST Manual, Altschul et al. NCB/NLM/NIH Bethesda, Md. 20894; Altschul et al., supra). The well known Smith Waterman algorithm may also be used to determine identity.
- NCBI National Center for Biotechnology Information
- GAP Genetics Computer Group, University of Wisconsin, Madison, Wis.
- two polypeptides for which the percent sequence identity is to be determined are aligned for optimal matching of their respective amino acids (the “matched span”, as determined by the algorithm).
- a gap opening penalty (which is calculated as 3 times the average diagonal; the “average diagonal” is the average of the diagonal of the comparison matrix being used; the “diagonal” is the score or number assigned to each perfect amino acid match by the particular comparison matrix) and a gap extension penalty (which is usually 1/10times the gap opening penalty), as well as a comparison matrix such as PAM 250 or BLOSUM 62 are used in conjunction with the algorithm.
- a standard comparison matrix see Dayhoff et al., Atlas of Protein Sequence and Structure, vol.
- Preferred parameters for a peptide sequence comparison include the following: Algorithm: Needleman et al., J. Mol. Biol. 48, 443-453 (1970); Comparison matrix: BLOSUM 62 from Henikoff et al., PNAS USA 89, 10915-10919 (1992); Gap Penalty: 12, Gap Length Penalty: 4, Threshold of Similarity: 0.
- the GAP program is useful with the above parameters.
- the aforementioned parameters are the default parameters for peptide comparisons (along with no penalty for end gaps) using the GAP algorithm.
- the procoagulant proteins of the current invention comprise (i) at least one coagulation factor component and (ii) an antibody or fragment thereof that is capable of binding a receptor, and/or a fragment thereof, wherein the receptor is present only (in the non-ubiquitous sense of the word) on the surface of activated platelets.
- said receptor is TLT-1.
- the procoagulant proteins of the current invention are preferably engineered such that their constituent parts may function independently of one another.
- said coagulation factor component of the current invention is capable of upregulating blood coagulation.
- said “antibody” component of the invention is preferably able to bind a receptor such as TLT-1, unhindered by the presence of said coagulation factor component.
- the carboxy terminus of the coagulation factor component may be covalently attached to the amino terminus of the antibody component of the construct, or vice versa.
- Said antibody component of the construct will preferably not bind to or demonstrate little affinity for any other triggering receptor expressed on myeloid cells (TREM).
- the construct of the current invention may or may not comprise a linker between said coagulation factor and said antibody constituents.
- Said optional linker may be any one of the linkers described in Table 3, or may be any other linker that binds both coagulation factor and antibody constituent parts of the construct, such that both are functional.
- the coagulation factor and anti-TLT-1 components are expressed as fusion proteins.
- the coagulation factor and anti-TLT-1 components are chemically conjugated.
- Procoagulant proteins wherein part (ii) is a mAb may comprise two coagulation factor polypeptides (part (i)).
- the coagulation factor may be fused to a HC of the mAb;
- the coagulation factor may be fused to a LC of the mAb.
- the coagulation factor may be fused to a antibody, or fragment thereof, which, in turn, is fused to a HC of the mAb or a LC of the mAb.
- a procoagulant protein of the present invention may comprise (i) at least one FV polypeptide and (ii) an antibody, or fragment thereof, that is capable of binding TLT-1.
- a procoagulant protein of the present invention may comprise (i) at least one FVII polypeptide and (ii) an antibody, or fragment thereof, that is capable of binding TLT-1.
- a procoagulant protein of the present invention may comprise (i) at least one FVIII polypeptide and (ii) an antibody, or fragment thereof, that is capable of binding TLT-1.
- a procoagulant protein of the present invention may comprise (i) at least one FIX polypeptide and (ii) an antibody, or fragment thereof, that is capable of binding TLT-1.
- a procoagulant protein of the present invention may comprise (i) at least one FX polypeptide and (ii) an antibody, or fragment thereof, that is capable of binding TLT-1.
- a procoagulant protein of the present invention may comprise (i) at least one FXI polypeptide and (ii) an antibody, or fragment thereof, that is capable of binding TLT-1.
- Procoagulant proteins may further comprise a linker.
- linker amino acid sequences which may be utilised when the procoagulant proteins are manufactured as fusion proteins, are shown in Table 3.
- said linker may be L1.
- the linker may be L2.
- the linker may be L3.
- the linker may be L4.
- the linker may be L5.
- the linker may be L6.
- the linker may be L7.
- the linker may be L8.
- the linker may be L9.
- the linker may be L10.
- Linker Length ID Linker sequence L0 0 no linker L1 2 GS L2 7 GSGGGGS L3 12 GSGGGGSGGGGS L4a 17 GSGGGGSGGGGSGGGGS L4b 17 GGGGSGGGGSGGGGSGS L5 22 GGGGSGSGGGGSGGGGSGGGGS L6 27 GGGGSGGGGSGSGGGGSGGGGSGGGGS L7 32 GGGGSGGGGSGGGGSGSGGGGSGGGGGS L8 37 GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGG GS L9 42 GGGGSGGGGSGGGGSGGGGSGGGGSGSGGGGSGGG GSGGGGS L10 16 YGPPSPSSPAPEFLGG
- the extracellular part of TLT-1 is composed of an immunoglobulin-like domain and a stalk.
- Procoagulant proteins of the invention may be capable of binding to either of these.
- a longer linker may allow part (i) of said fusion protein to adapt a functionally relevant position and orientation on the surface of the activated platelet, thereby facilitating its function.
- a procoagulant protein that is capable of binding the stalk of TLT-1 is adjacent to the platelet membrane.
- a procoagulant protein that is capable of binding the stalk may comprise a linker but the inclusion of a linker does not necessarily affect the function of the coagulation factor part of the fusion protein.
- procoagulant proteins of the invention are capable of binding a receptor that is present on platelets that are undergoing activation or that are fully activated, such as TLT-1.
- binding affinity is intended to refer to the property of procoagulant proteins, or the antibody component of procoagulant proteins, to bind or not to bind to their target. Binding affinity may be quantified by determining the binding constant (K D ) for an antibody component and its target. Similarly, the specificity of binding of an antibody component to its target may be defined in terms of the comparative binding constants (K D ) of the antibody for its target as compared to the binding constant with respect to the antibody and another, non-target molecule.
- the K D for the antibody with respect to the target will be 2-fold, preferably 5-fold, more preferably 10-fold less than K D with respect to the other, non-target molecule such as unrelated material or accompanying material in the environment. More preferably, the K D will be 50-fold less, even more preferably 100-fold less, and yet more preferably 200-fold less.
- this binding constant can be determined directly by well-known methods, and can be computed even for complex mixtures by methods such as those, for example, set forth in Caceci et al. (Byte 9:340-362, 1984).
- the K D may be established using a double-filter nitrocellulose filter binding assay such as that disclosed by Wong & Lohman (Proc. Natl. Acad. Sci. USA 90, 5428-5432, 1993).
- Other standard assays to evaluate the binding ability of antibodies towards targets are known in the art, including for example, ELISAs, Western blots, RIAs, and flow cytometry analysis.
- the binding kinetics (e.g., association rate and dissociation rate constants) and binding affinity of the antibody can also be assessed by standard assays known in the art, such as by surface plasmon resonce (SPR) analysis.
- SPR surface plasmon resonce
- a competitive binding assay can be conducted in which the binding of the antibody to the target is compared to the binding of the target by another, known ligand of that target, or another antibody.
- K D values for the antibody, or fragment thereof, of the invention may also be at least 1 ⁇ 10 ⁇ 15 M, such as at least 1 ⁇ 10 ⁇ 14 M, such as at least 1 ⁇ 10 ⁇ 13 M, such as at least 1 ⁇ 10 ⁇ 12 M, such as at least 1 ⁇ 10 ⁇ 11 M, such as at least 1 ⁇ 10 ⁇ 10 M, such as approximately 3 ⁇ 10 ⁇ 9 M, such as at least 1 ⁇ 10 ⁇ 9 M, or at least 1 ⁇ 10 ⁇ 8 M.
- An antibody of the invention may have a Kd (or Ki) for its target of 1 ⁇ 10 ⁇ 7 M or less, 1 ⁇ 10 ⁇ 8 M or less or 1 ⁇ 10 ⁇ 9 M or less.
- Preferred K D values for the antibody, or fragment thereof may be 1 ⁇ 10 ⁇ 15 M to 1 ⁇ 10 ⁇ 14 M, such as 1 ⁇ 10 ⁇ 14 M to 1 ⁇ 10 ⁇ 13 M 1 ⁇ 10 ⁇ 13 M to 1 ⁇ 10 ⁇ 12 M, such as 1 ⁇ 10 ⁇ 12 M to 1 ⁇ 10 ⁇ 11 M, such as 1 ⁇ 10 ⁇ 11 M to 1 ⁇ 10 ⁇ 10 M, such as 1 ⁇ 10 ⁇ 10 M to 1 ⁇ 10 ⁇ 9 M such as approximately 3 ⁇ 10 ⁇ 9 M, such as 1 ⁇ 10 ⁇ 9 M to 2 ⁇ 10 ⁇ 8 M.
- An antibody or fragment thereof that specifically binds its target may bind its target with a high affinity, such as a K D as discussed above, and may bind to other, non-target molecules with a lower affinity.
- the antibody may bind to a non-target molecules with a K D of 1 ⁇ 10 ⁇ 6 M or more, more preferably 1 ⁇ 10 ⁇ 5 M or more, more preferably 1 ⁇ 10 ⁇ 4 M or more, more preferably 1 ⁇ 10 ⁇ 3 M or more, even more preferably 1 ⁇ 10 ⁇ 2 M or more.
- a procoagulant protein of the invention is preferably capable of binding to its target with an affinity that is at least two-fold, 10-fold, 50-fold, 100-fold, 200-fold, 500-fold, 1.000-fold or 10.000-fold or greater than its affinity for binding to another non-target molecule, such as other TREMs than TLT-1.
- the functional effects of the invented procoagulant proteins may be assessed by means of various in vitro and in vivo experiments.
- In vitro experiments may be designed to assess the function of the fusion proteins as a whole, as well as their component (i) coagulation factor and (ii) antibody parts.
- fusion proteins may be tested in a tail-bleeding model in haemophilic mice that are transfused with human platelets.
- fusion proteins may be tested in a tail-bleeding model in haemophilic mice with the human TLT-1 gene inserted (“humanized” with respect to TLT-1).
- the procoagulant proteins may be provided in the form of fusion proteins or chemical conjugates.
- the invention also relates to polynucleotides that encode the procoagulant proteins of the invention.
- a polynucleotide of the invention may encode any procoagulant protein as described herein.
- the terms “nucleic acid molecule” and “polynucleotide” are used interchangeably herein and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- Non-limiting examples of polynucleotides include a gene, a gene fragment, messenger RNA (mRNA), cDNA, recombinant polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- mRNA messenger RNA
- cDNA messenger RNA
- recombinant polynucleotides plasmids
- vectors isolated DNA of any sequence
- isolated RNA of any sequence isolated RNA of any sequence
- nucleic acid probes and primers.
- a polynucleotide of the invention may be provided in isolated or purified form.
- a nucleic acid sequence which “encodes” a selected polypeptide is a nucleic acid molecule which is transcribed (in the case of DNA) and translated (in the case of mRNA) into a polypeptide in vivo, when placed under the control of appropriate regulatory sequences.
- the boundaries of the coding sequence are determined by a start codon at the 5′ (amino) terminus and a translation stop codon at the 3′ (carboxy) terminus.
- such nucleic acid sequences can include, but are not limited to, cDNA from viral, prokaryotic or eukaryotic mRNA, genomic sequences from viral or prokaryotic DNA or RNA, and even synthetic DNA sequences.
- a transcription termination sequence may be located 3′ to the coding sequence.
- Polynucleotides of the invention can be synthesised according to methods well known in the art, as described by way of example in Sambrook et al. (1989, Molecular Cloning—a laboratory manual; Cold Spring Harbor Press).
- the nucleic acid molecules of the present invention may be provided in the form of an expression cassette which includes control sequences operably linked to the inserted sequence, thus allowing for expression of the antibody of the invention in vivo.
- These expression cassettes are typically provided within vectors (e.g., plasmids or recombinant viral vectors).
- vectors e.g., plasmids or recombinant viral vectors.
- Such an expression cassette may be administered directly to a host subject.
- a vector comprising a polynucleotide of the invention may be administered to a host subject.
- the polynucleotide is prepared and/or administered using a genetic vector.
- a suitable vector may be any vector which is capable of carrying a sufficient amount of genetic information, and allowing expression of a polypeptide of the invention.
- the present invention thus includes expression vectors that comprise such polynucleotide sequences.
- expression vectors are routinely constructed in the art of molecular biology and may for example involve the use of plasmid DNA and appropriate initiators, promoters, enhancers and other elements, such as for example polyadenylation signals which may be necessary, and which are positioned in the correct orientation, in order to allow for expression of a peptide of the invention.
- Other suitable vectors would be apparent to persons skilled in the art.
- the invention also includes isolated cells that have been modified to express fusion proteins according to the invention.
- Such cells include transient, or—preferably—stable higher eukaryotic cell lines, such as mammalian cells or insect cells; lower eukaryotic cells, such as yeast; or prokaryotic cells such as bacterial cells.
- Particular examples of cells which may be modified by insertion of vectors or expression cassettes encoding for a construct of the invention include mammalian HEK293T, CHO, HeLa and COS cells.
- the cell line selected will be one which is not only stable, but also allows for mature glycosylation and cell surface expression of a polypeptide.
- Such cell lines of the invention may be cultured using routine methods to produce a fusion protein or construct according to the invention.
- polynucleotides, expression cassettes or vectors of the invention may be administered to a cell from a subject ex vivo and the cell then returned to the body of the subject.
- procoagulant proteins may be obtained by chemical conjugation of the antibody (such as a mAb), or fragment thereof, and the coagulation factor.
- a linker between the two proteins may contain one or more chemical moieties which are not present in those amino acids that are encoded by DNA.
- a chemical moiety used in the linker comprises the biradical with the structure
- biradical refers to an even-electron chemical compound with two free radical centres which act independently of one another.
- a chemical moiety used in the linker comprises a polymer: a macromolecule composed of repeating structural units that are typically connected by covalent chemical bonds.
- a polymer may be hydrophilic.
- hydrophilic or water-soluble refers to moieties that have some detectable degree of solubility in water. Methods to detect and/or quantify water solubility are well known in the art.
- Exemplary water-soluble polymers according to the invention include peptides, saccharides, (poly)ethers, (poly)amines, (poly)carboxylic acids and the like.
- Peptides can have mixed sequences and be composed of a single amino acid, e.g., (poly)lysine.
- An exemplary polysaccharide is (poly)sialic acid.
- An exemplary (poly)ether is (poly)ethylene glycol.
- (Poly)ethylene imine is an exemplary polyamine, and (poly)acrylic acid is a representative (poly)carboxylic acid.
- the hydrophilic polymer according to the present invention is, preferably, non-naturally occurring.
- the non-naturally occurring modifying group is a polymeric modifying group, in which at least one polymeric moiety is non-naturally occurring.
- the non-naturally occurring modifying group is a modified carbohydrate.
- the locus of functionalization with the modifying group is selected such that it does not prevent the “modified sugar” from being added enzymatically to a polypeptide.
- “Modified sugar” also refers to any glycosyl mimetic moiety that is functionalized with a modifying group and which is a substrate for a natural or modified enzyme, such as a glycosyltransferase.
- polymers are also suitable for the invention.
- Polymer backbones that are non-peptidic and water-soluble, are particularly useful in the invention.
- suitable polymers include, but are not limited to, other poly(alkylene glycols), such as poly(propylene glycol) (“PPG”), copolymers of ethylene glycol and propylene glycol and the like, poly(oxyethylated polyol), poly(olefinic alcohol), poly(vinylpyrrolidone), poly(hydroxypropylmethacrylamide), poly([alpha]-hydroxy acid), poly(vinyl alcohol), polyphosphazene, polyoxazoline, poly(N-acryloylmorpholine), such as described in U.S. Pat. No. 5,629,384, which is incorporated by reference herein in its entirety, as well as copolymers, terpolymers, and mixtures thereof.
- PPG poly(propylene glycol)
- PPG poly(propylene glycol)
- the polymeric linker may alter a property of the procoagulant protein, such as its bioavailability, biological activity or its half-life in the body.
- the polymeric linker is, preferably, linear.
- the molecular weight of each individual polymer chain may vary, it is typically in the range of from about 1,000 Da (1 kDa) to about 40,000 Da (40 kDa), such as about 1,000 Da to about 12,000 Da such as about 2,000 Da to about 11,000 Da, such as about 2,000 Da to about 3,000 Da; about 3,000 Da to about 4,000 Da; about 4,000 to about 5,000 Da; about 5,000 to about 6,000 Da; about 6,000 to about 7,000 Da; about 7,000 to about 8,000 Da; about 8,000 to about 9,000 Da; about 9,000 to about 10,000 Da; or about 10,000 to about 11,000 Da. It should be understood that these sizes represent estimates rather than exact measures.
- the molecules according to the invention are conjugated with a heterogenous population of hydrophilic polymers.
- a chemical moiety used in the linker comprises polyethylene glycol (PEG).
- PEG poly(ethylene glycol)
- n′ is an integer larger than 1.
- PEG is prepared by polymerization of ethylene oxide and is commercially available over a wide range of molecular weights.
- the PEG for use according to the present invention is, preferably, linear.
- PEG may refer to a polyethylene glycol compound, or derivative thereof, with or without coupling agents, coupling or activating moieties (e.g., with carboxylic acid/active ester, keto, alkoxyamine, thiol, triflate, tresylate, aziridine, oxirane, alkyne, azide or a maleimide moiety).
- coupling or activating moieties e.g., with carboxylic acid/active ester, keto, alkoxyamine, thiol, triflate, tresylate, aziridine, oxirane, alkyne, azide or a maleimide moiety.
- the PEG for use according to the invention is monodisperse. In another particular embodiment, the PEG for use according to the invention is polydisperse.
- Polydisperse PEG is composed of PEG molecules that have various molecular weights.
- the size distribution can be characterized statistically by its weight average molecular weight (Mw) and its number average molecular weight (Mn), the ratio of which is called the polydispersity index (Mw/Mn) (see e.g. “Polymer Synthesis and Characterization”, J. A. Nairn, University of Utah, 2003). Mw and Mn can be measured by mass spectroscopy.
- the polydispersity index may be a number that is greater than or equal to one and it may be estimated from Gel Permeation Chromatographic data.
- the polydispersity index is 1, the product is monodisperse and is thus made up of compounds with a single molecular weight.
- the polydispersity index is greater than 1 the polymer is polydisperse, and the polydispersity index tells how broad the distribution of polymers with different molecular weights is.
- the polydispersity index typically increases with the molecular weight of the PEG.
- the polydispersity index of the PEG for use according to the invention is i) below 1.06, ii) below 1.05, iii) below 1.04, iv) below 1.03 or v) between 1.02 and 1.03.
- conjugation of PEG substituents are described in Advanced Drug Delivery Reviews, 2002, 54, 459-476, Nature Reviews Drug Discovery, 2003, 2, 214-221 DOI:10.1038/nrd1033 , Adv Polym Sci, 2006, 192, 95-134, DOI 10.1007/12 — 022, Springer-Verlag, Berlin Heidelberg, 2005, and references therein.
- conjugation of the hydrophilic polymer substituent could take place by use of enzymatic methods. Such methods are for instance use of glycosyltransferases as described in WO2003/031464 or use of transglutaminases as described in WO2006134148.
- the hydroxyl end groups of the polymer molecule are provided in activated form, i.e. with reactive functional groups.
- Suitable activated polymer molecules are commercially available, e.g. from Sigma-Aldrich Corporation, St. Louis, Mo., USA, Rapp Polymere GmbH, Tübingen, Germany, or from PolyMASC Pharmaceuticals plc, UK.
- the polymer molecules can be activated by conventional methods known in the art, e.g. as disclosed in WO 90/13540.
- Specific examples of activated PEG polymers are disclosed in U.S. Pat. No. 5,932,462 and U.S. Pat. No. 5,643,575.
- the following publications disclose useful polymer molecules and/or PEGylation chemistries: WO2003/031464, WO2004/099231.
- the conjugation of the monoclonal antibody, fragment thereof or coagulation factor with the activated polymer molecules may be conducted by use of any conventional method, e.g. as described in the following references (which also describe suitable methods for activation of polymer molecules): R. F. Taylor, (1991), “Protein immobilisation. Fundamental and applications”, Marcel Dekker, N.Y.; S. S. Wong, (1992), “Chemistry of Protein Conjugation and Crosslinking”, CRC Press, Boca Raton; G. T. Hermanson et al., (1993), “Immobilized Affinity Ligand Techniques”, Academic Press, N.Y., ‘Bioconjugate Techniques, Second Edition, Greg T. Hermanson, 2008, Amsterdam, Elsevier).
- the activation method and/or conjugation chemistry to be used depends on the attachment group(s) of the polypeptide (examples of which are given further above), as well as the functional groups of the polymer (e.g. being amine, hydroxyl, carboxyl, aldehyde, sulfhydryl, succinimidyl, maleimide, vinylsulfone or haloacetate).
- the PEGylation may be directed towards conjugation to all available attachment groups on the polypeptide (i.e. such attachment groups that are exposed at the surface of the polypeptide) or may be directed towards one or more specific attachment groups, e.g. the N-terminal amino group.
- the conjugation may be achieved in one step or in a stepwise manner.
- a chemical moiety used as the linker is hydroxyethyl starch.
- hydroxyethyl starch HES/HAES
- HES/HAES hydroxyethyl starch
- Different types of hydroxyethyl starches are typically described by their average molecular weight, typically around 130 to 200 kDa.
- a chemical moiety used in the linker comprises polysialic acid.
- a chemical moiety used in the linker is attached to at least one of the proteins to a glycan: a polysaccharide or an oligosaccharide that is attached to a protein.
- a chemical moiety used in the linker is attached to at least one of the proteins to an O-linked glycan.
- a chemical moiety used in the linker is attached to at least one of the proteins to an N-linked glycan.
- N-glycans and O-glycans are attached to proteins such as mAbs and coagulation factors by the cells producing these proteins.
- the cellular N-glycosylation machinery recognizes and glycosylates N-glycosylation signals (N-X-S/T motifs) in the amino acid chain, as the nascent protein is translocated from the ribosome to the endoplasmic reticulum (Kiely et al. 1976; Glabe et al. 1980).
- O-glycans are attached to specific O-glycosylation sites in the amino acid chain, but the motifs triggering O-glycosylation are much more heterogenous than the N-glycosylation signals, and our ability to predict O-glycosylation sites in amino acid sequences is still inadequate (Julenius et al. 2004). Methods of conjugating polypeptides with various polymeric side groups are described e.g. in WO0331464.
- a chemical moiety used in the linker comprises a chemical moiety, which is used to attach said linker to at least one of the proteins with a structure selected of the biradicals:
- the linker comprises the biradical structure of
- the linker comprises the structure
- anti-TLT-1 mAb (fragment) may be a full size mAb against TLT-1 or a fragment or an analogue intellectually derived thereof such as but not limited to, a FAB-fragment or a sc-FAB with none, one or more point mutations
- the linker may be a water soluble polymer such as but not limited to e.g. PEG, polysialic acid, or hydroxyethyl starch
- protein is any protein which is thought to has one or more improved properties when attached to anti-TLT-1 mAb (fragment) may be for example prepared in a two step procedure.
- a linker with two different reactive groups RS1 and RS2 may be attached to the anti-TLT-1 mAb (fragment).
- the reaction may be run with low site selectivity or in a selective way, such that RS1 only reacts at one or few position of the anti TLT-1 mAb (fragment).
- RS1 could be an aldehyde and react by reductive amination only with N-termini of the anti TLT-1 mAb (fragment) by reductive amination, known to a person trained in the art.
- Another non-exclusive example RS1 could be a maleimide group, which may react with a free thiol on the anti TLT-1 mAb (fragment).
- the reactive group RS2 may be reacted with low site selectivity or site selectivity with a FVIIa molecule.
- a site selective reaction at FVIIa may be obtained when RS2 is a sialic acid derivative, which can react in the presence of a suitable enzyme such as but not limited to ST3Gal-III with N-linked glycans, which do not end exclusively with sialic acids.
- the order of attachment of the linker to the two proteins, namely the anti-TLT-1 mAb (fragment) and the protein may be switched, thereby attaching the RS1-Linker-RS2 molecule first to the protein molecule and then to the anti TLT-1 mAb (fragment).
- the present invention provides compositions and formulations comprising molecules of the invention, such as the fusion proteins, polynucleotides, vectors and cells described herein.
- the invention provides a pharmaceutical composition that comprises one or more fusion proteins of the invention, formulated together with a pharmaceutically acceptable carrier.
- one object of the invention is to provide a pharmaceutical formulation comprising such an antibody which is present in a concentration from 0.25 mg/ml to 250 mg/ml, and wherein said formulation has a pH from 2.0 to 10.0.
- the formulation may further comprise a buffer system, preservative(s), tonicity agent(s), chelating agent(s), stabilizers and surfactants.
- preservatives tonicity agent(s)
- chelating agent(s) chelating agent(s)
- stabilizers and surfactants The use of preservatives, isotonic agents, chelating agents, stabilizers and surfactants in pharmaceutical compositions is well-known to the skilled person. Reference may be made to Remington: The Science and Practice of Pharmacy, 19 th edition, 1995.
- the pharmaceutical formulation is an aqueous formulation.
- aqueous formulation is defined as a formulation comprising at least 50% w/w water.
- aqueous solution is defined as a solution comprising at least 50% w/w water, and the term “aqueous suspension” is defined as a suspension comprising at least 50% w/w water.
- the pharmaceutical formulation is a freeze-dried formulation, to which the physician or the patient adds solvents and/or diluents prior to use.
- the pharmaceutical formulation comprises an aqueous solution of such an antibody, and a buffer, wherein the antibody is present in a concentration from 1 mg/ml or above, and wherein said formulation has a pH from about 2.0 to about 10.0.
- treatment refers to the medical therapy of any human or other animal subject in need thereof. Said subject is expected to have undergone physical examination by a medical practitioner, who has given a tentative or definitive diagnosis which would indicate that the use of said specific treatment is beneficial to the health of said human or other animal subject.
- the timing and purpose of said treatment may vary from one individual to another, according to the status quo of the subject's health.
- Preventative or prophylactic administration of antibodies of the invention is also contemplated, with prevention being defined as delaying or averting manifestation aggravation of one or more symptoms of a disease or disorder.
- said treatment may be prophylactic, palliative, symptomatic and/or curative.
- prophylactic, palliative, symptomatic and/or curative treatments may represent separate aspects of the invention.
- a coagulopathy that results in an increased haemorrhagic tendency may be caused by any qualitative or quantitative deficiency of any pro-coagulative component of the normal coagulation cascade or any upregulation of fibrinolysis.
- Such coagulopathies may be congenital and/or acquired and/or iatrogenic and are identified by a person skilled in the art.
- Non-limiting examples of congenital hypocoagulopathies are haemophilia A, haemophilia B, Factor VII deficiency, Factor X deficiency, Factor XI deficiency, von Willebrand's disease and thrombocytopenias such as Glanzmann's thombasthenia and Bernard-Soulier syndrome.
- a non-limiting example of an acquired coagulopathy is serine protease deficiency caused by vitamin K deficiency; such vitamin K-deficiency may be caused by administration of a vitamin K antagonist, such as warfarin.
- Acquired coagulopathy may also occur following extensive trauma. In this case otherwise known as the “bloody vicious cycle”, it is characterised by haemodilution (dilutional thrombocytopaenia and dilution of clotting factors), hypothermia, consumption of clotting factors and metabolic derangements (acidosis). Fluid therapy and increased fibrinolysis may exaserbate this situation. Said haemorrhage may be from any part of the body.
- Haemophilia A with “inhibitors” that is, allo-antibodies against factor VIII
- haemophilia B with “inhibitors” that is, allo-antibodies against factor IX
- coagulopathies that are partly congenital and partly acquired.
- a non-limiting example of an iatrogenic coagulopathy is an overdosage of anticoagulant medication—such as heparin, aspirin, warfarin and other platelet aggregation inhibitors—that may be prescribed to treat thromboembolic disease.
- a second, non-limiting example of iatrogenic coagulopathy is that which is induced by excessive and/or inappropriate fluid therapy, such as that which may be induced by a blood transfusion.
- haemorrhage is associated with haemophilia A or B. In another embodiment, haemorrhage is associated with haemophilia A or B with acquired inhibitors. In another embodiment, haemorrhage is associated with von Willebrand's disease. In another embodiment, haemorrhage is associated with severe tissue damage. In another embodiment, haemorrhage is associated with severe trauma. In another embodiment, haemorrhage is associated with surgery. In another embodiment, haemorrhage is associated with haemorrhagic gastritis and/or enteritis. In another embodiment, the haemorrhage is profuse uterine bleeding, such as in placental abruption. In another embodiment, haemorrhage occurs in organs with a limited possibility for mechanical haemostasis, such as intracranially, intraaurally or intraocularly. In another embodiment, haemorrhage is associated with anticoagulant therapy.
- haemorrhage may be associated with thrombocytopaenia.
- constructs of the current invention may be co-administered with platelets.
- Embodiment 1 A procoagulant protein comprising (i) at least one coagulation factor, covalently attached to (ii) an antibody, or fragment thereof, that is capable of binding (iii) TLT-1, and/or a fragment or variant thereof.
- Embodiment 2 The procoagulant protein according to embodiment 1, wherein (iii) is TLT-1, or a fragment or variant thereof.
- Embodiment 3 The procoagulant protein according to embodiment 2, wherein (iii) is TLT-1 (16-162).
- Embodiment 4 The procoagulant protein according to embodiment 2, wherein (iii) is TLT-1 (20-125).
- Embodiment 5 The procoagulant protein according to embodiment 2, wherein (iii) is TLT-1 (126-162).
- Embodiment 6 The procoagulant protein according to any one of embodiments 1-2, wherein (i) is a serine protease or a derivative thereof.
- Embodiment 7 The procoagulant protein according to embodiment 3, wherein (i) is a Factor VII polypeptide.
- Embodiment 8 The procoagulant protein according to embodiment 3, wherein (i) is a Factor IX polypeptide.
- Embodiment 9 The procoagulant protein according to embodiment 3, wherein (i) is a Factor X polypeptide.
- Embodiment 10 The procoagulant protein according to any one of embodiments 1-2, wherein (i) is a Factor V polypeptide.
- Embodiment 11 The procoagulant protein according to any one of embodiments 1-2, wherein (i) is a Factor VIII polypeptide.
- Embodiment 12 The procoagulant protein according to any one of embodiments 1-2, wherein (i) is a Factor XI polypeptide.
- Embodiment 13 The procoagulant protein according to any one of embodiments 1-6, wherein (ii) is a monoclonal antibody or a fragment thereof.
- Embodiment 14 The procoagulant protein according to embodiment 10, wherein (ii) is a Fab fragment, a F(ab′) 2 fragment, a Fab′ fragment, a Fd fragment, a Fv fragment, a ScFv fragment, a dAb fragment or an isolated complementarity determining region (CDR).
- (ii) is a Fab fragment, a F(ab′) 2 fragment, a Fab′ fragment, a Fd fragment, a Fv fragment, a ScFv fragment, a dAb fragment or an isolated complementarity determining region (CDR).
- Embodiment 15 The procoagulant protein according embodiment 11, wherein (ii) is a Fab fragment.
- Embodiment 16 The procoagulant protein according to any one of embodiments 13-15, wherein the epitope of (ii) comprises one or more residues selected from the group consisting of V17, Q18, C19, H20, Y21, R22, L23, Q24, D25, V26, K27, A28, L63, G64, G65, G66, L67, L68, G89, A90, R91, G92, P93, Q94, I95 and L96 of SEQ ID NO: 5.
- Embodiment 17 The procoagulant protein according to any one of embodiments 13-15, wherein (ii) is an antibody, or a fragment thereof, which is capable of binding to the same epitope as mAb0023.
- Embodiment 18 A procoagulant protein according to any of embodiments 16-17, wherein the heavy chain of (ii) comprises:
- Embodiment 19 A procoagulant protein according to any of embodiments 16-18, wherein the light chain of (ii) comprises:
- Embodiment 20 A procoagulant protein according to any of embodiments 16-17, wherein the heavy chain of (ii) comprises:
- Embodiment 21 A procoagulant protein according to embodiment 20, wherein the heavy chain of (ii) comprises:
- Embodiment 22 The procoagulant protein according to any one of embodiments 13-15, wherein the epitope of (ii) comprises one or more residues selected from the group consisting of L36, P37, E38, G39, C40, Q41, P42, L43, V44, S45, S46, A47, V73, T74, L75, Q76, E77, E78, D79, A80, G81, E82, Y83, G84, C85, M86, R91, G92, P93, Q94, I95, L96, H97, R98, V99, S100 and L101 of SEQ ID NO: 5.
- Embodiment 23 The procoagulant protein according to any one of embodiments 13-15, wherein (ii) is an antibody, or a fragment thereof, which is capable of binding to the same epitope as mAb0051.
- Embodiment 24 A procoagulant protein according to any one of embodiments 22-23, wherein the heavy chain of (ii) comprises:
- Embodiment 25 A procoagulant protein according to any of embodiments 22-24, wherein the light chain of (ii) comprises:
- Embodiment 26 A procoagulant protein according to any one of embodiments 22-23, wherein the heavy chain of (ii) comprises:
- Embodiment 27 A procoagulant protein according to embodiment 26, wherein the heavy chain of (ii) comprises:
- Embodiment 28 The procoagulant protein according to any one of embodiments 13-15, wherein the epitope of (ii) comprises one or more residues selected from the group consisting of V17, Q18, C19, H20, Y21, R22, L23, Q24, D25, V26, K27, A28, R91, G92, P93, Q94, I95, L96, H97, R98, V99, S100 and L101 of SEQ ID NO: 5.
- Embodiment 29 The procoagulant protein according to any one of embodiments 13-15, wherein (ii) is an antibody, or a fragment thereof, which is capable of binding to the same epitope as mAb0062.
- Embodiment 30 A procoagulant protein according to any one of embodiments 28-29, wherein the heavy chain of (ii) comprises:
- Embodiment 31 A procoagulant protein according to any of embodiments 28-30, wherein the light chain of (ii) comprises:
- Embodiment 32 A procoagulant protein according to any of embodiments 28-31, wherein the heavy chain of (ii) comprises:
- Embodiment 33 A procoagulant protein according to embodiment 32, wherein the heavy chain of (ii) comprises:
- Embodiment 34 The procoagulant protein according to any one of embodiments 13-15, wherein the epitope of (ii) comprises one or more residues selected from the group consisting of E5, T6, H7, K8, I9, G10, S11, L12, A13, E14, N15, A16, F17, S18, D19, P20 and A21 of SEQ ID NO: 7.
- Embodiment 35 The procoagulant protein according to embodiment 34, wherein said residues are K8, I9, G10, S11, L12, A13, N15, A16, F17, S18, D19, P20 and A21.
- Embodiment 36 The procoagulant protein according to any one of embodiments 13-15, wherein the epitope of (ii) comprises one or more residues selected from the group consisting of K118, 1119, G120, S121, L122, A123, E124, N125, A126, F127 of SEQ ID NO: 6.
- Embodiment 37 The procoagulant protein according to any one of embodiments 13-15, wherein (ii) is an antibody, or a fragment thereof, which is capable of binding to the same epitope as mAb0061 or mAb0082.
- Embodiment 38 A procoagulant protein according to any one of embodiments 34-37, wherein the heavy chain of (ii) comprises:
- Embodiment 39 A procoagulant protein according to any of embodiments 34-38, wherein the light chain of (ii) comprises:
- Embodiment 40 A procoagulant protein according to any of embodiments 34-39, wherein the heavy chain of (ii) comprises:
- Embodiment 41 A procoagulant protein according to embodiment 40, wherein the heavy chain of (ii) comprises:
- Embodiment 42 A procoagulant protein according to any of embodiments 34-37, wherein the heavy chain of (ii) comprises:
- Embodiment 43 A procoagulant protein according to embodiment 42, wherein the heavy chain of (ii) comprises:
- Embodiment 44 The procoagulant protein according to any one of embodiments 13-15, wherein the paratope of (ii) comprises one or more residues selected from the group consisting of H50, N52, Y56, H58, Y73, F79, S115, T116, V118 and Y120 of the anti-TLT-1 light (L) chain (SEQ ID NO: 33), and residues V20, F45, R49, Y50, W51, E68, T75, N77, S116, G117, V118 and T120 of the anti-TLT-1 heavy (H) chain (SEQ ID NO: 32)
- Embodiment 45 The procoagulant protein according to any one of embodiments 13-15 and 44, wherein the epitope of (ii) comprises one or more residues selected from the group consisting of K133, I134, G135, S136, L137, A138, N140, A141, F142, S143, D144, P145 and A146 of SEQ ID NO: 4.
- Embodiment 46 The procoagulant protein according to any one of embodiments 13-15, wherein (ii) is an antibody, or a fragment thereof, which is capable of binding to the same epitope as mAb0012.
- Embodiment 47 A procoagulant protein according to any of embodiments 44-46, wherein the heavy chain of (ii) comprises:
- Embodiment 48 A procoagulant protein according to any of embodiments 44-47, wherein the light chain of (ii) comprises:
- Embodiment 49 A procoagulant protein according to any of embodiments 44-48, wherein the heavy chain of (ii) comprises:
- Embodiment 50 A procoagulant protein according to embodiment 49, wherein the heavy chain of (ii) comprises:
- Embodiment 51 The procoagulant protein according to any one of embodiments 1-50, wherein (ii) is a human monoclonal antibody or a fragment thereof.
- Embodiment 52 The procoagulant protein according to any one of embodiments 1-50, wherein (ii) is a chimeric antibody or a fragment thereof.
- Embodiment 53 The procoagulant protein according to any one of embodiments 1-50, wherein (ii) is a humanised antibody or a fragment thereof.
- Embodiment 54 The procoagulant protein according to any one of embodiments 51-53, wherein the isotype of (ii) is IgG.
- Embodiment 55 The procoagulant protein according to embodiment 54, wherein the isotype is IgG1, IgG2 or IgG4.
- Embodiment 56 The procoagulant protein according to embodiment 55, wherein the isotype is IgG4.
- Embodiment 57 The procoagulant protein according to any one of embodiments 1-56, further comprising a linker between (i) and (ii).
- Embodiment 58 The procoagulant protein according to any one of embodiments 1-57, which is a fusion protein.
- Embodiment 59 The procoagulant protein according to any one of embodiments 1-57, which is a conjugate of (i) and (ii).
- Embodiment 60 The conjugate according to embodiment 59, wherein (i) and (ii) are covalently connected by a linker comprising polyethyleneglycol (PEG).
- PEG polyethyleneglycol
- Embodiment 61 The conjugate according to any one of embodiments 59-60, wherein (i) and (ii) are covalently conjugated via a glycan of at least one of said proteins.
- Embodiment 62 A process for preparing a composition comprising at least one conjugate according to any one of embodiments 59-61, comprising chemically conjugating (i) the -TLT-1 antibody or fragment thereof with one reactive group (RS1) of a linker and reacting (ii) the coagulation factor with another reactive group (RS2) of said linker.
- RS1 reactive group
- RS2 reactive group
- Embodiment 63 The process as defined in embodiment 62, wherein (i) is a monoclonal antibody.
- Embodiment 64 The process as defined in embodiment 62, wherein (i) is a fragment of a monoclonal antibody.
- Embodiment 65 The process as defined in embodiment 64, wherein (i) is a Fab fragment.
- Embodiment 66 The process as defined in embodiment 65, wherein said Fab fragment contains one Cys mutation in the constant region.
- Embodiment 67 The process as defined in embodiment 62, wherein (i) is a scFab fragment.
- Embodiment 68 The process as defined in any one of embodiments 62-67, wherein (ii) is a FV polypeptide.
- Embodiment 69 The process as defined in any one of embodiments 62-67, wherein (ii) is a FVIIa polypeptide.
- Embodiment 70 The process as defined in any one of embodiments 62-67, wherein (ii) is a FVIII polypeptide.
- Embodiment 71 The process as defined in any one of embodiments 62-67, wherein (ii) is a FIX polypeptide.
- Embodiment 72 The process as defined in any one of embodiments 62-67, wherein (ii) is a FX polypeptide.
- Embodiment 73 The process as defined in any one of embodiments 62-67, wherein (ii) is a FXI polypeptide.
- Embodiment 74 The process as defined in any one of embodiments 62-73, wherein said linker is a water soluble.
- Embodiment 75 The process as defined in any one of embodiments 62-74, wherein said linker is polymer.
- Embodiment 76 The process as defined in any one of embodiments 74-75, wherein (ii) is polyethylene glycol (PEG).
- PEG polyethylene glycol
- Embodiment 77 The process as defined in any one of embodiments 74-75, wherein (ii) is polysialic acid.
- Embodiment 78 The process as defined in any one of embodiments 74-75, wherein (ii) is hydroxyethyl starch.
- Embodiment 79 The process as defined in any one of embodiments 62-78, wherein RS1 is an aldehyde.
- Embodiment 80 The process as defined in any one of embodiments 62-78, wherein RS1 is a maleimide group.
- Embodiment 81 The process as defined in any one of embodiments 62-78, wherein RS1 is activated carbohydrate derivative capable of reacting in an enzyme-catalysed reaction.
- Embodiment 82 The process as defined in any one of embodiments 81, wherein RS1 is an activated sialic acid derivative capable of reacting in an enzyme-catalysed reaction.
- Embodiment 83 The process as defined in embodiment 82, wherein RS1 is O 2 -[5′]cytidylyl- ⁇ -neuraminic acid.
- Embodiment 84 The process as defined in any one of embodiments 62-83, wherein RS2 is an aldehyde.
- Embodiment 85 The process as defined in any one of embodiments 62-83, wherein RS2 is a maleimide group.
- Embodiment 86 The process as defined in any one of embodiments 62-83, wherein RS2 is activated carbohydrate derivative capable of reacting in an enzyme-catalysed reaction.
- Embodiment 87 The process as defined in any one of embodiments 62-83, wherein RS2 is a sialic acid derivative.
- Embodiment 88 The procoagulant protein according to any one of embodiments 1-61, in which (ii) has a K D of less than 100 nM, such as less than 10 nM.
- Embodiment 89 A method of targeting a coagulation factor, or a functional fragment thereof, to the surface of activated platelets, said method comprising the contacting of activated platelets with a procoagulant protein according to any one of embodiments 1-61.
- Embodiment 90 A procoagulant protein according to any one of embodiments 1-61 for use as a medicament.
- Embodiment 91 The procoagulant protein of embodiment 87 for use as a procoagulant.
- Embodiment 92 A pharmaceutical formulation comprising the procoagulant protein according to any one of embodiments 1-61.
- Embodiment 93 The procoagulant protein according to any one of embodiments 1-61 or the pharmaceutical formulation according to embodiment 92 for use in the treatment of a coagulopathy.
- Embodiment 94 Use of the procoagulant protein according to any one of embodiments 1-61 for the manufacture of a medicament for the treatment of a coagulopathy.
- Embodiment 95 Use according to any one of embodiments 93 or 94, wherein said coagulopathy is haemophilia A, with or without inhibitors, or haemophilia B, with or without inhibitors.
- Embodiment 96 A method of treating coagulopathy, comprising administering an effective amount of the procoagulant protein according to any one of embodiments 1-61 or the formulation of embodiment 93 to an individual in need thereof.
- Embodiment 97 The method according to embodiment 95, wherein said coagulopathy is haemophilia A, with or without inhibitors, and haemophilia B, with or without inhibitors.
- Embodiment 98 A polynucleotide that encodes the procoagulant protein according to any one of embodiments 1-61.
- Embodiment 99 An isolated cell that comprises the fusion protein according to any one of embodiments 1-61 and/or the polynucleotide according to embodiment 97.
- Embodiment 100 A procoagulant protein to any one of embodiments 1-61, wherein (ii) bind to TLT-1 without competing with fibrinogen binding to TLT-1.
- Embodiment 101 A procoagulant protein to any one of embodiments 1-61, wherein (ii) does not inhibit platelet aggregation.
- anti-TLT-1 antibodies and fragments thereof e.g. Fab fragments
- Table 3a summarizes information regarding some of the anti-TLT-1 antibodies and fragments thereof further described below.
- parent antibodies, variants, fragments, fusions and conjugates thereof are listed with reference to the parent mAb and type of protein.
- Name refers to the name of the protein
- Parent refers to the antibody from which the anti-TLT-1 mAb, Fab or fusion/conjugate is derived and Type defines if the protein is a mAb, a Fab, a DNA fusion (fusion) with a coagulation factor or a chemical conjugate with a coagulation factor (conjugate).
- Nucleotide sequences encoding the extracellular domain of human TLT-1 (hTLT-1) ( FIG. 1 ) together with a C-terminal His-6 tag were PCR amplified with a forward primer containing a HindIII recognition site together with a kozak sequence, and a reverse primer containing a stop codon and an EcoRI recognition site ( FIG. 2 ).
- the HindIII- and EcoRI digested PCR fragment was inserted into the HindIII- and EcoRI sites of a pTT-based expression vector.
- the pTT vector is essentially described in Durocher, Y. et al., (2002) Nucleic Acid Res, 30: E9.
- pTT-hTLT-1 ECD-His The nucleotide and amino acid sequences for hTLT-1 ECD-His is shown in SEQ ID NO: 3 and 4.
- pTT-hTLT-1 ECD-His was transfected into HEK293-6E suspension cells in order to transiently express hTLT-1 ECD-His.
- HEK293-6E cells were grown in Freestyle HEK293 medium (GIBCO, cat. no. 12338-018) supplemented with 1% P/S (GIBCO cat. no. 15140-122), 0.1% pluronic (GIBCO, cat. no. 24040-032) and 25 ug/mL Geneticin (GIBCO, cat.
- HEK293-6E cells were transfected at a cell density of 1 mill/mL using 293fectin (Invitrogen, cat. no. 12347-019).
- 293fectin Invitrogen, cat. no. 12347-019
- the transfection was performed by diluting 1 mg of pTT-hTLT-1 ECD-His DNA into 30 mL Optimem (dilution A) and by diluting 1 mL 293fectin into 30 mL Optimem (GIBCO, cat. no. 51985-026, dilution B). Dilution A and B were mixed and incubated at room temperature for 30 minutes.
- the transfection mix was hereafter added to the HEK293-6E cells and cells were incubated at 37° C.
- hTLT-1 ECD-His protein Purification of the hTLT-1 ECD-His protein was conducted as a 2-step process composed of 1) His-affinity chromatography using the Cobalt-loaded resin TALON (Clontech, cat. no. 635506) and 2) anion-exchange chromatography using the fine-particle resin Source 15Q (GE Healthcare, cat. no. 17-0947). The purifications were conducted using an ⁇ ktaExplorer chromatography system (GE Healthcare, cat. no. 18-1112-41).
- the buffer systems used for the first purification step was an equilibration buffer composed of 20 mM Hepes, pH 7.0, 150 mM NaCl, a wash buffer composed of 20 mM Hepes, pH 7.0, 0.5 M NaCl and an elution buffer composed of 20 mM Hepes, pH 7.0, 150 mM Imidazole.
- the cell supernatant was applied directly without any adjustments onto a pre-equilibrated TALON column.
- the column was washed with 20 column volumes of equilibration buffer, 20 column volumes of wash buffer and last with 20 column volumes of equilibration buffer.
- the protein was eluted isocratically in approximately 5 column volumes of elution buffer.
- the molecular mass of the eluted protein was analysed using SDS-PAGE/Coomassie NuPage 4-12% Bis-Tris gels (Invitrogen, cat. no. NP0321BOX) and Matrix Assisted Laser Desorption Ionisation Time-of-Flight Mass Spectrometry (MALDI-TOF MS) setup on a Micro-flex system (Bruker Daltonics).
- MALDI-TOF MS Matrix Assisted Laser Desorption Ionisation Time-of-Flight Mass Spectrometry
- the hTLT-1 ECD-His protein contained an interlinked C—C dimer.
- the buffer systems used for this purification step was an equilibration buffer composed of 50 mM Hepes, pH 8.0 and an elution buffer composed of 50 mM Hepes, pH 8.0, 1 M NaCl. The sample was adjusted to a pH of 8.0 using 1 M NaOH and then diluted to a conductivity of approximately 10 mS/cm.
- the protein was applied to a pre-equilibrated Source 15Q column, washed with 5 column volumes of equilibration and eluted using 0-100% elution buffer over 20 column volumes. Based on UV280 monitoring, two peaks were apparent with almost base-line separation. Analyzing fractions over the two peaks using SDS-PAGE/Coomassie, MALDI-TOF MS and Dynamic Light-Scattering (DLS) using a Dynapro instrument (Wyatt Technology) analyses showed the presence of monomer hTLT-1 ECD-His protein in the peak eluting first and Cys-Cys dimer in the peak eluting second. A pool was prepared containing the monomer hTLT-1 ECD-His protein only.
- the final protein integrity was analyzed based on a Size-Exclusion High-Performance Liquid Chromatographic (SEC-HPLC) method setup on an Agilent LC 1100/1200 system and using a BIOSep-SEC-S3000 300 ⁇ 7.8 mm column (Phenomenex, cat. no. 00H-2146-K0) and a running buffer composed of 200 mM NaPhosphate pH 6.9, 300 mM NaCl and 10% isopropanol.
- the protein eluted as a single symmetric peak at a retention time of approximately 9.9 min at a flow rate of 1 ml/min.
- hTLT-1 ECD-His A batch of hTLT-1 ECD-His was prepared for an immunization study for production of monoclonal anti-TLT-1 antibodies.
- the protein was dialyzed into an isotonic PBS buffer using a Slide-A-Lyzer Dialysis Cassette 10 kDa MWCO (Pierce, cat. no. 66453).
- a NanoDrop spectropho-tometer (Thermo Scientific) was used together with an extinction coefficient of 0.55.
- RBF mice were immunized by injecting 50 ⁇ g of hTLT-1 ECD-His. FCA subcutaneously followed by two injections with 20 ⁇ g of hTLT-1 ECD-His in FIA. High responder mice were boosted intravenously with 25 ⁇ g of hTLT-1 ECD-His and the spleens were harvested after 3 days. Spleen cells were fused with the myeloma Fox cell line. Supernatants were screened for hTLT-1 specific antibody production in a specific ELISA and in a FACS assay utilizing hTLT-1- or Mock-transfected CHO cells as positive and negative target cells, respectively. A secondary screen was done on resting versus dual agonistic activated platelets of human, cynomolgous monkey, dog, rabbit or mouse origin.
- the light chain (LC) and heavy chain (HC) coding region cDNAs from each of the four anti-TLT-1 hybridomas were hereafter PCR amplified using UPM forward primer mix together with either a mouse LC,kappa specific reverse primer (reverse primer number 339, 348, or 610) or together with a reverse primer recognizing mouse IgG1, IgG2a, IgG2b or IgG3 sequences (reverse primer number 341, 347, 613, 614, 615, or 616, primer sequences are shown in Table 4 and SEQ ID NOs 60-145).
- the PCR reactions were performed using phusion PCR mix (FinnZymes, cat no.: F-531L).
- the resulting PCR fragments were cloned using Zero blunt Topo PCR cloning kit for sequencing (Invitrogen, cat. no. K287540) and sequenced.
- the variable domain sequences for 0012LC and HC are shown in FIG. 3 .
- the HC variable domain (V H ) encoding DNA sequences isolated from each of the four different anti-TLT-1 hybridomas were PCR amplified with forward primers containing a HinDIII restriction enzyme site and reverse primers containing a NheI restriction enzyme site for cloning purposes.
- the 0012V H , 0023V H , 0051V H and 0052V H DNA sequences were PCR amplified using phusion PCR mix (FinnZymes, cat No.
- primer sequences are shown in Table 4 and SEQ ID NOs 60-145), respectively, and inserted into the HinDIII and NheI restriction enzyme sites of a pTT based vector designated pTT-hIgG4, containing the constant region encoding sequences for human IgG4 HC (ie CH1-hinge-CH2-CH3).
- the pTT vector is essentially described in Durocher, Y. et al., (2002) Nucleic Acid Res, 30: E9 ( FIG. 22 ).
- the resulting vectors were designated pTT-0012HC ( FIG. 5 ), pTT-0023HC, pTT-0051HC, and pTT-0052HC.
- the anti-TLT-1 HC amino acid sequences encoded by the expression vectors are shown (SEQ. ID NO: 0012HC: 32, 0023HC: 34, 0051HC: 36, 0052HC: 38).
- V L The LC variable domain (V L ) encoding DNA sequences isolated from each of the four different anti-TLT-1 hybridomas were PCR amplified with forward primers containing a HinDIII restriction enzyme site and reverse primers containing a BsiWI restriction enzyme site for cloning purposes.
- the 0012V L , 0023V L , 0051V L and 0052V L DNA sequences were PCR amplified with the following primers number pairs: 493 (forward)+495 (reverse), 548 (forward)+549 (reverse), 492 (forward)+494 (reverse), and 619 (forward)+620 (reverse primer sequences are shown in Table 4 and SEQ ID NOs 60-145), respectively, and inserted into the HinDIII and BsiWI restriction enzyme sites of a pTT-based vector designated, pTT-hLC,Kappa, containing the constant region encoding sequences for human LC, kappa.
- the resulting vectors were designated pTT-0012LC, pTT-0023LC, pTT-0051LC, and pTT-0052LC.
- the anti-TLT-1 LC amino acid sequence encoded by the expression vectors are shown in (SEQ ID NO: 0012LC: 33, 0023LC: 35, 0051LC: 37, 0052LC: 39).
- the 0012V H amino acid sequence contains a potential N-linked glycosylation site (T60, kabat numbering) and the 0012V L and the 0052V H amino acid sequences each contain an unpaired Cys (C36 and C91, respectively, kabat numbering).
- Expression vectors encoding 0012HC.T60N or 0012HC.T60A or 0012LC.C36A or 0052HC.C91Y were developed using site directed mutagenesis (Quickchange II, Stratagene, Catalog number 20523-5) following the instructions of the manufacturer.
- the site-directed mutagenesis reactions were performed using a) pTT-0012HC DNA as template and primer numbers 682 (forward)+683 (reverse) for pTT-0012HC.T60N, b) pTT-0012HC DNA as template and primer numbers 688 (forward)+689 (reverse) for pTT-0012HC.T60A, c) pTT-0012LC DNA as template and primer numbers 598 (forward)+599 (reverse) for pTT-0012LC.C36A, d) pTT-0052HC DNA as template and the following primer numbers 684 (forward)+685 (reverse, primer sequences are shown in Table 4 and SEQ ID NOs 60-145) for pTT-0052HC.C91Y.
- the resulting expression vectors were sequenced in order to verify DNA sequences.
- the anti-TLT-1 HC and LC amino acid sequence encoded by the pTT-0012HC.T60N, pTT-0012HC.T60A and pTT-0012LC.C36A expression vectors are shown in (SEQ ID NO: 0012HC.T60N (also called 0061HC): 40, 0012HC.T60A (also called 0082HC): 43, 0012LC.C36A (also called 0061LC): 41).
- the 0012LC.C36A amino acid sequence is also shown without the N-terminal signal peptide sequence in SEQ ID NO: 153.
- V L encoding DNA sequences isolated from each of the four different anti-TLT-1 hybridomas were PCR amplified with forward primers containing a HinDIII restriction enzyme site and reverse primers containing a BsiWI restriction enzyme site for cloning purposes.
- 0012V L , 0012V L .C36A, 0023V L , 0051V L and 0052V L DNA sequences were PCR amplified with the following primer numbers: 493 (forward)+495 (reverse), 493 (forward)+495 (reverse), 548 (forward)+549 (reverse), 492 (forward)+494 (reverse), and 619 (forward)+620 (reverse, primer sequences are shown in Table 4 and SEQ ID NOs: 60-145) respectively, using phusion PCR mix (FinnZymes, cat No. F-531L). The human C L ,kappa encoding sequence was PCR amplified with forward primer number 486 and reverse primer number 485.
- Forward primer number 486 contains a BsiWI restriction enzyme site and reverse primer 485 encodes a HPC4 tag followed by a stop codon and contains a 3′ flanking EcoRI site for cloning purposes.
- the PCR reaction was performed using phusion PCR mix (FinnZymes, cat No. F-531L).
- HindIII+BsiWI digested 0012V L PCR fragment was mixed with BsiWI+EcoRI digested human C L ,kappa-HPC4 PCR fragment and inserted into the HinDIII+EcoRI sites of a pTT-based expression vector resulting in pTT-0012LC-HPC4 ( FIG. 4 ).
- the 0012V L sequence in pTT-0012LC-HPC4 was excised with HinDIII+BsiWI and replaced with HinDIII+BsiWI digested 0023V L , 0051V L , 0052V L and 0012V L .C36A PCR fragments.
- the resulting four expression vectors were designated: pTT-0023LC-HPC4, pTT-0051LC-HPC4, pTT-0052LC-HPC4 and pTT-0012LC.C36A.HPC4 ( FIG. 4B ).
- amino acid sequences encoded by pTT-0012LC.C36A-HPC4, pTT-0023LC-HPC4, pTT-0051LC-HPC4 and pTT-0052LC-HPC4 are shown in SEQ ID NO: 0012LC.C36A-HPC4 (also called 0061LC-HPC4): 167, 0023LC-HPC4: 179, 0051LC-HPC4: 177, 0052LC-HPC4 (also called 0062LC-HPC4): 174.
- the 0012V H .T60N-CH1-YGPPC, 0023V H -CH1-YGPPC, 0051V H -CH1-YGPPC and 0052V H .C91Y-CH1-YGPPC sequence was PCR amplified from pTT-0012HC.T60N, pTT-0023HC, pTT-0051HC and pTT-0052HC.C91Y respectively using forward and reverse primer pairs: 572 (forward)+698 (reverse), 576 (forward)+698 (reverse), 627 (forward)+698 (reverse) and 617 (forward)+698 (reverse), respectively.
- the forward primers contain a HinDIII restriction enzyme site and the reverse primer 698 contains a stop codon and an EcoRI site for cloning purposes.
- the resulting PCR fragment was digested with HinDIII+EcoRI and inserted into the HinDIII+EcoRI sites of a pTT based vector.
- the resulting expression vectors were designated pTT-0012V H .T60N-CH1-YGPPC ( FIG. 4A ), pTT-0023V H -CH1-YGPPC, pTT-0051V H -CH1-YGPPC and pTT-0052V H .C91Y-CH1-YGPPC.
- amino acid sequences encoded by pTT-0012V H .T60N-CH1-YGPPC ( FIG. 4A ), pTT-0023V H -CH1-YGPPC, pTT-0051V H -CH1-YGPPC and pTT-0052V H .C91Y-CH1-YGPPC is shown in SEQ ID NO: 0012V H .T60N-CH1-YGPPC (also called 0061VH-CH1-YGPPC): 171, 0023V H -CH1-YGPPC: 178, 0051V H -CH1-YGPPC 176, 0052V H .C91Y-CH1-YGPPC (also called 0062V H -CH1-YGPPC): 175.
- the 0012V H , 0023V H , 0051V H , and 0052V H sequences isolated from 0012Hyb, 0023Hyb, 0051Hyb, 0052Hyb were PCR amplified with primer numbers: 490 (forward)+491 (reverse), 546 (forward)+547 (reverse), 627 (forward)+628 (reverse), 617 (forward)+618 (reverse, primer sequences are shown in Table 4 and SEQ ID NOs 60-145), respectively, using phusion PCR mix (FinnZymes, cat No. F-531L).
- Forward primer number 489 contained a NheI site
- the 488 reverse primer number contained a stop codon and an EcoRI site
- the 487 reverse primer number contained an HPC4 tag encoding sequence, a stop codon followed by an EcoRI site for cloning purposes.
- HinDIII+NheI digested 0012V H PCR fragment was combined with either NheI+EcoRI digested human IgG 4 CH1 PCR fragment or with NheI+EcoRI digested human IgG 4 CH1-HPC4 PCR fragment and cloned into the HindIII+EcoRI sites for a pTT based vector.
- the resulting vectors were designated pTT-0012V H -CH1 and pTT-0012V H -CH1-HPC4, respectively.
- the pTT-0012V H -CH1-HPC4 vector is shown in FIG. 5B .
- the 0012V H -CH1-HPC4 amino acid and DNA sequences are shown in SEQ ID NOs 168-169.
- V H domains of pTT-0012V H -CH1 and of pTT-0012V H -CH1-HPC4 were excised by HindIII+NheI digestion and HinDIII+NheI digested 0197-0000-0023V H , 0197-0000-0051V H and 0197-0000-0052V H PCR fragments were inserted.
- the resulting expression vectors were designated: pTT-0023V H -CH1, pTT-0023V H -CH1-HPC4, pTT-0051V H -CH1, pTT-0051V H -CH1-HPC4, pTT-0052V H -CH1, and pTT-0052V H -CH1-HPC4.
- the 0012V H .T60N-CH1 and 0052V H .C91Y-CH1 sequence were PCR amplified from pTT-0012HC.T60N and pTT-0052HC.C91Y, respectively using phusion PCR mix (FinnZymes, cat No. F-531L).
- phusion PCR mix FernZymes, cat No. F-531L.
- the forward primer number 572 containing a HinDIII restriction enzyme site and reverse primer number 488 containing a EcoRI site for cloning purposes or reverse primer 487 containing a HPC4 tag encoding sequence together with a EcoRI site for cloning purposes were employed.
- the forward primer number 617 together with either reverse primer number 488 or 487 were employed (primer sequences are shown in Table 4 and SEQ ID NOs 60-145).
- the resulting PCR fragments were digested with HinDIII+EcoRI and inserted into the HinDIII+EcoRI sites of a pTT based vector.
- the resulting expression vectors were designated pTT-0012V H .T60N-CH1, pTT-0012V H .T60N-CH1-HPC4, pTT-0052V H .C91Y-CH1 and pTT-0052V H .C91Y-CH1-HPC4.
- amino acid sequence encoded by pTT-0012V H .T60N-CH1 is shown in SEQ ID NO: 0012V H .T60N-CH1 (also called 0061VH-CH1): 146 while the corresponding amino acid sequence without the N-terminal signal peptide sequence is shown in SEQ ID NO: 152.
- the FIX DNA sequence (including the signalpeptide encoding sequence) was PCR amplified from human FIX DNA sequences using forward primer 753 and reverse primer 754.
- Forward primer 753 inserts a 5′ end HinDIII restriction enzyme site and reverse primer 754 inserts a 17 amino acid long glycine-serine linker (L4b: GGGGSGGGGSGGGGSGS) containing a 3′ end BamHI restriction enzyme site for cloning purposes.
- the FIX-L4b PCR fragment was inserted into the HinDIII+BamHI sites of pTT-hTF.1-219-L4b-0012LC i.e.
- FIX-L4b-0012LC expression construct designated pTT-FIX-L4b-0012LC ( FIG. 5A ).
- the FIX-L4b-0012LC amino acid and DNA sequences are shown in SEQ ID NO: 172-173.
- the 0012LC.C36A coding region excluding the signal peptide sequence was PCR amplified using pTT-0012LC.C36A as template and using forward primer 1055 containing a 5′ end BamHI site and reverse primer 1056 containing a stop codon and an EcoRI site for cloning purposes (Table 4).
- the resulting PCR fragment was inserted into the BamHI and EcoRI sites of pTT-FIX-L4b-0012LC i.e. replacing the 0012LC DNA sequence with 0012LC.C36A DNA sequence.
- the resulting expression vector was called pTT-FIX-L4b-0012LC.C36A and encode the amino acid sequences shown in SEQ ID NO: FIX-L4b-0012LC.C36A (also called FIX-L4b-0061LC): 182.
- the human FVII DNA sequence (including the signalpeptide encoding sequence) was PCR amplified from human FVII DNA sequences using forward primer 751 and reverse primer 752.
- Forward primer 751 inserts a 5′ end HinDIII restriction enzyme site and reverse primer 752 inserts a 17 amino acid long glycine-serine linker (L4b: GGGGSGGGGSGGGGSGS) containing a 3′ end BamHI restriction enzyme site for cloning purposes.
- the FVII-L4b PCR fragment was inserted into the HinDIII+BamHI sites of pTT-hTF.1-219-L4b-0012LC i.e.
- the 0052V H C91Y-CH1-HPC4 encoding DNA sequence was PCR amplified using pTT-0052V H .C91Y-CH1-HPC4 vector as template and using forward primer 1236 containing a 5′ end BamHI restriction enzyme site and using reverse primer 1095 containing a stop codon and an EcoRI site for cloning purposes.
- the resulting PCR fragment was inserted into the BamHI+EcoRI site of pTT-FVII-L4b-0012LC ie replacing the 0012LC sequence and resulting in the expression vector designated pTT-FVII-L4b-0052V H .C91Y-CH1-HPC4.
- the FVII-L4b-0052V H .C91Y-CH1-HPC4 amino acid is shown in SEQ ID NO: FVII-L4b-0052VH.C91Y-CH1-HPC4 (also called FVII-L4b-0062VH-CH1-HPC4): 180.
- HEK293-6E cells were grown in Freestyle HEK293 medium (GIBCO, cat. no. 12338-018) supplemented with 1% P/S (GIBCO cat. no. 15140-122), 0.1% pluronic (GIBCO, cat. no. 24040-032) and 25 ⁇ g/mL Geneticin (GIBCO, cat. no. 10131-019) and cells were transfected at a cell density of approximately 1 mill/mL using 293fectin (Invitrogen, cat. no.
- the transfection was performed by diluting a total of 1 mg of DNA into 30 mL Optimem (dilution A) and by diluting 1 mL 293fectin into 30 mL Optimem (GIBCO, cat. no. 51985-026, dilution B). Dilution A and B were mixed and incubated at room temperature for 30 minutes. The transfection mix was hereafter added to the HEK293-6E cells and cells were incubated at 37° C. in a hunified incubator with orbital rotation (125 rpm).
- plasmids were cotransfected in a 1:1 (ug:ug) plasmid ratio using a total DNA amount of 1 mg for each liter of HEK293-6E cells to be transfected.
- Primer No. Primer sequence (5′ to 3′) 339 act gga tgg tgg gaa gat gga tac agt 341 aga tcc agg ggc tag cgg ata gac aga 347 cct gta gga cca gag ggc tcc aag gac act 348 gga gct ggt ggt ggc atc tca gga cct ttg 448 ttt aaaag ctt gcc gcc acc atg gag acc cct gcc tgg ccc cgg gtc 467 gga acc tcccc gcc tga tccccc gcc acc aga ccc ttctct aaaaaaa
- Purification of the anti-TLT-1 Fabs (0084, 0074, 0003 and 0004) was conducted using affinity chromatography based on the resin kappaSelect (GE Healthcare, cat. no. 17-5458-01).
- the four Fabs contain a single free cysteine residue, each included in the sequence.
- the purification was conducted using an ⁇ ktaExplorer chromatography system (GE Healthcare, cat. no. 18-1112-41).
- the buffer systems used for the purification step was an equilibration/wash buffer composed of 10 mM NaPhosphate, pH 7.5, 150 mM NaCl and an elution buffer composed of 20 mM Formic acid, pH 3.0.
- FIX-Fab0135 Purification of FIX-Fab0135 was conducted using an affinity chromatography method based on an anti-HPC4 resin (Roche, cat. no. 11815024001). The purification was conducted using an ⁇ ktaExplorer chromatography system (GE Healthcare, cat. no. 18-1112-41).
- the buffer systems used for the purification step was an equilibration buffer composed of 20 mM Hepes, pH 7.5, 1.0 mM CaCl 2 , 100 mM NaCl and 0.005% (v/v) Tween-80, a wash buffer composed of 20 mM Hepes, pH 7.5, 1.0 mM CaCl 2 , 1.0 M NaCl and 0.005% (v/v) Tween-80, and an elution buffer composed of 20 mM Hepes, pH 7.5, 5.0 mM EDTA and 100 mM NaCl.
- Cell supernatants were adjusted with 1 mM CaCl 2 final concentration and a pH of 7.5 and applied onto a pre-equilibrated anti-HPC4 column.
- the column was washed with 5 column volumes of equilibration buffer, 5 column volumes of wash buffer and last with 5 column volumes of equilibration buffer.
- the protein was eluted isocratically in approximately 4 column volumes of elution buffer.
- the protein was analyzed using SDS-PAGE/Coomassie and Matrix Assisted Laser Desorption Ionisation Time-of-Flight Mass Spectrometry (MALDI-TOF MS) setup on a Micro-flex system (Bruker Daltonics), showing that a pure and homogenous protein with a molecular mass of 106 kDa was obtained. Since the theoretical mass of the amino acid sequence for the FIX-Fab0135 construct was 95.9 kDa, the expressed protein contained post-translational modifications. To measure the final protein concentrations, a NanoDrop spectrophotometer (Thermo Scientific) was used together with extinction coefficient of 1.29.
- MALDI-TOF MS Matrix Assisted Laser Desorption Ionisation Time-of-Flight Mass Spectrometry
- hTLT-1 ECD-HPC4 Ala mutant expression constructs were designed according to Table 6.
- the expression constructs were developed by external contractor GENEART AG (Imretepark B35, 93059 Regensburg, Germany) and all 40 expression constructs were made based on the expression vector designated pcDNA3.1(+).
- Aliquots of DNA for each of the 40 hTLT-1 ECD-HPC4 pcDNA3.1(+) expression construct were transfected into HEK293-6E suspension cells in order to transiently express each hTLT-1 ECD-HPC4 Ala mutant protein (Table 6). Transient transfection and culturing of HEK293-6E cells were performed as described in example 14.
- the buffer systems used for the affinity purification step was an equilibration buffer composed of 20 mM NaPhosphate pH 7.2, 150 mM NaCl, an elution buffer composed of 10 mM Formic acid pH 3.5 and an pH-adjustment buffer composed of 0.5 M NaPhosphate pH 9.0.
- Cell supernatants were applied directly without any adjustments onto a pre-equilibrated MabSelect SuRe column.
- the column was washed with 15 column volumes of equilibration buffer and the monoclonal antibodies were eluted isocratically in approximately 2-5 column volume of elution buffer.
- the pooled fractions were adjusted to neutral pH using the described pH-adjustment buffer immediately after elution.
- the protein was further purified and buffer exchanged using said gel filtration column.
- the running buffer used for size exclusion chromatography was a 25 mM His pH 6.5, 135 mM NaCl.
- the flow rate used was 2.5 ml/min and the monoclonal anti-TLT-1 antibodies eluted as single peaks at approximately 0.4 column volumes.
- pools were prepared which contained pure antibody protein eluting as symmetric peaks at approximately 8.5 min. and with a minimum content of earlier eluting high-molecular weight protein.
- the purified antibodies were characterized using the previously described SDSPAGE/Coomassie (as described in example 2) and SEC-HPLC methods, showing that all antibody protein preparations produced were highly homogenous. All antibodies displayed expected heavy chain components of approximately 50 kDa and light chain components of approximately 25 kDa when using reducing conditions prior to running the SDS-PAGE/Coomassie analyses. Intact molecular mass determinations were performed using a Liquid Chromatography Electrospray Ionisation Time-of-Flight Mass Spectrometry method setup on an Agilent 6210 instrument and a desalting column MassPREP (Waters, cat. no. USRM10008656).
- the buffer system used was an equilibration buffer composed of 0.1% Formic acid in LC-MS graded-H 2 O and an elution buffer composed of 0.1% Formic acid in LC-MS graded-ACN.
- All antibodies displayed intact molecular masses of 147.2-148.6 kDa, which is approximately 2.7-3.1 kDa above the theoretical masses of the amino acid sequences for each of the antibodies.
- all the recombinantly expressed anti-TLT-1 antibodies displayed post-translational modifications corresponding to expected HC N-glycosylations. Final purities of 95-99% were obtained for the six antibodies.
- EDMAN degradations were performed using an automated sequenator system (Applied Biosystems 494 Protein Sequencer). 10-20 degradation cycles were conducted for each antibody. Here, expected light and heavy chain sequences were confirmed for the six cloned anti-TLT-1 antibodies.
- a NanoDrop spectrophotometer (Thermo Scientific) was used together with specific extinction coefficients for each of the six antibodies ranging from 1.34-1.51.
- the mAbs of interest were either immobilized directly to a CM5 chip or by capture via a human Fc capture mAb immobilized to a CM5 chip, while TLT-1-His was immobilized by capture via an anti-His mAb CM5 chip for analysis of Fabs. Reagents that were used are shown in Table 7.
- the TLT-1 mAbs were immobilised to a level of approx 500-1000 RU on a CM5 chip (50 ⁇ g/ml diluted in Na-acetate, pH 4.0) using the standard procedure recommended by the supplier. Two-fold dilutions of TLT-1 from 200 nM to 0.2 nM were tested for binding to the mAbs.
- Running and dilution buffer 10 mM HEPES, 150 mM, 0.005% p20, pH 7.4. Regeneration was obtained by 10 mM Glycine, pH 1.7.
- mAb capture via human Fc mAb Human Fc mAb was immobilised to approx 10.000 RU. The mAb of interest was added (approx 100 nM).
- the anti-His mAb was immobilised to approx 9.000 RU.
- the TLT-1-His was added to a level of approx 30-40 RU (10 ⁇ g/ml diluted in 10 mM Hepes, 150 mM NaCl, 3 mM EDTA, 0.005% Tween-20) using the standard procedure recommended by the supplier. 8-fold dilutions of Fabs from 3 to 0.047 ⁇ g/ml were tested for binding to the TLT-1-His.
- Running and dilution buffer 10 mM Hepes, 150 mM NaCl, 3 mM EDTA, 0.005% Tween-20. Regeneration was obtained by 3 M MgCl 2 .
- Binding constants for mAb0061, mAb0023, mAb0051 and mAb0062 and Fab0074, Fab0084, Fab0003 and Fab0004 were estimated by Biacore analysis (see Table 8). mAb0061 and mAb0051 do not compete with any of the other mAbs for binding (see Table 9). mAb0023 and mAb0062 do compete with each other (see Table 9).
- Relipidated TLT-1 in 20:80 PS:PC vesicles were prepared using Triton X-100 as detergent as described in Smith and Morrissey (2005) J. Thromb. Haemost., 2, 1155-1162 except that TLT-1 was used instead of TF.
- Lysis buffer 1 ⁇ Bugbuster (Novagen) in 50 mM Tris-HCl, 100 mM NaCl, 2 mM EDTA, pH 8.0. Add 0.5 mg/ml lysozyme+DNAseI. Add 1 ⁇ Complete Inhibitor Cocktail (Roche) IB-Wash buffer 1: 1:10 bugbuster in IB-buffer. Add 501 ⁇ g/ml lysozyme+0.5 ⁇ Complete Inhibitor Coctail (Roche) IB-Wash buffer 2: 1:10 Bugbuster in IB-buffer
- IB-Buffer 50 mM Tris-HCl, 100 mM NaCl, 2 mM EDTA, pH 8.0
- GndHCl buffer 6M Guanidinium HCl, 50 mM Tris-HCl, 50 mM NaCl, 0.1% Triton X-100 red., pH 8.0 Refolding buffer: 50 mM Tris-HCl, 800 mM Arginine, 0.1% Triton X-100, 5 mM reduced glutathione, 0.5 mM oxidized glutathione pH 8.5 Dialysis buffer: 20 mM Tris-HCl, 0.1% Triton X-100, pH 8.0 DTT:Reduced glutathione (Sigma G4251) Oxidized glutathione Sigma G4376 PC: 10 mg/ml L- ⁇ -phosphatidylcholine (Egg, chicken) in chloroform (Avanti Polar Lipids Inc.) Catalog No.
- TLT-1 (hTLT-1.18-188; SEQ ID NO: 149) including extracellular domain, linker and transmembrane domain was cloned into pET24a using primers 1004 (SEQ ID NO: 150) and 1005 (SEQ ID NO: 151) and pTT-hTLT-1 as template. Standard techniques for DNA preparation were employed. Transformation was performed into BL21 (DE3).
- the lysate was cleared by centrifugation 20000 g (8500 rpm) for 20 min at 4° C.
- the pellet was resuspended in 100 ml IB-Wash buffer.
- Suspension was mixed by gentle vortexing and incubated at RT for 5 min.
- Suspension was centrifuged at 20000 g for 20 min at 4° C. to collect inclusion bodies.
- Inclusion bodies were resuspended in 100 ml IB-Wash buffer 2.
- Sample was centrifuged at 20000 g for 20 min at 4° C. to collect inclusion bodies.
- the pellet was resuspended in 100 ml water and centrifuged at 20000 g for 20 min at 4° C. to collect inclusion bodies.
- Refolding The pellet was resolubilised in x ml GdnHCl buffer (20 ml). The final concentration of TLT-1 (A280 was measured) was 1-2 mg/ml. DTT (400 ⁇ l) was added to final concentration of 20 mM. Complete solubilization was ensured by magnetic stirring for ⁇ 1-2.5 hrs (1.5 h) at RT. Insolube material was removed by centrifugation at 20000 g for 20 min. A peristaltic pump was used slowly (overnight) to transfer the GdnHCl/protein solution (20 ml) to >20 ⁇ Refolding buffer (400 ml) at 4° C. The refolding buffer was stirred quickly to ensure rapid dilution.
- Precipitated protein was removed by centrifugation at 20000 g (8500 rpm) in 50 ml tubes for 30 min.
- the TLT-1 lip was concentrated from 400 ml to 120 ml in Amico-filter 76 mm dia., 10.000 MWCO at 4.5 bar.
- the protein was checked on an SDS-Page by EtOH-precipitation because of the GdnHCl in the sample. 2 ⁇ 500 ⁇ l and 2 ⁇ 25 ⁇ l were concentrated in 0.5 ml tubes with 10.000 MWCO. 50 ⁇ l sample+9 vol.
- TLT-1 binds fibrinogen as tested by SPR analysis. Furthermore, simultaneous binding of fibrinogen and each of the four mAbs: mAb0012, mAb0023, mAb0051 and mAb0062 was tested by SPR analysis in a Biacore T100 instrument.
- Human TLT-1 was immobilised to a level of approx 1000 RU on a CM5 chip (50 ⁇ g/ml diluted in Na-acetate, pH 4.0) using the standard procedure recommended by the supplier.
- Four-fold dilutions of human fibrinogen from 200 nM to 0.2 nM were tested for binding to the immobilized TLT-1.
- Running and dilution buffer 10 mM HEPES, 150 mM, 0.005% p20, pH 7.4.
- Regeneration was obtained by 10 mM Glycine, pH 1.7. Determination of kinetic and binding constants (k on , k off , K D ) was obtained assuming a 1:1 interaction of TLT-1 and fibrinogen using the Biacore T100 evaluation software (Table 11).
- TLT-1 (HCI-0150R) binds fibrinogen. mAb0023 and mAb0062 compete with this binding site. mAb0012 and mAb0051 do not compete.
- the HX-MS technique has been employed to identify the TLT-1 binding epitopes covered by the four monoclonal antibodies mAb0023, mAb0051, mAb0062 and mAb0061.
- the HX experiments were automated by a Leap robot (H/D-x PAL; Leap Technologies Inc.) operated by the LeapShell software (Leap Technologies Inc.), which performed initiation of the deuterium exchange reaction, reaction time control, quench reaction, injection onto the UPLC system and digestion time control.
- the Leap robot was equipped with two temperature controlled stacks maintained at 20° C. for buffer storage and HX reactions and maintained at 2° C. for storage of protein and quench solution, respectively.
- the Leap robot furthermore contained a cooled Trio VS unit (Leap Technologies Inc.) holding the pepsin-, pre- and analytical columns, and the LC tubing and switching valves at 1° C.
- the switching valves have been upgraded from HPLC to Microbore UHPLC switch valves (Cheminert, VICI AG).
- 100 ⁇ L quenched sample containing 200 pmol TLT-1 was loaded and passed over a Poroszyme® Immobilized Pepsin Cartridge (2.1 ⁇ 30 mm (Applied Biosystems)) using a isocratic flow rate of 200 ⁇ L/min (0.1% formic acid:CH3CN 95:5).
- the resulting peptides were trapped and desalted on a VanGuard pre-column BEH C18 1.7 ⁇ m (2.1 ⁇ 5 mm (Waters Inc.)).
- HX-MS raw data files were subjected to continuous lockmass-correction.
- Data analysis i.e., centroid determination of deuterated peptides and plotting of in-exchange curves, was performed using HX-Express ((Version Beta); Weis et al., J. Am. Soc. Mass Spectrom. 17, 1700 (2006)).
- HX Amide hydrogen/deuterium exchange
- Epitope mapping of mAb0051 and mAb0062 were performed in a separate experiment using hTLT-1.20-125 and carried out similarly to the mapping of mAb0023 as described above.
- Epitope mapping of mAb0061 was performed in two separate experiments using either the hTLT-1.16-162 protein or the hTLT-1.126-162 peptide.
- the observed exchange pattern in the presence or absence of mAb0023 can be divided into two different groups: One group of TLT-1 peptides display an exchange pattern that is unaffected by the binding of mAb0023 and another group of TLT-1 peptides that show protection from exchange upon mAb0023 binding.
- the regions displaying protection upon mAb0023 binding encompass peptides covering TLT-1 residues 36-51, 79-91 and 105-120.
- the epitope for mAb0023 can be narrowed to residues 36-47, VQCHYRLQDVKA (50%), 82-87, LGGGLL (30%), 108-115, GARGPQIL (20%) with the relative exchange protection for each segment noted in parenthesis.
- An overview of the peptide map for the 0023 epitope is shown in FIG. 6 .
- the observed exchange pattern in the presence or absence of mAb0051 can be divided into two different groups: one group of TLT-1 peptides display an exchange pattern that is unaffected by the binding of mAb0051 and a group that is affected.
- the regions displaying protection upon mAb0051 binding encompass peptides covering residues 52-66, 92-120.
- the epitope for mAb0051 can be narrowed to residues 55-66, LPEGCQPLVSSA (75%) and 110-120, RGPQILHRVSL (25%) as well as a weak interaction in the 92-105 stretch.
- An overview of the peptide map for the 0051 epitope is shown in FIG. 7 .
- the observed exchange pattern in the presence or absence of mAb0062 can be divided into two different groups: One group of TLT-1 peptides display an exchange pattern that is unaffected by the binding of mAb0062 and another group of TLT-1 peptides that show protection. The regions displaying protection upon mAb0062 binding encompass peptides covering residues 36-51 and 105-120. By comparing the relative amounts of exchange protection within each peptide the epitope for mAb0062 can be narrowed to 36-47, VQCHYRLQDVKA (60%) and 110-120, RGPQILHRVSL (40%). An overview of the peptide map for the 0062 epitope is shown in FIG. 8 .
- the epitope for mAb0061 was mapped in two separate experiments using either the hTLT-1.16-162 protein or the hTLT-1.126-162.
- the observed exchange pattern in the presence or absence of mAb0061 can be divided into two different groups: One group of TLT-1 peptides display an exchange pattern that is unaffected by the binding of mAb0061 and another group of TLT-1 peptides that show protection from exchange upon mAb0061 binding.
- the regions displaying protection upon mAb0061 binding encompass peptides covering residues 121-141. However, it is important to note that no information is given in this experiment for residue 142 and beyond. By comparing the relative amounts of exchange protection within each peptide the epitope for mAb0061 can be narrowed to begin at residue 130.
- hTLT-1 ECD-HPC4 Alanine mutant constructs were designed according to Table 6.
- the expression constructs were developed by external contractor GENEART AG (Imretepark B35, 93059 Regensburg, Germany) and all expression constructs were made based on the expression vector designated pcDNA3.1(+).
- Aliquots of DNA for each of the 40 hTLT-1 ECD-HPC4 pcDNA3.1(+) expression contruct were transfected into HEK293-6E suspension cells in order to transiently express each hTLT-1 ECD-HPC4 Ala mutant protein (Table 6). Transient transfection and culturing of HEK293 6e cells were performed as described in example A.
- hTLT-1 ECD-HPC4 Ala mutant protein containing supernatants were sterile-filtrated prior to analyses.
- concentration of expressed hTLT-1 ECD-HPC4 Ala mutant protein in the cleared cell supernatant was determined using a combination of RP-HPLC and SDS-PAGE/Coomassie analyses. These ranged from 4-40 ⁇ g/mL containing variable degree of dimer formation.
- monomer/dimer forms of the expressed protein were observed for all hTLT ECD-HPC4 Ala mutant constructs.
- the relative concentration of monomer/dimer hTLT-1 ECD-HPC4 protein was estimated by SDS-PAGE/Coomassie and an average Mw for each mutant preparation was calculated.
- Anti-hFc Polyclonal antibody was immobilized onto separate flow cells of a GLM sensor chip using a 1:1 mixture of 0.4 M EDAC [1-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride] and 0.1 M Sulfo-NHS [N-hydroxysulfosuccinimide].
- EDAC 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride
- Sulfo-NHS N-hydroxysulfosuccinimide.
- Each antibody was diluted in 10 mM sodium acetate pH 5.0 to a concentration of 50 ⁇ g/ml, and was immobilized to an individual flow cell at 30 ⁇ l/min for 240s.
- the antibodies were immobilized to flow cells A1-A6 (horizontal direction). After immobilization, the active sites on the flow cell were blocked with 1 M ethanolamine.
- the final immobilization level of capture antibody typically ranged from approximately 9,000 to 10,000 RU in one experiment.
- Capture of the anti-TLT-1 antibodies mAb0023, mAb0051, mAb0061 and mAb0062 was conducted by diluting to 0.5 ⁇ g/ml into HBS-EP buffer (10 mM HEPES, 150 mM NaCl, 3 mM EDTA, 0.05% surfactant P20, pH 7.4) and injected at 30 ⁇ l/min for 60s in vertical direction, creating interspot reference points with only anti-human Fc antibodies.
- the final capture level of test antibodies typically ranged from approximately 200 to 300 RU in one experiment.
- Binding of wt or Ala mutant hTLT-1 ECD-HPC4 protein was conducted by injecting over parallel flow cells in horizontal direction to allow for comparative analyses of binding to different captured anti-TLT-1 antibodies relative to binding to the interspot references.
- Each hTLT-1 ECD-HPC4 protein was diluted to 100 nM, based on the calculated average Mw, into HBS-EP buffer and injected at 30 ⁇ l/min for 240s.
- the GLM chip was regenerated after each injection cycle of analyte via one 18s injection of 1 M Formic acid followed by a 18s injection of 50 mM NaOH at 100 ⁇ l/min. This regeneration step removed the anti-TLT-1 antibody and any bound TLT-1 from the immobilized capture antibody surface, and allowed for the subsequent binding of the next test sample pair.
- the regeneration procedure did not remove the directly immobilized anti-human-Fc capture antibody from the chip surface.
- Binding curves were processed by double referencing (subtraction of interspot control surface signals as well as blank buffer injections over captured anti-TLT-1 antibodies). This allowed correction for instrument noise, bulk shift and drift during sample injections. Binding signal at 10s after stop of analyte injection was normalized to level of captured anti-TLT-1 antibody and presented as binding relative to wt hTLT-1 ECD-HPC4 protein.
- mAb0051 F54A ⁇ 0.4 wt; M91A ⁇ 0.2 wt; R117A ⁇ 0.2 wt; S119A ⁇ 0.6 wt.
- mAb0062 R41A ⁇ 0.2 wt; L42A ⁇ 0.6 wt; Q43A ⁇ 0.4 wt; F54A ⁇ 0.6 wt; M91A ⁇ 0.4 wt; R110A ⁇ 0.2 wt; H116A ⁇ 0.6 wt.
- mAb0023 L42A ⁇ 0.2 wt; Q43A ⁇ 0.2 wt; K46A ⁇ 0.2 wt; M91A ⁇ 0.4 wt; R110A ⁇ 0.2 wt. Since decreased binding could be observed for the hTLT-1 ECD-HPC4 mutant M91A for all 4 anti-TLT-1 antibodies, the residue probably has an important influence on protein stability rather than being part of an actual epitope. mAb0061 did not show a decreased binding to any of the mutated TLT-1 variants tested, indicating that the epitope is not covered by the mutants introduced in the binding study.
- anti-TLT-1 Fab, Fab0100 (identical to Fab0061), for crystallization:
- the anti-TLT-1 Fab fragment, Fab0100, comprising the heavy chain corresponding to SEQ ID NO: 152 and the light chain corresponding SEQ ID NO: 153 was expressed transiently in HEK293 cells according to the generalized procedure.
- Purification of anti-TLT-1 Fab, Fab0100, for crystallization Purification of said Fab was conducted by a two-step process composed of affinity chromatography using the kappaSelect resin (GE Healthcare, cat. no. 17-5458-01) and size-exclusion chromatography. The purification was conducted using an ⁇ ktaExplorer chromatography system (GE Healthcare, cat. no. 18-1112-41).
- the buffer systems used for the purification step was an equilibration buffer composed of 10 mM NaPhosphate, pH 7.5 and 150 mM NaCl and an elution buffer composed of 20 mM Formic acid, pH 3.0.
- the supernatant was adjusted with 1 M NaOH to a pH of 7.5 and applied onto a pre-equilibrated kappaSelect column.
- the column was washed with 5 column volumes of equilibration buffer and the Fab protein was isocratically eluted using approximately 5 column volumes of elution buffer.
- the Fab protein was analyzed using SDSPAGE/Coomassie and LC-MS analyses, showing that a pure and homogenous protein with an expected molecular weight of 46.9 kDa was obtained.
- a NanoDrop spectrophotometer (Thermo Scientific) was used together with an extinction coefficient of 1.31.
- the final polish of the Fab protein was conducted using a size-exclusion column (Superdex200).
- TLT-1-stalk peptide hTLT-1.126-162 (SEQ ID NO: 7) was prepared by solid phase peptide synthesis. Likewise, a shorter version hTLT-1.129-142 of the stalk peptide corresponding to SEQ ID NO: 8 was prepared.
- Preparation of Fab0100:hTLT-1.126-162 The complex between Fab0100 and hTLT-1.126-162 was prepared by adding two times molar excess of hTLT-1.126-162 to a solution of Fab0100 followed by isolation of the complex by separating excess hTLT-1.126-162 using preparative size exclusion chromatography.
- the Fab0100: hTLT-1.126-162 complex was prepared by mixing Fab (1100 ⁇ l, 98 ⁇ M) and hTLT-1.126-162 (155 ⁇ l, 1391 ⁇ M), both in PBS buffer (pH 7.4).
- the complex was subjected to gel filtration using a Superdex 200 HighLoad 26/60 (GE Healthcare) column eluted with PBS-buffer (pH 7.4) at a flow rate of 1 ml/min. Fractions corresponding to a volume of 3 ml were collected. Fractions containing the desired Fab0100: hTLT-1.126-162 complex were pooled and then concentrated using a centrifugal filter device (Amicon, 10 kDa cut-off) to a protein concentration of 8.6 mg/ml. This preparation was used for crystallization of the Fab0100:hTLT-1.126-162 complex.
- Fab0100:hTLT-1.129-142 The complex between Fab0100 and the shorter stalk peptide (hTLT-1.129-142) was similarly prepared with the exceptions that the molar ratio between hTLT-1.129-142 and Fab was 1.5:1 and that the gel filtration stop was omitted due to weaker binding of hTLT-1.129-142 compared to that of the longer stalk peptide (hTLT-1.126-162).
- Fab0100:hTLT-1.129-142 was crystallized by adding to the protein solution, in a 1:2 volume ratio (precipitant:protein), a precipitation solution containing 0.04 M potassium dihydrogen phosphate, 16% w/v PEG 8,000 and 20% glycerol, while the Fab0100:hTLT-1.126-162 complex was crystallized by adding to the protein solution, in a 1:1 volume ratio (precipitant:protein), a precipitation solution containing 20% w/v PEG 10,000 and 0.10 M Hepes pH 7.5.
- a crystal of the Fab0100:hTLT-1.129-142 complex was flash frozen in liquid N 2 and during data collection kept at 100 K by a cryogenic N 2 gas stream.
- Crystallographic data were subsequently collected to 2.14 ⁇ resolution using a Rigaku MicroMax-007 HF rotating anode and a marCCD 165 ⁇ -ray detector.
- Space group determination, integration and scaling of the data were made by the XDS software package (Kabsch, W. (1993) J. Appl. Crystallogr. 26, 795-800).
- Cell parameters of the crystal were determined to be 82.10, 64.99, 107.73 ⁇ , 90°, 95.12° and 90°, for a, b, c, ⁇ , ⁇ and ⁇ respectively, and the space group was determined to be C2.
- R sym for intensities of the data set was calculated to be 6.5%.
- a crystal of the Fab0100:hTLT-1.126-162 complex was transferred to a cryo-solution containing 75% of the precipitant solution and 25% of glycerol. The crystal was allowed to soak for about 15 seconds, then flash frozen in liquid N 2 and during data collection kept at 100 K by a cryogenic N 2 gas stream. Crystallographic data were subsequently collected to 1.85 ⁇ resolution at beam-line BL911-3 (Ursby, T. et al. (2004) AIP Conference Proceedings 705, 1241-1246) at MAX-lab, Lund, Sweden. Space group determination, integration and scaling of the data were made in the XDS software package.
- Cell parameters for the synchrotron data were determined to be 82.54, 65.32, 108.05 ⁇ , 90°, 95.15° and 90°, for a, b, c, ⁇ , ⁇ and ⁇ , respectively, and space group was determined to be C2.
- R sym for intensities of the data set was calculated to be 6.7%.
- the crystal was isomorphous with the Fab0100:hTLT-1.129-142 crystals and therefore rigid body refinement of the Fab0100:hTLT-1.129-142 complex was used for the original phasing of the Fab0100:hTLT-1.126-162 followed by automated model building and phasing using the ARP-wARP software package.
- Anti-TLT-1 effectively binds to the stalk of TLT-1.
- the average areas excluded in pair-wise interaction between Fab0100 and TLT-1 were calculated to be 764 ⁇ 2 .
- the average areas excluded in pair-wise interactions gave for the Fab0100:hTLT-1.126-162 complexe 656 and 871 A2, for anti-TLT-1 and TLT-1 respectively.
- Residues in the TLT-1 peptide (hTLT-1.126-162) making direct contacts to the anti-TLT-1 Fab in the Fab0100: hTLT-1.126-162 complex is defined as the epitope and residues in Fab0100 making direct contacts to hTLT-1.126-162 in the Fab0100: hTLT-1.126-162 complex is defined as the paratope.
- Epitope and paratope residues were identified by running the CONTACTS software of the CCP4 program suite using a cut-off distance of 4.0 ⁇ between the anti-TLT-1 Fab and the TLT-1 molecule.
- the results of the contact calculations for the Fab0100:hTLT-1.126-162 complex of the crystal structures are shown in Tables 14 and 15.
- the resulting TLT-1 epitope for Fab0100 was found to comprise the following residues of SEQ ID NO: 7): Lys 8 (133), Ile 9 (134), Gly 10 (135), Ser 11 (136), Leu 12 (137), Ala 13 (138), Asn 15 (140), Ala 16 (141), Phe 17 (142), Ser 18 (143), Asp 19 (144), Pro 20 (145), Ala 21 (146) where numbers in parenthesis refer to the corresponding residues in SEQ ID NO: 2 (Tables 12 and 13).
- the resulting paratope included residues His 31, Asn 33, Tyr 37, His 39, Tyr 54, Phe 60, Ser 96, Thr 97, Val 99 and Tyr 101 of the Fab0100 light chain corresponding to SEQ ID NO: 153 (Table 12), and residues Val 2, Phe 27, Arg 31, Tyr 32, Trp 33, Glu 50, Thr 57, Asn 59, Ser 98, Gly 99, Val 100 and Thr 102 of the Fab0100 heavy chain corresponding to SEQ ID NO: 152 (Table 13).
- the TLT-1 epitope residues involved in hydrogen-binding are also indicated in Tables 12 and 13.
- REMARK 3 CROSS-VALIDATION METHOD THROUGHOUT REMARK 3 FREE R VALUE TEST SET SELECTION : RANDOM REMARK 3 R VALUE (WORKING + TEST SET) : 0.17330 REMARK 3 R VALUE (WORKING SET): 0.17070 REMARK 3 FREE R VALUE : 0.22260 REMARK 3 FREE R VALUE TEST SET SIZE (%): 5.0 REMARK 3 FREE R VALUE TEST SET COUNT : 2463 REMARK 3 REMARK 3 FIT IN THE HIGHEST RESOLUTION BIN.
- REMARK 3 ALL ATOMS 3993 REMARK 3 REMARK 3 B VALUES.
- the peptide walking ELISA defined the minimal binding region of the peptide. This was established by coating biotinylated peptides with one residue frameshift in the stalk region of TLT-1 in streptavidin plates followed by binding of the antibody of interest (mAb0061). A secondary antibody was added for detection and binding was measured at 450 nm. Positive control: binding to biotinylated TLT-1.
- the biotinylated peptides were synthesised using standard solid phase peptide synthesis. Solutions of 0.3M Fmoc-protected amino acids in 0.3 M1-hydroxybenzotriazole (HOBt) in N-methylpyrrolidinone (NMP) were coupled using diisopropylcarbodiimide (DIC) for 1-4 hours. As solid support the Rink amide LL resin (Merck) was used in a 96 microtiter filterplate (Nunc) and ca. 20 mg resin pr well was used. The synthesis was performed using the Multipep RS peptide synthesiser from Intavis, Germany and manufacture protocol was used. The removal of Fmoc was done using 25% piperidin in NMP.
- the final deprotection was done using 90% trifluoracetic acid (TFA), 5% triisopropylsilan and 5% H20 for 3 hours. A total of 1 ml TFA was used per well. The TFA was filtered to 96 deep well (Nunc) and the TFA was reduced in volume by evaporation to ca. 100-200 ul per well and diethylether was added to all wells in order to precipitate the peptides. The suspension of peptide in diethylether was transferred to solvinert 96 well filter plate (0.47 um, Millipore) and the peptides were washed twice with diethylether and dried. The peptides were redissolved in 80% DMSO and 20% water giving a stock solution of ca. 1-3 mg/ml.
- the epitope mapping involved binding of mAb0061 to two series of biotinylated peptides from the stalk region of TLT-1.
- the biotinylated peptides were bound to streptavidin plates.
- Binding to biotinylated peptide in a well was recorded as “binding” when the absorption at 450 nm was above 3. “No binding” was recorded when signal was below 1. A signal in between was recorded as “weak binding”.
- biotinylated peptides were put into wells in the following way:
- Row A peptide 2-12 (20mers)
- Row B peptide 13-24 (20mers)
- Row C peptide 25-27 (20mers)
- Row C peptide 29-36 (16mers)
- Row D peptide 37-48 (16mers)
- Row E peptide 49-58 (16mers) Result from triple determination:
- the 20mer-peptides (5-16) give rise to strong positive signals ( ⁇ 3) corresponding to amino acids: IGSLAENAF.
- the 16mer petides 36-42 give rise to a strong positive signals ( ⁇ 3) corresponding to KIGSLAENAF.
- the peptide walking ELISA has defined the minimal binding area of the epitope for binding to mAb0061 as the following stretch of amino acid residues: KIGSLAENAF. This stretch is indeed part of the epitope defined above by the crystal structure: KIGSLANAFSDPA.
- Factor VIIa Native (wild-type) Factor VIIa and Factor VIIa variant (both hereafter referred to as “Factor VIIa”) are assayed in parallel to directly compare their specific activities.
- the assay is carried out in a microtiter plate (MaxiSorp, Nunc, Denmark).
- the absorbance at 405 nm is measured continuously in a SpectraMaxTM 340 plate reader (Molecular Devices, USA).
- the absorbance developed during a 20-minute incubation, after subtraction of the absorbance in a blank well containing no enzyme, is used to calculate the ratio between the activities of variant and wild-type Factor VIIa:
- Ratio ( A 405 nm Factor VIIa variant)/( A 405 nm Factor VIIa wild-type).
- Factor VIIa Native (wild-type) Factor VIIa and Factor VIIa variant (both hereafter referred to as “Factor VIIa”) are assayed in parallel to directly compare their specific activities.
- the assay is carried out in a microtiter plate (MaxiSorp, Nunc, Denmark).
- Factor VIIa (10 nM) and Factor X (0.8 microM) in 100 ⁇ L 50 mM Hepes, pH 7.4, containing 0.1 M NaCl, 5 mM CaCl 2 and 1 mg/ml bovine serum albumin, are incubated for 15 min.
- Factor X cleavage is then stopped by the addition of 50 ⁇ L 50 mM Hepes, pH 7.4, containing 0.1 M NaCl, 20 mM EDTA and 1 mg/ml bovine serum albumin.
- the amount of Factor Xa generated is measured by addition of the chromogenic substrate Z-D-Arg-Gly-Arg-p-nitroanilide (S-2765, Chromogenix, Sweden), final concentration 0.5 mM.
- the absorbance at 405 nm is measured continuously in a SpectraMaxTM 340 plate reader (Molecular Devices, USA). The absorbance developed during 10 minutes, after subtraction of the absorbance in a blank well containing no FVIIa, is used to calculate the ratio between the proteolytic activities of variant and wild-type Factor VIIa:
- Ratio ( A 405 nm Factor VIIa variant)/( A 405 nm Factor VIIa wild-type).
- the FVIII activity (FVIII:C) of the rFVIII compound is evaluated in a chromogenic FVIII assay using Coatest SP reagents (Chromogenix) as follows: rFVIII samples and a FVIII standard (e.g. purified wild-type rFVIII calibrated against the 7th international FVIII standard from NIBSC) are diluted in Coatest assay buffer (50 mM Tris, 150 mM NaCl, 1% BSA, pH 7.3, with preservative). Fifty ⁇ l of samples, standards, and buffer negative control are added to 96-well microtiter plates (Nunc) in duplicates.
- the factor IXa/factor X reagent, the phospholipid reagent and CaCl 2 from the Coatest SP kit are mixed 5:1:3 (vol:vol:vol) and 75 ⁇ l of this added to the wells. After 15 min incubation at room temperature, 50 ⁇ l of the factor Xa substrate S-2765/thrombin inhibitor 1-2581 mix is added and the reagents incubated for 10 minutes at room temperature before 25 ⁇ l 1 M citric acid, pH 3, is added. The absorbance at 415 nm is measured on a Spectramax microtiter plate reader (Molecular Devices) with absorbance at 620 nm used as reference wavelength.
- the value for the negative control is subtracted from all samples and a calibration curve prepared by linear regression of the absorbance values plotted vs. FVIII concentration. Specific activity is calculated by dividing the activity of the samples with the protein concentration determined by HPLC. The concentration of the sample is determined by integrating the area under the peak in the chromatogram corresponding to the light chain and compare with the area of the same peak in a parallel analysis of a wild-type unmodified rFVIII, where the concentration is determined by amino acid analyses.
- FVIII activity (FVIII:C) of the rFVIII compounds is further evaluated in a one-stage FVIII clot assay as follows: rFVIII samples and a FVIII standard (e.g. purified wild-type rFVIII calibrated against the 7th international FVIII standard from NIBSC) are diluted in HBS/BSA buffer (20 mM hepes, 150 mM NaCl, pH 7.4 with 1% BSA) to approximately 10 U/ml, followed by 10-fold dilution in FVIII-deficient plasma containing VWF (Dade Behring). Samples are subsequently diluted in HBS/BSA buffer.
- a FVIII standard e.g. purified wild-type rFVIII calibrated against the 7th international FVIII standard from NIBSC
- the APTT clot time is measured using an ACL300R or an ACL5000 instrument (Instrumentation Laboratory) using the single factor program.
- FVIII-deficient plasma with VWF (Dade Behring) is used as assay plasma and SynthASil, (HemosILTM, Instrumentation Laboratory) as aPTT reagent.
- the diluted sample or standard is mixed with FVIII-deficient plasma and aPTT reagents at 37° C. Calcium chloride is added and time until clot formation is determined by measuring turbidity.
- the FVIII:C in the sample is calculated based on a standard curve of the clot formation times of the dilutions of the FVIII standard.
- Preactivated native (wild-type) Factor Xa and preactivated Factor Xa variant are assayed in parallel to directly compare their specific activities.
- the assay is carried out in a microtiter plate (MaxiSorp, Nunc, Denmark).
- Prothrombin cleavage is then stopped by the addition of 50 ⁇ L 50 mM Hepes, pH 7.4, containing 0.1 M NaCl, 20 mM EDTA and 1 mg/ml bovine serum albumin.
- the amount of Thrombin generated is measured by addition of the chromogenic substrate H-D-Phenylalanyl-L-pipecolyl-L-Arg-p-nitroanilide (S-2738, Chromogenix, Sweden), final concentration 0.5 mM.
- the absorbance at 405 nm is measured continuously in a SpectraMaxTM 340 plate reader (Molecular Devices, USA). The absorbance developed during 10 minutes, after subtraction of the absorbance in a blank well containing no FXa, is used to calculate the ratio between the proteolytic activities of variant and wild-type Factor FXa:
- Ratio ( A 405 nm Factor Xa variant)/( A 405 nm Factor Xa wild-type).
- anti-TLT-1 mAb (fragment) may be a full size mAb against TLT-1 or a fragment or an analogue intellectually derived thereof such as but not limited to, a FAB-fragment or a sc-FAB with none, one or more point mutations
- the linker may be a water soluble polymer such as but not limited to e.g. PEG, polysialic acid, or hydroxyethyl starch
- FVIIa is any molecule with a sequence similarity of >50% to native FVIIa with any retained activity of FVIIa may, for example, be prepared in a two step procedure.
- a linker with two different reactive groups RS1 and RS2 may be attached to the anti-TLT-1 mAb (fragment).
- the reaction may be run with low site selectivity or in a selective way, such that RS1 only reacts at one or few position of the anti TLT-1 mAb (fragment).
- RS1 could be an aldehyde and react by reductive amination only with N-termini of the anti TLT-1 mAb (fragment) by reductive amination, known to a person trained in the art.
- Another non-exclusive example RS1 could be a maleimide group, which may react with a free thiol on the anti-TLT-1 mAb (fragment).
- the reactive group RS2 may be reacted with low site selectivity or site selectivity with a FVIIa molecule.
- a site selective reaction at FVIIa may be obtained when RS2 is a sialic acid derivative, which can react in the presence of a suitable enzyme such as but not limited to ST3Gal-III with N-linked glycans, which do not end exclusively with sialic acids.
- the order of attachment of the linker to the two proteins, namely the anti-TLT-1 mAb (fragment) and the FVIIa molecule may be switched, thereby attaching the RS1-Linker-RS2 molecule first to the FVIIa molecule and then to the anti TLT-1 mAb (fragment).
- Step 1 3-(2,5-Dioxo-2,5-dihydropyrrol-1-yl)propionic acid 2,5-dioxopyrrolidiny-1-yl ester
- 3-Maleimidopropionic acid (1.0 g, 5.9 mmol) was dissolved in tetrahydrofuran (20 ml).
- N,N-Dimethylformamide (5 ml) was added. The reaction mixture was stirred at room temperature, while it was turning sluggish. The mixture was stirred for 2 min. N,N-Dimethylformamide (5 ml) was added. The mixture was stirred for 2.5 h at room temperature.
- Step 2 N-((3-( ⁇ -(3-(2,5-dioxo-2,5-dihydropyrrol-1-yl)propionylamino) 1-0 kDa PEGyl)propionylamino)acetyl)-O 2 -[5′]cytidylyl- ⁇ -neuraminic acid (NNC 0129-0000-3259)
- N-((3-( ⁇ -Amino10 kDa PEGyl)propionylamino)acetyl)-O 2 -[5′]cytidylyl- ⁇ -neuraminic acid (100 mg, 0.009 mmol) was dissolved in a mixture of tetrahydrofuran (2 ml) and dichloromethane (10 ml).
- Ethyldiisopropylamine (0.005 ml, 0.028 mmol) was added. The reaction mixture was stirred at room temperature for 16 h. Dichloromethane (2 ml) and ethyldiisopropylamine (0.5 ml) were added. Amionomethylated polystyrene resin (commercially available at e.g. Novabiochem, loading 0.85 mmol/g, 438 mg, 0.372 mmol) was added. The mixture was slowly stirred at room temperature for 1 h. The resin was removed by filtration. The solvent was removed in vacuo with a bath temperature of 25° C. The residue was dissolved in dichloromethane (4 ml).
- Step 3 Attachment of N-((3-( ⁇ -(3-(2,5-dioxo-2,5-dihydropyrrol-1-yl)propionylamino)10 kDa PEGyl)propionylamino)acetyl)-O 2 -[5′]cytidylyl- ⁇ -neuraminic Acid to an Anti-TLT-1 FAB
- the buffer was changed to a buffer composed of 20 mM imidazole, 10 mM CaCl 2 , 0.02% Tween 80, 1 M glycerol, which had been adjusted to pH 7.35 by repeated ultracentrifugation at 4000 rpm.
- the solution was subjected to a size exclusion chromatography on a Superose 75 10/300 GL column (GE Healthcare) at a flow of 0.50 ml/min, utilizing a buffer composed of 25 mM TRIS, 150 mM NaCl, which had been adjusted to pH 8.00 as eluent.
- Fractions were pooled on the basis of the UV-trace at 280 nm of the chromatogram.
- the pool (0.148 mg, 1.4 ml), containing the desired compound as judged by SDS-PAGE and which were devoid of free PEG reagent as judged by SDS-PAGE utilizing a PEG-specific staining method (described in Kur requirementsst, M. M. Analyt. Biochem. 1992, 200, 244-248.) was used in the following step.
- CMP NeuNAc CMP-N-acetylneuraminic acid
- the reaction mixture was subjected to a size exclusion chromatography on a Superdex 200 10/300 GL column (GE Healthcare) with a flow of 0.5 ml/min utilizing a buffer of 10 mM Histidine, 20 mM CaCl 2 , 150 mM NaCl which had been adjusted to pH 6.1 as eluent.
- the fractions containing the desired product as judged by SDS-PAGE on a TRIS-Acetate gel were pooled. Using a molar absorption of 11.22 at 280 nm on a Nandrop® apparatus, a yield of 0.022 mg was found.
- the result of a SDS-PAGE analysis was in accordance with the expectation for the desired product.
- the product was named FVIIa-Fab1029.
- Step 1 Attachment of N-((3-( ⁇ -(3-(2,5-dioxo-2,5-dihydropyrrol-1-yl)propionylamino)10 kDa PEGyl)propionylamino)acetyl)-O 2 -[5′]cytidylyl- ⁇ -neuraminic Acid to an Anti TLT-1 FAB Fragment
- TLT-1-FAB-fragment (1.35 mg, 27.4 nmol) in a 0.27 mg/ml solution in a buffer composed of 20 mM HEPES, 5 mM EDTA, 100 mM NaCl which had been adjusted to pH 7.5 was placed in an Amicon ultracentrifugation device with a cut off of 10 kDa. It was subjected to ultracentrifugation at 4000 rpm at 20° C. for 10 min. Buffer composed of 20 mM imidazole, 10 mM CaCl 2 , 0.02% Tween 80, 1 M glycerol which had been adjusted to pH 7.35 (4 ml) was added.
- the mixture was subjected to ultracentrifugation at 4000 rpm at 20° C. for 8 min. Buffer composed of 20 mM imidazole, 10 mM CaCl 2 , 0.02% Tween 80, 1 M glycerol which had been adjusted to pH 7.35 (4 ml) was added. The mixture was subjected to ultracentrifugation at 4000 rpm at 20° C. for 8 min. Buffer composed of 20 mM imidazole, 10 mM CaCl 2 , 0.02% Tween 80, 1 M glycerol which had been adjusted to pH 7.35 (3 ml) was added. The mixture was subjected to ultracentrifugation at 4000 rpm at 20° C. for 10 min.
- the mixture was placed in a reaction vial.
- Buffer composed of 20 mM imidazole, 10 mM CaCl 2 , 0.02% Tween 80, 1 M glycerol which had been adjusted to pH 7.35 (4 ml) was added, so that the total volume of the reaction mixture was at this time 4.7 ml.
- a 1 M solution of TCEP (0.54 ml) in a buffer of imidazole, 10 mM CaCl 2 , 0.02% Tween 80, 1 M glycerol which had been adjusted to pH 7.35 was added.
- the reaction mixture was shaken at 300 rpm for 1 h.
- the mixture was divided into two parts each of which was applied to a PD-10 column (GE Healthtech) which had been equilibrated with a buffer of 25 mM HEPES with a pH 7.0.
- the eluates were combined (7 ml in total) and were concentrated to 1 ml by ultracentrifugation at 4000 rpm for at 20° C. for 6-8 min in an Amicon ultracentrifugation device with a cut off of 10 kDa.
- the reaction mixture was gently shaken at 300 rpm at 20° C. for 3.2 h. It was concentrated to a volume of 0.30 ml by ultracentrifugation at 4000 rpm at 19° C. for 11 min in an Amicon ultracentrifugation device with a cut off of 10 kDa. It was applied to a size exclusion chromatography on a Superdex 75 10/300 GL column (GE Healthtech) at a flow of 0.50 ml/min utilizing a buffer of 25 mM TRIS, 150 mM NaCl which had been adjusted to pH 8.0 as eluent.
- NEM N-methylmaleimide
- the SDS-PAGE analysis under reducing conditions was in compliance with the expected result for the desired product.
- the SDS-PAGE analysis under non-reducing conditions showed some material, in which one chain of the anti-TLT-1-FAB fragment had been lost. However, it remained unsolved, whether this finding was due to problems in the analysis or whether a chain had really been lost either during the described reaction or even earlier.
- a concentration of 0.1 mg/ml was found giving a yield of 0.287 mg.
- the solution was subjected to a buffer change to 20 mM histidine, 10 mM CaCl 2 , 20% glycerol, 0.02% Tween 80, 500 mM NaCl which had been adjusted to pH 6.05 by repeating ultracentrifugation and addition of the buffer. A total volume of 0.40 ml was obtained. A 0.4 mg/ml (242 U/mg, 98 U/ml, 0.0055 ml) solution of sialidase from A. Urifaciens and a 2.5 mg/ml solution of ST3Gal-III (0.033 ml) were added subsequently. The reaction mixture was gently shaken for 15 min at 300 rpm at 32° C., left for 2 h at 32° C.
- the reaction mixture was diluted with water (0.030 ml). It was subjected to a size exclusion chromatography using a Superose 6 10/300 GL column (GE Healthcare) and utilizing a buffer of 10 mM Histidine, 1.7 mM CaCl 2 , 0.01% Tween80, 0.3 M NaCl, 8.8 mM sucrose which had been adjusted to pH 7 at a flow of 0.50 ml/min. The fractions containing the desired product as judged by SDS-PAGE analysis were pooled.
- the pool was subjected to a buffer change using an Amicon ultracentrifugation device with a cut off of 10 kDa to a buffer composed of 20 mM histidine, 10 mM CaCl 2 , 1 M glycerol, 0.02% Tween 80, 500 mM NaCl which had been adjusted to pH 6.07. A total volume of 0.250 ml was obtained. Using a molar absorption of 14.6 at 280 nm on a Nanodrop apparatus, a concentration of 0.59 mg/ml was found, corresponding to a yield of 0.148 mg.
- CMP-N-acetylneuraminic acid (CMP NeuNAc, 0.26 mg, 0.026 ml) in a buffer of 20 mM histidine, 10 mM CaCl 2 , 20% glycerol, 0.02% Tween 80, 500 mM NaCl which had been adjusted to pH 6.05 and a solution of ST3Gal-III (0.015 ml) was added.
- the reaction mixture was shaken gently at 300 rpm at 32° C. for 15 min and then left at 32° C. for another 45 min.
- the reaction mixture was diluted with water (0.10 ml).
- the SDS-PAGE analysis of the product under reduced conditions is in accordance with the expectation for the desired product.
- the SDS-PAGE analysis under non-reduced conditions shows changing amounts of a band which corresponds to a product where the FAB-fragment has lost one chain.
- the appearance of a band corresponding to a may be due to the presence of such compound in the product or may be due to decomposition during denaturizing prior SDS-PAGE analysis.
- TLT-1 was immobilized directly to a CM5 chip to a level of approx 2000 RU (50 ug/ml diluted in Na-acetate, pH 4.0) using the standard procedure recommended by the supplier and reagents provided in Table 16. Two-fold dilutions of FVIIa-Fab1029 and FIX-Fab0135 from 20 nM to 0.3 nM were tested for binding to TLT-1.
- Running and dilution buffer 10 mM HEPES, 150 mM, 0.005% p20, pH 7.4. Regeneration was obtained by 10 mM Glycine, pH 1.7. Determination of kinetic and binding constants (k on , k off , K D ) was obtained assuming a 1:1 interaction of TLT-1 and FVIIa-Fab1029 or FIX-Fab0135 using the Biacore T100 evaluation software.
- Binding constants for FVIIa-Fab1029 and FIX-Fab0135 binding to TLT-1 was estimated by biacore analysis and binding to TLT-1 was confirmed (Table 17).
- FVIIa-Fab1029 Promotes Fibrin Clot Formation in Hemophilia-Like Whole Blood
- FIG. 11A The TEG traces obtained with normal HWB (NWB), “hemophilia” blood, and “hemophilia” blood supplemented with (0; 0.25; 0.5; 1.0;nM) of FVIIa-Fab1029 or rFVIIa are shown in FIG. 11A . Shown in FIG. 11B are the R-time values obtained for the depicted TEG traces. FIG. 11B , in addition to R-time values for the FVIIa-Fab1029 or rFVIIa protein, also includes R-time values for equivalent concentrations of rFVIIa. All data are obtained from one representative donor. The FVIIa-Fab1029 is observed to efficiently normalize clotting of hemophilia-like HWB.
- FIX-Fab0135 has FVIII-Bypassing Activity and Promotes Fibrin Clot Formation in Hemophilia A-Like Whole Blood
- HWB Citrated-stabilized human whole blood
- Clot formation is measured by thrombelastography (5000 series TEG analyzer, Haemoscope Corporation, Niles, Ill., USA).
- Hemophilia A-like conditions are obtained by incubation of normal citrate-stabilized human whole blood (HWB) with 10 ⁇ g/ml anti-FVIII antibody (Sheep anti-Human Factor VIII; Hematologic Technologies Inc) for 30 min at room temp.
- Various concentrations (0.1; 0.2; 1.0; 5.0; 10 nM) of the FIX-Fab0135 are added to hemophilia A-like citrated HWB.
- Clotting is initiated when 340 ⁇ l of normal or premixed HWB is transferred to a thrombelastograph cup containing 20 ⁇ l 0.2 M CaCl 2 with 0.03 ⁇ M lipidated TF (Innovin®, Dade Behring GmbH (Marburg, Germany).
- the TEG trace is followed continuously for up to 120 min.
- TEG traces obtained with normal HWB (HWB), “hemophilia” blood, and “hemophilia” blood supplemented with (0.1; 0.2; 1.0; 5.0; 10 nM) of FIX-Fab0135 are shown in FIG. 12 .
- Also shown for comparison are the TEG traces obtained when FIX-Fab0135 is replaced by 1 nM rFVIIa or 10 nM rFIX. All data are obtained from one representative donor.
- FIX-Fab0135 is observed to efficiently normalize clotting of hemophilia A-like HWB.
- FIX dependent propagation of the coagulation requires assembly of a FIXa/FVIIIa complex on the surface of activated platelets, and the resulting FX activation (tenase) activity is prevented by inhibitory FVIII antibodies.
- the present example with FIX-Fab0135 demonstrates that targeting of FIX to TLT-1 on the surface of platelets generates a FIX containing complex with pro-coagulant activity even when FVIII is blocked by an inhibitory antibody.
- TLT-1 enriched phospholipid vesicles prepared as described in Example 20 are applied in the experiment shown in FIG. 13 to mimic TLT-1 on the surface of activated platelets.
- Various concentrations (0.05-100 nM) r FVIIa is incubated at room temperature for 15 min i) in Hepes buffer (50 mM Hepes, 0.1 M NaCl, 5 mM CaCl 2 , 1 mg/ml BSA pH 7.4) or in Hepes buffer with ii) 10 nM FIX, iii) 10 nM FIXa or iv) 10 nM FIX-Fab0135.
- FX Enzyme Research Laboratories, UK
- TLT-1 enriched phospholipid vesicles at 1:4,000 dilution in absence or presence of 5 nM FVIII and incubated for 3 min.
- the reaction is stopped by addition of an equal volume stop buffer (50 mM Hepes, 0.1 M NaCl, 20 mM EDTA, 1 mg/ml BSA pH 7.5).
- the amount of FXa generated in the samples is then determined in a chromogenic assay by transferring 50 ⁇ l of the mixture to a microtiter plate well and adding 25 ⁇ l Chromozyme X (final 0.42 mg/ml) to the well.
- the absorbance at 405 nm is measured continuously in a microplate Spectramax photometer (Molecular Devices, Sunnyvale Calif., USA).
- FVIIa is capable of activating FIX (Osterud and Rappaport, 1977) and the resulting FIXa is then designated to combine with FVIIIa and form the proteolytic component of the so-called tenase complex. Formation of this complex takes place on the surface of activated platelets.
- the tenase complex is responsible for a massive FX activation that plays a key role in the propagation phase of the coagulation process. Inability to form an active tenase complex is the central diathesis in both hemophilia A and B patients.
- TLT-1 enriched phospholipid vesicles are applied to mimic the surface of activated platelets.
- This system is used to test whether targeting of FIX to TLT-1 on such vesicles by means of the FIX-Fab0135 can promote FX activation in analogy with the tenase complex on activated platelets. Furthermore it is of interest to examine whether the presence of FVIII is obligatory or not for this activity.
- FIG. 13 shows: 1) that very little FXa is generated at all FVIIa concentrations tested in absence and presence of 5 nM FVIII under the conditions of the experiment without FIX derivatives added (o); 2) that this is the case also when 10 nM FIX is present in the reaction mixture ( ⁇ ); 3) that a marked FX activation is observed when 10 nM FIX is replaced by 10 nM FIXa, however, only in the presence of FVIII ( ⁇ ); 4) that targeting of FIX to TLT-1 enriched phospholipid vesicles by means of the FIX-Fab0135 provides a complex which is activated by FVIIa in a concentration dependent manner; 5) that the resulting activated tenase-like complex markedly promotes FX activation both in presence and in absence of FVIII.
- FIX-Fab0135 FIX fusion protein provides a FVIII bypassing agent which markedly promotes FVIIa-mediated FXa activation by a mechanism which involves FVIIa activation of FIX targeted to TLT-1 and formation of a complex with a considerable FVIII-independent tenase-like activity.
- TLT-1 has been reported to only be expressed on activated platelets (Washington et al. (2004) Blood. 2004 Aug. 15; 104(4):1042-7).
- the “Platelet calibrator kit” from Biocytex (Marseille, France) in which platelets are stained by no wash indirect immunoflurescence with specific monoclonal antibodies and analyzed by quantitative flow cytometry.
- the expression level of the tested antigen is determined using calibration beads with a definite number of binding sites for the detecting antibody. According to manufacturers instruction platelets in citrated human whole blood were activated by different concentrations (0.3-30 ⁇ M) of protease activated receptor (PAR)-1 activating peptide with amino acid sequence SFLLRN.
- PAR protease activated receptor
- the samples were diluted 1:4 in a saline buffer provided in the kit before labeled with TLT-1 binding antibodies.
- the TLT-1 binding antibodies used were either mAb0123 (IgG1 subtype of the mAb0023 antibody) or mAb0136 (IgG1 subtype of the mAb0012 antibody).
- mAb0123 IgG1 subtype of the mAb0023 antibody
- mAb0136 IgG1 subtype of the mAb0012 antibody
- the absolute number of TLT-1 on the platelet surface was obtained by using the bead derived standard curve.
- Step 1 N-((3-( ⁇ -(Fluorenylmethoxycarbonylamino)3 kDa PEGyl)propionylamino)acetyl)-O 2 -[5′]cytidylyl- ⁇ -neuraminic Acid
- the THF was removed in vacuo, having a bath temperature of 25° C.
- the remaining mixture was diluted with water up to 60 ml and was filtered through a 0.45 ⁇ m filter.
- the solution was divided into three parts each of which was subjected to an HPLC chromatography on a C4 column, using a flow of 20 ml/min and a gradient of 0-60% acetonitrile in an aqueous buffer of 50 mM ammonium hydrogencarbonate over 50 min after it had washed with an aqueous buffer of 50 mM ammonium hydrogencarbonate for 10 min.
- Step 2 N-((3-( ⁇ -Amino-3 kDa PEGyl)propionylamino)acetyl)-O 2 -[5′]cytidylyl- ⁇ -neuraminic Acid
- N-((3-( ⁇ -(Fluorenylmethoxycarbonylamino)3 kDa PEGyl)propionylamino)acetyl)-O 2 -[5′]cytidylyl- ⁇ -neuraminic acid (532 mg, 0.135 mmol) was dissolved in N,N-dimethylformamide (9 ml). Piperidine (2.25 ml) was added. The reaction mixture was stirred for 20 min at room temperature. Ether (150 ml) was added. The mixture was left at room temperature for 1 h. The formed precipitate was isolated by decantation and centrifugation. It was dissolved in dichloromethane (10 ml).
- Step 3 N-((3-( ⁇ -(3-(2,5-dioxo-2,5-dihydropyrrol-1-yl)propionylamino)3 kDa PEGyl)propionylamino)acetyl)-O 2 -[5′]cytidylyl- ⁇ -neuraminic acid (NNC 0129-0000-3259)
- N-((3-( ⁇ -Amino-3 kDa PEGyl)propionylamino)acetyl)-O 2 -[5′]cytidylyl-1-neuraminic acid (343 mg, 0.009 mmol) was dissolved in a mixture of dichloromethane (15 ml). Ethyldiisopropylamine (0.05 ml, 0.028 mmol) was added. 3-(2,5-Dioxo-2,5-dihydropyrrol-1-yl)propionic acid 2,5-dioxopyrrolidiny-1-yl ester (492 mg, 1.85 mmol) was added as a solid.
- the reaction mixture was stirred at room temperature for 16 h.
- Dichloromethane 140 ml was added.
- Amionomethylated polystyrene resin (commercially available at e.g. Novabiochem, loading 0.85 mmol/g, 4.3 g, 3.69 mmol) was added.
- the mixture was slowly stirred at room temperature for 1 h.
- the resin was removed by filtration.
- the solvent was removed in vacuo with a bath temperature of 25° C.
- Amberlyst 15 resin (2 g) was added.
- the reaction mixture was slowly stirred for 20 min.
- the resin was removed by filtration.
- the solvent was removed in vacuo with a bath temperature of 25° C.
- the residue was dissolved in dichloromethane (10 ml).
- Step 4 Attachment of N-((3-( ⁇ -(3-(2,5-dioxo-2,5-dihydropyrrol-1-yl)propionylamino)3 kDa PEGyl)propionylamino)acetyl)-O 2 -[5′]cytidylyl- ⁇ -neuraminic Acid to an Anti TLT-1 FAB
- a solution of an anti-TLT-1 FAB fragment with parts of the hinge region wherein an unpaired Cys was incorporated (10 mg) in a phosphate buffer was placed in amicon ultracentrifugation device with a cut off of 10 kDa.
- the buffer was changed to a buffer composed of 100 mM HEPES which had been adjusted to pH 7.3, by repeated ultracentrifugation at 4000 rpm.
- a solution of the protein in the buffer composed of 100 mM HEPES which had been adjusted to pH 7.3, (36 ml) was obtained.
- a 1 mg/ml solution of tris(2-carboxyethyl)phosphine hydrochloride (4 ml) was added.
- the reaction mixture was shaken at 300 rpm at 20° C. for 15 min and left at 20° C. for 45 min.
- the reaction mixture was placed in an ultracentrifugation device with a cut off of 10 kDa.
- the buffer was changed to a buffer composed of 25 mM HEPES which had been adjusted to pH 7.0 by repeated ultracentrifugation at 4000 rpm to give a solution of 13.2 ml.
- the pool (9.9 mg, 13.7 ml), containing the desired compound as judged by SDS-PAGE and which were devoid of free PEG reagent as judged by SDS-PAGE utilizing a PEG-specific staining method (described in Kur sincest, M. M. Analyt. Biochem. 1992, 200, 244-248.) was used in the following step.
- the buffer was changed to a buffer of 20 mM HEPES, 10 mM CaCl 2 , 0.005% Tween80, 100 mM NaCl, which had been adjusted to pH 7.5 be repeated centrifugation at 4000 rpm to give a final volume of 6.5 ml.
- This solution was added to the immobilized sialidase.
- the reaction mixture was rolled at room temperature for 3.5 h.
- Buffer composed of 20 mM histidine, 10 mM CaCl 2 , 20% glycerol, 0.02% Tween 80, 500 mM NaCl which had been adjusted to pH 6.0 was added. An ultracentrifugation at 4000 rpm for 2 min was applied. Another portion of buffer composed of 20 mM histidine, 10 mM CaCl 2 , 20% glycerol, 0.02% Tween 80, 500 mM NaCl which had been adjusted to pH 6.0 was added. An ultracentrifugation at 4000 rpm for 10 min was applied. The reaction product of the reaction with the immobilized sialidase was added, by filtration to remove the immobilized sialidase.
- buffer composed of 20 mM histidine, 10 mM CaCl 2 , 20% glycerol, 0.02% Tween 80, 500 mM NaCl which had been adjusted to pH 6.0 was added. An ultracentrifugation at 4000 rpm for 10 min was applied to obtain a total volume of 9 ml. A solution of ST3Gal-III (500 ⁇ l) was added. The reaction mixture is gently shaken at 32° C. for 15 min and thereafter left at 32° C. for 16 h.
- CMP-N-acetylneuraminic acid (CMP NeuNAc, 0.70 mg, 0.89 ml) in a buffer of 20 mM histidine, 10 mM CaCl 2 , 20% glycerol, 0.02% Tween 80, 500 mM NaCl which had been adjusted to pH 6.0 was added was added. The reaction mixture was gently shaken at 32° C. for 15 min and thereafter left at 32° C. for 1 h.
- the reaction mixture was subjected to a size exclusion chromatography on a Superdex 200 26/60 GL column (GE Healthcare) with a flow of 2 ml/min utilizing a buffer of 10 mM Histidine, 10 mM CaCl 2 , 0.01% Tween 80, 200 mM NaCl which had been adjusted to pH 6 as eluent.
- the fractions containing the desired product as judged by SDS-PAGE on a TRIS-Acetate gel were pooled. Using a molar absorption of 12.86 at 280 nm on a Nandrop® apparatus, a yield of 3.2 mg was found. The result of a SDS-PAGE analysis was in accordance with the expectation for the desired product.
- FVIIa 407C (5 mg, 0.55 mg/ml, 9 ml) in 20 mM HEPES, 100 mM NaCl, 10 mM CaCl2, pH 7.0 was mixed with solutions of glutathione (reduced, 40 mM, 125 microliter, in HEPES buffer), glutathione (oxidised, 1.6 mM, 125 microliter, in HEPES buffer), para-aminobenzamidine (0.5 M, 500 microliter, in HEPES buffer), and glutaredoxin (Grx2, EC 1.20.4.1, 96 micromolar, 200 microliter). The volume was adjusted to 10.0 ml, pH was 7.0.
- the resulting mixture was incubated at 32 degrees Celsius for 5 h.
- EDTA in water 800 microliter, 0.25 M, pH 7.0 was added. The solution was diluted with desalted water until the conductivity was reduced to 8.3 mS/cm (20 ml).
- the solution was injected on a pre-conditioned HiTrap Q FF column (preconditioned in Buffer A, 5 ml column volume).
- Buffer A 50 mM HEPES, 100 mM NaCl, 1 mM EDTA, 0.01% Tween-80, pH 7.0
- Buffer B 50 mM HEPES, 100 mM NaCl, 10 mM CaCl2, 0.01% Tween-80, pH 7.0
- the immobilised protein was washed with Buffer A (5 CV) using a ⁇ kta purifier 100 chromatography station.
- the protein was eluded with buffer B (10 CV) at 2 ml/min. Elution of the protein of interest was done by monitoring the absorbance at 280 nm.
- Protein concentration in the combined pool was estimated to be 0.49 mg/ml (abs. 280 nm), volume 7.5 ml, 3.8 mg FVIIa (77.6 nmol).
- the solution was injected on a pre-conditioned HiTrap Q FF column (preconditioned in Buffer A, 5 ml column volume).
- Buffer A 50 mM HEPES, 100 mM NaCl, 1 mM EDTA, 0.01% Tween-80, pH 7.0
- Buffer B 50 mM HEPES, 100 mM NaCl, 10 mM CaCl2, 0.01% Tween-80, pH 7.0
- the immobilised protein was washed with Buffer A (5 CV) using a ⁇ kta purifier 100 chromatography station.
- the protein was eluded with buffer B (10 CV) at 2 ml/min. Elution of the protein of interest was done by monitoring the absorbance at 280 nm.
- the fractions of interest were pooled resulting in a total volume of 12 ml.
- the protein concentration was measured (Abs. at 280 nm) to 0.30 mg/ml, 3.6 mg of protein in total.
- the mixture was placed in an Amicon Ultracentrifugal filter device (Millipore corp., MWCO 10 kDa) and the buffer was exchanged by repetitive additions of buffer (20 mM HEPES, 1.0 mM CaCl2, 100 mM NaCl, 0.005% (v/v) Tween-80, pH 7.5) followed by centrifugation.
- buffer (20 mM HEPES, 1.0 mM CaCl2, 100 mM NaCl, 0.005% (v/v) Tween-80, pH 7.5
- the buffer exchanged sample of antibody fragment was mixed with the linker conjugated FVIIa sample and the resulting solution was bufferexchanged into a buffer (50 mM HEPES, 100 mM NaCl, 35 mM CaCl 2 , 50 mM benzamidine, 0.01% Tween-80, pH 7.5) and subsequently concentrated to 7 ml. The mixture was incubated over night at room temperature. The resulting mixture was analysed using SDS-PAGE gel electrophoresis.
- a buffer 50 mM HEPES, 100 mM NaCl, 35 mM CaCl 2 , 50 mM benzamidine, 0.01% Tween-80, pH 7.5
- the solution was injected on a pre-conditioned HiTrap Q FF column (preconditioned in Buffer A, 5 ml column volume).
- Buffer A 50 mM HEPES, 100 mM NaCl, 1 mM EDTA, 0.01% Tween-80, pH 7.0
- Buffer B 50 mM HEPES, 100 mM NaCl, 10 mM CaCl 2 , 0.01% Tween-80, pH 7.0
- the immobilised protein was washed with Buffer A (5 CV) using a ⁇ kta purifier 100 chromatography station.
- the protein was eluded with buffer B (10 CV) at 2 ml/min.
- the selected fractions were concentrated in an Amicon Ultracentrifugal filter device (Millipore corp., MWCO 10 kDa) and the buffer was exchanged by repetitive additions of buffer (20 mM HEPES, 1.0 mM CaCl2, 100 mM NaCl, 0.005% (v/v) Tween-80, pH 7.5) followed by centrifugation.
- the concentrated sample (5 ml) was injected on a preconditioned Superdex Hiload 16/60 column (GE Healthcare, pre-conditioned in the applied buffer).
- Buffer 10 mM L-Histidine, 10 mM CaCl 2 , 100 mM NaCl, 0.01% Tween80, pH 6.0
- the protein was purified by elution at a flow of 0.8 ml/min over 2 CV.
- the pool of selected fractions was concentrated using an Amicon Ultracentrifugal filter device (Millipore corp., MWCO 10 kDa) to a total volume: 2.25 ml.
- the amount of protein was measured (abs. 280 nm) to be 1.2 mg (protein conjugate).
- 6-hydroxy-9-[2-(piperazin-4-ium-1-carbonyl)phenyl]xanthen-3-one was suspended in a mixture of sat. aq. sodium bicarbonate (50 ml) and tetrahydrofuran (50 ml). The mixture was stirred for 10 minutes. Diglycolic anhydride is added. After 3 h, additional diglyoclic anydride (500 mg) was added. The mixture is stirred for 20 h. The mixture was acidified with fuming hydrochloric acid to pH 1.
- Cystamine dihydrochloride was dissolved in 1 M NaOH (aq.), 50 ml. The solution was extracted with DCM (5 ⁇ 30 ml). The combined org. phases were dried (Na 2 SO 4 ), filtered, and concentrated in vacuo.
- the diamine was dissolved in acetonitril (30 ml). A solution was added dropwise solution of anhydride in acetonitril (30 ml) to the solution. The resulting mixture was stirred for 15 minutes. The formed solid was allowed to settle for 1 h. The solvent was decanted off.
- the formed amino acid was dissolved in sat. aq. sodium bicarbonate (25 ml). The resulting mixture was stirred over night. DCM (50 ml) and aq. sodium hydroxide (50 ml) were added. The phases were separated. The organic phase was extracted with aq. sodium hydroxide (3 ⁇ 50 ml). The combined aqueous extracts were acidified by addition of hydrochloric acid (fuming) causing extensive precipitation. The mixture was filtered. The isolated slurry was redissolved in DMF and concentrated in vacuo.
- B-domain deleted factor VIII (turoctocoq alpha, Novo Nordisk A/S, 1.92 ml, 4.2 mg/ml) in imidazol buffer (20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 150 mM NaCl, 1 M glycerol, pH 7.3) and sialidase (recombinant, Arthrobactor Ureafaciens sialidase, 3.2 U) were mixed and left for 1 hour at ambient temperature. The sample was diluted to 25 ml with buffer.
- the solution was injected on a pre-conditioned monoQ column (pre-conditioned in Buffer A, 5 ml column volume).
- Buffer A 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 25 mM NaCl, 1M glycerol, pH 7.3
- Buffer B 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 1M NaCl, 1 M glycerol, pH7.3.
- the immobilised protein was washed with Buffer A (5 CV) using a ⁇ kta purifier 100 chromatography station.
- the protein was eluded with a gradient of buffer B (2 CV eq+5 wash out unbound sample+2 CV 0-20% B+10 CV 20% B+10 CV 100% B) at 1 ml/min. Elution of the protein of interest was done by monitoring the absorbance at 280 nm.
- the isolated N,O-asialo BDD-FVIII (0.98 mg/ml, 5 mg) was mixed with Fluorescent cytidyl monophosphate neuraminic acid derivative and recombinant sialyltransferase (His-ST3Gall). The resulting mixture was incubated over night at room temperature in the dark.
- the sample was diluted to 40 ml with buffer A: 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 25 mM NaCl, 1M glycerol, pH 7.3.
- the solution was injected on a pre-conditioned monoQ column (pre-conditioned in Buffer A, 5 ml column volume).
- Buffer A 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 25 mM NaCl, 1M glycerol, pH 7.3.
- Buffer B 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 1M NaCl, 1 M glycerol, pH 7.3.
- the immobilised protein was washed with Buffer A (5 CV) using a ⁇ kta purifier 100 chromatography station.
- the protein was eluded with a gradient of buffer B (2 CV eq+5 wash out unbound sample+2 CV 0-20% B+10 CV 20% B+10 CV 100% B) at 1 ml/min. Elution of the protein of interest was done by monitoring the absorbance at 280 nm.
- the selected fractions were pooled and incubated with cytidylmonophosphate N-acetylneuraminic acid and sialyltranferase (ST3GalIII) for 30 minutes.
- the mixture was diluted to 35 ml with buffer A.
- the solution was injected on a pre-conditioned monoQ column (pre-conditioned in Buffer A, 5 ml column volume).
- Buffer A 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 25 mM NaCl, 1M glycerol, pH 7.3.
- Buffer B 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 1M NaCl, 1 M glycerol, pH 7.3.
- the immobilised protein was washed with Buffer A (5 CV) using a ⁇ kta purifier 100 chromatography station.
- the protein was eluded with a gradient of buffer B (2 CV eq+5 wash out unbound sample+2 CV 0-20% B+10 CV 20% B+10 CV 100% B) at 1 ml/min. Elution of the protein of interest was done by monitoring the absorbance at 280 nm.
- the selected fractions were pooled and evaluated by SDS PAGE gel electrophoresis (4-12% Bis-Tris acetate, reduced and non-reduced).
- the isolated fractions were mixed with buffer (15 ml) containing tris(carboxyethyl)phosphine, TCEP (20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 25 mM NaCl, 1M glycerol, pH 7.3, 0.7 mM TCEP). The resulting mixture was incubated for 20 minutes. The solution was injected on a pre-conditioned monoQ column (5/50 GL, preconditioned in Buffer A with TCEP).
- Buffer A1 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 25 mM NaCl, 1M glycerol, pH 7.3, 0.7 mM TCEP).
- Buffer A2 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 25 mM NaCl, 1M glycerol, pH 7.3).
- Buffer B1 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 1 M NaCl, 1M glycerol, pH 7.3).
- the immobilised protein was washed with Buffer A1 (45 CV) followed by Buffer A2 (10 CV) using a ⁇ kta purifier 100 chromatography station.
- the protein was eluded with buffer B (15 CV 100% B) at 1 ml/min. Elution of the protein of interest was done by monitoring the absorbance at 280 nm.
- the selected fractions were pooled and analysed by SDS-PAGE (Tris-acetate).
- the isolated factor VIII compound was diluted with Buffer A and injected on a pre-conditioned monoQ column (5/50 GL, pre-conditioned in Buffer A).
- Buffer A containing 4.8 mM BM(PEG) 2 (1,8-Bismaleimidodiethyleneglycol, Pierce/Thermo scientific) was maintained for 100 minutes.
- the protein was washed and eluded using the following protocol: 10 CV A1, 25CV in buffer A2 (bismaleimide) at 0.25 ml/min (100 min), 10CV buffer A1, 10CV 100% B1.
- Anti-TLT-1 antibody fragment 0084 was buffer exchanged using an Amicon Ultracentrifugal filter device MWCO 30 kDa into HEPES buffer (20 mM HEPES+1 mM CaCl 2 , 100 mM NaCl+0.005% Tween80, pH: 7.50). Concentration measured to be: 3.44 mg/ml, 2 mg): Tris(3-sulfonatephenyl)phosphine hydrate sodium salt (Alfa Aesar, technical grade 85%) was added to a resulting concentration of 12.5 mM. The resulting mixture was incubated at room temperature for 2 h.
- the antibody fragment was buffer exchanged using an Amicon Ultracentrifugal filter device MWCO 30 kDa into imidazol buffer (20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 25 mM NaCl, 1M glycerol, pH 7.3).
- the solution was injected on a pre-conditioned monoQ column (pre-conditioned in Buffer A, 5 ml column volume).
- Buffer A 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 25 mM NaCl, 1M glycerol, pH 7.3.
- Buffer B 20 mM Imidazol, 10 mM CaCl 2 , 0.02% Tween 80, 1M NaCl, 1 M glycerol, pH 7.3.
- the immobilised protein was washed with Buffer A (5 CV) using a ⁇ kta purifier 100 chromatography station.
- the protein was eluded with a gradient of buffer B (2 CV eq+5 wash out unbound sample+2 CV 0-20% B+10 CV 20% B+10 CV 100% B) at 1 ml/min. Elution of the protein of interest was done by monitoring the absorbance at 280 nm.
- the selected fractions were pooled and concentrated.
- the protein was injected on a pre-conditioned Superdex 200 16/60 PG column (pre-conditioned in Buffer A).
- Buffer A Histidine (1.5 g, 1.5 mg/ml), CaCl 2 *H2O (376 mg, 0.37 mg/ml), NaCl (18 g, 18 mg/ml), Sucrose (3 g, 3 mg/ml), Tween 80 (100 mg, 0.1 mg/ml), Diluted to 1000 ml with MQ, adjust to pH 7.0.
- the end concentrations are: Factor IX: 0.33 mg/ml, ST3Gal3: 0.08 mg/ml
- Factor IX and an antibody fragment are conjugated using the methods described herein, i.e, reduction mediated by a phosphine or glutathion, coupling to a linker entity, and conjugation followed by purification and analysis.
- FVIIa-Fab9015 is Superior to rFVIIa in Reducing Tail-Bleeding in Transient Haemophilic Mice
- mice Humanized TLT-1 knock-out/knock-in mice were made transiently haemophilic by administration of a monoclonal FVIII-antibody. Five minutes before induction of tail-bleeding, the mice were pre-treated with 20, 5 or 0.8 nmol/kg FVIIa-Fab9015 (3.625 ml/kg), 20 nmol/kg rFVIIa or vehicle. Tail-bleeding was induced by transection 4 mm from the tail-tip, and the resulting bleeding was observed for 30 minutes. Platelet counts were obtained initially and 30, 60 and 120 minutes after induction of tail-bleeding.
- TLT-1-FAb-FVIIa dose-dependently reduced blood loss and bleeding time, reaching statistical significance at 20 and 5 nmol/kg. Moreover 20 nmol/kg FVIIa-Fab9015 was significantly more efficacious compared to 20 nmol/kg rFVIIa ( FIG. 15 ).
- FVIIa-Fab9015 was superior to rFVIIa in reducing haemophilic tail-bleeding in TLT-1 KOKI mice. No signs of adverse effects, eg. decrease in platelet counts, were observed.
- FVIIa-Fab9015 was tested in a thrombin generation assay.
- human platelet rich plasma (PRP) obtained by centrifugation of citrated human whole blood at 220 g for 20 min.
- the upper phase containing platelets was collected and the remaining sample was centrifuged at 2500 g for 10 min to obtain platelet poor plasma (PPP) used to adjust the platelet concentration to be used at a final concentration of 150000 plts/ ⁇ l.
- PPP platelet poor plasma
- the PRP was made haemophilic by 30 min incubation with a sheep anti-human FVIII polyclonal antibody (0.1 mg/ml) (HTI #Z0429).
- Platelets were activated with either protease activated recertor-1 activation peptide (SFLLRN; Bachem #H-2936) or a combination of the peptide and the GPVI activating snake venom Convulxin (Pentapharm #119-02).
- Generated thrombin was measured using a fluorogenic method from Thrombinoscope®. PRP, FluCa reagent and compound were mixed and added to 96-well Nunc Microwell round bottom well plates. The reaction was started by the addition of platelet activator and the fluorescent signal from the substrate was detected in a ThermoFisher Fluoroskan plate reader (Fisher Scientific). The thrombin concentration was calculated using a Thrombin calibrator provided by Thrombinoscope according to their instructions.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Toxicology (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Diabetes (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/982,360 US20130337537A1 (en) | 2011-03-02 | 2012-03-02 | Coagulation factor-targeting to tlt-1 on activated platelets |
Applications Claiming Priority (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP11156682.4 | 2011-03-02 | ||
| EP11156682 | 2011-03-02 | ||
| US201161449254P | 2011-03-04 | 2011-03-04 | |
| PCT/EP2012/053619 WO2012117091A1 (en) | 2011-03-02 | 2012-03-02 | Coagulation factor-targeting to tlt-1 on activated platelets |
| US13/982,360 US20130337537A1 (en) | 2011-03-02 | 2012-03-02 | Coagulation factor-targeting to tlt-1 on activated platelets |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2012/053619 A-371-Of-International WO2012117091A1 (en) | 2011-03-02 | 2012-03-02 | Coagulation factor-targeting to tlt-1 on activated platelets |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/094,082 Continuation US20160263230A1 (en) | 2011-03-02 | 2016-04-08 | Coagulation Factor-Targeting to TLT-1 on Activated Platelets |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20130337537A1 true US20130337537A1 (en) | 2013-12-19 |
Family
ID=44558650
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/982,360 Abandoned US20130337537A1 (en) | 2011-03-02 | 2012-03-02 | Coagulation factor-targeting to tlt-1 on activated platelets |
| US15/094,082 Abandoned US20160263230A1 (en) | 2011-03-02 | 2016-04-08 | Coagulation Factor-Targeting to TLT-1 on Activated Platelets |
| US16/125,026 Active US11135275B2 (en) | 2011-03-02 | 2018-09-07 | Coagulation factor-targeting to TREM-like transcript 1 (TLT-1) on activated platelets |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/094,082 Abandoned US20160263230A1 (en) | 2011-03-02 | 2016-04-08 | Coagulation Factor-Targeting to TLT-1 on Activated Platelets |
| US16/125,026 Active US11135275B2 (en) | 2011-03-02 | 2018-09-07 | Coagulation factor-targeting to TREM-like transcript 1 (TLT-1) on activated platelets |
Country Status (13)
| Country | Link |
|---|---|
| US (3) | US20130337537A1 (https=) |
| EP (1) | EP2680875B1 (https=) |
| JP (2) | JP6309273B2 (https=) |
| KR (1) | KR20140012082A (https=) |
| CN (1) | CN103429256B (https=) |
| AU (1) | AU2012222366A1 (https=) |
| BR (1) | BR112013021661A2 (https=) |
| CA (1) | CA2828769A1 (https=) |
| IL (1) | IL227501A0 (https=) |
| MX (1) | MX2013009862A (https=) |
| RU (1) | RU2013142015A (https=) |
| WO (1) | WO2012117091A1 (https=) |
| ZA (1) | ZA201306111B (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113692415A (zh) * | 2019-04-17 | 2021-11-23 | 诺和诺德股份有限公司 | 双特异性抗体 |
Families Citing this family (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| TWI353991B (en) | 2003-05-06 | 2011-12-11 | Syntonix Pharmaceuticals Inc | Immunoglobulin chimeric monomer-dimer hybrids |
| SG10201505217WA (en) | 2010-07-09 | 2015-08-28 | Biogen Hemophilia Inc | Chimeric clotting factors |
| US9994632B2 (en) * | 2014-05-26 | 2018-06-12 | Samsung Electronics Co., Ltd. | Humanized or affinity-matured anti Ang-2 antibody and uses thereof |
| US11685785B2 (en) * | 2015-06-12 | 2023-06-27 | Ascendo Biotechnology, Inc. | Methods and antibodies for modulation of immunoresponse |
| WO2018053597A1 (en) * | 2016-09-23 | 2018-03-29 | Csl Limited | Coagulation factor binding proteins and uses thereof |
| AR110079A1 (es) | 2016-11-16 | 2019-02-20 | Bayer Healthcare Llc | Factor viii direccionado a los glóbulos rojos y método para su uso |
| EP3454063B1 (de) * | 2017-09-06 | 2022-05-18 | AVA Lifescience GmbH | Durchflusszytometrie-messverfahren |
| US10597462B1 (en) * | 2017-11-08 | 2020-03-24 | University Of Puerto Rico | Anti-TLT-1 antibody and uses thereof |
| WO2020226907A1 (en) * | 2019-05-07 | 2020-11-12 | Beijing Neoletix Biological Technology Co., Ltd. | Fusion protein of single domain antibody and procoagulant |
| WO2025168826A1 (en) | 2024-02-08 | 2025-08-14 | Hemab Aps | Methods of treating coagulopathy |
Family Cites Families (38)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5047335A (en) | 1988-12-21 | 1991-09-10 | The Regents Of The University Of Calif. | Process for controlling intracellular glycosylation of proteins |
| EP0470128B2 (en) | 1989-04-19 | 2003-08-13 | Enzon, Inc. | Active carbonates of polyalkylene oxides for modification of polypeptides |
| DE3920358A1 (de) | 1989-06-22 | 1991-01-17 | Behringwerke Ag | Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung |
| US5278299A (en) | 1991-03-18 | 1994-01-11 | Scripps Clinic And Research Foundation | Method and composition for synthesizing sialylated glycosyl compounds |
| WO1993010260A1 (en) | 1991-11-21 | 1993-05-27 | The Board Of Trustees Of The Leland Stanford Junior University | Controlling degradation of glycoprotein oligosaccharides by extracellular glycosisases |
| DE69232137T2 (de) | 1991-11-25 | 2002-05-29 | Enzon Inc | Multivalente antigen-bindende proteine |
| US5877289A (en) | 1992-03-05 | 1999-03-02 | The Scripps Research Institute | Tissue factor compositions and ligands for the specific coagulation of vasculature |
| US5643575A (en) | 1993-10-27 | 1997-07-01 | Enzon, Inc. | Non-antigenic branched polymer conjugates |
| US5629384A (en) | 1994-05-17 | 1997-05-13 | Consiglio Nazionale Delle Ricerche | Polymers of N-acryloylmorpholine activated at one end and conjugates with bioactive materials and surfaces |
| US5932462A (en) | 1995-01-10 | 1999-08-03 | Shearwater Polymers, Inc. | Multiarmed, monofunctional, polymer for coupling to molecules and surfaces |
| JP4451514B2 (ja) | 1999-08-24 | 2010-04-14 | 財団法人化学及血清療法研究所 | 血液凝固第vii因子改変体 |
| DE60143292D1 (de) | 2000-05-03 | 2010-12-02 | Novo Nordisk Healthcare Ag | Varianten des menschlichen Koagulationsfaktors VII |
| AU8755001A (en) | 2000-09-13 | 2002-03-26 | Novo Nordisk As | Human coagulation factor vii variants |
| AU2002218029A1 (en) | 2000-11-09 | 2002-05-21 | The Scripps Research Institute | Modified factor viia |
| MXPA03008590A (es) | 2001-03-22 | 2003-12-08 | Novo Nordisk Healthcare Ag | Derivados del factor vii de coagulacion. |
| BR0212818A (pt) | 2001-09-27 | 2004-10-05 | Novo Nordisk Healthcare Ag | Polipeptìdeo de fator vii, construção de polionucletìdeo, célula hospedeira, animal transgênico, planta transgênica, método para produzir o polipeptìdeo de fator vii composição farmacêutica, uso de um polipeptìdeo de fator vii, e, método para o tratamento de distúrbios do sangramento em um sujeito ou para o aprimoramento do sistema hemostático normal |
| EP2042196B1 (en) | 2001-10-10 | 2016-07-13 | ratiopharm GmbH | Remodelling and glycoconjugation of Granulocyte Colony Stimulating Factor (G-CSF) |
| JP2005512524A (ja) | 2001-11-02 | 2005-05-12 | ノボ ノルディスク ヘルス ケア アクチェンゲゼルシャフト | ヒト凝固第vii因子ポリペプチド |
| ES2293088T3 (es) | 2002-09-25 | 2008-03-16 | Novo Nordisk Health Care Ag | Polipeptidos del factor vii de la coagulacion humana. |
| US20040180054A1 (en) | 2003-03-13 | 2004-09-16 | Hanmi Pharm. Co., Ltd. | Physiologically active polypeptide conjugate having prolonged in vivo half-life |
| US20040180409A1 (en) * | 2003-03-16 | 2004-09-16 | Mcvicar Daniel | TLT-1, a novel platelet-associated receptor and uses therefor |
| EP2055189A1 (en) | 2003-04-09 | 2009-05-06 | Neose Technologies, Inc. | Glycopegylation methods and proteins/peptides produced by the methods |
| PT1624891E (pt) * | 2003-05-06 | 2010-01-05 | Syntonix Pharmaceuticals Inc | Proteínas quiméricas de factor de coagulação-fc destinadas ao tratamento da hemofilia |
| JP2006527590A (ja) | 2003-06-18 | 2006-12-07 | ディレボ・ビオテク・アーゲー | 新規生物学的実体およびその使用 |
| WO2005024006A2 (en) | 2003-09-09 | 2005-03-17 | Novo Nordisk Health Care Ag | Coagulation factor vii polypeptides |
| US7393833B2 (en) | 2005-03-09 | 2008-07-01 | The Board Of Regents Of The University Of Oklahoma | Chimeric proteins with phosphatidylserine binding domains |
| RU2007145085A (ru) | 2005-06-15 | 2009-07-20 | Ново Нордиск Хелс Кеа Аг (Ch) | Опосредованное трансглютаминазой коньюгирование гормона роста |
| JP5690047B2 (ja) | 2005-09-14 | 2015-03-25 | ノボ ノルディスク ヘルス ケア アーゲー | ヒト凝固第vii因子ポリペプチド |
| JP5216219B2 (ja) * | 2006-01-06 | 2013-06-19 | 真司 武岡 | 薬物運搬体 |
| CN101389356B (zh) | 2006-01-06 | 2012-09-05 | 武冈真司 | 药物输送物质 |
| US7553936B2 (en) * | 2006-12-04 | 2009-06-30 | The United States of America as represented by Secretary Department of Health and Human Services | Anti-TREM-like transcript-1 (TLT-1) antibodies and compositions |
| CN105131127B (zh) | 2007-05-30 | 2018-09-07 | 浦项工科大学校产学协力团 | 免疫球蛋白融合蛋白 |
| KR101582841B1 (ko) | 2008-02-27 | 2016-01-11 | 노보 노르디스크 에이/에스 | 콘쥬게이트된 인자 viii 분자 |
| CN102112144A (zh) * | 2008-05-16 | 2011-06-29 | 拜耳医药保健有限公司 | 靶向性凝固因子及其使用方法 |
| EP2149603A1 (en) | 2008-07-28 | 2010-02-03 | DRK-Blutspendedienst Baden-Württemberg-Hessen gGmbH | Factor IX variants with clotting activity in absence of their cofactor and their use for treating bleeding disorders |
| KR20110039348A (ko) | 2008-08-06 | 2011-04-15 | 노보 노르디스크 헬스 케어 악티엔게젤샤프트 | 연장된 생체내 효능을 가지는 콘쥬게이트된 단백질 |
| JP5770161B2 (ja) * | 2009-04-06 | 2015-08-26 | ノヴォ ノルディスク アー/エス | 血小板への第viii因子タンパク質の標的送達 |
| EP2470561A1 (en) * | 2009-08-27 | 2012-07-04 | Novo Nordisk A/S | Targeting tissue factor to activated platelets |
-
2012
- 2012-03-02 BR BR112013021661A patent/BR112013021661A2/pt not_active Application Discontinuation
- 2012-03-02 EP EP12707095.1A patent/EP2680875B1/en active Active
- 2012-03-02 CA CA2828769A patent/CA2828769A1/en not_active Withdrawn
- 2012-03-02 CN CN201280011375.7A patent/CN103429256B/zh active Active
- 2012-03-02 JP JP2013555888A patent/JP6309273B2/ja active Active
- 2012-03-02 KR KR1020137023069A patent/KR20140012082A/ko not_active Withdrawn
- 2012-03-02 US US13/982,360 patent/US20130337537A1/en not_active Abandoned
- 2012-03-02 RU RU2013142015/10A patent/RU2013142015A/ru unknown
- 2012-03-02 MX MX2013009862A patent/MX2013009862A/es unknown
- 2012-03-02 WO PCT/EP2012/053619 patent/WO2012117091A1/en not_active Ceased
- 2012-03-02 AU AU2012222366A patent/AU2012222366A1/en not_active Withdrawn
-
2013
- 2013-07-16 IL IL227501A patent/IL227501A0/en unknown
- 2013-08-14 ZA ZA2013/06111A patent/ZA201306111B/en unknown
-
2016
- 2016-04-08 US US15/094,082 patent/US20160263230A1/en not_active Abandoned
-
2017
- 2017-12-07 JP JP2017235148A patent/JP2018043997A/ja active Pending
-
2018
- 2018-09-07 US US16/125,026 patent/US11135275B2/en active Active
Non-Patent Citations (4)
| Title |
|---|
| Berkner et al, Isolation and Expression of cDNAs Encoding Human Factor VII. Cold Spring Harb Symp Quant Biol 1986. 51: 531-541 Cold Spring Harb Symp Quant Biol 1986. 51: 531-541. * |
| Halabian et al, Expression and purification of recombinant human coagulation factor VII fused to a histidine tag using Gateway technology. Blood Transfus 2009; 7: 305-12. * |
| Lu et al, Preparation and Characterization of Monoclonal Antibody Against Protein TREM-Like Transcript-1 (TLT-1). Hybridoma (Larchmt). 2006 Feb;25(1):20-6. * |
| Washington et al, ATREM family member, TLT-1, is found exclusively in the _-granules ofmegakaryocytes and platelets. BLOOD, 15 AUGUST 2004 _ VOLUME 104, NUMBER 4 p1042-47. * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113692415A (zh) * | 2019-04-17 | 2021-11-23 | 诺和诺德股份有限公司 | 双特异性抗体 |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2014509326A (ja) | 2014-04-17 |
| WO2012117091A1 (en) | 2012-09-07 |
| ZA201306111B (en) | 2014-04-30 |
| CN103429256A (zh) | 2013-12-04 |
| JP2018043997A (ja) | 2018-03-22 |
| US20160263230A1 (en) | 2016-09-15 |
| CA2828769A1 (en) | 2012-09-07 |
| RU2013142015A (ru) | 2015-04-10 |
| IL227501A0 (en) | 2013-09-30 |
| US11135275B2 (en) | 2021-10-05 |
| CN103429256B (zh) | 2022-09-13 |
| JP6309273B2 (ja) | 2018-04-11 |
| EP2680875B1 (en) | 2019-10-23 |
| EP2680875A1 (en) | 2014-01-08 |
| KR20140012082A (ko) | 2014-01-29 |
| US20190083587A1 (en) | 2019-03-21 |
| MX2013009862A (es) | 2013-10-25 |
| AU2012222366A1 (en) | 2013-08-01 |
| BR112013021661A2 (pt) | 2016-11-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11135275B2 (en) | Coagulation factor-targeting to TREM-like transcript 1 (TLT-1) on activated platelets | |
| EP3219723B1 (en) | Targeting tissue factor to activated platelets | |
| US10717784B2 (en) | Antibodies capable of specifically binding two epitopes on tissue factor pathway inhibitor | |
| KR20190112747A (ko) | 응고촉진 항체 | |
| CN113692415B (zh) | 双特异性抗体 | |
| US20160297892A1 (en) | Novel Methods and Antibodies for Treating Coagulapathy | |
| KR20210040389A (ko) | 개선된 응혈 촉진 항체 | |
| US20210246212A1 (en) | Anti-gpiib/iiia antibodies and uses thereof | |
| ES2757930T3 (es) | Direccionamiento de factores de coagulación al TLT-1 en plaquetas activadas | |
| RU2818588C2 (ru) | Биспецифические антитела |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: NOVO NORDISK A/S, DENMARK Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:HILDEN, IDA;PESCHKE, BERND;BREINHOLT, JENS;AND OTHERS;REEL/FRAME:031210/0455 Effective date: 20130812 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |