US20040266989A1 - Methods and compositions for the treatment of gastrointestinal disorders - Google Patents
Methods and compositions for the treatment of gastrointestinal disorders Download PDFInfo
- Publication number
- US20040266989A1 US20040266989A1 US10/766,735 US76673504A US2004266989A1 US 20040266989 A1 US20040266989 A1 US 20040266989A1 US 76673504 A US76673504 A US 76673504A US 2004266989 A1 US2004266989 A1 US 2004266989A1
- Authority
- US
- United States
- Prior art keywords
- cys
- xaa
- tyr
- asn
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000034 method Methods 0.000 title claims abstract description 101
- 208000018522 Gastrointestinal disease Diseases 0.000 title claims abstract description 42
- 239000000203 mixture Substances 0.000 title abstract description 36
- 238000011282 treatment Methods 0.000 title description 21
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 504
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 164
- 206010010774 Constipation Diseases 0.000 claims abstract description 38
- 201000006549 dyspepsia Diseases 0.000 claims abstract description 37
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 36
- 208000035475 disorder Diseases 0.000 claims abstract description 31
- 208000021302 gastroesophageal reflux disease Diseases 0.000 claims abstract description 13
- 208000011231 Crohn disease Diseases 0.000 claims abstract description 11
- 208000017228 Gastrointestinal motility disease Diseases 0.000 claims abstract description 11
- 206010021518 Impaired gastric emptying Diseases 0.000 claims abstract description 11
- 206010009900 Colitis ulcerative Diseases 0.000 claims abstract description 10
- 208000022559 Inflammatory bowel disease Diseases 0.000 claims abstract description 10
- 201000006704 Ulcerative Colitis Diseases 0.000 claims abstract description 10
- 208000001288 gastroparesis Diseases 0.000 claims abstract description 10
- 201000005078 Colonic Pseudo-Obstruction Diseases 0.000 claims abstract description 9
- 208000014797 chronic intestinal pseudoobstruction Diseases 0.000 claims abstract description 9
- 208000024798 heartburn Diseases 0.000 claims abstract description 9
- 108010010430 asparagine-proline-alanine Proteins 0.000 claims description 228
- 108010004073 cysteinylcysteine Proteins 0.000 claims description 156
- 108010069495 cysteinyltyrosine Proteins 0.000 claims description 114
- 150000001413 amino acids Chemical group 0.000 claims description 110
- ALJGSKMBIUEJOB-FXQIFTODSA-N Pro-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@@H]1CCCN1 ALJGSKMBIUEJOB-FXQIFTODSA-N 0.000 claims description 104
- DVKQPQKQDHHFTE-ZLUOBGJFSA-N Cys-Cys-Asn Chemical compound C([C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CS)N)C(=O)N DVKQPQKQDHHFTE-ZLUOBGJFSA-N 0.000 claims description 101
- PLTGTJAZQRGMPP-FXQIFTODSA-N Asn-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC(N)=O PLTGTJAZQRGMPP-FXQIFTODSA-N 0.000 claims description 100
- ISWAQPWFWKGCAL-ACZMJKKPSA-N Cys-Cys-Glu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(O)=O ISWAQPWFWKGCAL-ACZMJKKPSA-N 0.000 claims description 99
- GYAUWXXORNTCHU-QWRGUYRKSA-N Gly-Cys-Tyr Chemical compound NCC(=O)N[C@@H](CS)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 GYAUWXXORNTCHU-QWRGUYRKSA-N 0.000 claims description 94
- ALNKNYKSZPSLBD-ZDLURKLDSA-N Cys-Thr-Gly Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O ALNKNYKSZPSLBD-ZDLURKLDSA-N 0.000 claims description 89
- SNYCNNPOFYBCEK-ZLUOBGJFSA-N Asn-Ser-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O SNYCNNPOFYBCEK-ZLUOBGJFSA-N 0.000 claims description 80
- YNQMEIJEWSHOEO-SRVKXCTJSA-N Asn-Tyr-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC(=O)N)N)O YNQMEIJEWSHOEO-SRVKXCTJSA-N 0.000 claims description 72
- 108010069205 aspartyl-phenylalanine Proteins 0.000 claims description 67
- 108010024409 linaclotide Proteins 0.000 claims description 56
- WYKJENSCCRJLRC-ZDLURKLDSA-N Thr-Gly-Cys Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)N[C@@H](CS)C(=O)O)N)O WYKJENSCCRJLRC-ZDLURKLDSA-N 0.000 claims description 55
- CGDZGRLRXPNCOC-SRVKXCTJSA-N Tyr-Cys-Cys Chemical compound SC[C@@H](C(O)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 CGDZGRLRXPNCOC-SRVKXCTJSA-N 0.000 claims description 51
- UQJUGHFKNKGHFQ-VZFHVOOUSA-N Ala-Cys-Thr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(O)=O UQJUGHFKNKGHFQ-VZFHVOOUSA-N 0.000 claims description 50
- 108010061238 threonyl-glycine Proteins 0.000 claims description 50
- SBMGKDLRJLYZCU-BIIVOSGPSA-N Cys-Asn-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CS)N)C(=O)O SBMGKDLRJLYZCU-BIIVOSGPSA-N 0.000 claims description 43
- 239000000018 receptor agonist Substances 0.000 claims description 41
- 229940044601 receptor agonist Drugs 0.000 claims description 40
- RFLVTVBAESPKKR-ZLUOBGJFSA-N Asn-Cys-Cys Chemical compound N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(O)=O RFLVTVBAESPKKR-ZLUOBGJFSA-N 0.000 claims description 39
- 208000002551 irritable bowel syndrome Diseases 0.000 claims description 39
- 102000000820 Enterotoxin Receptors Human genes 0.000 claims description 38
- 108010001687 Enterotoxin Receptors Proteins 0.000 claims description 38
- YZQCXOFQZKCETR-UWVGGRQHSA-N Asp-Phe Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 YZQCXOFQZKCETR-UWVGGRQHSA-N 0.000 claims description 33
- 230000000694 effects Effects 0.000 claims description 32
- 210000004027 cell Anatomy 0.000 claims description 29
- 229920001184 polypeptide Polymers 0.000 claims description 28
- 101500007657 Crotalus durissus terrificus Crotoxin chain gamma Proteins 0.000 claims description 26
- 239000003112 inhibitor Substances 0.000 claims description 24
- LZMQSTPFYJLVJB-GUBZILKMSA-N Glu-Leu-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)O)N LZMQSTPFYJLVJB-GUBZILKMSA-N 0.000 claims description 22
- LHRCZIRWNFRIRG-SRVKXCTJSA-N Cys-Tyr-Asp Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CS)N)O LHRCZIRWNFRIRG-SRVKXCTJSA-N 0.000 claims description 21
- WLJPJRGQRNCIQS-ZLUOBGJFSA-N Ser-Ser-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O WLJPJRGQRNCIQS-ZLUOBGJFSA-N 0.000 claims description 21
- 208000010643 digestive system disease Diseases 0.000 claims description 21
- 208000018685 gastrointestinal system disease Diseases 0.000 claims description 21
- AOZBJZBKFHOYHL-AVGNSLFASA-N Cys-Glu-Tyr Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O AOZBJZBKFHOYHL-AVGNSLFASA-N 0.000 claims description 19
- GZAUZBUKDXYPEH-CIUDSAMLSA-N Leu-Cys-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N GZAUZBUKDXYPEH-CIUDSAMLSA-N 0.000 claims description 19
- 208000008589 Obesity Diseases 0.000 claims description 19
- 235000020824 obesity Nutrition 0.000 claims description 19
- 206010004446 Benign prostatic hyperplasia Diseases 0.000 claims description 18
- 206010007559 Cardiac failure congestive Diseases 0.000 claims description 18
- 206010019280 Heart failures Diseases 0.000 claims description 18
- 208000004403 Prostatic Hyperplasia Diseases 0.000 claims description 18
- 102000005962 receptors Human genes 0.000 claims description 17
- 108020003175 receptors Proteins 0.000 claims description 17
- 239000008194 pharmaceutical composition Substances 0.000 claims description 16
- 241000214780 Galega Species 0.000 claims description 15
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 claims description 15
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 15
- 239000000730 antalgic agent Substances 0.000 claims description 14
- QOOFKCCZZWTCEP-AVGNSLFASA-N Glu-Tyr-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)O)N)O QOOFKCCZZWTCEP-AVGNSLFASA-N 0.000 claims description 12
- 206010061218 Inflammation Diseases 0.000 claims description 12
- 230000001684 chronic effect Effects 0.000 claims description 12
- 230000001965 increasing effect Effects 0.000 claims description 12
- 230000004054 inflammatory process Effects 0.000 claims description 12
- 102100022662 Guanylyl cyclase C Human genes 0.000 claims description 11
- 101710198293 Guanylyl cyclase C Proteins 0.000 claims description 11
- 206010028980 Neoplasm Diseases 0.000 claims description 11
- 210000004899 c-terminal region Anatomy 0.000 claims description 11
- 101100337060 Caenorhabditis elegans glp-1 gene Proteins 0.000 claims description 10
- KABHAOSDMIYXTR-GUBZILKMSA-N Cys-Glu-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)N KABHAOSDMIYXTR-GUBZILKMSA-N 0.000 claims description 10
- 235000007025 Galega officinalis Nutrition 0.000 claims description 10
- PKZVWAGGKFAVKR-UBHSHLNASA-N Trp-Cys-Cys Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N PKZVWAGGKFAVKR-UBHSHLNASA-N 0.000 claims description 10
- BLFLLBZGZJTVJG-UHFFFAOYSA-N benzocaine Chemical compound CCOC(=O)C1=CC=C(N)C=C1 BLFLLBZGZJTVJG-UHFFFAOYSA-N 0.000 claims description 10
- ANFSNXAXVLRZCG-RSAXXLAASA-N benzphetamine hydrochloride Chemical compound [Cl-].C([C@H](C)[NH+](C)CC=1C=CC=CC=1)C1=CC=CC=C1 ANFSNXAXVLRZCG-RSAXXLAASA-N 0.000 claims description 10
- RYYVLZVUVIJVGH-UHFFFAOYSA-N caffeine Chemical compound CN1C(=O)N(C)C(=O)C2=C1N=CN2C RYYVLZVUVIJVGH-UHFFFAOYSA-N 0.000 claims description 10
- 239000000835 fiber Substances 0.000 claims description 10
- AHLBNYSZXLDEJQ-FWEHEUNISA-N orlistat Chemical compound CCCCCCCCCCC[C@H](OC(=O)[C@H](CC(C)C)NC=O)C[C@@H]1OC(=O)[C@H]1CCCCCC AHLBNYSZXLDEJQ-FWEHEUNISA-N 0.000 claims description 10
- DHHVAGZRUROJKS-UHFFFAOYSA-N phentermine Chemical compound CC(C)(N)CC1=CC=CC=C1 DHHVAGZRUROJKS-UHFFFAOYSA-N 0.000 claims description 10
- WPVGRKLNHJJCEN-BZSNNMDCSA-N Tyr-Asp-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=C(O)C=C1 WPVGRKLNHJJCEN-BZSNNMDCSA-N 0.000 claims description 9
- CFQVGYWKSLKWFX-KBIXCLLPSA-N Cys-Glu-Ile Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O CFQVGYWKSLKWFX-KBIXCLLPSA-N 0.000 claims description 8
- ICFRWCLVYFKHJV-FXQIFTODSA-N Val-Cys-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N ICFRWCLVYFKHJV-FXQIFTODSA-N 0.000 claims description 8
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 claims description 8
- 108010027338 isoleucylcysteine Proteins 0.000 claims description 8
- 108020004707 nucleic acids Proteins 0.000 claims description 8
- 102000039446 nucleic acids Human genes 0.000 claims description 8
- 150000007523 nucleic acids Chemical class 0.000 claims description 8
- 208000009935 visceral pain Diseases 0.000 claims description 8
- UUUHXMGGBIUAPW-UHFFFAOYSA-N 1-[1-[2-[[5-amino-2-[[1-[5-(diaminomethylideneamino)-2-[[1-[3-(1h-indol-3-yl)-2-[(5-oxopyrrolidine-2-carbonyl)amino]propanoyl]pyrrolidine-2-carbonyl]amino]pentanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-3-methylpentanoyl]pyrrolidine-2-carbon Chemical compound C1CCC(C(=O)N2C(CCC2)C(O)=O)N1C(=O)C(C(C)CC)NC(=O)C(CCC(N)=O)NC(=O)C1CCCN1C(=O)C(CCCN=C(N)N)NC(=O)C1CCCN1C(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C1CCC(=O)N1 UUUHXMGGBIUAPW-UHFFFAOYSA-N 0.000 claims description 7
- AHPWQERCDZTTNB-FXQIFTODSA-N Arg-Cys-Cys Chemical compound C(C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N)CN=C(N)N AHPWQERCDZTTNB-FXQIFTODSA-N 0.000 claims description 7
- AAIUGNSRQDGCDC-ZLUOBGJFSA-N Asp-Cys-Cys Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N)C(=O)O AAIUGNSRQDGCDC-ZLUOBGJFSA-N 0.000 claims description 7
- 101800001288 Atrial natriuretic factor Proteins 0.000 claims description 7
- 102400001282 Atrial natriuretic peptide Human genes 0.000 claims description 7
- 101800001890 Atrial natriuretic peptide Proteins 0.000 claims description 7
- 101800000407 Brain natriuretic peptide 32 Proteins 0.000 claims description 7
- 102400000667 Brain natriuretic peptide 32 Human genes 0.000 claims description 7
- 101800002247 Brain natriuretic peptide 45 Proteins 0.000 claims description 7
- 102000012421 C-Type Natriuretic Peptide Human genes 0.000 claims description 7
- 101800000060 C-type natriuretic peptide Proteins 0.000 claims description 7
- 208000014540 Functional gastrointestinal disease Diseases 0.000 claims description 7
- CFVQPNSCQMKDPB-CIUDSAMLSA-N Lys-Cys-Cys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N CFVQPNSCQMKDPB-CIUDSAMLSA-N 0.000 claims description 7
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 claims description 7
- 108020001621 Natriuretic Peptide Proteins 0.000 claims description 7
- 102000004571 Natriuretic peptide Human genes 0.000 claims description 7
- 102000004270 Peptidyl-Dipeptidase A Human genes 0.000 claims description 7
- 108090000882 Peptidyl-Dipeptidase A Proteins 0.000 claims description 7
- NSQLIUXCMFBZME-MPVJKSABSA-N carperitide Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)=O)[C@@H](C)CC)C1=CC=CC=C1 NSQLIUXCMFBZME-MPVJKSABSA-N 0.000 claims description 7
- 239000002934 diuretic Substances 0.000 claims description 7
- 230000001882 diuretic effect Effects 0.000 claims description 7
- 239000012530 fluid Substances 0.000 claims description 7
- 239000000692 natriuretic peptide Substances 0.000 claims description 7
- HPNRHPKXQZSDFX-OAQDCNSJSA-N nesiritide Chemical compound C([C@H]1C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)CNC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CO)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1N=CNC=1)C(O)=O)=O)[C@@H](C)CC)C1=CC=CC=C1 HPNRHPKXQZSDFX-OAQDCNSJSA-N 0.000 claims description 7
- 229940113178 5 Alpha reductase inhibitor Drugs 0.000 claims description 6
- 239000002677 5-alpha reductase inhibitor Substances 0.000 claims description 6
- ZRGNRZLDMUACOW-HERUPUMHSA-N Ala-Cys-Trp Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)N ZRGNRZLDMUACOW-HERUPUMHSA-N 0.000 claims description 6
- FIADUEYFRSCCIK-CIUDSAMLSA-N Cys-Glu-Arg Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FIADUEYFRSCCIK-CIUDSAMLSA-N 0.000 claims description 6
- MUZAUPFGPMMZSS-GUBZILKMSA-N Cys-Glu-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)N MUZAUPFGPMMZSS-GUBZILKMSA-N 0.000 claims description 6
- UYYZZJXUVIZTMH-AVGNSLFASA-N Cys-Glu-Phe Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O UYYZZJXUVIZTMH-AVGNSLFASA-N 0.000 claims description 6
- GOKFTBDYUJCCSN-QEJZJMRPSA-N Cys-Glu-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)N GOKFTBDYUJCCSN-QEJZJMRPSA-N 0.000 claims description 6
- BUAUGQJXGNRTQE-AAEUAGOBSA-N Cys-Trp-Gly Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CS)N BUAUGQJXGNRTQE-AAEUAGOBSA-N 0.000 claims description 6
- 201000003883 Cystic fibrosis Diseases 0.000 claims description 6
- 230000001800 adrenalinergic effect Effects 0.000 claims description 6
- 239000012634 fragment Substances 0.000 claims description 6
- UNAANXDKBXWMLN-UHFFFAOYSA-N sibutramine Chemical compound C=1C=C(Cl)C=CC=1C1(C(N(C)C)CC(C)C)CCC1 UNAANXDKBXWMLN-UHFFFAOYSA-N 0.000 claims description 6
- 229960004425 sibutramine Drugs 0.000 claims description 6
- 108010038745 tryptophylglycine Proteins 0.000 claims description 6
- QDZOEBFLNHCSSF-PFFBOGFISA-N (2S)-2-[[(2R)-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-1-[(2R)-2-amino-5-carbamimidamidopentanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-N-[(2R)-1-[[(2S)-1-[[(2R)-1-[[(2S)-1-[[(2S)-1-amino-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]pentanediamide Chemical compound C([C@@H](C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](N)CCCNC(N)=N)C1=CC=CC=C1 QDZOEBFLNHCSSF-PFFBOGFISA-N 0.000 claims description 5
- GDPHPXYFLPDZGH-XBTMSFKCSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[2-[[(2r)-2-[[(2s)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]propanoyl]amino]acetyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]-5-(diaminomethylideneamino)pentanoic acid Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)NC(=O)CNC(=O)[C@@H](C)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 GDPHPXYFLPDZGH-XBTMSFKCSA-N 0.000 claims description 5
- PHIQHXFUZVPYII-ZCFIWIBFSA-N (R)-carnitine Chemical compound C[N+](C)(C)C[C@H](O)CC([O-])=O PHIQHXFUZVPYII-ZCFIWIBFSA-N 0.000 claims description 5
- RTHCYVBBDHJXIQ-MRXNPFEDSA-N (R)-fluoxetine Chemical compound O([C@H](CCNC)C=1C=CC=CC=1)C1=CC=C(C(F)(F)F)C=C1 RTHCYVBBDHJXIQ-MRXNPFEDSA-N 0.000 claims description 5
- XHZFHAGIQPYPAM-UHFFFAOYSA-N 3-hydroxy-1-[(4-methoxyphenyl)methyl]piperidin-2-one Chemical compound C1=CC(OC)=CC=C1CN1C(=O)C(O)CCC1 XHZFHAGIQPYPAM-UHFFFAOYSA-N 0.000 claims description 5
- JBYXPOFIGCOSSB-GOJKSUSPSA-N 9-cis,11-trans-octadecadienoic acid Chemical compound CCCCCC\C=C\C=C/CCCCCCCC(O)=O JBYXPOFIGCOSSB-GOJKSUSPSA-N 0.000 claims description 5
- 108700029992 Ala(2)-Arg(6)- enkephalin-Leu Proteins 0.000 claims description 5
- 229920001661 Chitosan Polymers 0.000 claims description 5
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 claims description 5
- 244000303965 Cyamopsis psoralioides Species 0.000 claims description 5
- FMGSKLZLMKYGDP-UHFFFAOYSA-N Dehydroepiandrosterone Natural products C1C(O)CCC2(C)C3CCC(C)(C(CC4)=O)C4C3CC=C21 FMGSKLZLMKYGDP-UHFFFAOYSA-N 0.000 claims description 5
- 241000218671 Ephedra Species 0.000 claims description 5
- 108010011459 Exenatide Proteins 0.000 claims description 5
- 241000227647 Fucus vesiculosus Species 0.000 claims description 5
- 235000000885 Garcinia xanthochymus Nutrition 0.000 claims description 5
- JILRMFFFCHUUTJ-ACZMJKKPSA-N Gln-Ser-Ser Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O JILRMFFFCHUUTJ-ACZMJKKPSA-N 0.000 claims description 5
- IYAUFWMUCGBFMQ-CIUDSAMLSA-N Glu-Arg-Cys Chemical compound C(C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)O)N)CN=C(N)N IYAUFWMUCGBFMQ-CIUDSAMLSA-N 0.000 claims description 5
- OHWJUIXZHVIXJJ-GUBZILKMSA-N Glu-Lys-Cys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)O)N OHWJUIXZHVIXJJ-GUBZILKMSA-N 0.000 claims description 5
- LJZJIPKGTGGVRK-AJNGGQMLSA-N Glu-Phe-Cys-Cys Chemical compound N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(O)=O LJZJIPKGTGGVRK-AJNGGQMLSA-N 0.000 claims description 5
- GWKBAXRZPLSWJS-QEJZJMRPSA-N Glu-Trp-Cys Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)O)N GWKBAXRZPLSWJS-QEJZJMRPSA-N 0.000 claims description 5
- 102400000322 Glucagon-like peptide 1 Human genes 0.000 claims description 5
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 claims description 5
- 101800000224 Glucagon-like peptide 1 Proteins 0.000 claims description 5
- LPHGQDQBBGAPDZ-UHFFFAOYSA-N Isocaffeine Natural products CN1C(=O)N(C)C(=O)C2=C1N(C)C=N2 LPHGQDQBBGAPDZ-UHFFFAOYSA-N 0.000 claims description 5
- ZEXLJFNSKAHNFH-SYKYGTKKSA-N L-Phenylalaninamide, L-tyrosyl-L-prolyl-L-tryptophyl- Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)C1=CC=C(O)C=C1 ZEXLJFNSKAHNFH-SYKYGTKKSA-N 0.000 claims description 5
- 108010000817 Leuprolide Proteins 0.000 claims description 5
- XMBSYZWANAQXEV-UHFFFAOYSA-N N-alpha-L-glutamyl-L-phenylalanine Natural products OC(=O)CCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XMBSYZWANAQXEV-UHFFFAOYSA-N 0.000 claims description 5
- RTHCYVBBDHJXIQ-UHFFFAOYSA-N N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine Chemical compound C=1C=CC=CC=1C(CCNC)OC1=CC=C(C(F)(F)F)C=C1 RTHCYVBBDHJXIQ-UHFFFAOYSA-N 0.000 claims description 5
- 102400001112 Nocistatin Human genes 0.000 claims description 5
- 101800004812 Nocistatin Proteins 0.000 claims description 5
- MFOCDFTXLCYLKU-CMPLNLGQSA-N Phendimetrazine Chemical compound O1CCN(C)[C@@H](C)[C@@H]1C1=CC=CC=C1 MFOCDFTXLCYLKU-CMPLNLGQSA-N 0.000 claims description 5
- 241001127637 Plantago Species 0.000 claims description 5
- 244000134552 Plantago ovata Species 0.000 claims description 5
- 235000003421 Plantago ovata Nutrition 0.000 claims description 5
- 239000009223 Psyllium Substances 0.000 claims description 5
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 claims description 5
- 102400000096 Substance P Human genes 0.000 claims description 5
- 101800003906 Substance P Proteins 0.000 claims description 5
- 241001072888 Teucrium Species 0.000 claims description 5
- 241000519996 Teucrium chamaedrys Species 0.000 claims description 5
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 claims description 5
- 108010050025 alpha-glutamyltryptophan Proteins 0.000 claims description 5
- 229960005274 benzocaine Drugs 0.000 claims description 5
- 229960003228 benzphetamine hydrochloride Drugs 0.000 claims description 5
- 229960001058 bupropion Drugs 0.000 claims description 5
- SNPPWIUOZRMYNY-UHFFFAOYSA-N bupropion Chemical compound CC(C)(C)NC(C)C(=O)C1=CC=CC(Cl)=C1 SNPPWIUOZRMYNY-UHFFFAOYSA-N 0.000 claims description 5
- 229960001948 caffeine Drugs 0.000 claims description 5
- VJEONQKOZGKCAK-UHFFFAOYSA-N caffeine Natural products CN1C(=O)N(C)C(=O)C2=C1C=CN2C VJEONQKOZGKCAK-UHFFFAOYSA-N 0.000 claims description 5
- 201000011510 cancer Diseases 0.000 claims description 5
- JUFFVKRROAPVBI-PVOYSMBESA-N chembl1210015 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@]3(O[C@@H](C[C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C3)C(O)=O)O2)O)[C@@H](CO)O1)NC(C)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 JUFFVKRROAPVBI-PVOYSMBESA-N 0.000 claims description 5
- 229910052804 chromium Inorganic materials 0.000 claims description 5
- 239000011651 chromium Substances 0.000 claims description 5
- 229940108924 conjugated linoleic acid Drugs 0.000 claims description 5
- FMGSKLZLMKYGDP-USOAJAOKSA-N dehydroepiandrosterone Chemical compound C1[C@@H](O)CC[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC=C21 FMGSKLZLMKYGDP-USOAJAOKSA-N 0.000 claims description 5
- 229940120144 didrex Drugs 0.000 claims description 5
- 229960005259 diethylpropion hydrochloride Drugs 0.000 claims description 5
- ICFXZZFWRWNZMA-UHFFFAOYSA-N diethylpropion hydrochloride Chemical compound [Cl-].CC[NH+](CC)C(C)C(=O)C1=CC=CC=C1 ICFXZZFWRWNZMA-UHFFFAOYSA-N 0.000 claims description 5
- 108010015205 endomorphin 1 Proteins 0.000 claims description 5
- 108010015198 endomorphin 2 Proteins 0.000 claims description 5
- XIJHWXXXIMEHKW-LJWNLINESA-N endomorphin-2 Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)C1=CC=C(O)C=C1 XIJHWXXXIMEHKW-LJWNLINESA-N 0.000 claims description 5
- 229960001519 exenatide Drugs 0.000 claims description 5
- 229960002464 fluoxetine Drugs 0.000 claims description 5
- 239000003629 gastrointestinal hormone Substances 0.000 claims description 5
- 108010055341 glutamyl-glutamic acid Proteins 0.000 claims description 5
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 claims description 5
- OYHQOLUKZRVURQ-IXWMQOLASA-N linoleic acid Natural products CCCCC\C=C/C\C=C\CCCCCCCC(O)=O OYHQOLUKZRVURQ-IXWMQOLASA-N 0.000 claims description 5
- 229940087857 lupron Drugs 0.000 claims description 5
- 229960001243 orlistat Drugs 0.000 claims description 5
- 229960000436 phendimetrazine Drugs 0.000 claims description 5
- 229960003562 phentermine Drugs 0.000 claims description 5
- 229960002847 prasterone Drugs 0.000 claims description 5
- 229940035613 prozac Drugs 0.000 claims description 5
- 229940070687 psyllium Drugs 0.000 claims description 5
- 229940034887 tenuate Drugs 0.000 claims description 5
- 229940002552 xenical Drugs 0.000 claims description 5
- ROTFWKNWJRZUIC-MZBYGZHOSA-N 85456-43-5 Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C1=CC=C(O)C=C1 ROTFWKNWJRZUIC-MZBYGZHOSA-N 0.000 claims description 4
- SMYXEYRYCLIPIL-ZLUOBGJFSA-N Cys-Cys-Cys Chemical compound SC[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(O)=O SMYXEYRYCLIPIL-ZLUOBGJFSA-N 0.000 claims description 4
- GNDJOCGXGLNCKY-ACZMJKKPSA-N Gln-Cys-Cys Chemical compound N[C@@H](CCC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(O)=O GNDJOCGXGLNCKY-ACZMJKKPSA-N 0.000 claims description 4
- YLABFXCRQQMMHS-AVGNSLFASA-N Gln-Tyr-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)N)N)O YLABFXCRQQMMHS-AVGNSLFASA-N 0.000 claims description 4
- MXPBQDFWIMBACQ-ACZMJKKPSA-N Glu-Cys-Cys Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(O)=O MXPBQDFWIMBACQ-ACZMJKKPSA-N 0.000 claims description 4
- NMROINAYXCACKF-WHFBIAKZSA-N Gly-Cys-Cys Chemical compound NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(O)=O NMROINAYXCACKF-WHFBIAKZSA-N 0.000 claims description 4
- UVUIXIVPKVMONA-CIUDSAMLSA-N His-Cys-Cys Chemical compound SC[C@@H](C(O)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CC1=CN=CN1 UVUIXIVPKVMONA-CIUDSAMLSA-N 0.000 claims description 4
- KBHYLOIVRVBBEB-JBDRJPRFSA-N Ile-Cys-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N KBHYLOIVRVBBEB-JBDRJPRFSA-N 0.000 claims description 4
- 102000004877 Insulin Human genes 0.000 claims description 4
- 108090001061 Insulin Proteins 0.000 claims description 4
- TWTNGJMBFRTKEX-FXQIFTODSA-N Met-Cys-Cys Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(O)=O TWTNGJMBFRTKEX-FXQIFTODSA-N 0.000 claims description 4
- 208000012902 Nervous system disease Diseases 0.000 claims description 4
- WFLWKEUBTSOFMP-FXQIFTODSA-N Pro-Cys-Cys Chemical compound OC(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1 WFLWKEUBTSOFMP-FXQIFTODSA-N 0.000 claims description 4
- SNNSYBWPPVAXQW-ZLUOBGJFSA-N Ser-Cys-Cys Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N)O SNNSYBWPPVAXQW-ZLUOBGJFSA-N 0.000 claims description 4
- DGOJNGCGEYOBKN-BWBBJGPYSA-N Thr-Cys-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N)O DGOJNGCGEYOBKN-BWBBJGPYSA-N 0.000 claims description 4
- MHCLIYHJRXZBGJ-AAEUAGOBSA-N Trp-Gly-Cys Chemical compound N[C@@H](CC1=CNC2=CC=CC=C12)C(=O)NCC(=O)N[C@@H](CS)C(=O)O MHCLIYHJRXZBGJ-AAEUAGOBSA-N 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 4
- 108010063718 gamma-glutamylaspartic acid Proteins 0.000 claims description 4
- 229940125396 insulin Drugs 0.000 claims description 4
- RCQRKPUXJAGEEC-ZLUOBGJFSA-N Ala-Cys-Cys Chemical compound C[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(O)=O RCQRKPUXJAGEEC-ZLUOBGJFSA-N 0.000 claims description 3
- YUZPQIQWXLRFBW-ACZMJKKPSA-N Cys-Glu-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O YUZPQIQWXLRFBW-ACZMJKKPSA-N 0.000 claims description 3
- VIRYODQIWJNWNU-NRPADANISA-N Cys-Glu-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)N VIRYODQIWJNWNU-NRPADANISA-N 0.000 claims description 3
- 208000010228 Erectile Dysfunction Diseases 0.000 claims description 3
- 208000027601 Inner ear disease Diseases 0.000 claims description 3
- FZXOPYUEQGDGMS-ACZMJKKPSA-N Ser-Ser-Gln Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(O)=O FZXOPYUEQGDGMS-ACZMJKKPSA-N 0.000 claims description 3
- 206010041277 Sodium retention Diseases 0.000 claims description 3
- 238000013270 controlled release Methods 0.000 claims description 3
- 108010049041 glutamylalanine Proteins 0.000 claims description 3
- 108010079547 glutamylmethionine Proteins 0.000 claims description 3
- 201000001881 impotence Diseases 0.000 claims description 3
- 239000002571 phosphodiesterase inhibitor Substances 0.000 claims description 3
- 208000023504 respiratory system disease Diseases 0.000 claims description 3
- SEKBHZJLARBNPB-GHCJXIJMSA-N Asn-Ile-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O SEKBHZJLARBNPB-GHCJXIJMSA-N 0.000 claims description 2
- DJIMLSXHXKWADV-CIUDSAMLSA-N Asn-Leu-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(N)=O DJIMLSXHXKWADV-CIUDSAMLSA-N 0.000 claims description 2
- AMGQTNHANMRPOE-LKXGYXEUSA-N Asn-Thr-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O AMGQTNHANMRPOE-LKXGYXEUSA-N 0.000 claims description 2
- RWGDABDXVXRLLH-ACZMJKKPSA-N Cys-Glu-Asn Chemical compound C(CC(=O)O)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CS)N RWGDABDXVXRLLH-ACZMJKKPSA-N 0.000 claims description 2
- VBPGTULCFGKGTF-ACZMJKKPSA-N Cys-Glu-Asp Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O VBPGTULCFGKGTF-ACZMJKKPSA-N 0.000 claims description 2
- BCSYBBMFGLHCOA-ACZMJKKPSA-N Cys-Glu-Cys Chemical compound SC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CS)C(O)=O BCSYBBMFGLHCOA-ACZMJKKPSA-N 0.000 claims description 2
- DZIGZIIJIGGANI-FXQIFTODSA-N Cys-Glu-Gln Chemical compound SC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O DZIGZIIJIGGANI-FXQIFTODSA-N 0.000 claims description 2
- UDPSLLFHOLGXBY-FXQIFTODSA-N Cys-Glu-Glu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O UDPSLLFHOLGXBY-FXQIFTODSA-N 0.000 claims description 2
- UXUSHQYYQCZWET-WDSKDSINSA-N Cys-Glu-Gly Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O UXUSHQYYQCZWET-WDSKDSINSA-N 0.000 claims description 2
- UUOYKFNULIOCGJ-GUBZILKMSA-N Cys-Glu-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)N UUOYKFNULIOCGJ-GUBZILKMSA-N 0.000 claims description 2
- SDXQKJAWASHMIZ-CIUDSAMLSA-N Cys-Glu-Met Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(O)=O SDXQKJAWASHMIZ-CIUDSAMLSA-N 0.000 claims description 2
- SBORMUFGKSCGEN-XHNCKOQMSA-N Cys-Glu-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)N)C(=O)O SBORMUFGKSCGEN-XHNCKOQMSA-N 0.000 claims description 2
- ZEXHDOQQYZKOIB-ACZMJKKPSA-N Cys-Glu-Ser Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O ZEXHDOQQYZKOIB-ACZMJKKPSA-N 0.000 claims description 2
- BDWIZLQVVWQMTB-XKBZYTNZSA-N Cys-Glu-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)N)O BDWIZLQVVWQMTB-XKBZYTNZSA-N 0.000 claims description 2
- 229940099471 Phosphodiesterase inhibitor Drugs 0.000 claims description 2
- 241000593508 Garcinia Species 0.000 claims 4
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 claims 2
- 108010078321 Guanylate Cyclase Proteins 0.000 claims 2
- 102000014469 Guanylate cyclase Human genes 0.000 claims 2
- 238000012258 culturing Methods 0.000 claims 1
- 239000002702 enteric coating Substances 0.000 claims 1
- 238000009505 enteric coating Methods 0.000 claims 1
- 239000011159 matrix material Substances 0.000 claims 1
- 230000002194 synthesizing effect Effects 0.000 claims 1
- 102100034605 Atrial natriuretic peptide receptor 3 Human genes 0.000 abstract description 19
- 101000924488 Homo sapiens Atrial natriuretic peptide receptor 3 Proteins 0.000 abstract description 19
- 230000036407 pain Effects 0.000 abstract description 14
- 208000002193 Pain Diseases 0.000 abstract description 13
- 230000002981 neuropathic effect Effects 0.000 abstract description 4
- 206010017943 Gastrointestinal conditions Diseases 0.000 abstract description 2
- 229940127240 opiate Drugs 0.000 abstract description 2
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical compound O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 description 370
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 86
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 76
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 76
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 74
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 70
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 67
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 65
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 60
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 55
- 235000001014 amino acid Nutrition 0.000 description 55
- 229940024606 amino acid Drugs 0.000 description 51
- 239000003795 chemical substances by application Substances 0.000 description 51
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 50
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 46
- 238000003776 cleavage reaction Methods 0.000 description 42
- 230000007017 scission Effects 0.000 description 42
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 40
- -1 antispasmodics Substances 0.000 description 34
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 description 31
- 108010077245 asparaginyl-proline Proteins 0.000 description 31
- 125000000998 L-alanino group Chemical group [H]N([*])[C@](C([H])([H])[H])([H])C(=O)O[H] 0.000 description 30
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 28
- 108090000317 Chymotrypsin Proteins 0.000 description 27
- 229960002376 chymotrypsin Drugs 0.000 description 27
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 24
- 150000001875 compounds Chemical class 0.000 description 24
- 239000000556 agonist Substances 0.000 description 23
- IWVNIQXKTIQXCT-SRVKXCTJSA-N Cys-Tyr-Asn Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CS)N)O IWVNIQXKTIQXCT-SRVKXCTJSA-N 0.000 description 22
- 108090000623 proteins and genes Proteins 0.000 description 22
- 238000003556 assay Methods 0.000 description 21
- 210000001035 gastrointestinal tract Anatomy 0.000 description 21
- 102000004169 proteins and genes Human genes 0.000 description 20
- 235000018102 proteins Nutrition 0.000 description 19
- 241000588724 Escherichia coli Species 0.000 description 18
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 17
- 229940044551 receptor antagonist Drugs 0.000 description 17
- 239000002464 receptor antagonist Substances 0.000 description 17
- 241000699670 Mus sp. Species 0.000 description 15
- 108090000631 Trypsin Proteins 0.000 description 15
- 102000004142 Trypsin Human genes 0.000 description 15
- 239000012588 trypsin Substances 0.000 description 15
- 230000000968 intestinal effect Effects 0.000 description 14
- 229960002876 tegaserod Drugs 0.000 description 14
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 13
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 13
- 238000002648 combination therapy Methods 0.000 description 13
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 12
- CPDDZSSEAVLMRY-FEQFWAPWSA-N tegaserod maleate Chemical compound [H+].[H+].[O-]C(=O)\C=C/C([O-])=O.C1=C(OC)C=C2C(/C=N/NC(=N)NCCCCC)=CNC2=C1 CPDDZSSEAVLMRY-FEQFWAPWSA-N 0.000 description 12
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 11
- DECCMEWNXSNSDO-ZLUOBGJFSA-N Ala-Cys-Ala Chemical compound C[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(O)=O DECCMEWNXSNSDO-ZLUOBGJFSA-N 0.000 description 11
- 241000607447 Yersinia enterocolitica Species 0.000 description 11
- 108010047495 alanylglycine Proteins 0.000 description 11
- 230000001580 bacterial effect Effects 0.000 description 11
- 230000002496 gastric effect Effects 0.000 description 11
- ZOOGRGPOEVQQDX-UUOKFMHZSA-N 3',5'-cyclic GMP Chemical compound C([C@H]1O2)OP(O)(=O)O[C@H]1[C@@H](O)[C@@H]2N1C(N=C(NC2=O)N)=C2N=C1 ZOOGRGPOEVQQDX-UUOKFMHZSA-N 0.000 description 10
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 10
- 108091034117 Oligonucleotide Proteins 0.000 description 10
- 230000000202 analgesic effect Effects 0.000 description 10
- ZOOGRGPOEVQQDX-UHFFFAOYSA-N cyclic GMP Natural products O1C2COP(O)(=O)OC2C(O)C1N1C=NC2=C1NC(N)=NC2=O ZOOGRGPOEVQQDX-UHFFFAOYSA-N 0.000 description 10
- 210000002011 intestinal secretion Anatomy 0.000 description 10
- 210000000936 intestine Anatomy 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 9
- QNQZBKQEIFTHFZ-UHFFFAOYSA-N Loxizin Chemical compound CCCCCN(CCCOC)C(=O)C(CCC(O)=O)NC(=O)C1=CC=C(Cl)C(Cl)=C1 QNQZBKQEIFTHFZ-UHFFFAOYSA-N 0.000 description 9
- 239000002253 acid Substances 0.000 description 9
- FSXRLASFHBWESK-UHFFFAOYSA-N dipeptide phenylalanyl-tyrosine Natural products C=1C=C(O)C=CC=1CC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FSXRLASFHBWESK-UHFFFAOYSA-N 0.000 description 9
- 239000003814 drug Substances 0.000 description 9
- 238000009472 formulation Methods 0.000 description 9
- 229950009386 loxiglumide Drugs 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- 239000013598 vector Substances 0.000 description 9
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 9
- 229940098232 yersinia enterocolitica Drugs 0.000 description 9
- PIABYSIYPGLLDQ-XVSYOHENSA-N Asn-Thr-Phe Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O PIABYSIYPGLLDQ-XVSYOHENSA-N 0.000 description 8
- 102100021277 Beta-secretase 2 Human genes 0.000 description 8
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 8
- 108010040718 Neurokinin-1 Receptors Proteins 0.000 description 8
- ICHZYBVODUVUKN-SRVKXCTJSA-N Ser-Asn-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ICHZYBVODUVUKN-SRVKXCTJSA-N 0.000 description 8
- 101800002751 Sialorphin Proteins 0.000 description 8
- 230000007423 decrease Effects 0.000 description 8
- BQJCRHHNABKAKU-KBQPJGBKSA-N morphine Chemical compound O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O BQJCRHHNABKAKU-KBQPJGBKSA-N 0.000 description 8
- 101710150190 Beta-secretase 2 Proteins 0.000 description 7
- 102100037346 Substance-P receptor Human genes 0.000 description 7
- JXNRXNCCROJZFB-RYUDHWBXSA-N Tyr-Arg Chemical compound NC(=N)NCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 JXNRXNCCROJZFB-RYUDHWBXSA-N 0.000 description 7
- 108010053037 kyotorphin Proteins 0.000 description 7
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 7
- 239000003775 serotonin noradrenalin reuptake inhibitor Substances 0.000 description 7
- 210000000813 small intestine Anatomy 0.000 description 7
- 210000002784 stomach Anatomy 0.000 description 7
- 238000012360 testing method Methods 0.000 description 7
- RLQZIECDMISZHS-UHFFFAOYSA-N 2-phenylcyclohexa-2,5-diene-1,4-dione Chemical compound O=C1C=CC(=O)C(C=2C=CC=CC=2)=C1 RLQZIECDMISZHS-UHFFFAOYSA-N 0.000 description 6
- WZUZGDANRQPCDD-SRVKXCTJSA-N Asp-Phe-Cys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC(=O)O)N WZUZGDANRQPCDD-SRVKXCTJSA-N 0.000 description 6
- 102000004859 Cholecystokinin Receptors Human genes 0.000 description 6
- 108090001085 Cholecystokinin Receptors Proteins 0.000 description 6
- 206010009944 Colon cancer Diseases 0.000 description 6
- AEJSNWMRPXAKCW-WHFBIAKZSA-N Cys-Ala-Gly Chemical compound SC[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O AEJSNWMRPXAKCW-WHFBIAKZSA-N 0.000 description 6
- QMMFVYPAHWMCMS-UHFFFAOYSA-N Dimethyl sulfide Chemical compound CSC QMMFVYPAHWMCMS-UHFFFAOYSA-N 0.000 description 6
- HAQLBBVZAGMESV-IHRRRGAJSA-N Met-Lys-Lys Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O HAQLBBVZAGMESV-IHRRRGAJSA-N 0.000 description 6
- 241001529936 Murinae Species 0.000 description 6
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- XZFYRXDAULDNFX-UHFFFAOYSA-N N-L-cysteinyl-L-phenylalanine Natural products SCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XZFYRXDAULDNFX-UHFFFAOYSA-N 0.000 description 6
- CDNPIRSCAFMMBE-SRVKXCTJSA-N Phe-Asn-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O CDNPIRSCAFMMBE-SRVKXCTJSA-N 0.000 description 6
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 6
- DWJQKEZKLQCHKO-SRVKXCTJSA-N Tyr-Asn-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CS)C(=O)O)N)O DWJQKEZKLQCHKO-SRVKXCTJSA-N 0.000 description 6
- 238000010171 animal model Methods 0.000 description 6
- 239000003610 charcoal Substances 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 230000008991 intestinal motility Effects 0.000 description 6
- RDOIQAHITMMDAJ-UHFFFAOYSA-N loperamide Chemical compound C=1C=CC=CC=1C(C=1C=CC=CC=1)(C(=O)N(C)C)CCN(CC1)CCC1(O)C1=CC=C(Cl)C=C1 RDOIQAHITMMDAJ-UHFFFAOYSA-N 0.000 description 6
- 229960001571 loperamide Drugs 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 239000003981 vehicle Substances 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 5
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 5
- DSTWKJOBKSMVCV-UWVGGRQHSA-N Cys-Tyr Chemical compound SC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 DSTWKJOBKSMVCV-UWVGGRQHSA-N 0.000 description 5
- XLDYDEDTGMHUCZ-GHCJXIJMSA-N Ile-Asp-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N XLDYDEDTGMHUCZ-GHCJXIJMSA-N 0.000 description 5
- IWMJFLJQHIDZQW-KKUMJFAQSA-N Leu-Ser-Phe Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 IWMJFLJQHIDZQW-KKUMJFAQSA-N 0.000 description 5
- IMAKMJCBYCSMHM-AVGNSLFASA-N Lys-Glu-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN IMAKMJCBYCSMHM-AVGNSLFASA-N 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 102000003729 Neprilysin Human genes 0.000 description 5
- 108090000028 Neprilysin Proteins 0.000 description 5
- VTVVYQOXJCZVEB-WDCWCFNPSA-N Thr-Leu-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O VTVVYQOXJCZVEB-WDCWCFNPSA-N 0.000 description 5
- 230000003187 abdominal effect Effects 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- DZOJBGLFWINFBF-UMSFTDKQSA-N osanetant Chemical compound C([C@](C1)(CCCN2CCC(CC2)(N(C(C)=O)C)C=2C=CC=CC=2)C=2C=C(Cl)C(Cl)=CC=2)CCN1C(=O)C1=CC=CC=C1 DZOJBGLFWINFBF-UMSFTDKQSA-N 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 230000002265 prevention Effects 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 230000028327 secretion Effects 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 238000013268 sustained release Methods 0.000 description 5
- 239000012730 sustained-release form Substances 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- 108091005478 5-HT1 receptors Proteins 0.000 description 4
- 102000035038 5-HT1 receptors Human genes 0.000 description 4
- BKOIIURTQAJHAT-GUBZILKMSA-N Asp-Pro-Pro Chemical compound OC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 BKOIIURTQAJHAT-GUBZILKMSA-N 0.000 description 4
- 108091006146 Channels Proteins 0.000 description 4
- DCXGXDGGXVZVMY-GHCJXIJMSA-N Cys-Asn-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CS DCXGXDGGXVZVMY-GHCJXIJMSA-N 0.000 description 4
- JXNRXNCCROJZFB-UHFFFAOYSA-N Di-Me ester-(2R, 3E)-Phytochromobilin Natural products NC(N)=NCCCC(C(O)=O)NC(=O)C(N)CC1=CC=C(O)C=C1 JXNRXNCCROJZFB-UHFFFAOYSA-N 0.000 description 4
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 4
- DTCCMDYODDPHBG-ACZMJKKPSA-N Gln-Ala-Cys Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(O)=O DTCCMDYODDPHBG-ACZMJKKPSA-N 0.000 description 4
- CYTSBCIIEHUPDU-ACZMJKKPSA-N Gln-Asp-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O CYTSBCIIEHUPDU-ACZMJKKPSA-N 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- 101001125071 Homo sapiens Neuromedin-K receptor Proteins 0.000 description 4
- 208000004454 Hyperalgesia Diseases 0.000 description 4
- XLXPYSDGMXTTNQ-UHFFFAOYSA-N Ile-Phe-Leu Natural products CCC(C)C(N)C(=O)NC(C(=O)NC(CC(C)C)C(O)=O)CC1=CC=CC=C1 XLXPYSDGMXTTNQ-UHFFFAOYSA-N 0.000 description 4
- KFKWRHQBZQICHA-STQMWFEESA-N L-leucyl-L-phenylalanine Natural products CC(C)C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 KFKWRHQBZQICHA-STQMWFEESA-N 0.000 description 4
- SVBJIZVVYJYGLA-DCAQKATOSA-N Leu-Ser-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O SVBJIZVVYJYGLA-DCAQKATOSA-N 0.000 description 4
- 102100029409 Neuromedin-K receptor Human genes 0.000 description 4
- 101100342977 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) leu-1 gene Proteins 0.000 description 4
- MMYUOSCXBJFUNV-QWRGUYRKSA-N Phe-Gly-Cys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)NCC(=O)N[C@@H](CS)C(=O)O)N MMYUOSCXBJFUNV-QWRGUYRKSA-N 0.000 description 4
- BWTKUQPNOMMKMA-FIRPJDEBSA-N Phe-Ile-Phe Chemical compound C([C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 BWTKUQPNOMMKMA-FIRPJDEBSA-N 0.000 description 4
- ZUZINZIJHJFJRN-UBHSHLNASA-N Pro-Phe-Ala Chemical compound C([C@@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1NCCC1)C1=CC=CC=C1 ZUZINZIJHJFJRN-UBHSHLNASA-N 0.000 description 4
- RIAKPZVSNBBNRE-BJDJZHNGSA-N Ser-Ile-Leu Chemical compound OC[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(O)=O RIAKPZVSNBBNRE-BJDJZHNGSA-N 0.000 description 4
- CRJZZXMAADSBBQ-SRVKXCTJSA-N Ser-Lys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CO CRJZZXMAADSBBQ-SRVKXCTJSA-N 0.000 description 4
- 101150006914 TRP1 gene Proteins 0.000 description 4
- 239000007983 Tris buffer Substances 0.000 description 4
- LVTKHGUGBGNBPL-UHFFFAOYSA-N Trp-P-1 Chemical compound N1C2=CC=CC=C2C2=C1C(C)=C(N)N=C2C LVTKHGUGBGNBPL-UHFFFAOYSA-N 0.000 description 4
- COYSIHFOCOMGCF-WPRPVWTQSA-N Val-Arg-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CCCN=C(N)N COYSIHFOCOMGCF-WPRPVWTQSA-N 0.000 description 4
- COYSIHFOCOMGCF-UHFFFAOYSA-N Val-Arg-Gly Natural products CC(C)C(N)C(=O)NC(C(=O)NCC(O)=O)CCCN=C(N)N COYSIHFOCOMGCF-UHFFFAOYSA-N 0.000 description 4
- 241000607253 Vibrio mimicus Species 0.000 description 4
- 238000010521 absorption reaction Methods 0.000 description 4
- 229960000583 acetic acid Drugs 0.000 description 4
- 230000001154 acute effect Effects 0.000 description 4
- 108010044940 alanylglutamine Proteins 0.000 description 4
- RDOXTESZEPMUJZ-UHFFFAOYSA-N anisole Chemical compound COC1=CC=CC=C1 RDOXTESZEPMUJZ-UHFFFAOYSA-N 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 239000011575 calcium Substances 0.000 description 4
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 4
- 230000000112 colonic effect Effects 0.000 description 4
- 231100000673 dose–response relationship Toxicity 0.000 description 4
- 239000003792 electrolyte Substances 0.000 description 4
- 229940035423 ethyl ether Drugs 0.000 description 4
- MVKIWCDXKCUDEH-QFIPXVFZSA-N fedotozine Chemical compound C([C@](CC)(N(C)C)C=1C=CC=CC=1)OCC1=CC(OC)=C(OC)C(OC)=C1 MVKIWCDXKCUDEH-QFIPXVFZSA-N 0.000 description 4
- 229950008449 fedotozine Drugs 0.000 description 4
- 230000005176 gastrointestinal motility Effects 0.000 description 4
- 239000008103 glucose Substances 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- CGIGDMFJXJATDK-UHFFFAOYSA-N indomethacin Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 CGIGDMFJXJATDK-UHFFFAOYSA-N 0.000 description 4
- 230000002757 inflammatory effect Effects 0.000 description 4
- 108010044056 leucyl-phenylalanine Proteins 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 4
- 229960005181 morphine Drugs 0.000 description 4
- 238000002414 normal-phase solid-phase extraction Methods 0.000 description 4
- 230000036961 partial effect Effects 0.000 description 4
- 108010091617 pentalysine Proteins 0.000 description 4
- 108010051242 phenylalanylserine Proteins 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 108010093296 prolyl-prolyl-alanine Proteins 0.000 description 4
- 150000003384 small molecules Chemical class 0.000 description 4
- 239000002904 solvent Substances 0.000 description 4
- 238000001356 surgical procedure Methods 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 208000011580 syndromic disease Diseases 0.000 description 4
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 4
- GJJFMKBJSRMPLA-HIFRSBDPSA-N (1R,2S)-2-(aminomethyl)-N,N-diethyl-1-phenyl-1-cyclopropanecarboxamide Chemical compound C=1C=CC=CC=1[C@@]1(C(=O)N(CC)CC)C[C@@H]1CN GJJFMKBJSRMPLA-HIFRSBDPSA-N 0.000 description 3
- GTPHQORJKFJIRB-JTQLPTLWSA-N (2s)-2-amino-n-[(2r)-1-[[(2s)-1-[[(2s)-1-amino-1-oxo-3-phenylpropan-2-yl]amino]-3-(4-fluorophenyl)-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]-3-(4-hydroxyphenyl)propanamide Chemical compound C([C@H](N)C(=O)N[C@H](C)C(=O)N[C@@H](CC=1C=CC(F)=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)C1=CC=C(O)C=C1 GTPHQORJKFJIRB-JTQLPTLWSA-N 0.000 description 3
- LIFNDDBLJFPEAN-BPSSIEEOSA-N (2s)-4-amino-2-[[(2s)-2-[[2-[[2-[[(2s)-5-amino-2-[[(2s)-2-[[(2s)-6-amino-2-[[(2s)-2-[[(2s)-5-oxopyrrolidine-2-carbonyl]amino]propanoyl]amino]hexanoyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoyl]amino Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)CNC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@@H]1CCC(=O)N1 LIFNDDBLJFPEAN-BPSSIEEOSA-N 0.000 description 3
- XPNMCDYOYIKVGB-CONSDPRKSA-N (2s,3s)-2-benzhydryl-n-[(2-methoxy-5-propan-2-ylphenyl)methyl]-1-azabicyclo[2.2.2]octan-3-amine Chemical compound COC1=CC=C(C(C)C)C=C1CN[C@@H]1[C@H](C(C=2C=CC=CC=2)C=2C=CC=CC=2)N2CCC1CC2 XPNMCDYOYIKVGB-CONSDPRKSA-N 0.000 description 3
- LORDFXWUHHSAQU-UHFFFAOYSA-N 3,4,5-trimethoxybenzoic acid [2-(dimethylamino)-2-phenylbutyl] ester Chemical compound C=1C=CC=CC=1C(CC)(N(C)C)COC(=O)C1=CC(OC)=C(OC)C(OC)=C1 LORDFXWUHHSAQU-UHFFFAOYSA-N 0.000 description 3
- BIAVGWDGIJKWRM-FQEVSTJZSA-N 3-hydroxy-2-phenyl-n-[(1s)-1-phenylpropyl]quinoline-4-carboxamide Chemical compound N([C@@H](CC)C=1C=CC=CC=1)C(=O)C(C1=CC=CC=C1N=1)=C(O)C=1C1=CC=CC=C1 BIAVGWDGIJKWRM-FQEVSTJZSA-N 0.000 description 3
- 229940127239 5 Hydroxytryptamine receptor antagonist Drugs 0.000 description 3
- 108091005477 5-HT3 receptors Proteins 0.000 description 3
- 108091005482 5-HT4 receptors Proteins 0.000 description 3
- 108091032151 5-hydroxytryptamine receptor family Proteins 0.000 description 3
- 102000040125 5-hydroxytryptamine receptor family Human genes 0.000 description 3
- 206010000060 Abdominal distension Diseases 0.000 description 3
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 206010001233 Adenoma benign Diseases 0.000 description 3
- OMMDTNGURYRDAC-NRPADANISA-N Ala-Glu-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O OMMDTNGURYRDAC-NRPADANISA-N 0.000 description 3
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 3
- QXOPPIDJKPEKCW-GUBZILKMSA-N Asn-Pro-Arg Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CC(=O)N)N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O QXOPPIDJKPEKCW-GUBZILKMSA-N 0.000 description 3
- DKQCWCQRAMAFLN-UBHSHLNASA-N Asp-Trp-Asp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(O)=O)C(O)=O DKQCWCQRAMAFLN-UBHSHLNASA-N 0.000 description 3
- OQMGSMNZVHYDTQ-ZKWXMUAHSA-N Asp-Val-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC(=O)O)N OQMGSMNZVHYDTQ-ZKWXMUAHSA-N 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 201000009030 Carcinoma Diseases 0.000 description 3
- 108010010737 Ceruletide Proteins 0.000 description 3
- 108010003422 Circulating Thymic Factor Proteins 0.000 description 3
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 3
- 206010010539 Congenital megacolon Diseases 0.000 description 3
- OABOXRPGTFRBFZ-IMJSIDKUSA-N Cys-Cys Chemical compound SC[C@H](N)C(=O)N[C@@H](CS)C(O)=O OABOXRPGTFRBFZ-IMJSIDKUSA-N 0.000 description 3
- 108010016626 Dipeptides Proteins 0.000 description 3
- 238000011891 EIA kit Methods 0.000 description 3
- 208000017701 Endocrine disease Diseases 0.000 description 3
- 108010092674 Enkephalins Proteins 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- 206010017999 Gastrointestinal pain Diseases 0.000 description 3
- DRDSQGHKTLSNEA-GLLZPBPUSA-N Gln-Glu-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O DRDSQGHKTLSNEA-GLLZPBPUSA-N 0.000 description 3
- DQPOBSRQNWOBNA-GUBZILKMSA-N Gln-His-Asn Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(O)=O DQPOBSRQNWOBNA-GUBZILKMSA-N 0.000 description 3
- JJGBXTYGTKWGAT-YUMQZZPRSA-N Gly-Pro-Glu Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O JJGBXTYGTKWGAT-YUMQZZPRSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 208000004592 Hirschsprung disease Diseases 0.000 description 3
- 208000035154 Hyperesthesia Diseases 0.000 description 3
- 125000000393 L-methionino group Chemical group [H]OC(=O)[C@@]([H])(N([H])[*])C([H])([H])C(SC([H])([H])[H])([H])[H] 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- URLZCHNOLZSCCA-VABKMULXSA-N Leu-enkephalin Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 URLZCHNOLZSCCA-VABKMULXSA-N 0.000 description 3
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 3
- QVLMCRFQGHWOPM-ZKWNWVNESA-N N-arachidonoyl vanillylamine Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)NCC1=CC=C(O)C(OC)=C1 QVLMCRFQGHWOPM-ZKWNWVNESA-N 0.000 description 3
- WJBLNOPPDWQMCH-MBPVOVBZSA-N Nalmefene Chemical compound N1([C@@H]2CC3=CC=C(C=4O[C@@H]5[C@](C3=4)([C@]2(CCC5=C)O)CC1)O)CC1CC1 WJBLNOPPDWQMCH-MBPVOVBZSA-N 0.000 description 3
- 208000009905 Neurofibromatoses Diseases 0.000 description 3
- APSUXPSYBJVPPS-YAUKWVCOSA-N Norbinaltorphimine Chemical compound N1([C@@H]2CC3=CC=C(C=4O[C@@H]5[C@](C3=4)([C@]2(CC=2C=3C[C@]4(O)[C@]67CCN(CC8CC8)[C@@H]4CC=4C7=C(C(=CC=4)O)O[C@H]6C=3NC=25)O)CC1)O)CC1CC1 APSUXPSYBJVPPS-YAUKWVCOSA-N 0.000 description 3
- 102000003840 Opioid Receptors Human genes 0.000 description 3
- 108090000137 Opioid Receptors Proteins 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- AEEQKUDWJGOFQI-SRVKXCTJSA-N Phe-Cys-Cys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O)N AEEQKUDWJGOFQI-SRVKXCTJSA-N 0.000 description 3
- 208000037062 Polyps Diseases 0.000 description 3
- 206010054048 Postoperative ileus Diseases 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 239000004365 Protease Substances 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- VGNYHOBZJKWRGI-CIUDSAMLSA-N Ser-Asn-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CO VGNYHOBZJKWRGI-CIUDSAMLSA-N 0.000 description 3
- NJSPTZXVPZDRCU-UBHSHLNASA-N Ser-Asp-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)N NJSPTZXVPZDRCU-UBHSHLNASA-N 0.000 description 3
- PPCZVWHJWJFTFN-ZLUOBGJFSA-N Ser-Ser-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O PPCZVWHJWJFTFN-ZLUOBGJFSA-N 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 3
- 241000607626 Vibrio cholerae Species 0.000 description 3
- 208000009956 adenocarcinoma Diseases 0.000 description 3
- 229940035676 analgesics Drugs 0.000 description 3
- 239000005557 antagonist Substances 0.000 description 3
- 230000002921 anti-spasmodic effect Effects 0.000 description 3
- 239000000935 antidepressant agent Substances 0.000 description 3
- 229940005513 antidepressants Drugs 0.000 description 3
- 229940124575 antispasmodic agent Drugs 0.000 description 3
- 108010091092 arginyl-glycyl-proline Proteins 0.000 description 3
- PQKHESYTSKMWFP-WZJCLRDWSA-N beta-Funaltrexamine Chemical compound C([C@]12[C@H]3OC=4C(O)=CC=C(C2=4)C[C@@H]2[C@]1(O)CC[C@H]3NC(=O)/C=C/C(=O)OC)CN2CC1CC1 PQKHESYTSKMWFP-WZJCLRDWSA-N 0.000 description 3
- 229930190815 caerulein Natural products 0.000 description 3
- 229910052799 carbon Inorganic materials 0.000 description 3
- YRALAIOMGQZKOW-HYAOXDFASA-N ceruletide Chemical compound C([C@@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)[C@@H](C)O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(OS(O)(=O)=O)C=C1 YRALAIOMGQZKOW-HYAOXDFASA-N 0.000 description 3
- 229960001706 ceruletide Drugs 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 210000001072 colon Anatomy 0.000 description 3
- 108050003126 conotoxin Proteins 0.000 description 3
- 230000008602 contraction Effects 0.000 description 3
- 238000011262 co‐therapy Methods 0.000 description 3
- 239000003255 cyclooxygenase 2 inhibitor Substances 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- QNQZBKQEIFTHFZ-GOSISDBHSA-N dexloxiglumide Chemical compound CCCCCN(CCCOC)C(=O)[C@@H](CCC(O)=O)NC(=O)C1=CC=C(Cl)C(Cl)=C1 QNQZBKQEIFTHFZ-GOSISDBHSA-N 0.000 description 3
- 229950010525 dexloxiglumide Drugs 0.000 description 3
- 206010012601 diabetes mellitus Diseases 0.000 description 3
- 210000002919 epithelial cell Anatomy 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 229950000331 ezlopitant Drugs 0.000 description 3
- PJMPHNIQZUBGLI-UHFFFAOYSA-N fentanyl Chemical compound C=1C=CC=CC=1N(C(=O)CC)C(CC1)CCN1CCC1=CC=CC=C1 PJMPHNIQZUBGLI-UHFFFAOYSA-N 0.000 description 3
- 229960002428 fentanyl Drugs 0.000 description 3
- 108010028490 frakefamide Proteins 0.000 description 3
- 229950001535 frakefamide Drugs 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 108010079413 glycyl-prolyl-glutamic acid Proteins 0.000 description 3
- 108010010147 glycylglutamine Proteins 0.000 description 3
- 239000007943 implant Substances 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 201000010260 leiomyoma Diseases 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000006510 metastatic growth Effects 0.000 description 3
- 229960000600 milnacipran Drugs 0.000 description 3
- 229960005297 nalmefene Drugs 0.000 description 3
- AJPSBXJNFJCCBI-YOHUGVJRSA-N naloxonazine Chemical compound C([C@@H](N(CC1)CC=C)[C@]2(O)CC\C3=N/N=C4/[C@H]5[C@]67CCN(CC=C)[C@@H]([C@@]7(CC4)O)CC4=CC=C(C(O5)=C46)O)C4=CC=C(O)C5=C4[C@@]21[C@H]3O5 AJPSBXJNFJCCBI-YOHUGVJRSA-N 0.000 description 3
- 229960004127 naloxone Drugs 0.000 description 3
- UZHSEJADLWPNLE-GRGSLBFTSA-N naloxone Chemical compound O=C([C@@H]1O2)CC[C@@]3(O)[C@H]4CC5=CC=C(O)C2=C5[C@@]13CCN4CC=C UZHSEJADLWPNLE-GRGSLBFTSA-N 0.000 description 3
- 229960003086 naltrexone Drugs 0.000 description 3
- DQCKKXVULJGBQN-XFWGSAIBSA-N naltrexone Chemical compound N1([C@@H]2CC3=CC=C(C=4O[C@@H]5[C@](C3=4)([C@]2(CCC5=O)O)CC1)O)CC1CC1 DQCKKXVULJGBQN-XFWGSAIBSA-N 0.000 description 3
- DKJCUVXSBOMWAV-PCWWUVHHSA-N naltrindole Chemical compound N1([C@H]2CC3=CC=C(C=4O[C@@H]5[C@](C3=4)([C@]2(CC2=C3[CH]C=CC=C3N=C25)O)CC1)O)CC1CC1 DKJCUVXSBOMWAV-PCWWUVHHSA-N 0.000 description 3
- 201000004931 neurofibromatosis Diseases 0.000 description 3
- 229950009875 osanetant Drugs 0.000 description 3
- 210000000496 pancreas Anatomy 0.000 description 3
- 239000004031 partial agonist Substances 0.000 description 3
- 239000012071 phase Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 238000002390 rotary evaporation Methods 0.000 description 3
- 230000035945 sensitivity Effects 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- YRALAIOMGQZKOW-UHFFFAOYSA-N sulfated caerulein Natural products C=1C=CC=CC=1CC(C(N)=O)NC(=O)C(CC(O)=O)NC(=O)C(CCSC)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)CNC(=O)C(C(C)O)NC(=O)C(NC(=O)C(CC(O)=O)NC(=O)C(CCC(N)=O)NC(=O)C1NC(=O)CC1)CC1=CC=C(OS(O)(=O)=O)C=C1 YRALAIOMGQZKOW-UHFFFAOYSA-N 0.000 description 3
- 229950011332 talnetant Drugs 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- 230000014616 translation Effects 0.000 description 3
- 230000032258 transport Effects 0.000 description 3
- 229960005345 trimebutine Drugs 0.000 description 3
- 229960004441 tyrosine Drugs 0.000 description 3
- 229940118696 vibrio cholerae Drugs 0.000 description 3
- BPKIMPVREBSLAJ-QTBYCLKRSA-N ziconotide Chemical compound C([C@H]1C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]2C(=O)N[C@@H]3C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CSSC2)C(N)=O)=O)CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CSSC3)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(N1)=O)CCSC)[C@@H](C)O)C1=CC=C(O)C=C1 BPKIMPVREBSLAJ-QTBYCLKRSA-N 0.000 description 3
- 229960002811 ziconotide Drugs 0.000 description 3
- XLEKQZHPKBRJNB-BKLSDQPFSA-N (2r)-3-sulfanylpyrrolidine-2-carboxylic acid Chemical compound OC(=O)[C@H]1NCCC1S XLEKQZHPKBRJNB-BKLSDQPFSA-N 0.000 description 2
- SULKGYKWHKPPKO-RAJPIYRYSA-N (4s)-4-[[(2r)-2-[[(2s,3r)-2-[[(2s)-4-amino-4-oxo-2-[[(2s)-pyrrolidine-2-carbonyl]amino]butanoyl]amino]-3-hydroxybutanoyl]amino]-3-sulfanylpropanoyl]amino]-5-[[(2s,3s)-1-[[(2r)-1-[[(2s)-1-[[(2s)-1-[[(2s)-1-[[(2s)-1-[[(2r)-1-[[(2s,3r)-1-[[2-[[(1r)-1-carboxy Chemical compound N([C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CS)C(O)=O)[C@@H](C)O)C(=O)[C@@H]1CCCN1 SULKGYKWHKPPKO-RAJPIYRYSA-N 0.000 description 2
- MYTWXYLBLUEQKJ-RAALKQJNSA-N (4s)-5-[[(2s,3s)-1-[[(2r)-1-[[(2r)-1-[[(2s)-4-amino-1-[(2s)-2-[[(2s)-1-[[(2r)-1-[[(2s)-1-[[2-[[(2r)-1-[[(2s)-1-[[(1s)-3-amino-1-carboxy-3-oxopropyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-sulfanylpropan-2-yl]amino]-2-oxoethyl]amino]-1-oxo-3-phenyl Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O)CC1=CC=CC=C1 MYTWXYLBLUEQKJ-RAALKQJNSA-N 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- APIXJSLKIYYUKG-UHFFFAOYSA-N 3 Isobutyl 1 methylxanthine Chemical compound O=C1N(C)C(=O)N(CC(C)C)C2=C1N=CN2 APIXJSLKIYYUKG-UHFFFAOYSA-N 0.000 description 2
- PECYZEOJVXMISF-UHFFFAOYSA-N 3-aminoalanine Chemical compound [NH3+]CC(N)C([O-])=O PECYZEOJVXMISF-UHFFFAOYSA-N 0.000 description 2
- WLHCBQAPPJAULW-UHFFFAOYSA-N 4-methylbenzenethiol Chemical compound CC1=CC=C(S)C=C1 WLHCBQAPPJAULW-UHFFFAOYSA-N 0.000 description 2
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 2
- 208000004998 Abdominal Pain Diseases 0.000 description 2
- 208000003200 Adenoma Diseases 0.000 description 2
- IYCZBJXFSZSHPN-DLOVCJGASA-N Ala-Cys-Phe Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O IYCZBJXFSZSHPN-DLOVCJGASA-N 0.000 description 2
- LJFNNUBZSZCZFN-WHFBIAKZSA-N Ala-Gly-Cys Chemical compound N[C@@H](C)C(=O)NCC(=O)N[C@@H](CS)C(=O)O LJFNNUBZSZCZFN-WHFBIAKZSA-N 0.000 description 2
- VCSABYLVNWQYQE-SRVKXCTJSA-N Ala-Lys-Lys Chemical compound NCCCC[C@H](NC(=O)[C@@H](N)C)C(=O)N[C@@H](CCCCN)C(O)=O VCSABYLVNWQYQE-SRVKXCTJSA-N 0.000 description 2
- VCSABYLVNWQYQE-UHFFFAOYSA-N Ala-Lys-Lys Natural products NCCCCC(NC(=O)C(N)C)C(=O)NC(CCCCN)C(O)=O VCSABYLVNWQYQE-UHFFFAOYSA-N 0.000 description 2
- RTZCUEHYUQZIDE-WHFBIAKZSA-N Ala-Ser-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O RTZCUEHYUQZIDE-WHFBIAKZSA-N 0.000 description 2
- 206010001935 American trypanosomiasis Diseases 0.000 description 2
- 206010002091 Anaesthesia Diseases 0.000 description 2
- NVFSJIXJZCDICF-SRVKXCTJSA-N Asp-Lys-Lys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)O)N NVFSJIXJZCDICF-SRVKXCTJSA-N 0.000 description 2
- QOCFFCUFZGDHTP-NUMRIWBASA-N Asp-Thr-Gln Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O QOCFFCUFZGDHTP-NUMRIWBASA-N 0.000 description 2
- RMFITHMDQGFSDC-UBHSHLNASA-N Asp-Trp-Cys Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC(=O)O)N RMFITHMDQGFSDC-UBHSHLNASA-N 0.000 description 2
- QOJJMJKTMKNFEF-ZKWXMUAHSA-N Asp-Val-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CC(O)=O QOJJMJKTMKNFEF-ZKWXMUAHSA-N 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 206010061666 Autonomic neuropathy Diseases 0.000 description 2
- 235000014469 Bacillus subtilis Nutrition 0.000 description 2
- 101100505161 Caenorhabditis elegans mel-32 gene Proteins 0.000 description 2
- 208000024699 Chagas disease Diseases 0.000 description 2
- 208000005243 Chondrosarcoma Diseases 0.000 description 2
- 241000588919 Citrobacter freundii Species 0.000 description 2
- 208000015943 Coeliac disease Diseases 0.000 description 2
- 206010010904 Convulsion Diseases 0.000 description 2
- 229940093444 Cyclooxygenase 2 inhibitor Drugs 0.000 description 2
- WXKWQSDHEXKKNC-ZKWXMUAHSA-N Cys-Asp-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CS)N WXKWQSDHEXKKNC-ZKWXMUAHSA-N 0.000 description 2
- GGIHYKLJUIZYGH-ZLUOBGJFSA-N Cys-Cys-Asp Chemical compound C([C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CS)N)C(=O)O GGIHYKLJUIZYGH-ZLUOBGJFSA-N 0.000 description 2
- CLEFUAZULXANBU-MELADBBJSA-N Cys-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CS)N)C(=O)O CLEFUAZULXANBU-MELADBBJSA-N 0.000 description 2
- VRJZMZGGAKVSIQ-SRVKXCTJSA-N Cys-Tyr-Ser Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O VRJZMZGGAKVSIQ-SRVKXCTJSA-N 0.000 description 2
- VVNCNSJFMMFHPL-VKHMYHEASA-N D-penicillamine Chemical compound CC(C)(S)[C@@H](N)C(O)=O VVNCNSJFMMFHPL-VKHMYHEASA-N 0.000 description 2
- 206010012735 Diarrhoea Diseases 0.000 description 2
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 2
- 238000001061 Dunnett's test Methods 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 238000012286 ELISA Assay Methods 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 201000006107 Familial adenomatous polyposis Diseases 0.000 description 2
- KRHYYFGTRYWZRS-UHFFFAOYSA-N Fluorane Chemical compound F KRHYYFGTRYWZRS-UHFFFAOYSA-N 0.000 description 2
- 102400000921 Gastrin Human genes 0.000 description 2
- 108010052343 Gastrins Proteins 0.000 description 2
- 101800001586 Ghrelin Proteins 0.000 description 2
- 102400000442 Ghrelin-28 Human genes 0.000 description 2
- QGWXAMDECCKGRU-XVKPBYJWSA-N Gln-Val-Gly Chemical compound CC(C)[C@H](NC(=O)[C@@H](N)CCC(N)=O)C(=O)NCC(O)=O QGWXAMDECCKGRU-XVKPBYJWSA-N 0.000 description 2
- YKLNMGJYMNPBCP-ACZMJKKPSA-N Glu-Asn-Asp Chemical compound C(CC(=O)O)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N YKLNMGJYMNPBCP-ACZMJKKPSA-N 0.000 description 2
- KCCNSVHJSMMGFS-NRPADANISA-N Glu-Val-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)O)N KCCNSVHJSMMGFS-NRPADANISA-N 0.000 description 2
- QXUPRMQJDWJDFR-NRPADANISA-N Glu-Val-Ser Chemical compound CC(C)[C@H](NC(=O)[C@@H](N)CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O QXUPRMQJDWJDFR-NRPADANISA-N 0.000 description 2
- 102000005720 Glutathione transferase Human genes 0.000 description 2
- 108010070675 Glutathione transferase Proteins 0.000 description 2
- WCORRBXVISTKQL-WHFBIAKZSA-N Gly-Ser-Ser Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O WCORRBXVISTKQL-WHFBIAKZSA-N 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- OBTMRGFRLJBSFI-GARJFASQSA-N His-Asn-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC2=CN=CN2)N)C(=O)O OBTMRGFRLJBSFI-GARJFASQSA-N 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- 206010020751 Hypersensitivity Diseases 0.000 description 2
- 206010020850 Hyperthyroidism Diseases 0.000 description 2
- 208000013038 Hypocalcemia Diseases 0.000 description 2
- FFFHZYDWPBMWHY-VKHMYHEASA-N L-homocysteine Chemical compound OC(=O)[C@@H](N)CCS FFFHZYDWPBMWHY-VKHMYHEASA-N 0.000 description 2
- 208000018142 Leiomyosarcoma Diseases 0.000 description 2
- VHFFQUSNFFIZBT-CIUDSAMLSA-N Lys-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCCCN)N VHFFQUSNFFIZBT-CIUDSAMLSA-N 0.000 description 2
- BOJYMMBYBNOOGG-DCAQKATOSA-N Lys-Pro-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O BOJYMMBYBNOOGG-DCAQKATOSA-N 0.000 description 2
- YSPZCHGIWAQVKQ-AVGNSLFASA-N Lys-Pro-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCCN YSPZCHGIWAQVKQ-AVGNSLFASA-N 0.000 description 2
- 108010040722 Neurokinin-2 Receptors Proteins 0.000 description 2
- 206010061876 Obstruction Diseases 0.000 description 2
- 229940123257 Opioid receptor antagonist Drugs 0.000 description 2
- 208000018737 Parkinson disease Diseases 0.000 description 2
- 102000004861 Phosphoric Diester Hydrolases Human genes 0.000 description 2
- 108090001050 Phosphoric Diester Hydrolases Proteins 0.000 description 2
- FNGOXVQBBCMFKV-CIUDSAMLSA-N Pro-Ser-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O FNGOXVQBBCMFKV-CIUDSAMLSA-N 0.000 description 2
- 101100244562 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) oprD gene Proteins 0.000 description 2
- 208000028017 Psychotic disease Diseases 0.000 description 2
- 241000700157 Rattus norvegicus Species 0.000 description 2
- VDVYTKZBMFADQH-AVGNSLFASA-N Ser-Gln-Tyr Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 VDVYTKZBMFADQH-AVGNSLFASA-N 0.000 description 2
- AMRRYKHCILPAKD-FXQIFTODSA-N Ser-Met-Asn Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CO)N AMRRYKHCILPAKD-FXQIFTODSA-N 0.000 description 2
- DINQYZRMXGWWTG-GUBZILKMSA-N Ser-Pro-Pro Chemical compound OC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 DINQYZRMXGWWTG-GUBZILKMSA-N 0.000 description 2
- PYTKULIABVRXSC-BWBBJGPYSA-N Ser-Ser-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PYTKULIABVRXSC-BWBBJGPYSA-N 0.000 description 2
- 102100037342 Substance-K receptor Human genes 0.000 description 2
- KERCOYANYUPLHJ-XGEHTFHBSA-N Thr-Pro-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O KERCOYANYUPLHJ-XGEHTFHBSA-N 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 241000223109 Trypanosoma cruzi Species 0.000 description 2
- YMTOEGGOCHVGEH-IHRRRGAJSA-N Val-Lys-Lys Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O YMTOEGGOCHVGEH-IHRRRGAJSA-N 0.000 description 2
- 241001135251 Yersinia kristensenii Species 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 108010024078 alanyl-glycyl-serine Proteins 0.000 description 2
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 2
- 125000000217 alkyl group Chemical group 0.000 description 2
- 239000000908 ammonium hydroxide Substances 0.000 description 2
- 230000037005 anaesthesia Effects 0.000 description 2
- 230000003502 anti-nociceptive effect Effects 0.000 description 2
- 229940125681 anticonvulsant agent Drugs 0.000 description 2
- 239000001961 anticonvulsive agent Substances 0.000 description 2
- 239000002518 antifoaming agent Substances 0.000 description 2
- 239000002220 antihypertensive agent Substances 0.000 description 2
- 229940030600 antihypertensive agent Drugs 0.000 description 2
- 239000000164 antipsychotic agent Substances 0.000 description 2
- 229940005529 antipsychotics Drugs 0.000 description 2
- 210000000436 anus Anatomy 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 2
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 208000024330 bloating Diseases 0.000 description 2
- KGBXLFKZBHKPEV-UHFFFAOYSA-N boric acid Chemical compound OB(O)O KGBXLFKZBHKPEV-UHFFFAOYSA-N 0.000 description 2
- 108010089894 bradykinin potentiating factors Proteins 0.000 description 2
- 229940041514 candida albicans extract Drugs 0.000 description 2
- 210000004534 cecum Anatomy 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- AOXOCDRNSPFDPE-UKEONUMOSA-N chembl413654 Chemical compound C([C@H](C(=O)NCC(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@H](CCSC)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](C)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)CNC(=O)[C@@H](N)CCC(O)=O)C1=CC=C(O)C=C1 AOXOCDRNSPFDPE-UKEONUMOSA-N 0.000 description 2
- 208000029664 classic familial adenomatous polyposis Diseases 0.000 description 2
- 230000002860 competitive effect Effects 0.000 description 2
- 239000013068 control sample Substances 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 150000001945 cysteines Chemical class 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 108700023159 delta Opioid Receptors Proteins 0.000 description 2
- 102000048124 delta Opioid Receptors Human genes 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 239000002270 dispersing agent Substances 0.000 description 2
- RUZYUOTYCVRMRZ-UHFFFAOYSA-N doxazosin Chemical compound C1OC2=CC=CC=C2OC1C(=O)N(CC1)CCN1C1=NC(N)=C(C=C(C(OC)=C2)OC)C2=N1 RUZYUOTYCVRMRZ-UHFFFAOYSA-N 0.000 description 2
- 229960001389 doxazosin Drugs 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- 229960002413 ferric citrate Drugs 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- DBEPLOCGEIEOCV-WSBQPABSSA-N finasteride Chemical compound N([C@@H]1CC2)C(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H](C(=O)NC(C)(C)C)[C@@]2(C)CC1 DBEPLOCGEIEOCV-WSBQPABSSA-N 0.000 description 2
- 229960004039 finasteride Drugs 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 235000013355 food flavoring agent Nutrition 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- GNKDKYIHGQKHHM-RJKLHVOGSA-N ghrelin Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)CN)COC(=O)CCCCCCC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C1=CC=CC=C1 GNKDKYIHGQKHHM-RJKLHVOGSA-N 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- YMAWOPBAYDPSLA-UHFFFAOYSA-N glycylglycine Chemical compound [NH3+]CC(=O)NCC([O-])=O YMAWOPBAYDPSLA-UHFFFAOYSA-N 0.000 description 2
- 210000003630 histaminocyte Anatomy 0.000 description 2
- 239000003906 humectant Substances 0.000 description 2
- 229910000040 hydrogen fluoride Inorganic materials 0.000 description 2
- 230000000705 hypocalcaemia Effects 0.000 description 2
- 208000003532 hypothyroidism Diseases 0.000 description 2
- 230000002989 hypothyroidism Effects 0.000 description 2
- 238000002513 implantation Methods 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 229960000905 indomethacin Drugs 0.000 description 2
- 210000002490 intestinal epithelial cell Anatomy 0.000 description 2
- 210000004347 intestinal mucosa Anatomy 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- 239000011630 iodine Substances 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- NPFOYSMITVOQOS-UHFFFAOYSA-K iron(III) citrate Chemical compound [Fe+3].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NPFOYSMITVOQOS-UHFFFAOYSA-K 0.000 description 2
- 229930027917 kanamycin Natural products 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 229960000318 kanamycin Drugs 0.000 description 2
- 229930182823 kanamycin A Natural products 0.000 description 2
- 102000048260 kappa Opioid Receptors Human genes 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- UZKWTJUDCOPSNM-UHFFFAOYSA-N methoxybenzene Substances CCCCOC=C UZKWTJUDCOPSNM-UHFFFAOYSA-N 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 230000004899 motility Effects 0.000 description 2
- 102000051367 mu Opioid Receptors Human genes 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 229910001120 nichrome Inorganic materials 0.000 description 2
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 description 2
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 2
- 238000001543 one-way ANOVA Methods 0.000 description 2
- 239000006072 paste Substances 0.000 description 2
- 229960005190 phenylalanine Drugs 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 229920003023 plastic Polymers 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 108010031719 prolyl-serine Proteins 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 125000006239 protecting group Chemical group 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 229940126409 proton pump inhibitor Drugs 0.000 description 2
- 239000000612 proton pump inhibitor Substances 0.000 description 2
- 239000006215 rectal suppository Substances 0.000 description 2
- 229940100618 rectal suppository Drugs 0.000 description 2
- 210000000664 rectum Anatomy 0.000 description 2
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 108010071207 serylmethionine Proteins 0.000 description 2
- 239000002002 slurry Substances 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 125000006850 spacer group Chemical group 0.000 description 2
- 210000000278 spinal cord Anatomy 0.000 description 2
- 238000007619 statistical method Methods 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 210000003699 striated muscle Anatomy 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- IKBKZGMPCYNSLU-RGVLZGJSSA-N tegaserod Chemical compound C1=C(OC)C=C2C(/C=N/NC(=N)NCCCCC)=CNC2=C1 IKBKZGMPCYNSLU-RGVLZGJSSA-N 0.000 description 2
- 125000003396 thiol group Chemical group [H]S* 0.000 description 2
- UMGDCJDMYOKAJW-UHFFFAOYSA-N thiourea Chemical compound NC(N)=S UMGDCJDMYOKAJW-UHFFFAOYSA-N 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 229960004799 tryptophan Drugs 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 230000009278 visceral effect Effects 0.000 description 2
- 239000003643 water by type Substances 0.000 description 2
- 239000012138 yeast extract Substances 0.000 description 2
- 108020001588 κ-opioid receptors Proteins 0.000 description 2
- 108020001612 μ-opioid receptors Proteins 0.000 description 2
- OGNSCSPNOLGXSM-UHFFFAOYSA-N (+/-)-DABA Natural products NCCC(N)C(O)=O OGNSCSPNOLGXSM-UHFFFAOYSA-N 0.000 description 1
- FBOUIAKEJMZPQG-AWNIVKPZSA-N (1E)-1-(2,4-dichlorophenyl)-4,4-dimethyl-2-(1,2,4-triazol-1-yl)pent-1-en-3-ol Chemical compound C1=NC=NN1/C(C(O)C(C)(C)C)=C/C1=CC=C(Cl)C=C1Cl FBOUIAKEJMZPQG-AWNIVKPZSA-N 0.000 description 1
- YFGBQHOOROIVKG-BHDDXSALSA-N (2R)-2-[[(2R)-2-[[2-[[2-[[(2S)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]acetyl]amino]acetyl]amino]-3-phenylpropanoyl]amino]-4-methylsulfanylbutanoic acid Chemical compound C([C@H](C(=O)N[C@H](CCSC)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 YFGBQHOOROIVKG-BHDDXSALSA-N 0.000 description 1
- RQBSKKBNALPMSL-QUMGSSFMSA-N (2r)-2-[[(2s)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]-6-formamido-n-[2-oxo-2-[[(2s)-1-oxo-1-[[(3r)-2-oxothiolan-3-yl]amino]-3-phenylpropan-2-yl]amino]ethyl]hexanamide Chemical compound C([C@H](N)C(=O)N[C@H](CCCCNC=O)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@H]1C(SCC1)=O)C1=CC=C(O)C=C1 RQBSKKBNALPMSL-QUMGSSFMSA-N 0.000 description 1
- UDTXUDHDIVNHCL-AENUQYPBSA-N (2s)-2-[[(2s)-4-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-1-[(2s)-6-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-amino-4-methylpentanoyl]amino]-4-carboxybutanoyl]amino]-4-carboxybutanoyl]amino]-4-carboxybutanoyl]amino]-4-methylpe Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O UDTXUDHDIVNHCL-AENUQYPBSA-N 0.000 description 1
- DAZBILQQVFBVPE-XKKUQSFHSA-N (2s)-4-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-1-[(2s)-4-amino-2-[[2-[[(2r)-2-[[(2s)-2-[[(2s)-1-[(2s)-6-amino-2-[[(2s)-2-[[(2s)-2-[[(2s,3r)-2-amino-3-hydroxybutanoyl]amino]-4-methylsulfanylbutanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]hexan Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N1[C@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(O)=O)CCC1 DAZBILQQVFBVPE-XKKUQSFHSA-N 0.000 description 1
- BNIFSVVAHBLNTN-XKKUQSFHSA-N (2s)-4-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-1-[(2s)-4-amino-2-[[2-[[(2s)-2-[[(2s)-2-[[(2s)-1-[(2s)-6-amino-2-[[(2s)-2-[[(2s)-2-[[(2s,3r)-2-amino-3-hydroxybutanoyl]amino]-4-methylsulfanylbutanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]hexan Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N1[C@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(O)=O)CCC1 BNIFSVVAHBLNTN-XKKUQSFHSA-N 0.000 description 1
- XILNRORTJVDYRH-HKUYNNGSSA-N (2s,3s)-n-[[2-methoxy-5-[5-(trifluoromethyl)tetrazol-1-yl]phenyl]methyl]-2-phenylpiperidin-3-amine Chemical compound C1([C@@H]2NCCC[C@@H]2NCC2=CC(=CC=C2OC)N2C(=NN=N2)C(F)(F)F)=CC=CC=C1 XILNRORTJVDYRH-HKUYNNGSSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- OVSKIKFHRZPJSS-UHFFFAOYSA-N 2,4-D Chemical compound OC(=O)COC1=CC=C(Cl)C=C1Cl OVSKIKFHRZPJSS-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- QDGAVODICPCDMU-UHFFFAOYSA-N 2-amino-3-[3-[bis(2-chloroethyl)amino]phenyl]propanoic acid Chemical compound OC(=O)C(N)CC1=CC=CC(N(CCCl)CCCl)=C1 QDGAVODICPCDMU-UHFFFAOYSA-N 0.000 description 1
- AKLMUGFDGONMAA-UHFFFAOYSA-N 268545-87-5 Chemical compound C=12C3=NC(C)=CC=1N(C(CCC)CCC)CCN2N=C3C1=CC=C(Cl)C=C1Cl AKLMUGFDGONMAA-UHFFFAOYSA-N 0.000 description 1
- NPFVRBCDMFKOPY-UHFFFAOYSA-N 3-(4-imidazol-1-ylthiophen-2-yl)-4-methyl-4,5-dihydro-1h-pyridazin-6-one Chemical compound CC1CC(=O)NN=C1C1=CC(N2C=NC=C2)=CS1 NPFVRBCDMFKOPY-UHFFFAOYSA-N 0.000 description 1
- YOKCETMQAPIAGM-UHFFFAOYSA-N 3-[(2-aminoacetyl)amino]propanoic acid Chemical compound NCC(=O)NCCC(O)=O YOKCETMQAPIAGM-UHFFFAOYSA-N 0.000 description 1
- UQTZMGFTRHFAAM-ZETCQYMHSA-N 3-iodo-L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C(I)=C1 UQTZMGFTRHFAAM-ZETCQYMHSA-N 0.000 description 1
- PPVTTWPBNHFCAJ-XMSQKQJNSA-N 4-amino-5-chloro-2-(cyclopropylmethoxy)-n-[(1r,2r)-2-[(4-methylpiperidin-1-yl)methyl]cyclohexyl]benzamide Chemical compound C1CC(C)CCN1C[C@@H]1[C@H](NC(=O)C=2C(=CC(N)=C(Cl)C=2)OCC2CC2)CCCC1 PPVTTWPBNHFCAJ-XMSQKQJNSA-N 0.000 description 1
- YPELFRMCRYSPKZ-UHFFFAOYSA-N 4-amino-5-chloro-2-ethoxy-N-({4-[(4-fluorophenyl)methyl]morpholin-2-yl}methyl)benzamide Chemical compound CCOC1=CC(N)=C(Cl)C=C1C(=O)NCC1OCCN(CC=2C=CC(F)=CC=2)C1 YPELFRMCRYSPKZ-UHFFFAOYSA-N 0.000 description 1
- LVRVABPNVHYXRT-BQWXUCBYSA-N 52906-92-0 Chemical compound C([C@H](N)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O)C(C)C)C1=CC=CC=C1 LVRVABPNVHYXRT-BQWXUCBYSA-N 0.000 description 1
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical compound NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 1
- 208000010400 APUDoma Diseases 0.000 description 1
- 208000000583 Adenolymphoma Diseases 0.000 description 1
- IXTPACPAXIOCRG-ACZMJKKPSA-N Ala-Glu-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N IXTPACPAXIOCRG-ACZMJKKPSA-N 0.000 description 1
- CXISPYVYMQWFLE-VKHMYHEASA-N Ala-Gly Chemical compound C[C@H]([NH3+])C(=O)NCC([O-])=O CXISPYVYMQWFLE-VKHMYHEASA-N 0.000 description 1
- QCTFKEJEIMPOLW-JURCDPSOSA-N Ala-Ile-Phe Chemical compound C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 QCTFKEJEIMPOLW-JURCDPSOSA-N 0.000 description 1
- DHBKYZYFEXXUAK-ONGXEEELSA-N Ala-Phe-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CC=CC=C1 DHBKYZYFEXXUAK-ONGXEEELSA-N 0.000 description 1
- LSMDIAAALJJLRO-XQXXSGGOSA-N Ala-Thr-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O LSMDIAAALJJLRO-XQXXSGGOSA-N 0.000 description 1
- 208000000044 Amnesia Diseases 0.000 description 1
- 208000005034 Angiolymphoid Hyperplasia with Eosinophilia Diseases 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 208000019901 Anxiety disease Diseases 0.000 description 1
- RYRQZJVFDVWURI-SRVKXCTJSA-N Arg-Gln-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCCN=C(N)N)N RYRQZJVFDVWURI-SRVKXCTJSA-N 0.000 description 1
- JQFZHHSQMKZLRU-IUCAKERBSA-N Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCN=C(N)N JQFZHHSQMKZLRU-IUCAKERBSA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 241001424309 Arita Species 0.000 description 1
- LJUOLNXOWSWGKF-ACZMJKKPSA-N Asn-Asn-Glu Chemical compound C(CC(=O)O)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)N)N LJUOLNXOWSWGKF-ACZMJKKPSA-N 0.000 description 1
- HZYFHQOWCFUSOV-IMJSIDKUSA-N Asn-Asp Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(O)=O HZYFHQOWCFUSOV-IMJSIDKUSA-N 0.000 description 1
- XVVOVPFMILMHPX-ZLUOBGJFSA-N Asn-Asp-Asp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O XVVOVPFMILMHPX-ZLUOBGJFSA-N 0.000 description 1
- FANGHKQYFPYDNB-UBHSHLNASA-N Asn-Asp-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)N)N FANGHKQYFPYDNB-UBHSHLNASA-N 0.000 description 1
- KNENKKKUYGEZIO-FXQIFTODSA-N Asn-Met-Asn Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CC(=O)N)N KNENKKKUYGEZIO-FXQIFTODSA-N 0.000 description 1
- GZXOUBTUAUAVHD-ACZMJKKPSA-N Asn-Ser-Glu Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O GZXOUBTUAUAVHD-ACZMJKKPSA-N 0.000 description 1
- PBVLJOIPOGUQQP-CIUDSAMLSA-N Asp-Ala-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O PBVLJOIPOGUQQP-CIUDSAMLSA-N 0.000 description 1
- VGRHZPNRCLAHQA-IMJSIDKUSA-N Asp-Asn Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(O)=O VGRHZPNRCLAHQA-IMJSIDKUSA-N 0.000 description 1
- OAMLVOVXNKILLQ-BQBZGAKWSA-N Asp-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC(O)=O OAMLVOVXNKILLQ-BQBZGAKWSA-N 0.000 description 1
- IDDMGSKZQDEDGA-SRVKXCTJSA-N Asp-Phe-Asn Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(O)=O)CC1=CC=CC=C1 IDDMGSKZQDEDGA-SRVKXCTJSA-N 0.000 description 1
- MGSVBZIBCCKGCY-ZLUOBGJFSA-N Asp-Ser-Ser Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O MGSVBZIBCCKGCY-ZLUOBGJFSA-N 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 206010061692 Benign muscle neoplasm Diseases 0.000 description 1
- 208000035821 Benign schwannoma Diseases 0.000 description 1
- 208000003609 Bile Duct Adenoma Diseases 0.000 description 1
- 238000009010 Bradford assay Methods 0.000 description 1
- 201000007652 Brody myopathy Diseases 0.000 description 1
- 101100512078 Caenorhabditis elegans lys-1 gene Proteins 0.000 description 1
- 101100366889 Caenorhabditis elegans sta-2 gene Proteins 0.000 description 1
- 101100315624 Caenorhabditis elegans tyr-1 gene Proteins 0.000 description 1
- 229940127291 Calcium channel antagonist Drugs 0.000 description 1
- 206010007270 Carcinoid syndrome Diseases 0.000 description 1
- 201000000274 Carcinosarcoma Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 208000007389 Cementoma Diseases 0.000 description 1
- 206010008642 Cholesteatoma Diseases 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 206010008754 Choreoathetosis Diseases 0.000 description 1
- 208000016216 Choristoma Diseases 0.000 description 1
- 208000017667 Chronic Disease Diseases 0.000 description 1
- 108010038061 Chymotrypsinogen Proteins 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 206010009895 Colitis ischaemic Diseases 0.000 description 1
- 208000000151 Colon Diverticulum Diseases 0.000 description 1
- 108010056643 Corticotropin-Releasing Hormone Receptors Proteins 0.000 description 1
- 208000009798 Craniopharyngioma Diseases 0.000 description 1
- 101710095468 Cyclase Proteins 0.000 description 1
- 101710157975 Cyclic nucleotide phosphodiesterase inhibitor Proteins 0.000 description 1
- AYKQJQVWUYEZNU-IMJSIDKUSA-N Cys-Asn Chemical compound SC[C@H](N)C(=O)N[C@H](C(O)=O)CC(N)=O AYKQJQVWUYEZNU-IMJSIDKUSA-N 0.000 description 1
- OXOQBEVULIBOSH-ZDLURKLDSA-N Cys-Gly-Thr Chemical compound [H]N[C@@H](CS)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(O)=O OXOQBEVULIBOSH-ZDLURKLDSA-N 0.000 description 1
- OOULJWDSSVOMHX-WDSKDSINSA-N Cys-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CS OOULJWDSSVOMHX-WDSKDSINSA-N 0.000 description 1
- HEPLXMBVMCXTBP-QWRGUYRKSA-N Cys-Phe-Gly Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(O)=O HEPLXMBVMCXTBP-QWRGUYRKSA-N 0.000 description 1
- JIZRUFJGHPIYPS-SRVKXCTJSA-N Cys-Tyr-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CS)N)O JIZRUFJGHPIYPS-SRVKXCTJSA-N 0.000 description 1
- 201000005171 Cystadenoma Diseases 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 206010011878 Deafness Diseases 0.000 description 1
- 206010013554 Diverticulum Diseases 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 208000006402 Ductal Carcinoma Diseases 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 208000003468 Ehrlich Tumor Carcinoma Diseases 0.000 description 1
- 241000702224 Enterobacteria phage M13 Species 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 208000002519 Epithelioid Leiomyoma Diseases 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 244000119461 Garcinia xanthochymus Species 0.000 description 1
- 208000005577 Gastroenteritis Diseases 0.000 description 1
- 206010017964 Gastrointestinal infection Diseases 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 208000007569 Giant Cell Tumors Diseases 0.000 description 1
- DXJZITDUDUPINW-WHFBIAKZSA-N Gln-Asn Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(O)=O DXJZITDUDUPINW-WHFBIAKZSA-N 0.000 description 1
- MFJAPSYJQJCQDN-BQBZGAKWSA-N Gln-Gly-Glu Chemical compound NC(=O)CC[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O MFJAPSYJQJCQDN-BQBZGAKWSA-N 0.000 description 1
- UESYBOXFJWJVSB-AVGNSLFASA-N Gln-Phe-Ser Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O UESYBOXFJWJVSB-AVGNSLFASA-N 0.000 description 1
- KUBFPYIMAGXGBT-ACZMJKKPSA-N Gln-Ser-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O KUBFPYIMAGXGBT-ACZMJKKPSA-N 0.000 description 1
- BYKZWDGMJLNFJY-XKBZYTNZSA-N Gln-Ser-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)N)N)O BYKZWDGMJLNFJY-XKBZYTNZSA-N 0.000 description 1
- 201000005618 Glomus Tumor Diseases 0.000 description 1
- LKDIBBOKUAASNP-FXQIFTODSA-N Glu-Ala-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O LKDIBBOKUAASNP-FXQIFTODSA-N 0.000 description 1
- FYYSIASRLDJUNP-WHFBIAKZSA-N Glu-Asp Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(O)=O FYYSIASRLDJUNP-WHFBIAKZSA-N 0.000 description 1
- IDEODOAVGCMUQV-GUBZILKMSA-N Glu-Ser-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O IDEODOAVGCMUQV-GUBZILKMSA-N 0.000 description 1
- MFBYPDKTAJXHNI-VKHMYHEASA-N Gly-Cys Chemical compound [NH3+]CC(=O)N[C@@H](CS)C([O-])=O MFBYPDKTAJXHNI-VKHMYHEASA-N 0.000 description 1
- YDWZGVCXMVLDQH-WHFBIAKZSA-N Gly-Cys-Asn Chemical compound NCC(=O)N[C@@H](CS)C(=O)N[C@H](C(O)=O)CC(N)=O YDWZGVCXMVLDQH-WHFBIAKZSA-N 0.000 description 1
- HDNXXTBKOJKWNN-WDSKDSINSA-N Gly-Glu-Asn Chemical compound NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O HDNXXTBKOJKWNN-WDSKDSINSA-N 0.000 description 1
- CQMFNTVQVLQRLT-JHEQGTHGSA-N Gly-Thr-Gln Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O CQMFNTVQVLQRLT-JHEQGTHGSA-N 0.000 description 1
- VPZXBVLAVMBEQI-VKHMYHEASA-N Glycyl-alanine Chemical compound OC(=O)[C@H](C)NC(=O)CN VPZXBVLAVMBEQI-VKHMYHEASA-N 0.000 description 1
- 108010008488 Glycylglycine Proteins 0.000 description 1
- 208000005234 Granulosa Cell Tumor Diseases 0.000 description 1
- 102400001367 Guanylin Human genes 0.000 description 1
- 101800004305 Guanylin Proteins 0.000 description 1
- 208000035773 Gynandroblastoma Diseases 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 108010077008 HOE 825 Proteins 0.000 description 1
- 208000002927 Hamartoma Diseases 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 101710121697 Heat-stable enterotoxin Proteins 0.000 description 1
- 101710111320 Heat-stable enterotoxin A2 Proteins 0.000 description 1
- 208000002125 Hemangioendothelioma Diseases 0.000 description 1
- 208000006050 Hemangiopericytoma Diseases 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 208000017095 Hereditary nonpolyposis colon cancer Diseases 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- CZVQSYNVUHAILZ-UWVGGRQHSA-N His-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CN=CN1 CZVQSYNVUHAILZ-UWVGGRQHSA-N 0.000 description 1
- 229940122957 Histamine H2 receptor antagonist Drugs 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 241000598436 Human T-cell lymphotropic virus Species 0.000 description 1
- 206010020772 Hypertension Diseases 0.000 description 1
- 208000004356 Hysteria Diseases 0.000 description 1
- CYHYBSGMHMHKOA-CIQUZCHMSA-N Ile-Ala-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N CYHYBSGMHMHKOA-CIQUZCHMSA-N 0.000 description 1
- UMYZBHKAVTXWIW-GMOBBJLQSA-N Ile-Asp-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N UMYZBHKAVTXWIW-GMOBBJLQSA-N 0.000 description 1
- JODPUDMBQBIWCK-GHCJXIJMSA-N Ile-Ser-Asn Chemical compound [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O JODPUDMBQBIWCK-GHCJXIJMSA-N 0.000 description 1
- HXIDVIFHRYRXLZ-NAKRPEOUSA-N Ile-Ser-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)O)N HXIDVIFHRYRXLZ-NAKRPEOUSA-N 0.000 description 1
- WIYDLTIBHZSPKY-HJWJTTGWSA-N Ile-Val-Phe Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 WIYDLTIBHZSPKY-HJWJTTGWSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 1
- 206010051925 Intestinal adenocarcinoma Diseases 0.000 description 1
- 206010022680 Intestinal ischaemia Diseases 0.000 description 1
- 208000009164 Islet Cell Adenoma Diseases 0.000 description 1
- 239000007836 KH2PO4 Substances 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- YQEZLKZALYSWHR-UHFFFAOYSA-N Ketamine Chemical compound C=1C=CC=C(Cl)C=1C1(NC)CCCCC1=O YQEZLKZALYSWHR-UHFFFAOYSA-N 0.000 description 1
- PMGDADKJMCOXHX-UHFFFAOYSA-N L-Arginyl-L-glutamin-acetat Natural products NC(=N)NCCCC(N)C(=O)NC(CCC(N)=O)C(O)=O PMGDADKJMCOXHX-UHFFFAOYSA-N 0.000 description 1
- WTDRDQBEARUVNC-LURJTMIESA-N L-DOPA Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C(O)=C1 WTDRDQBEARUVNC-LURJTMIESA-N 0.000 description 1
- WTDRDQBEARUVNC-UHFFFAOYSA-N L-Dopa Natural products OC(=O)C(N)CC1=CC=C(O)C(O)=C1 WTDRDQBEARUVNC-UHFFFAOYSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- XUIIKFGFIJCVMT-LBPRGKRZSA-N L-thyroxine Chemical compound IC1=CC(C[C@H]([NH3+])C([O-])=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-LBPRGKRZSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- KPYAOIVPJKPIOU-KKUMJFAQSA-N Leu-Lys-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O KPYAOIVPJKPIOU-KKUMJFAQSA-N 0.000 description 1
- DDVHDMSBLRAKNV-IHRRRGAJSA-N Leu-Met-Leu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(O)=O DDVHDMSBLRAKNV-IHRRRGAJSA-N 0.000 description 1
- DPURXCQCHSQPAN-AVGNSLFASA-N Leu-Pro-Pro Chemical compound CC(C)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 DPURXCQCHSQPAN-AVGNSLFASA-N 0.000 description 1
- KZZCOWMDDXDKSS-CIUDSAMLSA-N Leu-Ser-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O KZZCOWMDDXDKSS-CIUDSAMLSA-N 0.000 description 1
- BRTVHXHCUSXYRI-CIUDSAMLSA-N Leu-Ser-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O BRTVHXHCUSXYRI-CIUDSAMLSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 201000004462 Leydig Cell Tumor Diseases 0.000 description 1
- 208000026709 Liddle syndrome Diseases 0.000 description 1
- 206010024612 Lipoma Diseases 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000004138 Lymphangiomyoma Diseases 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- NPBGTPKLVJEOBE-IUCAKERBSA-N Lys-Arg Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=N NPBGTPKLVJEOBE-IUCAKERBSA-N 0.000 description 1
- JMNRXRPBHFGXQX-GUBZILKMSA-N Lys-Ser-Glu Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O JMNRXRPBHFGXQX-GUBZILKMSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 108010092101 MEN 11420 Proteins 0.000 description 1
- 208000004155 Malabsorption Syndromes Diseases 0.000 description 1
- 208000008095 Malignant Carcinoid Syndrome Diseases 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 208000010728 Meckel diverticulum Diseases 0.000 description 1
- 208000000172 Medulloblastoma Diseases 0.000 description 1
- 208000026139 Memory disease Diseases 0.000 description 1
- 208000027530 Meniere disease Diseases 0.000 description 1
- 208000004535 Mesenteric Ischemia Diseases 0.000 description 1
- 208000010153 Mesonephroma Diseases 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 102400000988 Met-enkephalin Human genes 0.000 description 1
- 108010042237 Methionine Enkephalin Proteins 0.000 description 1
- 102400001357 Motilin Human genes 0.000 description 1
- 101800002372 Motilin Proteins 0.000 description 1
- 208000016285 Movement disease Diseases 0.000 description 1
- 208000007727 Muscle Tissue Neoplasms Diseases 0.000 description 1
- 201000004458 Myoma Diseases 0.000 description 1
- 208000005927 Myosarcoma Diseases 0.000 description 1
- 108090001041 N-Methyl-D-Aspartate Receptors Proteins 0.000 description 1
- 102000004868 N-Methyl-D-Aspartate Receptors Human genes 0.000 description 1
- 108010079364 N-glycylalanine Proteins 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 201000004404 Neurofibroma Diseases 0.000 description 1
- 102000002002 Neurokinin-1 Receptors Human genes 0.000 description 1
- 108010040716 Neurokinin-3 Receptors Proteins 0.000 description 1
- 102000002003 Neurokinin-3 Receptors Human genes 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 208000005890 Neuroma Diseases 0.000 description 1
- 108050006807 Nicotinic acetylcholine receptors Proteins 0.000 description 1
- 102000019315 Nicotinic acetylcholine receptors Human genes 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 206010033645 Pancreatitis Diseases 0.000 description 1
- 206010033664 Panic attack Diseases 0.000 description 1
- 206010061332 Paraganglion neoplasm Diseases 0.000 description 1
- FSXRLASFHBWESK-HOTGVXAUSA-N Phe-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 FSXRLASFHBWESK-HOTGVXAUSA-N 0.000 description 1
- 241001440127 Phyllodes Species 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- 208000007452 Plasmacytoma Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- NPYPAHLBTDXSSS-UHFFFAOYSA-N Potassium ion Chemical compound [K+] NPYPAHLBTDXSSS-UHFFFAOYSA-N 0.000 description 1
- LNLNHXIQPGKRJQ-SRVKXCTJSA-N Pro-Arg-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H]1CCCN1 LNLNHXIQPGKRJQ-SRVKXCTJSA-N 0.000 description 1
- HPXVFFIIGOAQRV-DCAQKATOSA-N Pro-Arg-Gln Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(O)=O HPXVFFIIGOAQRV-DCAQKATOSA-N 0.000 description 1
- CMOIIANLNNYUTP-SRVKXCTJSA-N Pro-Gln-His Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O CMOIIANLNNYUTP-SRVKXCTJSA-N 0.000 description 1
- KDBHVPXBQADZKY-GUBZILKMSA-N Pro-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 KDBHVPXBQADZKY-GUBZILKMSA-N 0.000 description 1
- 206010036774 Proctitis Diseases 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 239000012564 Q sepharose fast flow resin Substances 0.000 description 1
- 206010036775 Rectal inflammations Diseases 0.000 description 1
- 206010038802 Reticuloendothelial system stimulated Diseases 0.000 description 1
- 208000017442 Retinal disease Diseases 0.000 description 1
- 206010038923 Retinopathy Diseases 0.000 description 1
- 208000005678 Rhabdomyoma Diseases 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- JPIDMRXXNMIVKY-VZFHVOOUSA-N Ser-Ala-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O JPIDMRXXNMIVKY-VZFHVOOUSA-N 0.000 description 1
- MQUZANJDFOQOBX-SRVKXCTJSA-N Ser-Phe-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O MQUZANJDFOQOBX-SRVKXCTJSA-N 0.000 description 1
- BSXKBOUZDAZXHE-CIUDSAMLSA-N Ser-Pro-Glu Chemical compound [H]N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O BSXKBOUZDAZXHE-CIUDSAMLSA-N 0.000 description 1
- LDEBVRIURYMKQS-WISUUJSJSA-N Ser-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@@H](N)CO LDEBVRIURYMKQS-WISUUJSJSA-N 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 102000012479 Serine Proteases Human genes 0.000 description 1
- 108010022999 Serine Proteases Proteins 0.000 description 1
- 208000003274 Sertoli cell tumor Diseases 0.000 description 1
- 208000002669 Sex Cord-Gonadal Stromal Tumors Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 206010042658 Sweat gland tumour Diseases 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 206010043276 Teratoma Diseases 0.000 description 1
- FQPQPTHMHZKGFM-XQXXSGGOSA-N Thr-Ala-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O FQPQPTHMHZKGFM-XQXXSGGOSA-N 0.000 description 1
- MGJLBZFUXUGMML-VOAKCMCISA-N Thr-Lys-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)N)O MGJLBZFUXUGMML-VOAKCMCISA-N 0.000 description 1
- VTMGKRABARCZAX-OSUNSFLBSA-N Thr-Pro-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)[C@@H](C)O VTMGKRABARCZAX-OSUNSFLBSA-N 0.000 description 1
- GXDLGHLJTHMDII-WISUUJSJSA-N Thr-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CO)C(O)=O GXDLGHLJTHMDII-WISUUJSJSA-N 0.000 description 1
- STUAPCLEDMKXKL-LKXGYXEUSA-N Thr-Ser-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O STUAPCLEDMKXKL-LKXGYXEUSA-N 0.000 description 1
- MFMGPEKYBXFIRF-SUSMZKCASA-N Thr-Thr-Gln Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O MFMGPEKYBXFIRF-SUSMZKCASA-N 0.000 description 1
- AUYYCJSJGJYCDS-LBPRGKRZSA-N Thyrolar Chemical compound IC1=CC(C[C@H](N)C(O)=O)=CC(I)=C1OC1=CC=C(O)C(I)=C1 AUYYCJSJGJYCDS-LBPRGKRZSA-N 0.000 description 1
- 208000009205 Tinnitus Diseases 0.000 description 1
- NBHGNEJMBNQQKZ-UBHSHLNASA-N Trp-Asp-Cys Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N NBHGNEJMBNQQKZ-UBHSHLNASA-N 0.000 description 1
- DEZKIRSBKKXUEV-NYVOZVTQSA-N Trp-Asp-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC3=CNC4=CC=CC=C43)C(=O)O)N DEZKIRSBKKXUEV-NYVOZVTQSA-N 0.000 description 1
- IMMPMHKLUUZKAZ-WMZOPIPTSA-N Trp-Phe Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)N)C(O)=O)C1=CC=CC=C1 IMMPMHKLUUZKAZ-WMZOPIPTSA-N 0.000 description 1
- 108010027252 Trypsinogen Proteins 0.000 description 1
- 102000018690 Trypsinogen Human genes 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 108010078814 Tumor Suppressor Protein p53 Proteins 0.000 description 1
- SCCKSNREWHMKOJ-SRVKXCTJSA-N Tyr-Asn-Ser Chemical compound N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O SCCKSNREWHMKOJ-SRVKXCTJSA-N 0.000 description 1
- HZZKQZDUIKVFDZ-AVGNSLFASA-N Tyr-Gln-Ser Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CO)C(=O)O)N)O HZZKQZDUIKVFDZ-AVGNSLFASA-N 0.000 description 1
- CGWAPUBOXJWXMS-HOTGVXAUSA-N Tyr-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=C(O)C=C1 CGWAPUBOXJWXMS-HOTGVXAUSA-N 0.000 description 1
- 102400000230 Uroguanylin Human genes 0.000 description 1
- 101800000255 Uroguanylin Proteins 0.000 description 1
- JIODCDXKCJRMEH-NHCYSSNCSA-N Val-Arg-Gln Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N JIODCDXKCJRMEH-NHCYSSNCSA-N 0.000 description 1
- IWZYXFRGWKEKBJ-GVXVVHGQSA-N Val-Gln-His Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N IWZYXFRGWKEKBJ-GVXVVHGQSA-N 0.000 description 1
- BZOSBRIDWSSTFN-AVGNSLFASA-N Val-Leu-Met Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](C(C)C)N BZOSBRIDWSSTFN-AVGNSLFASA-N 0.000 description 1
- XXWBHOWRARMUOC-NHCYSSNCSA-N Val-Lys-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N)C(=O)O)N XXWBHOWRARMUOC-NHCYSSNCSA-N 0.000 description 1
- VIKZGAUAKQZDOF-NRPADANISA-N Val-Ser-Glu Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O VIKZGAUAKQZDOF-NRPADANISA-N 0.000 description 1
- UGFMVXRXULGLNO-XPUUQOCRSA-N Val-Ser-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O UGFMVXRXULGLNO-XPUUQOCRSA-N 0.000 description 1
- RLVTVHSDKHBFQP-ULQDDVLXSA-N Val-Tyr-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)CC1=CC=C(O)C=C1 RLVTVHSDKHBFQP-ULQDDVLXSA-N 0.000 description 1
- 108010003205 Vasoactive Intestinal Peptide Proteins 0.000 description 1
- 102400000015 Vasoactive intestinal peptide Human genes 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 208000012886 Vertigo Diseases 0.000 description 1
- 241000936820 Vibrio cholerae non-O1 Species 0.000 description 1
- 206010066969 Vitello-intestinal duct remnant Diseases 0.000 description 1
- 206010047700 Vomiting Diseases 0.000 description 1
- 208000021146 Warthin tumor Diseases 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 210000000683 abdominal cavity Anatomy 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 239000003082 abrasive agent Substances 0.000 description 1
- 229960005054 acepromazine Drugs 0.000 description 1
- NOSIYYJFMPDDSA-UHFFFAOYSA-N acepromazine Chemical compound C1=C(C(C)=O)C=C2N(CCCN(C)C)C3=CC=CC=C3SC2=C1 NOSIYYJFMPDDSA-UHFFFAOYSA-N 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 201000004471 adenofibroma Diseases 0.000 description 1
- 208000018234 adnexal spiradenoma/cylindroma of a sweat gland Diseases 0.000 description 1
- 230000001919 adrenal effect Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000005273 aeration Methods 0.000 description 1
- 230000016571 aggressive behavior Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 108010087924 alanylproline Proteins 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 206010053552 allodynia Diseases 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 208000010029 ameloblastoma Diseases 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 229960002684 aminocaproic acid Drugs 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 201000009431 angiokeratoma Diseases 0.000 description 1
- 208000000252 angiomatosis Diseases 0.000 description 1
- 150000008064 anhydrides Chemical class 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 230000036506 anxiety Effects 0.000 description 1
- 230000036528 appetite Effects 0.000 description 1
- 235000019789 appetite Nutrition 0.000 description 1
- ATALOFNDEOCMKK-OITMNORJSA-N aprepitant Chemical compound O([C@@H]([C@@H]1C=2C=CC(F)=CC=2)O[C@H](C)C=2C=C(C=C(C=2)C(F)(F)F)C(F)(F)F)CCN1CC1=NNC(=O)N1 ATALOFNDEOCMKK-OITMNORJSA-N 0.000 description 1
- 229960001372 aprepitant Drugs 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 108010062796 arginyllysine Proteins 0.000 description 1
- 210000001815 ascending colon Anatomy 0.000 description 1
- JHLHNYVMZCADTC-LOSJGSFVSA-N asimadoline Chemical compound C([C@@H](N(C)C(=O)C(C=1C=CC=CC=1)C=1C=CC=CC=1)C=1C=CC=CC=1)N1CC[C@H](O)C1 JHLHNYVMZCADTC-LOSJGSFVSA-N 0.000 description 1
- 229950002202 asimadoline Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 108010092854 aspartyllysine Proteins 0.000 description 1
- 208000006673 asthma Diseases 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 210000000467 autonomic pathway Anatomy 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 210000000270 basal cell Anatomy 0.000 description 1
- 208000001119 benign fibrous histiocytoma Diseases 0.000 description 1
- 208000021592 benign granular cell tumor Diseases 0.000 description 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 1
- 102000016959 beta-3 Adrenergic Receptors Human genes 0.000 description 1
- 108010014502 beta-3 Adrenergic Receptors Proteins 0.000 description 1
- 229940000635 beta-alanine Drugs 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 239000012148 binding buffer Substances 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 239000012496 blank sample Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 125000006278 bromobenzyl group Chemical group 0.000 description 1
- 210000000621 bronchi Anatomy 0.000 description 1
- 206010006451 bronchitis Diseases 0.000 description 1
- 239000000480 calcium channel blocker Substances 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 1
- 208000005761 carcinoid heart disease Diseases 0.000 description 1
- 208000002458 carcinoid tumor Diseases 0.000 description 1
- 229940082638 cardiac stimulant phosphodiesterase inhibitors Drugs 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 239000013553 cell monolayer Substances 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 201000003340 cellular leiomyoma Diseases 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 201000005217 chondroblastoma Diseases 0.000 description 1
- 208000009060 clear cell adenocarcinoma Diseases 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 206010009887 colitis Diseases 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 208000012839 conversion disease Diseases 0.000 description 1
- 230000036461 convulsion Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000012043 crude product Substances 0.000 description 1
- 201000010305 cutaneous fibrous histiocytoma Diseases 0.000 description 1
- 125000004093 cyano group Chemical group *C#N 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 108010016616 cysteinylglycine Proteins 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000013872 defecation Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000018044 dehydration Effects 0.000 description 1
- 238000006297 dehydration reaction Methods 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 239000000551 dentifrice Substances 0.000 description 1
- 201000009101 diabetic angiopathy Diseases 0.000 description 1
- 201000002249 diabetic peripheral angiopathy Diseases 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- MNNHAPBLZZVQHP-UHFFFAOYSA-N diammonium hydrogen phosphate Chemical compound [NH4+].[NH4+].OP([O-])([O-])=O MNNHAPBLZZVQHP-UHFFFAOYSA-N 0.000 description 1
- 229910000388 diammonium phosphate Inorganic materials 0.000 description 1
- 229960004132 diethyl ether Drugs 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 230000001079 digestive effect Effects 0.000 description 1
- 208000024558 digestive system cancer Diseases 0.000 description 1
- 208000019836 digestive system infectious disease Diseases 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 210000003027 ear inner Anatomy 0.000 description 1
- 238000013156 embolectomy Methods 0.000 description 1
- 210000003890 endocrine cell Anatomy 0.000 description 1
- 208000030172 endocrine system disease Diseases 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 210000000105 enteric nervous system Anatomy 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 210000003608 fece Anatomy 0.000 description 1
- 239000012526 feed medium Substances 0.000 description 1
- 206010016629 fibroma Diseases 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 239000004088 foaming agent Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 229960003692 gamma aminobutyric acid Drugs 0.000 description 1
- 201000008361 ganglioneuroma Diseases 0.000 description 1
- 230000030136 gastric emptying Effects 0.000 description 1
- 201000010231 gastrointestinal system cancer Diseases 0.000 description 1
- 238000003304 gavage Methods 0.000 description 1
- 239000012362 glacial acetic acid Substances 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003365 glass fiber Substances 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 201000005626 glomangioma Diseases 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 description 1
- 108010078144 glutaminyl-glycine Proteins 0.000 description 1
- 229960002449 glycine Drugs 0.000 description 1
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 1
- 108010036960 glycyl-beta-alanine Proteins 0.000 description 1
- 229940043257 glycylglycine Drugs 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229910052736 halogen Inorganic materials 0.000 description 1
- 150000002367 halogens Chemical class 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000010370 hearing loss Effects 0.000 description 1
- 231100000888 hearing loss Toxicity 0.000 description 1
- 208000016354 hearing loss disease Diseases 0.000 description 1
- 201000011066 hemangioma Diseases 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 201000009379 histiocytoid hemangioma Diseases 0.000 description 1
- 201000008298 histiocytosis Diseases 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- 201000001421 hyperglycemia Diseases 0.000 description 1
- 230000009610 hypersensitivity Effects 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006882 induction of apoptosis Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000003914 insulin secretion Effects 0.000 description 1
- 108010056777 interleukin-2 (59-72) Proteins 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- VBUWHHLIZKOSMS-RIWXPGAOSA-N invicorp Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)C(C)C)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 VBUWHHLIZKOSMS-RIWXPGAOSA-N 0.000 description 1
- 150000002496 iodine Chemical class 0.000 description 1
- 230000019948 ion homeostasis Effects 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 208000023569 ischemic bowel disease Diseases 0.000 description 1
- 201000008222 ischemic colitis Diseases 0.000 description 1
- 201000002529 islet cell tumor Diseases 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 229960003299 ketamine Drugs 0.000 description 1
- HQBZLVPZOGIAIQ-SDDDUWNISA-N ketazocine Chemical compound N1([C@H]2[C@@H]([C@](CC1)(C)C=1C(=CC=C(O)C=1)C2=O)C)CC1CC1 HQBZLVPZOGIAIQ-SDDDUWNISA-N 0.000 description 1
- 208000017169 kidney disease Diseases 0.000 description 1
- 150000003951 lactams Chemical class 0.000 description 1
- 210000002429 large intestine Anatomy 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 229950008325 levothyroxine Drugs 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 229950008874 lirexapride Drugs 0.000 description 1
- 210000003750 lower gastrointestinal tract Anatomy 0.000 description 1
- WGFOBBZOWHGYQH-MXHNKVEKSA-N lubiprostone Chemical compound O1[C@](C(F)(F)CCCC)(O)CC[C@@H]2[C@@H](CCCCCCC(O)=O)C(=O)C[C@H]21 WGFOBBZOWHGYQH-MXHNKVEKSA-N 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 230000000527 lymphocytic effect Effects 0.000 description 1
- 108010077127 lymphoguanylin Proteins 0.000 description 1
- 125000005439 maleimidyl group Chemical class C1(C=CC(N1*)=O)=O 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 208000008585 mastocytosis Diseases 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 208000004840 megacolon Diseases 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000006984 memory degeneration Effects 0.000 description 1
- 208000023060 memory loss Diseases 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 210000000716 merkel cell Anatomy 0.000 description 1
- 208000004197 mesenchymoma Diseases 0.000 description 1
- 208000011831 mesonephric neoplasm Diseases 0.000 description 1
- 230000004066 metabolic change Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- CSHFHJNMIMPJST-HOTGVXAUSA-N methyl (2s)-2-[[(2s)-2-[[2-[(2-aminoacetyl)amino]acetyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoate Chemical compound NCC(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)OC)CC1=CC=CC=C1 CSHFHJNMIMPJST-HOTGVXAUSA-N 0.000 description 1
- KXKVLQRXCPHEJC-UHFFFAOYSA-N methyl acetate Chemical compound COC(C)=O KXKVLQRXCPHEJC-UHFFFAOYSA-N 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 229960004085 mosapride Drugs 0.000 description 1
- 229950002910 motapizone Drugs 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 210000003097 mucus Anatomy 0.000 description 1
- 201000002077 muscle cancer Diseases 0.000 description 1
- 201000004130 myoblastoma Diseases 0.000 description 1
- 208000009091 myxoma Diseases 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- NGCNKEZHGRXHNL-WVWQGFTISA-N n-[(2r,3r,4r,5s,6r)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-[(1s,4s,7s,10s,13s,16s)-13-benzyl-16-(1h-indol-3-ylmethyl)-7-(2-methylpropyl)-3,6,9,12,15,18,20-heptaoxo-2,5,8,11,14,17,21-heptazabicyclo[8.8.4]docosan-4-yl]acetamide Chemical compound C([C@H]1C(=O)N[C@H]2CC(=O)NC[C@H](NC(=O)[C@H](CC=3C=CC=CC=3)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC2=O)C(=O)N[C@H](C(N1)=O)CC(C)C)C(=O)N[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1NC(C)=O NGCNKEZHGRXHNL-WVWQGFTISA-N 0.000 description 1
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 201000003631 narcolepsy Diseases 0.000 description 1
- 239000003887 narcotic antagonist Substances 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 229950000640 nepadutant Drugs 0.000 description 1
- 201000008383 nephritis Diseases 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 208000029986 neuroepithelioma Diseases 0.000 description 1
- 230000003040 nociceptive effect Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 208000004128 odontoma Diseases 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 208000008798 osteoma Diseases 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 101800002712 p27 Proteins 0.000 description 1
- 208000022102 pancreatic neuroendocrine neoplasm Diseases 0.000 description 1
- 208000019906 panic disease Diseases 0.000 description 1
- 208000003154 papilloma Diseases 0.000 description 1
- 208000007312 paraganglioma Diseases 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 108010026901 peptide 106 Proteins 0.000 description 1
- 108010009779 peptide 32 Proteins 0.000 description 1
- 108010011990 peptide 74 Proteins 0.000 description 1
- YYCZLGUOLIWZAW-GVETXGJZSA-N peptide 75 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)C(C)C)C1=CC=CC=C1 YYCZLGUOLIWZAW-GVETXGJZSA-N 0.000 description 1
- 108010012038 peptide 78 Proteins 0.000 description 1
- 229940125863 peptide 78 Drugs 0.000 description 1
- 239000000813 peptide hormone Substances 0.000 description 1
- 108010011903 peptide receptors Proteins 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 239000008024 pharmaceutical diluent Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N phenol group Chemical group C1(=CC=CC=C1)O ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 230000001817 pituitary effect Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920001610 polycaprolactone Polymers 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 208000015768 polyposis Diseases 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- 229910001414 potassium ion Inorganic materials 0.000 description 1
- GUUBJKMBDULZTE-UHFFFAOYSA-M potassium;2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid;hydroxide Chemical compound [OH-].[K+].OCCN1CCN(CCS(O)(=O)=O)CC1 GUUBJKMBDULZTE-UHFFFAOYSA-M 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 108010090894 prolylleucine Proteins 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 208000002815 pulmonary hypertension Diseases 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 210000001187 pylorus Anatomy 0.000 description 1
- 238000005173 quadrupole mass spectroscopy Methods 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000003653 radioligand binding assay Methods 0.000 description 1
- 238000001525 receptor binding assay Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000000611 regression analysis Methods 0.000 description 1
- 230000015721 regulation of epithelial cell proliferation Effects 0.000 description 1
- 229950003039 renzapride Drugs 0.000 description 1
- GZSKEXSLDPEFPT-IINYFYTJSA-N renzapride Chemical compound COC1=CC(N)=C(Cl)C=C1C(=O)N[C@H]1[C@H](C2)CCC[N@]2CC1 GZSKEXSLDPEFPT-IINYFYTJSA-N 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000001850 reproductive effect Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 201000007416 salivary gland adenoid cystic carcinoma Diseases 0.000 description 1
- PGKXDIMONUAMFR-AREMUKBSSA-N saredutant Chemical compound C([C@H](CN(C)C(=O)C=1C=CC=CC=1)C=1C=C(Cl)C(Cl)=CC=1)CN(CC1)CCC1(NC(C)=O)C1=CC=CC=C1 PGKXDIMONUAMFR-AREMUKBSSA-N 0.000 description 1
- 229950004387 saredutant Drugs 0.000 description 1
- 206010039667 schwannoma Diseases 0.000 description 1
- 239000000932 sedative agent Substances 0.000 description 1
- 230000001624 sedative effect Effects 0.000 description 1
- 230000035807 sensation Effects 0.000 description 1
- 239000003369 serotonin 5-HT3 receptor antagonist Substances 0.000 description 1
- 239000000387 serotonin 5-HT4 receptor agonist Substances 0.000 description 1
- 229920002379 silicone rubber Polymers 0.000 description 1
- 239000004945 silicone rubber Substances 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 201000002859 sleep apnea Diseases 0.000 description 1
- 208000019116 sleep disease Diseases 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- ADNPLDHMAVUMIW-CUZNLEPHSA-N substance P Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(N)=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CCCN=C(N)N)C1=CC=CC=C1 ADNPLDHMAVUMIW-CUZNLEPHSA-N 0.000 description 1
- 150000003457 sulfones Chemical class 0.000 description 1
- 230000002483 superagonistic effect Effects 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 230000002381 testicular Effects 0.000 description 1
- WROMPOXWARCANT-UHFFFAOYSA-N tfa trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 1
- 208000001644 thecoma Diseases 0.000 description 1
- 150000007970 thio esters Chemical class 0.000 description 1
- 150000003568 thioethers Chemical class 0.000 description 1
- 210000000115 thoracic cavity Anatomy 0.000 description 1
- 231100000886 tinnitus Toxicity 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 229940035722 triiodothyronine Drugs 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 210000001364 upper extremity Anatomy 0.000 description 1
- 210000002438 upper gastrointestinal tract Anatomy 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 210000002229 urogenital system Anatomy 0.000 description 1
- SJMPVWVIVWEWJK-AXEIBBKLSA-N uroguanylin Chemical compound SC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CS)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCC(N)=O SJMPVWVIVWEWJK-AXEIBBKLSA-N 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 239000000085 vanilloid receptor antagonist Substances 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 238000009423 ventilation Methods 0.000 description 1
- 231100000889 vertigo Toxicity 0.000 description 1
- 229950005485 vofopitant Drugs 0.000 description 1
- 230000008673 vomiting Effects 0.000 description 1
- REZGGXNDEMKIQB-UHFFFAOYSA-N zaprinast Chemical compound CCCOC1=CC=CC=C1C1=NC(=O)C2=NNNC2=N1 REZGGXNDEMKIQB-UHFFFAOYSA-N 0.000 description 1
- 229950005371 zaprinast Drugs 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/10—Peptides having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/08—Drugs for disorders of the alimentary tract or the digestive system for nausea, cinetosis or vertigo; Antiemetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/10—Laxatives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/12—Antidiarrhoeals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/14—Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/08—Drugs for disorders of the urinary system of the prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/10—Drugs for genital or sexual disorders; Contraceptives for impotence
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/04—Centrally acting analgesics, e.g. opioids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/18—Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/20—Hypnotics; Sedatives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/22—Anxiolytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/24—Antidepressants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/16—Otologicals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/12—Drugs for disorders of the metabolism for electrolyte homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/48—Drugs for disorders of the endocrine system of the pancreatic hormones
- A61P5/50—Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/10—Antioedematous agents; Diuretics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/04—Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/24—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
- C07K14/245—Escherichia (G)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- This invention relates to methods and compositions for treating various disorders, including gastrointestinal disorders, obesity, congestive heart failure and benign prostatic hyperplasia.
- IBS Irritable bowel syndrome
- c-IBS constipation-predominant
- d-IBS diarrhea-predominant
- a-IBS alternating between the two
- IBS is considered to be a “biopsychosocial” disorder resulting from a combination of three interacting mechanisms: altered bowel motility, an increased sensitivity of the intestine or colon to pain stimuli (visceral sensitivity) and psychosocial factors (Camilleri 2001, Gastroenterology 120:652-668).
- NO inducible nitric oxide
- iNOS synthase
- the present invention features compositions and related methods for treating IBS and other gastrointestinal disorders and conditions (e.g., gastrointestinal motility disorders, functional gastrointestinal disorders, gastroesophageal reflux disease (GERD), Crohn's disease, ulcerative colitis, Inflammatory bowel disease, functional heartburn, dyspepsia (including functional dyspepsia or nonulcer dyspepsia), gastroparesis, chronic intestinal pseudo-obstruction (or colonic pseudo-obstruction), and disorders and conditions associated with constipation, e.g., constipation associated with use of opiate pain killers, post-surgical constipation, and constipation associated with neuropathic disorders as well as other conditions and disorders.
- the compositions feature peptides that activate the guanylate cyclase C (GC—C) receptor.
- GC—C guanylate cyclase C
- the present invention also features compositions and related methods for treating obesity, congestive heart failure and benign prostatic hyperplasia (BPH).
- BPH benign prostatic hyperplasia
- the peptides are useful because they can increase gastrointestinal motility.
- the peptides are useful, in part, because they can decrease inflammation.
- the peptides are also useful because they can decrease gastrointestinal pain or visceral pain.
- the invention features pharmaceutical compositions comprising certain peptides that are capable of activating the guanylate-cyclase C (GC—C) receptor. Also within the invention are pharmaceutical compositions comprising a peptide of the invention as well as combination compositions comprising a peptide of the invention and a second therapeutic agent, e.g., an agent for treating constipation (e.g., SPI-0211; Sucampo Pharmaceuticals, Inc.; Bethesda, Md.) or some other gastrointestinal disorder.
- a second therapeutic agent include: acid reducing agents such as proton pump inhibitors and H2 receptor blockers, pro-motility agents such as 5HT receptor agonists (e.g.
- Zelnorm® anti-inflammatory agents
- antispasmodics antidepressants
- centrally-acting analgesic agents such as opiod receptor agonists, opiod receptor antagonists, agents for the treatment of Inflammatory bowel disease, Crohn's disease and ulcerative colitis (e.g., Traficet-ENTM (ChemoCentryx, Inc.; San Carlos, Calif.) agents that treat gastrointestinal or visceral pain and cGMP phosphodiesterase inhibitors (motapizone, zaprinast, and suldinac sulfone).
- the pharmaceutical compositions can include an analgesic agent selected from the group consisting of: Ca channel blockers (e.g., ziconotide), 5HT receptor antagonists (for example 5HT3, 5HT4 and 5HT1 receptor antagonists), opioid receptor agonists (e.g., loperamide, fedotozine, and fentanyl, naloxone, naltrexone, methyl nalozone, nalmefene, cypridime, beta funaltrexamine, naloxonazine, naltrindole, and nor-binaltorphimine, morphine, diphenyloxylate, enkephalin pentapeptide, and trimebutine), NK1 receptor antagonists (e.g., ezlopitant and SR-14033), CCK receptor agonists (e.g., loxiglumide), NK1 receptor antagonists, NK3 receptor antagonists (e.g., talnetant,
- the invention includes methods for treating various gastrointestinal disorders by administering a peptide that acts as a partial or complete agonist of the GC—C receptor.
- the peptide includes at least six cysteines that form three disulfide bonds. In certain embodiments the disulfide bonds are replaced by other covalent cross-links and in some cases the cysteines are substituted by other residues to provide for alternative covalent cross-links.
- the peptides may also include at least one trypsin or chymotrypsin cleavage site and/or a carboxy-terminal analgesic peptide or small molecule, e.g., AspPhe or some other analgesic peptide.
- the analgesic peptide or small molecule may be preceded by a chymotrypsin or trypsin cleavage site that allows release of the analgesic peptide or small molecule.
- the peptides and methods of the invention are also useful for treating pain and inflammation associated with various disorders, including gastrointestinal disorders.
- Certain peptides include a functional chymotrypsin or trypsin cleavage site located so as to allow inactivation of the peptide upon cleavage.
- Certain peptides having a functional cleavage site undergo cleavage and gradual inactivation in the digestive tract, and this is desirable in some circumstances.
- a functional chymotrypsin site is altered, increasing the stability of the peptide in vivo.
- the invention includes methods for treating other disorders such as congestive heart failure and benign prostatic hyperplasia by administering a peptide or small molecule (parenterally or orally) that acts as an agonist of the GC—C receptor.
- a peptide or small molecule parenterally or orally
- Such agents can be used in combination with natriuretic peptides (e.g., atrial natriuretic peptide, brain natriuretic peptide or C-type natriuretic peptide), a diuretic, or an inhibitor of angiotensin converting enzyme.
- the invention features methods and compositions for increasing intestinal motility.
- Intestinal motility involves spontaneous coordinated dissentions and contractions of the stomach, intestines, colon and rectum to move food through the gastrointestinal tract during the digestive process.
- the peptides include either one or two or more contiguous negatively charged amino acids (e.g., Asp or Glu) or one or two or more contiguous positively charged residues (e.g., Lys or Arg) or one or two or more contiguous positively or negatively charged amino acids at the carboxy terminus.
- all of the flanking amino acids at the carboxy terminus are either positively or negatively charged.
- the carboxy terminal charged amino acids are preceded by a Leu.
- amino acid sequences can be added to the carboxy terminus of the peptide: Asp; Asp Lys; Lys Lys Lys Lys Lys Lys Lys Lys (SEQ ID NO:123); Asp Lys Lys Lys Lys Lys (SEQ ID NO:124); Leu Lys Lys; and Leu Asp. It is also possible to simply add Leu at the carboxy terminus.
- the invention features a peptide comprising, consisting of, or consisting essentially of the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xa4 Xaa 5 is Asn Ser Ser Asn Tyr (SEQ ID NO:121) or is missing or Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing.
- Xaa 8 , Xaa 9 , Xaa 12 , Xaa 13 , Xaa 14 , Xaa 17 , and Xaa 19 can be any amino acid.
- Xaa 5 is Asn, Trp, Tyr, Asp, or Phe.
- Xaa 5 can also be Thr or Ile.
- Xaa 5 is Tyr, Asp or Trp.
- Xaa 8 is Glu, Asp, Gln, Gly or Pro.
- Xaa 8 is Glu; in some embodiments Xaa 9 is Leu, Ile, Val, Ala, Lys, Arg, Trp, Tyr or Phe in some embodiments Xaa 9 is Leu, Ile, Val, Lys, Arg, Trp, Tyr or Phe.
- an amino acid can be replace by a non-naturally occurring amino acid or a naturally or non-naturally occurring amino acid analog.
- an aromatic amino acid can be replaced by 3,4-dihydroxy-L-phenylalanine, 3-iodo-L-tyrosine, triiodothyronine, L-thyroxine, phenylglycine (Phg) or nor-tyrosine (norTyr).
- Phg and norTyr and other amino acids including Phe and Tyr can be substituted by, e.g., a halogen, —CH3, —OH, —CH 2 NH 3 , —C(O)H, —CH 2 CH 3 , —CN, —CH 2 CH 2 CH 3 , —SH, or another group.
- Xaa 12 is Asn, Tyr, Asp or Ala. In other embodiments Xaa 12 is Asn. In some embodiments Xaa 13 is Ala, Pro or Gly, and in other embodiments it is Pro. In some embodiments Xaa 14 is Ala, Leu, Ser, Gly, Val, Glu, Gln, Ile, Leu, Lys, Arg, or Asp, and in other embodiments it is Ala or Gly, and in still other embodiments it is Ala.
- the invention also features methods for treating a gastrointestinal disorder (e.g., a gastrointestinal motility disorder, a functional gastrointestinal disorder, gastroesophageal reflux disease, functional heartburn, dyspepsia, functional dyspepsia, nonulcer dyspepsia, gastroparesis, chronic intestinal pseudo-obstruction, colonic pseudo-obstruction), obesity, congestive heart failure or benign prostatic hyperplasia by administering a composition comprising an aforementioned peptide
- a gastrointestinal disorder e.g., a gastrointestinal motility disorder, a functional gastrointestinal disorder, gastroesophageal reflux disease, functional heartburn, dyspepsia, functional dyspepsia, nonulcer dyspepsia, gastroparesis, chronic intestinal pseudo-obstruction, colonic pseudo-obstruction
- a gastrointestinal disorder e.g., a gastrointestinal motility disorder, a functional gastrointestinal disorder, gastroesophageal reflux disease, functional heartburn
- Xaa 9 is Trp, Tyr or Phe or when Xaa 16 is Trp the peptide has a potentially functional chymotrypsin cleavage site that is located at a position where cleavage will inactivate GC—C receptor binding by the peptide.
- Xaa 9 is Lys or Arg or when Xaa 16 is Lys or Arg, the peptide has a potentially functional trypsin cleavage site that is located at a position where cleavage will inactivate GC—C receptor binding by the peptide.
- the peptide has a chymotrypsin cleavage site that is located at a position where cleavage will liberate the portion of the peptide carboxy-terminal to Xaa 19 .
- the peptide can have a chymotrypsin cleavage site that is located at a position where cleavage will liberate the portion of the peptide amino-terminal to Xaa 19 .
- the same effect is seen when Xaa 19 is His.
- the peptide When Xaa 19 is Lys or Arg, the peptide has a trypsin cleavage site that is located at a position where cleavage will liberate portion of the peptide carboxy-terminal to Xaa 19 . Thus, if the peptide includes an analgesic peptide carboxy-terminal to Xaa 19 , the peptide will be liberated in the digestive tract upon exposure to the appropriate protease.
- analgesic peptides which can be included in the peptide are: AspPhe (as Xaa 20 Xaa 21 ), endomorphin-1, endomorphin-2, nocistatin, dalargin, lupron, and substance P and other analgesic peptides described herein. These peptides can, for example, be used to replace Xaa 20 Xaa 21 .
- the peptide has a chymotrypsin cleavage site that is located at a position where cleavage will liberate the portion of the peptide amino-terminal to Xaa 1 (or Xaa 2 or Xaa 3 ) along with Xaa 1 , Xaa 2 or Xaa 3 .
- the peptide has a trypsin cleavage site that is located at a position where cleavage will liberate portion of the peptide amino-terminal to Xaa 1 along with Xaa 1 , Xaa 2 or Xaa 3 ).
- the peptide can have a chymotrypsin cleavage site that is located at a position where cleavage will liberate the portion of the peptide amino-terminal to Xaa 1 .
- the peptide includes an analgesic peptide amino-terminal to Xaa 1 , the peptide will be liberated in the digestive tract upon exposure to the, appropriate protease.
- analgesic peptides which can be included in the peptide are: AspPhe, endomorphin-1, endomorphin-2, nocistatin, dalargin, lupron, and substance p and other analgesic peptides described herein.
- the peptides of the invention bear some sequence similarity to ST peptides. However, they include amino acid changes and/or additions that improve functionality. These changes can, for example, increase or decrease activity (e.g., increase or decrease the ability of the peptide to stimulate intestinal motility), alter the ability of the peptide to fold correctly, the stability of the peptide, the ability of the peptide to bind the GC—C receptor and/or decrease toxicity. In some cases the peptides may function more desirably than wild-type ST peptide. For example, they may limit undesirable side effects such as diarrhea and dehydration.
- one or both members of one or more pairs of Cys residues which normally form a disulfide bond can be replaced by homocysteine, 3-mercaptoproline (Kolodziej et al. 1996 Int J Pept Protein Res 48:274); ⁇ , ⁇ dimethylcysteine (Hunt et al. 1993 Int J Pept Protein Res 42:249) or diaminopropionic acid (Smith et al. 1978 J Med Chem 21:117) to form alternative internal cross-links at the positions of the normal disulfide bonds.
- one or more disulfide bonds can be replaced by alternative covalent cross-links, e.g., an amide bond, an ester linkage, an alkyl linkage, a thio ester linkage, a lactam bridge, a carbamoyl linkage, a urea linkage, a thiourea linkage, a phosphonate ester linkage, an alkyl linkage, and alkenyl linkage, an ether, a thioether linkage, or an amino linkage.
- alternative covalent cross-links e.g., an amide bond, an ester linkage, an alkyl linkage, a thio ester linkage, a lactam bridge, a carbamoyl linkage, a urea linkage, a thiourea linkage, a phosphonate ester linkage, an alkyl linkage, and alkenyl linkage, an ether, a thioether linkage, or an amino
- the peptide can include an amino terminal sequence that facilitates recombinant production of the peptide and is cleaved prior to administration of the peptide to a patient.
- the peptide can also include other amino terminal or carboxyterminal amino acids.
- the additional amino acids protect the peptide, stabilize the peptide or alter the activity of the peptide.
- some or all of these additional amino acids are removed prior to administration of the peptide to a patient.
- the peptide can include 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, 60, 70 80, 90, 100 or more amino acids at its amino terminus or carboxy terminus or both.
- the number of flanking amino acids need not be the same. For example, there can be 10 additional amino acids at the amino terminus of the peptide and none at the carboxy terminus.
- the peptide comprises the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is missing; Xaa 8 is Glu; Xaa 9 is Leu, Ile, Lys, Arg, Trp, Tyr or Phe; Xaa 12 is Asn; Xaa 13 is Pro; Xaa 14 is Ala; Xaa 16 is Thr, Ala, Lys, Arg, Trp; Xaa 17 is Gly; Xaa 19 is Tyr or Leu; and
- the invention also features a therapeutic or prophylactic method comprising administering a peptide comprising the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is Asn Ser Ser Asn Tyr (SEQ ID NO:121) or is missing or Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn, Trp, Tyr, Asp, Ile, Thr, or Phe; Xaa 8 is Glu, Asp, Gln, Gly or Pro
- the peptide comprises the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is missing; Xaa 8 is Glu; Xaa 9 is Leu, Ile, Lys, Arg, Trp, Tyr, or Phe; Xaa 12 is Asn; Xaa 13 is Pro; Xaa 14 is Ala; Xaa 16 is Thr, Ala, Lys, Arg, Trp or Xaa 16 is any amino acid or
- the invention features, a purified polypeptide comprising the amino acid sequence (II):
- Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is Asn Ser Ser Asn Tyr (SEQ ID NO:121) or is missing or Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn;
- Xaa 8 is Glu or Asp
- Xaa 9 is Leu, Ile, Val, Trp, Tyr or Phe;
- Xaa 16 is Thr, Ala, Trp;
- Xaa 19 is Trp, Tyr, Phe or Leu or is missing; and Xaa 20 Xaa 21 is AspPhe.
- the invention features a purified polypeptide comprising the amino acid sequence (II): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Asn 12 Pro 13 Ala 14 Cys 15 Xaa 16 Gly 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:120) wherein, Xaa 9 is Leu, Ile or Val and Xaa 16 is Trp, Tyr or Phe; Xaa 9 is Trp, Tyr or Phe, and Xaa 16 is Thr or Ala; Xaa 19 is Trp, Tyr, Phe and Xaa 20 Xaa 21 is AspPhe; and Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn; the peptide comprises fewer than 50, 40,
- the peptides can be co-administered with or linked, e.g., covalently linked to any of a variety of other peptides including analgesic peptides or analgesic compounds.
- a therapeutic peptide of the invention can be linked to an analgesic agent selected from the group consisting of: Ca channel blockers (e.g., ziconotide), complete or partial 5HT receptor antagonists (for example 5HT3, 5HT4 and 5HT1 receptor antagonists), complete or partial 5HT receptor agonists including 5HT3, 5HT4 (for example tegaserod, mosapride and renzapride) and 5HT1 receptor agonists, CRF receptor agonists (NBI-34041), ⁇ -3 adrenoreceptor agonists, opioid receptor agonists (e.g., loperamide, fedotozine, and fentanyl, naloxone, naltrexone, methyl nalozone,
- Amino acid, non-amino acid, peptide and non-peptide spacers can be interposed between a peptide that is a GC—C receptor agonsit and a peptide that has some other biological function, e.g., an analgesic peptide or a peptide used to treat obesity.
- the linker can be one that is cleaved from the flanking peptides in vivo or one that remains linked to the flanking peptides in vivo.
- glycine, beta-alanine, glycyl-glycine, glycyl-beta-alanine, gamma-aminobutyric acid, 6-aminocaproic acid, L-phenylalanine, L-tryptophan and glycil-L-valil-L-phenylalanine can be used as a spacer (Chaltin et al. 2003 Helvetica Chimica Acta 86:533-547; Caliceti et al. 1993 FARMCO 48:919-32) as can polyethylene glycols (Butterworth et al. 1987 J. Med. Chem 30:1295-302) and maleimide derivatives (King et al.
- the peptides can include the amino acid sequence of a peptide that occurs naturally in a vertebrate (e.g., mammalian) species or in a bacterial species.
- the peptides can be partially or completely non-naturally occurring peptides.
- peptidomimetics corresponding to the peptides of the invention.
- the patient is suffering from a gastrointestinal disorder; the patient is suffering from a disorder selected from the group consisting of: a gastrointestinal motility disorder, irritable bowel syndrome, chronic constipation, a functional gastrointestinal disorder, gastroesophageal reflux disease, functional heartburn, dyspepsia, functional dyspepsia, nonulcer dyspepsia, gastroparesis, chronic intestinal pseudo-obstruction, Crohn's disease, ulcerative colitis, Irritable bowel syndrome, colonic pseudo-obstruction, obesity, congestive heart failure, or benign prostatic hyperplasia; the composition is administered orally; the peptide comprises 30 or fewer amino acids, the peptide comprises 20 or fewer amino acids, and the peptide comprises no more than 5 amino acids prior to Cys 6 ; the peptide comprises 150, 140, 130, 120, 110, 100, 90, 80, 70, 60, 50, 40, or 30 or fewer amino acids.
- the peptide comprises 20 or fewer amino acids. In other embodiments the peptide comprises no more than 20, 15, 10, or 5 peptides subsequent to Cys 18 .
- Xaa 19 is a chymotrypsin or trypsin cleavage site and an analgesic peptide is present immediately following Xaa 19 .
- the invention features a method for treating a patient suffering from constipation.
- Clinically accepted criteria that define constipation range from the frequency of bowel movements, the consistency of feces and the ease of bowel movement.
- One common definition of constipation is less than three bowel movements per week.
- Other definitions include abnormally hard stools or defecation that requires excessive straining (Schiller 2001, Aliment Pharmacol Ther 15:749-763).
- Constipation may be idiopathic (functional constipation or slow transit constipation) or secondary to other causes including neurologic, metabolic or endocrine disorders.
- Constipation may also be the result of surgery (postoperative ileus) or due to the use of drugs such as analgesics (like opiods), antihypertensives, anticonvulsants, antidepressants, antispasmodics and antipsychotics.
- the method comprising administering a composition comprising a purified polypeptide comprising the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is Asn Ser Ser Asn Tyr (SEQ ID NO:121) or is missing or Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn, Trp, Tyr, Asp, Ile, Thr, or Phe; Xaa 8 is Glu, Asp, Gln, Gly or Pro; Xa
- the peptide comprises the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is missing; Xaa 8 is Glu; Xaa 9 is Leu, Ile, Lys, Arg, Trp, Tyr or Phe; Xaa 12 is Asn; Xaa 13 is Pro; Xaa 14 is Ala; Xaa 16 is Thr, Ala, Lys, Arg, Trp; Xaa 17 is Gly; Xaa 19 is Tyr or
- the constipation is associated with use of a therapeutic agent; the constipation is associated with a neuropathic disorder; the constipation is post-surgical constipation (postoperative ileus); and the constipation associated with a gastrointestinal disorder; the constipation is idiopathic (functional constipation or slow transit constipation); the constipation is associated with neuropathic, metabolic or endocrine disorder (e.g., diabetes mellitus, hypothyroidism, hyperthyroidism, hypocalcaemia, Multiple Sclerosis, Parkinson's disease, spinal cord lesions, neurofibromatosis, autonomic neuropathy, Chagas disease, Hirschsprung's disease or cystic fibrosis).
- neuropathic, metabolic or endocrine disorder e.g., diabetes mellitus, hypothyroidism, hyperthyroidism, hypocalcaemia, Multiple Sclerosis, Parkinson's disease, spinal cord lesions, neurofibromatosis, autonomic neuropathy, Chagas disease, Hirschsprung's disease or
- Constipation may also be the result of surgery (postoperative ileus) or due the use of drugs such as analgesics (e.g., opiods), antihypertensives, anticonvulsants, antidepressants, antispasmodics and antipsychotics.
- the invention features a method for treating a patient suffering a gastrointestinal disorder, the method comprising administering to the patient a composition comprising a purified polypeptide comprising the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is Asn Ser Ser Asn Tyr (SEQ ID NO:121) or is missing or Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn, Trp, Tyr, Asp, Ile, Thr, or
- the peptide comprises the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xa 5 is missing; Xaa 8 is Glu; Xaa 9 is Leu, Ile, Lys, Arg, Trp, Tyr or Phe; Xaa 12 is Asn; Xaa 13 is Pro; Xaa 14 is Ala; Xaa 16 is Thr, Ala, Lys, Arg, Trp; Xaa 17 is Gly; Xaa 19 is Tyr or
- the patient is suffering from a gastrointestinal disorder; the patient is suffering from a disorder selected from the group consisting of: a gastrointestinal motility disorder, irritable bowel syndrome, chronic constipation, a functional gastrointestinal disorder, gastroesophageal reflux disease, functional heartburn, dyspepsia, functional dyspepsia, nonulcer dyspepsia, gastroparesis, chronic intestinal pseudo-obstruction, Crohn's disease, ulcerative colitis, Inflammatory bowel disease, colonic pseudo-obstruction, obesity, congestive heart failure, or benign prostatic hyperplasia.
- a gastrointestinal motility disorder irritable bowel syndrome
- chronic constipation a functional gastrointestinal disorder
- gastroesophageal reflux disease functional heartburn
- dyspepsia functional dyspepsia
- nonulcer dyspepsia gastroparesis
- chronic intestinal pseudo-obstruction Crohn's disease
- ulcerative colitis ulcerative colitis
- Xaa 9 is Leu, Ile or Val and Xaa 16 is Trp, Tyr or Phe; Xaa 9 is Trp, Tyr or Phe and Xaa 16 is Thr or Ala; Xaa 19 is Trp, Tyr, Phe; Xaa 19 is Lys or Arg;Xaa 20 Xaa 21 is AspPhe; Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn.
- the invention features a method for increasing gastrointestinal motility in a patient, the method comprising: administering to the patient a composition comprising a purified polypeptide comprising the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is Asn Ser Ser Asn Tyr (SEQ ID NO:121) or is missing or Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn, Trp, Tyr, Asp, Ile, Thr, or
- the peptide comprises the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xa 5 is missing; Xaa 8 is Glu; Xaa 9 is Leu, Ile, Lys, Arg, Trp, Tyr or Phe; Xaa 12 is Asn; Xaa 13 is Pro; Xaa 14 is Ala; Xaa 16 is Thr, Ala, Lys, Arg, Trp; Xaa 17 is Gly; Xaa 19 is Tyr or Leu;
- the invention features a method for increasing the activity of an intestinal guanylate cyclase (GC—C) receptor in a patient, the method comprising: administering to the patient a composition comprising a purified polypeptide comprising the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is Asn Ser Ser Asn Tyr (SEQ ID NO:121) or is missing or Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn
- the peptide comprises the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xa 5 is missing; Xaa 8 is Glu; Xaa 9 is Leu, Ile, Lys, Arg, Trp, Tyr or Phe; Xaa 12 is Asn; Xaa 13 is Pro; Xaa 14 is Ala; Xaa 16 is Thr, Ala, Lys, Arg, Trp; Xaa 17 is Gly; Xaa 19 is Tyr or Leu;
- the invention features an isolated nucleic acid molecule comprising a nucleotide sequence encoding a polypeptide comprising the amino acid sequence: (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is Asn Ser Ser Asn Tyr or is missing or Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn, Trp, Tyr, Asp, Ile, Thr, or Phe; Xaa 8 is Glu, Asp, Gl
- the peptide comprises the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is missing; Xaa 8 is Glu; Xaa 9 is Leu, Ile, Lys, Arg, Trp, Tyr or Phe; Xaa 12 is Asn; Xaa 13 is Pro; Xaa 14 is Ala; Xaa 16 is Thr, Ala, Lys, Arg, Trp; Xaa 17 is Gly; Xaa 19 is Tyr or Leu;
- the invention features a method for treating constipation, the method comprising administering an agonist of the intestinal guanylate cyclase (GC—C) receptor.
- the agonist is a peptide
- the peptide includes four Cys that form two disulfide bonds
- the peptide includes six Cys that form three disulfide bonds.
- the invention features a method for treating a gastrointestinal disorder, a gastrointestinal motility disorder, irritable bowel syndrome, chronic constipation, a functional gastrointestinal disorder, gastroesophageal reflux disease, functional heartburn, dyspepsia, functional dyspepsia, nonulcer dyspepsia, gastroparesis, chronic intestinal pseudo-obstruction, colonic pseudo-obstruction, Crohn's disease, ulcerative colitis, Inflammatory bowel disease, obesity, congestive heart failure, or benign prostatic hyperplasia, the method comprising administering an agonist of the intestinal guanylate cyclase (GC—C) receptor either orally, by rectal suppository, or parenterally.
- the agonist is a peptide
- the peptide includes four Cys that form two disulfide bonds
- the peptide includes six Cys that form three disulfide bonds.
- the invention features a method for treating a gastrointestinal disorder selected from the group consisting of: a gastrointestinal motility disorder, irritable bowel syndrome, chronic constipation, a functional gastrointestinal disorder, gastroesophageal reflux disease, functional heartburn, dyspepsia, functional dyspepsia, nonulcer dyspepsia, gastroparesis, chronic intestinal pseudo-obstruction, colonic pseudo-obstruction, Crohn's disease, ulcerative colitis, Inflammatory bowel disease, the method comprising administering an agonist of the intestinal guanylate cyclase (GC—C) receptor.
- the composition is administered orally; the peptide comprises 30 or fewer amino acids, the peptide comprises 20 or fewer amino acids, and the peptide comprises no more than 5 amino acids prior to Cys 5 .
- the agonist is a peptide
- the peptide includes four Cys that form two disulfide bonds
- the peptide includes six Cys that form three disulfide bonds.
- the invention features a method for treating obesity, the method comprising administering an agonist of the intestinal guanylate cyclase (GC—C) receptor.
- the agonist is a peptide
- the peptide includes four Cys that form two disulfide bonds
- the peptide includes six Cys that form three disulfide bonds.
- the invention features a method for treating obesity, the method comprising administering a polypeptide comprising the amino acid sequence: (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is Asn Ser Ser Asn Tyr (SEQ ID NO:121) or is missing or Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn, Trp, Tyr, Asp, Ile, Thr, or Phe; Xaa 8 is Glu, Asn, Trp, Tyr, Asp, Ile,
- the peptide comprises the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is missing; Xaa 8 is Glu; Xaa 9 is Leu, Ile, Lys, Arg, Trp, Tyr or Phe; Xaa 12 is Asn; Xaa 13 is Pro; Xaa 14 is Ala; Xaa 16 is Thr, Ala, Lys, Arg, Trp; Xaa 17 is Gly; Xaa 19 is Tyr or Leu; and Xaa 20
- the invention features a pharmaceutical composition comprising a polypeptide described herein.
- the invention features a method for treating congestive heart failure, the method comprising: administering to the patient a composition comprising a purified polypeptide comprising the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID NO:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is Asn Ser Ser Asn Tyr (SEQ ID NO:121) or is missing or Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn, Trp, Tyr, Asp, Ile, Thr, or Phe
- the peptide can be administered in combination with another agent for treatment of congestive heart failure, for example, a natriuretic peptide such as atrial natriuretic peptide, brain natriuretic peptide or C-type natriuretic peptide), a diuretic, or an inhibitor of angiotensin converting enzyme.
- a natriuretic peptide such as atrial natriuretic peptide, brain natriuretic peptide or C-type natriuretic peptide
- a diuretic such as an agent for treatment of congestive heart failure
- angiotensin converting enzyme for example, a natriuretic peptide such as atrial natriuretic peptide, brain natriuretic peptide or C-type natriuretic peptide
- an inhibitor of angiotensin converting enzyme for example, a natriuretic peptide such as atrial
- the peptide comprises the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID No: 119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is missing; Xaa 8 is Glu; Xaa 9 is Leu, Ile, Lys, Arg, Trp, Tyr or Phe; Xaa 12 is Asn; Xaa 13 is Pro; Xaa 14 is Ala; Xaa 16 is Thr, Ala, Lys, Arg, Trp; Xaa 17 is Gly; Xaa 19 is Tyr or Leu;
- the invention features a method for treating benign prostatic hyperplasia, the method comprising: administering to the patient a composition comprising a purified polypeptide comprising the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID No:119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is Asn Ser Ser Asn Tyr (SEQ ID NO:121) or is missing or Xaa 1 Xaa 2 Xaa 3 Xaa 4 is missing and Xaa 5 is Asn, Trp, Tyr, Asp, Ile, Thr, or
- the peptide can be administered in combination with another agent for treatment of BPH, for example, a 5-alpha reductase inhibitor (e.g., finasteride) or an alpha adrenergic inhibitor (e.g., doxazosine).
- a 5-alpha reductase inhibitor e.g., finasteride
- an alpha adrenergic inhibitor e.g., doxazosine
- the peptide comprises the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID No: 119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is missing; Xaa 8 is Glu; Xaa 9 is Leu, Ile, Lys, Arg, Trp, Tyr or Phe; Xaa 12 is Asn; Xaa 13 is Pro; Xaa 14 is Ala; Xaa 16 is Thr, Ala, Lys, Arg, Trp; Xaa 17 is Gly; Xaa 19 is Tyr or Leu;
- the invention features a method for treating or reducing pain, including visceral pain, pain associated with a gastrointestinal disorder or pain associated with some other disorder, the method comprising: administering to a patient a composition comprising a is purified polypeptide comprising the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 , (SEQ ID No: 119) e.g., a purified polypeptide comprising an amino acid sequence disclosed herein.
- a composition comprising a is purified polypeptide comprising the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 X
- the invention features a method for treating inflammation, including inflammation of the gastrointestinal tract, e.g., inflammation associated with a gastrointestinal disorder or infection or some other disorder, the method comprising: administering to a patient a composition comprising a purified polypeptide comprising the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 , (SEQ ID No: 119) e.g., a purified polypeptide comprising an amino acid sequence disclosed herein.
- a composition comprising a purified polypeptide comprising the amino acid sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7
- the peptide includes a peptide comprising or consisting of the amino acid sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys Cys Glu Xaa 9 Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr Xaa 20 Xaa 21 (II) (SEQ ID NO:66) wherein Xaa 9 is any amino acid, wherein Xaa 9 is any amino acid other than Leu, wherein Xaa 9 is selected from Phe, Trp and Tyr; wherein Xaa 9 is selected from any other natural or non-natural aromatic amino acid, wherein Xaa 9 is Tyr; wherein Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is Asn Ser Ser Asn Tyr (SEQ ID NO:121); wherein Xaa 1 , Xaa 2 , Xaa 3 , Xaa 4 , and
- a peptide comprising the sequence (I): Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys 6 Cys 7 Xaa 8 Xaa 9 Cys 10 Cys 11 Xaa 12 Xaa 13 Xaa 14 Cys 15 Xaa 16 Xaa 17 Cys 18 Xaa 19 Xaa 20 Xaa 21 (SEQ ID No: 119) wherein: Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 is missing and/or the sequence Xaa 19 Xaa 20 Xaa 21 is missing peptide can still contain additional carboxyterminal or amino terminal amino acids or both
- peptides comprising, consisting of or consisting essentially of the amino acid sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 Xaa 5 Cys Cys Glu Xaa 9 Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr Xaa 20 Xaa 21 (II) (SEQ ID NO:66) are the following peptides: Gln Ser Ser Asn Tyr Cys Cys Glu (SEQ ID NO:67) Tyr Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr Asn Thr Ser Asn Tyr Cys Cys Glu (SEQ ID NO:68) Tyr Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr Asn Leu Ser Asn Tyr Cys Cys Glu (SEQ ID NO:69) Tyr Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr Asn Ile Ser Asn Tyr Cys Cys Glu (SEQ ID NO:66) are the following peptid
- the invention features a method for treating congestive heart failure, the method comprising administering a complete or partial agonist of the intestinal guanylate cyclase (GC—C) receptor.
- the agonist can be administered in combination with another agent for treatment of congestive heart failure, for example, a natriuretic peptide such as atrial natriuretic peptide, brain natriuretic peptide or C-type natriuretic peptide), a diuretic, or an inhibitor of angiotensin converting enzyme.
- the invention features a method for treating BPH, the method comprising administering a complete or partial agonist of the intestinal guanylate cyclase (GC—C) receptor.
- the agonist can be administered in combination with another agent for treatment of BPH, for example, a 5-alpha reductase inhibitor (e.g., finasteride) or an alpha adrenergic inhibitor (e.g., doxazosine).
- the invention features a method for treating obesity, the method comprising administering a complete or partial agonist of the intestinal guanylate cyclase (GC—C) receptor.
- GC—C intestinal guanylate cyclase
- the agonist can be administered in combination with another agent for treatment of obesity, for example, gut hormone fragment peptide YY 3-36 (PYY 3-36 )( N. Engl. J. Med.
- a peptide useful for treating obesity can be administered as a co-therapy with a peptide of the invention either as a distinct molecule or as part of a fusion protein with a peptide of the invention.
- PYY 3-36 can be fused to the carboxy or amino terminus of a peptide of the invention.
- Such a fusion protein can include a chymostrypsin or trypsin cleavage site that can permit cleavage to separate the two peptides.
- the peptides and agonist of the intestinal guanylate cyclase (GC—C) receptor can be used to treat constipation or decreased intestinal motility, slow digestion or slow stomach emptying.
- the peptides can be used to relieve one or more symptoms of IBS (bloating, pain, constipation), GERD (acid reflux into the esophagus), functional dyspepsia, or gastroparesis (nausea, vomiting, bloating, delayed gastric emptying) and other disorders described herein.
- FIG. 1 a depicts the results of LCMS analysis of recombinant MM-416776 peptide and MD-915 peptide.
- FIGS. 1 b and c depict the results of LCMS analysis of synthetic MD-1100 peptide and the blank.
- FIG. 2 depicts the results of the intestinal GC—C receptor activity assay of synthetic MM-416776 peptide, MD-915 peptide and two different MD-1100 peptides.
- FIG. 3 a depicts the effect of recombinant MM-416776 peptide and Zelnorm® in a murine gastrointestinal transit model.
- FIG. 3 b depicts the effect of synthetic MD-1100 peptide and Zelnorm® in an acute murine gastrointestinal transit model.
- FIG. 3 b depicts the effect of synthetic MD-1100 peptide and Zelnorm® in an chronic murine gastrointestinal transit model.
- FIGS. 4 a and 4 b depict the effect of peptides MD-915, MD-1100, and MM-416776 in an acute murine gastrointestinal transit model.
- FIG. 4 c depicts the effect of MD-1100 peptide in a chronic murine gastrointestinal transit model.
- FIG. 5 a depicts the effect of MM-416776 peptide and Zelnorm® in a suckling mouse intestinal secretion model.
- FIG. 5 b depicts the effects of MD-1100 and Zelnorm® in a mouse intestinal secretion model.
- FIGS. 6 a and 6 b depict the effects of MM 416776, MD-1100 and MD-915 peptides in a mouse intestinal secretion model.
- FIG. 7 shows the results of experiment in which MD-1100 activity was analyzed in the TNBS colonic distention model.
- FIGS. 8 a and 8 b show the effects of differing doses of MD-915 and MD-1100 in the PBQ writhing assay.
- FIG. 9 shows the results of Kd determination analysis using MD-1100 in a competitive radioligand binding assay.
- FIGS. 10 a and 10 b show bioavailability data for IV and orally administered MD-1100 as detected by an ELISA assay and LCMS.
- the peptides of the invention bind to the intestinal guanylate cyclase (GC—C) receptor, a key regulator of fluid and electrolyte balance in the intestine.
- GC—C intestinal guanylate cyclase
- this receptor which is located on the apical membrane of the intestinal epithelial surface, causes an increase in intestinal epithelial cyclic GMP (cGMP).
- cGMP intestinal epithelial cyclic GMP
- This increase in cGMP is believed to cause a decrease in water and sodium absorption and an increase in chloride and potassium ion secretion, leading to changes in intestinal fluid and electrolyte transport and increased intestinal motility.
- the intestinal GC—C receptor possesses an extracellular ligand binding region, a transmembrane region, an intracellular protein kinase-like region and a cyclase catalytic domain. Proposed functions for the GC—C receptor are fluid and electrolyte homeostasis, the regulation of epithelial cell proliferation and the induction of apoptosis (Shalubhai 2002 Curr Opin Drug Dis Devel 5:261-268).
- GC—C In addition to being expressed in the intestine by gastrointestinal epithelial cells, GC—C is expressed in extra-intestinal tissues including kidney, lung, pancreas, pituitary, adrenal, developing liver (reviewed in Vaandrager 2002, Mol Cell Biochem 230:73-83) and male and female reproductive tissues (reviewed in Vaandrager 2002 Mol Cell Biochem 230:73-83)) This suggests that the GC—C receptor agonists can be used in the treatment of disorders outside the GI tract, for example, congestive heart failure and benign prostatic hyperplasia.
- Ghrelin a peptide hormone secreted by the stomach, is a key regulator of appetite in humans. Ghrelin expression levels are regulated by fasting and by gastric emptying (Kim et al., 2003, Neuroreprt 14:1317-20; Gualillo et al., 2003, FEBS Letts 552: 105-9). Thus, by increasing gastrointestinal motility, GC—C receptor agonists may also be used to regulate obesity.
- the GC—C receptor is activated by guanylin (Gn) (U.S. Pat. No. 5,96,097), uroguanylin (Ugn) (U.S. Pat. No. 5,140,102) and lymphoguanylin (Forte et al., 1999, Endocrinology 140:1800-1806).
- Gn guanylin
- Ugn U.S. Pat. No. 5,140,102
- lymphoguanylin guanylin
- these agents are 10-100 fold less potent than a class of bacterially derived peptides, termed ST (reviewed in Gianella 1995 J Lab Clin Med 125:173-181).
- ST peptides are considered super agonists of GC—C and are very resistant to proteolytic degradation.
- ST peptide is capable of stimulating the enteric nervous system (Rolfe et al., 1994, J Physiolo 475: 531-537; Rolfe et al., 1999, Gut 44: 615-619; Nzegwu et al., 1996, Exp Physiol 81: 313-315).
- cGMP has been reported to have anitnociceptive effects in multiple animal models of pain (Lazaro Ibanez et al., 2001, Eur J Pharmacol 426: 39-44; Soares et al., 2001, British J Pharmacol 134: 127-131; Jain et al., 2001, Brain Res 909:170-178; Amarante et al., 2002, Eur J Pharmacol 454:19-23).
- GC—C agonists may have both an analgesic as well an anti-inflammatory effect.
- ST peptides are derived from a preproprotein that generally has at least 70 amino acids.
- the pre and pro regions are cleaved as part of the secretion process, and the resulting mature protein, which generally includes fewer than 20 amino acids, is biologically active.
- E. coli ST Ib (Moseley et al. (1983) Infect. Immun. 39:1167) having the mature amino acid sequence Asn Ser Ser Asn Tyr Cys Cys Glu Leu Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr (SEQ ID NO:1); E. coli ST Ia (So and McCarthy (1980) Proc. Natl. Acad. Sci. USA 77:4011) having the mature amino acid sequence Asn Thr Phe Tyr Cys Cys Glu Leu Cys Cys Asn Pro Ala Cys Ala Gly Cys Tyr (SEQ ID NO:2); E.
- enterocolitica ST peptides Y-ST(Y-STa), Y-STb, and Y-STc (reviewed in Huang et al. (1997) Microb. Pathog. 22:89) having the following pro-form amino acid sequences: Gln Ala Cys Asp Pro Pro Ser Pro Pro Ala Glu Val Ser Ser Asp Trp Asp Cys Cys Asp Val Cys Cys Asn Pro Ala Cys Ala Gly Cys (SEQ ID NO:5) (as well as a Ser-7 to Leu-7 variant of Y-STa (SEQ ID NO:122), (Takao et al. (1985) Eur. J. Biochem.
- kristensenii ST peptide having the mature amino acid sequence Ser Asp Trp Cys Cys Glu Val Cys Cys Asn Pro Ala Cys Ala Gly Cys (SEQ ID NO:8); V. cholerae non-01 ST peptide (Takao et al. (1985) FEBS lett. 193:250) having the mature amino acid sequence Ile Asp Cys Cys Glu Ile Cys Cys Asn Pro Ala Cys Phe Gly Cys Leu Asn (SEQ ID NO:9); and V. mimicus ST peptide (Arita (1991) et al. FEMS Microbiol. Lett.
- the immature (including pre and pro regions) form of E. coli ST-1A (ST-P) protein has the sequence: mkklmlaifisvlsfpsfsqstesldsskekitletkkcdvvknnsekksenmnntfyccelccnpacagcy (SEQ ID NO:20; see GenBank® Accession No. P01559 (gi:123711).
- the pre sequence extends from aa 1-19.
- the pro sequence extends from aa 20-54.
- the mature protein extends from 55-72.
- coli ST-1B (ST-H) protein has the sequence: mkksilfiflsvlsfspfaqdakpvesskekitleskkcniakksnksgpesmnssnyccelccnpactgcy (SEQ ID NO: 21; see GenBank® Accession No. P07965 (gi:3915589).
- enterocolitica ST protein has the sequence: mkkivfvlvlmlssfgafgqetvsgqfsdalstpitaevykqacdpplppaevssdwdccdvccnpacagc (SEQ ID NO:22) see GenBank® Accession No. S25659 (gi:282047).
- the peptides of the invention like the bacterial ST peptides, have six Cys residues. These six Cys residues form three disulfide bonds in the mature and active form of the peptide. If the six Cys residues are identified, from the amino to carboxy terminus of the peptide, as A, B, C, D, E, and F, then the disulfide bonds form as follows: A-D, B-E, and C—F. The formation of these bonds is thought to be important for GC—C receptor binding.
- Certain of the peptides of the invention include a potentially functional chymotrypsin cleavage site, e.g., a Trp, Tyr or Phe located between either Cys B and Cys D or between Cys E and Cys F. Cleavage at either chymotrypsin cleavage site reduces or eliminates the ability of the peptide to bind to the GC—C receptor.
- a potentially functional chymotrypsin cleavage site e.g., a Trp, Tyr or Phe located between either Cys B and Cys D or between Cys E and Cys F.
- chymotrypsinogen is produced in the pancreas.
- this inactive enzyme reaches the small intestine it is converted to active chymotrypsin by the excision of two di-peptides.
- Active chymotrypsin can potentially cleave peptides at the peptide bond on the carboxy-terminal side of Trp, Tyr or Phe.
- the presence of active chymotrypsin in the intestinal tract can potentially lead to cleavage of certain of the peptides of the invention having an appropriately positioned functional chymotrypsin cleavage site. It is expected that chymotrypsin cleavage will moderate the action of a peptide of the invention having an appropriately positioned chymotrypsin cleavage site as the peptide passes through the intestinal tract.
- Trypsinogen like chymotrypsin, is a serine protease that is produced in the pancreas and is present in the digestive tract.
- the active form, trypsin will cleave peptides having a Lys or Arg.
- the presence of active trypsin in the intestinal tract can lead to cleavage of certain of the peptides of the invention having an appropriately positioned functional trypsin cleavage site. It is expected that chymotrypsin cleavage will moderate the action of a peptide of the invention having an appropriately positioned trypsin cleavage site as the peptide passes through the intestinal tract.
- Certain of the peptides of the invention include analgesic or antinociceptive tags such as the carboxy-terminal sequence AspPhe immediately following a Trp, Tyr or Phe that creates a functional chymotrypsin cleavage site or following Lys or Arg that creates a functional trypsin cleavage site.
- Chymotrypsin in the intestinal tract can potentially cleave such peptides immediately carboxy terminal to the Trp, Phe or Tyr residue, releasing the dipeptide, AspPhe. This dipeptide has been shown to have analgesic activity in animal models (Abdikkahi et al.
- analgesic peptides can be present at the carboxy terminus of the peptide (following a functional cleavage site) including: endomorphin-1, endomorphin-2, nocistatin, dalargin, lupron, and substance P.
- a number of the useful peptides are based on the core sequence: Cys Cys Glu Leu Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr (SEQ ID NO:29).
- the core sequence is followed by Asp Phe.
- the carboxy terminal Tyr in the core sequence can allow the Asp Phe dipeptide to be released by chymotrypsin in the digestive tract.
- the core sequence can be optionally be preceded by Asn Ser Ser Asn Tyr or Asn.
- useful variants based on the core sequence include: Asn Ser Ser Asn Tyr Cys Cys Glu (SEQ ID NO:26; Leu Cys Cys Asn Pro Ala Cys Thr MM-416776) Gly Cys Tyr Asn Ser Ser Asn Tyr Cys Cys Glu (SEQ ID NO:27) Leu Cys Cys Asn Pro Ala Cys Trp Gly Cys Tyr Asn Ser Ser Asn Tyr Cys Cys Glu (SEQ ID NO:28; Tyr Cys Cys Asn Pro Ala Cys Thr MD-915) Gly Cys Tyr Cys Cys Glu Leu Cys Cys Asn Pro (SEQ ID NO:29; Ala Cys Thr Gly Cys Tyr MM416774) Cys Cys Glu Leu Cys Cys Asn Pro (SEQ ID NO:30) Ala Cys Trp Gly Cys Tyr Cys Cys Glu Tyr Cys Cys Asn Pro (SEQ ID NO:31; Ala Cys Thr Gly Cys
- the peptides of the invention are produced as a prepro protein that includes the amino terminal leader sequence: mkksilfiflsvlsfspfaqdakpvesskekitleskkcniakksnksgpesmn (SEQ ID NO:23).
- the peptide is produced by a bacterial cell, e.g., E. coli
- the forgoing leader sequence will be cleaved and the mature peptide will be efficiently secreted from the bacterial cell.
- U.S. Pat. No. 5,395,490 describes vectors, expression systems and methods for the efficient production of ST peptides in bacterial cells and methods for achieving efficient secretion of mature ST peptides.
- the vectors, expression systems and methods described in U.S. Pat. No. 5,395,490 can be used to produce the ST peptides and variant ST peptides of the present invention
- the invention includes variant peptides which can include one, two, three, four, five, six, seven, eight, nine, or ten (in some embodiments fewer than 5 or fewer than 3 or 2 or fewer) amino acid substitutions compared to SEQ ID NOs:25 to 59 and 66 to 110.
- the substitution(s) can be conservative or non-conservative.
- the naturally-occurring amino acids can be substituted by D-isomers of any amino acid, non-natural amino acids, and other groups.
- a conservative amino acid substitution results in the alteration of an amino acid for a similar acting amino acid, or amino acid of like charge, polarity, or hydrophobicity. At some positions, even conservative amino acid substitutions can reduce the activity of the peptide.
- Useful peptides can be produced either in bacteria including, without limitation, E. coli, or in other existing systems for peptide or protein production (e.g., Bacillus subtilis, baculovirus expression systems using Drosophila Sf9 cells, yeast or filamentous fungal expression systems, mammalian cell expression systems), or they can be chemically synthesized.
- bacteria including, without limitation, E. coli, or in other existing systems for peptide or protein production (e.g., Bacillus subtilis, baculovirus expression systems using Drosophila Sf9 cells, yeast or filamentous fungal expression systems, mammalian cell expression systems), or they can be chemically synthesized.
- the nucleic acid molecule encoding the peptide will preferably also encode a leader sequence that permits the secretion of the mature peptide from the cell.
- the sequence encoding the peptide can include the pre sequence and the pro sequence of, for example, a naturally-occurring bacterial ST peptide.
- the secreted, mature peptide can be purified from the culture medium.
- the sequence encoding a peptide of the invention is preferably inserted into a vector capable of delivering and maintaining the nucleic acid molecule in a bacterial cell.
- the DNA molecule may be inserted into an autonomously replicating vector (suitable vectors include, for example, pGEM3Z and pcDNA3, and derivatives thereof).
- the vector nucleic acid may be a bacterial or bacteriophage DNA such as bacteriophage lambda or M13 and derivatives thereof. Construction of a vector containing a nucleic acid described herein can be followed by transformation of a host cell such as a bacterium. Suitable bacterial hosts include but are not limited to, E. coli, B.
- the genetic construct also includes, in addition to the encoding nucleic acid molecule, elements that allow expression, such as a promoter and regulatory sequences.
- the expression vectors may contain transcriptional control sequences that control transcriptional initiation, such as promoter, enhancer, operator, and repressor sequences. A variety of transcriptional control sequences are well known to those in the art.
- the expression vector can also include a translation regulatory sequence (e.g., an untranslated 5′ sequence, an untranslated 3′ sequence, or an internal ribosome entry site).
- the vector can be capable of autonomous replication or it can integrate into host DNA to ensure stability during peptide production.
- the protein coding sequence that includes a peptide of the invention can also be fused to a nucleic acid encoding a polypeptide affinity tag, e.g., glutathione S-transferase (GST), maltose E binding protein, protein A, FLAG tag, hexa-histidine, myc tag or the influenza HA tag, in order to facilitate purification.
- GST glutathione S-transferase
- the affinity tag or reporter fusion joins the reading frame of the peptide of interest to the reading frame of the gene encoding the affinity tag such that a translational fusion is generated. Expression of the fusion gene results in translation of a single polypeptide that includes both the peptide of interest and the affinity tag.
- DNA sequence encoding a protease recognition site will be fused between the reading frames for the affinity tag and the peptide of interest.
- Mature peptides and variants thereof can be synthesized by the solid-phase method using an automated peptide synthesizer.
- the peptide can be synthesized on Cyc(4-CH 2 Bxl)-OCH 2 -4-(oxymethyl)-phenylacetamidomethyl resin using a double coupling program.
- Protecting groups must be used appropriately to create the correct disulfide bond pattern.
- protecting groups can be used: t-butyloxycarbonyl (alpha-amino groups); acetamidomethyl (thiol groups of Cys residues B and E); 4-methylbenyl (thiol groups of Cys residues C and F); benzyl (y-carboxyl of glutamic acid and the hydroxyl group of threonine, if present); and bromobenzyl (phenolic group of tyrosine, if present).
- Coupling is effected with symmetrical anhydride of t-butoxylcarbonylamino acids or hydroxybenzotriazole ester (for asparagine or glutamine residues), and the peptide is deprotected and cleaved from the solid support in hydrogen fluoride, dimethyl sulfide, anisole, and p-thiocresol using 8/1/1/0.5 ratio (v/v/v/w) at 0° C. for 60 min.
- the disulfide bond between Cys residues C and F is formed by first dissolving the peptide in 50% acetic acid in water. Saturated iodine solution in glacial acetic acid is added (1 ml iodine solution per 100 ml solution). After incubation at room temperature for 2 days in an enclosed glass container, the solution is diluted five-fold with deionized water and extracted with ethyl ether four times for removal of unreacted iodine. After removal of the residual amount of ethyl ether by rotary evaporation the solution of crude product is lyophilized and purified by successive reverse-phase chromatography.
- peptides and other agents to bind to the intestinal GC—C receptor can be tested as follows.
- Cells of the T84 human colon carcinoma cell line (American Type Culture Collection (Bethesda, Md.) are grown to confluence in 24-well culture plates with a 1:1 mixture of Ham's F12 medium and Dulbecco's modified Eagle's medium (DMEM), supplemented with 5% fetal calf serum. Cells used in the assay are typically between passages 54-60. Briefly, T84 cell monolayers in 24-well plates are washed twice with 1 ml of binding buffer (DMEM containing 0.05% bovine serum albumin and 25 mM HEPES, pH 7.2), then incubated for 30 min at 37° C.
- binding buffer DMEM containing 0.05% bovine serum albumin and 25 mM HEPES, pH 7.2
- E. coli ST peptide in the presence of mature radioactively labeled E. coli ST peptide and the test material at various concentrations.
- the cells are then washed four times with 1 ml of DMEM and solubilized with 0.5 ml/well 1N NaOH.
- the level of radioactivity in the solubilized material is then determined using standard methods.
- MD-915 A variant ST peptide, referred to as MD-915, was reproduced recombinantly and tested in an animal model.
- MD-915 has the sequence: Asn Ser Ser Asn Tyr Cys Cys Glu Tyr Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr (SEQ ID NO:28).
- a peptide having the sequence of the wild-type ST peptide was also created (MM-416776).
- MD-915 and MM-416776 peptides were produced as preproproteins using vectors produced as follows.
- a sequence encoding a heat-stable enterotoxin pre-pro sequence was amplified from pGK51/pGSK51 (ATCC 67728) using oligonucleotide MO3514 (5′CACACCATATGAAGAAATCAATATTATTTATTTTTCTTTCTG 3′ (SEG ID NO:60)) and oligonucelotide M03515 (5′CACACCTCGAGTTAGGTCTCCATGCTTTCAGGACCACTTTTATTAC 3′ (SEQ ID NO: 61)).
- the amplification product fragment was digested with NdeI/XhoI and ligated to the T7 expression vector, pET26b(+) (Novagen) digested with NdeI/XhoI thereby creating plasmid MB3976.
- the region encoding the pre-pro protein was sequenced and found to encode the amino acid sequence: mkksilfiflsvlsfspfaqdakpagsskekitleskkcnivkk s n k s g pesm (SEQ ID NO: 24) which differs from the amino acid sequence of heat-stable enterotoxin a2 precursor (sta2; mkksilfiflsvlsfspfaqdakpagsskekitleskkcnivkknnesspesm (SEQ ID NO:25); GenBank® Accession No. Q47185, GI: 3913876) at three positions (indicated by underlining and bold text) near the C-terminus.
- MB3976 complementary oligos encoding each ST peptide variant or wild-type ST peptide were annealed and cloned into the MB3976 expression vector.
- MB3984 encoding MM-416776 peptide full length wild-type ST peptide as a prepro protein
- MB 3976 was digested with BsaI/XhoI and ligated to annealed oligos MO3621 (5′GCATGAATAGTAGCAATTACTGCTGTGAATTGTGTTGTAATCCTGCTTGTACCGGGT GCTATTAATAAC 3′ (SEQ ID NO:62)
- MO3622 5′TCGAGTTATTAATAGCACCCGGTACAAGCAGGATTACAACACAATTCACAGCAGTA ATTGCTACTATTC 3′ (SEQ ID NO:63)).
- MB3985 (encoding MD-915 as a prepro protein) containing the following amino acid sequence, NSSNYCCEYCCNPACTGCY (SEQ ID NO:28) fused downstream of the pre-pro sequence
- MB 3976 was digested with BsaI/XhoI and ligated to annealed oligos M03529 (5′GCATGAATAGTAGCAATTACTGCTGTGAATATTGTTGTAATCCTGCTTGTACCGGGT GCTATTAATAAC 3′ (SEQ ID NO:64)) and MO3530 (5′TCGAGTTATTAATAGCACCCGGTACAAGCAGGATTACAACAATATTCACAGCAGTA ATTGCTACTATTC 3′ (SEQ ID NO:65)).
- the MD-915 peptide and the MM-416776 peptide were produced as follows.
- the expression vectors were transformed into E. coli bacterial host BL21 ⁇ DE3 (Invitrogen). A single colony was innoculated and grown shaking overnight at 30° C. in L broth+25 mg/l kanamycin.
- the overnight culture was added to 3.2 L of batch medium (Glucose 25 g/l, Caseamino Acids 5 g/l, Yeast Extract 5 g/l, KH 2 PO 4 13.3 g/l, (NH 4 ) 2 HPO 4 4 g/l, MgSO 4 -7H 2 0 1.2 g/l, Citric Acid 1.7 g/l, EDTA 8.4 mg/l, CoCl 2 -6H 2 O 2.5 mg/l, MnCl 2 -4H 2 O 15 mg/l, CuCl 2 -4H 2 0 1.5 mg/l, H 3 BO 3 3 mg/l, Na 2 MoO 4 -2H 2 0 2.5 mg/l, Zn Acetate-2H 2 0 13 mg/l, Ferric Citrate 100 mg/l, Kanamycin 25 mg/l, Antifoam DF 2 0 4 1 ml/l) and fermented using the following process parameters: pH 6.7—control with base only (28% NH 4 OH), 30° C
- MD-915 peptide and MM-416776 peptide fractions were analyzed by standard LCMS and HPLC. LCMS analysis revealed that MD-915 is more homogeneous than MM-416776 (see FIG. 1 a; note that MD-915 peptide exhibits fewer peaks (Panel B) than MM-416776 (Panel A)).
- Peptides were chemically synthesized by a commercial peptide synthesis company. Varying yields of peptides were obtained depending on the efficiency of chemical synthesis. Thus, the four peptides, in decreasing order of yield were: Cys Cys Glu Tyr Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr (SEQ ID NO:31; MD-1100), 10-20% yield; Cys Cys Glu Leu Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr (SEQ ID NO:29; MM416774); Asn Ser Ser Asn Tyr Cys Cys Glu Tyr Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr (SEQ ID NO:28; MD-915); Asn Ser Ser Asn Tyr Cys Cys Glu Leu Cys Cys Asn Pro Ala Cys Thr Gly Cys Tyr (SEQ ID NO:26 MM-416776), ⁇ 5% yield.
- the specific amino acid changes introduced into the peptides can create improved manufacturing properties
- FIG. 1 b shows the total ion chromatograph profile of synthetically manufactured MD-1100.
- FIG. 1 c shows the total ion chromatograph profile of the control blank sample. There is one major peak present in the MD-1100 sample that is not also present in the control sample. Quantitative analysis suggests the MD-1100 is >98% pure.
- the ability of MD-915, MM-416776, and MD-1100 to activate the intestinal GC—C receptor was assessed in an assay employing the T84 human colon carcinoma cell line (American Type Culture Collection (Bethesda, Md.). For the assays cells were grown to confluency in 24-well culture plates with a 1:1 mixture of Ham's F12 medium and Dulbecco's modified Eagle's medium (DMEM), supplemented with 5% fetal calf serum and were used at between passages 54 and 60.
- DMEM Dulbecco's modified Eagle's medium
- the dried samples were resuspended in 0.5 ml of phosphate buffer provided in the Cayman Chemical Cyclic GMP EIA kit (Cayman Chemical, Ann Arbor, Mich.). Cyclic GMP was measured by EIA according to procedures outlined in the Cayman Chemical Cyclic GMP EIA kit.
- FIG. 2 shows the activity of chemically synthesized peptide variants in this GC—C receptor activity assay.
- MM-416776 and two different MD-1100 peptides (MD-1100(a) and MD-1100(b), synthesized by two different methods) had activity comparable to MM-416776.
- MD-915 and MM-416776 peptide were chemically synthesized in a manner identical to that of MD-1100(b).
- GIT murine gastrointestinal transit
- mice were fasted with free access to water for 12 to 16 hours before the treatment with peptide or control buffer.
- the peptides were orally administered at 1 ⁇ g/kg-1 mg/kg of peptide in buffer (20 mM Tris pH 7.5) 7 minutes before being given an oral dose of 5% Activated Carbon (Aldrich 242276-250G).
- Control mice were administered buffer only before being given a dose of Activated Carbon.
- the mice were sacrificed and their intestines from the stomach to the cecum were dissected. The total length of the intestine as well as the distance traveled from the stomach to the charcoal front was measured for each animal and the results are expressed as the percent of the total length of the intestine traveled by the charcoal front.
- mice All results are reported as the average of 10 mice ⁇ standard deviation. A comparison of the distance traveled by the charcoal between the mice treated with peptide versus the mice treated with vehicle alone was performed using a Student's t test and a statistically significant difference was considered for P ⁇ 0.05. P-values are calculated using a two-sided T-Test assuming unequal variances.
- FIG. 3 a, b wild-type ST peptide (MM-416776, (Sigma-Aldrich, St Louis, Mo.; 0.1 mg/kg), synthetically manufactured MD-1100 and Zelnorm® (0.1 mg/kg), a drug approved for IBS that is an agonist for the serotonin receptor 5HT4, increase gastrointestinal transit rate in this model.
- FIG. 4 a shows the result of a study demonstrating that intestinal transit rate increases with an increasing dosage of either recombinantly synthesized MM-416776 or MD-915.
- FIG. 4 b shows the results of a study demonstrating both chemically synthesized MM-416776 or MD-1100 peptide increase intestinal transit rates more than either Tris buffer alone or an equivalent dose of Zelnorm®.
- FIG. 4 c shows the results of a study demonstrating both chemically synthesized MD-1100 or Zelnorm® are effective in a mouse gastrointestinal motility assay upon chronic dosing (daily for 5 days). The results are shown side by side with acute dosing (1 day).
- MM-416776 peptide and MD-915 were tested for their ability to increase intestinal secretion using a suckling mouse model of intestinal secretion.
- a test compound is administered to suckling mice that are between 7 and 9 days old. After the mice are sacrificed, the gastrointestinal tract from the stomach to the cecum is dissected (“guts”). The remains (“carcass”) as well as the guts are weighed and the ratio of guts to carcass weight is calculated. If the ratio is above 0.09, one can conclude that the test compound increases intestinal secretion.
- FIG. 5 a shows a dose response curve for wild-type ST peptide (MM-416776) in this model.
- FIG. 5 b shows dose response curve for the MD-1100 peptide in this model.
- FIG. 6 a shows a dose response curve for the recombinant MM-416776 peptide described above and the recombinant MD-915 peptide described above. As can be seen from FIG. 6 a, both peptides increase intestinal secretion in this model.
- FIG. 6 b shows a dose response curve for chemically synthesized MD-915, MD-1100 and MM-416776 as well as wild-type ST peptide (purchased from Sigma-Aldrich, St Louis, Mo.).
- TNBS trinitrobenzenesulphonic acid
- FIG. 7 shows the results of experiment in which MD-1100 activity was analyzed in the TNBS colorectal model. Significant decreases in abdominal response are observed at 0.3 ⁇ g/kg and 3 ⁇ g/kg MD-1100. These results demonstrate that MD-1100 reduces pain associated with colorectal distension in this animal model.
- Male Wistar Rats (200-250 g) are surgically implanted with nichrome wire electrodes as in the TNBS model. Ten days post surgical implantation, partial restraint stress (PRS), is performed as described by Williams et al. for two hours (Williams et al. 1988 Gastroenterology 64:611). Briefly, under light anesthesia with ethyl-ether, the foreshoulders, upper forelimbs and thoracic trunk are wrapped in a confining harness of paper tape to restrict, but not prevent body movements. Control sham-stress animals are anaesthetized but not wrapped. Thirty minutes before the end of the PRS session, the animals are administered test-compound or vehicle.
- PRS partial restraint stress
- the CRD distension procedure is performed as described above for the TNBS model with barostat at pressures of 15, 30, 45 and 60 mm Hg.
- Statistical analysis on the number of bursts is determined and analyzed as in the TNBS model above.
- the PBQ-induced writhing model can be used to assess pain control activity of the peptides and GC—C receptor agonists of the invention. This model is described by Siegmund et al. (1957 Proc. Soc. Exp. Bio. Med. 95:729-731). Briefly, one hour after oral dosing with a test compound, e.g., a peptide, morphine or vehicle, 0.02% phenylbenzoquinone (PBQ) solution (12.5 mL/kg) is injected by intraperitoneal route into the mouse.
- PBQ phenylbenzoquinone
- the number of stretches and writhings are recorded from the 5 th to the 10 th minute after PBQ injection, and can also be counted between the 35 th and 40 th minute and between the 60 th and 65 th minute to provide a kinetic assessment.
- the results are expressed as the number of stretches and writhings (mean ⁇ SEM) and the percentage of variation of the nociceptive threshold calculated from the mean value of the vehicle-treated group.
- the statistical significance of any differences between the treated groups and the control group is determined by a Dunnett's test using the residual variance after a one-way analysis of variance (P ⁇ 0.05) using SigmaStat Software.
- FIGS. 8 a and 8 b show the effect of different doses of MD-915 and MD-1100 in the PBQ writhing assay.
- Indomethacin an NSAID (nonsteroidal anti-inflammatory drug) with known pain control activity, was used as the positive control in the assay.
- Significant reductions in writhings were observed for MD-915 (1 mg/kg dose) and MD-1100 (2.5 mg/kg dose) compared to the vehicle control. Loss of efficacy at the highest dose tested has also been observed for multiple other compounds (such as 5HT-3 antagonists) tested in similar assays.
- the results of this study suggest that both MD-915 and MD-1100 have antinociceptive effects in this visceral pain model comparable to the intermediate doses of indomethacin.
- Intestinal mucosa was extruded from the intestine by gentle pressure between a piece of parafilm and a P-1000 pipette tip. Intestinal epithelial cells were placed in 2 ml PBS and pipetted up and down with a 5 ml pipette to make a suspension of cells. Protein concentration in the suspension was measured using the Bradford method ( Anal. Biochem. 72: 248-254 (1976)).
- a competition binding assay was performed based on the method of Giannella et al. ( Am. J. Physiol. 245: G492-G498) between [ 125 I] labeled MM-416776 and MD-1100.
- the assay mixture contained: 0.5 ml of DME with 20 mM HEPES-KOH pH 7.0, 0.9 mg of the cell suspension listed above, 21.4 fmol[ 125 I]-MM-416776 (42.8 pM), and different concentrations of competitor MD-1100 (0.01 to 1000 nM). The mixture was incubated at room temperature for 1 hour, and the reaction stopped by applying the mixture to GF/B glass-fiber filters (Whatman).
- FIG. 9 shows that the Kd for MD-1100 in this assay is 4.5 nm.
- %B/Bo is the percentage of the ratio of radioactivity trapped in each sample (B) compared to the radioactivity retained in a control sample with no cold competitor (Bo).
- Giannella et al. Am. J Physiol. 245: G492-G4978 observed that the Kd for wild-type ST peptide in this same assay was ⁇ 13 nm.
- FIG. 10 a show absorption data for intravenously and orally administered MD-1100 as detected by the ELISA assay. MD-1100 appears to be minimally systemically absorbed and is ⁇ 2.2% bioavailable.
- the sample was eluted from the analytical column with a reverse phase gradient (Mobile Phase A: 10 mM ammonium hydroxide in dH 2 O, Mobile Phase B: 10 mM ammonium hydroxide in 80% acetonitrile and 20% methanol; 20% B for the first 3 minutes then ramping to 95% B over 4 min. and holding for 2 min., all at a flow rate of 0.4 mL/min.). At 9.1 minutes, the gradient returns to the initial conditions of 20%B for 1 min.
- Mobile Phase A 10 mM ammonium hydroxide in dH 2 O
- Mobile Phase B 10 mM ammonium hydroxide in 80% acetonitrile and 20% methanol
- MRM triple-quadrapole mass spectrometry
- FIG. 10 b shows absorption data for IV and orally administered MD-1100 as detected by LCMS.
- MD-1100 appears similarly minimally systemically absorbed and is ⁇ 0.11% bioavailable.
- the peptides and agonists of the invention are preferably administered orally, e.g., as a tablet, gel, paste, slurry, liquid, powder or in some other form.
- Orally administered compositions can include binders, flavoring agents, and humectants.
- the peptides and agonists can be co-administered with other agents used to treat gastrointestinal disorders including but not limited to acid suppressing agents such as Histamine-2 receptor agonists (H2As) and proton pump inhibitors (PPIs).
- H2As Histamine-2 receptor agonists
- PPIs proton pump inhibitors
- the peptides and agonists can also be administered by rectal suppository.
- peptides and agonists are preferably administered parenterally or orally.
- the peptides described herein can be used alone or in combination with other agents.
- the peptides can be administered together with an analgesic peptide or compound.
- the analgesic peptide or compound can be covalently attached to a peptide described herein or it can be a separate agent that is administered together with or sequentially with a peptide described herein in a combination therapy.
- Combination therapy can be achieved by administering two or more agents, e.g., a peptide described herein and an analgesic peptide or compound, each of which is formulated and administered separately, or by administering two or more agents in a single formulation.
- agents e.g., a peptide described herein and an analgesic peptide or compound, each of which is formulated and administered separately, or by administering two or more agents in a single formulation.
- two agents can be formulated together and administered in conjunction with a separate formulation containing a third agent. While the two or more agents in the combination therapy can be administered simultaneously, they need not be.
- administration of a first agent (or combination of agents) can precede administration of a second agent (or combination of agents) by minutes, hours, days, or weeks.
- the two or more agents can be administered within minutes of each other or within 1, 2, 3, 6, 9, 12, 15, 18, or 24 hours of each other or within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14 days of each other or within 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks of each other. In some cases even longer intervals are possible. While in many cases it is desirable that the two or more agents used in a combination therapy be present in within the patient's body at the same time, this need not be so.
- Combination therapy can also include two or more administrations of one or more of the agents used in the combination. For example, if agent X and agent Y are used in a combination, one could administer them sequentially in any combination one or more times, e.g., in the order X—Y—X, X—X—Y, Y—X—Y, Y—Y—X, X—X—Y—Y, etc.
- the agents alone or in combination, can be combined with any pharmaceutically acceptable carrier or medium. Thus, they can be combined with materials that do not produce an adverse, allergic or otherwise unwanted reaction when administered to a patient.
- the carriers or mediums used can include solvents, dispersants, coatings, absorption promoting agents, controlled release agents, etc.
- the agents either in their free form or as a salt can be combined with a polymer such as polylactic-glycoloic acid (PLGA), poly-(I)-lactic-glycolic-tartaric acid (P(I)LGT) (WO 01/12233), polyglycolic acid (U.S. Pat. No. 3,773,919), polylactic acid (U.S. Pat. No. 4,767,628); poly( ⁇ -caprolactone) to create a sustained release formulation.
- PLGA polylactic-glycoloic acid
- P(I)LGT poly-(I)-lactic-glycolic-tartaric acid
- P(I)LGT) WO 01/12233
- polyglycolic acid U.S. Pat. No. 3,773,919
- polylactic acid U.S. Pat. No. 4,767,628
- poly( ⁇ -caprolactone) poly( ⁇ -caprolactone)
- Such formulations can be used to implants that release a peptide or another agent over a period of a few days, a few weeks or several months depending on the polymer, the particle size of the polymer, and the size of the implant (see, e.g., U.S. Pat. No. 6,620,422).
- Other sustained release formulations are described in EP 0 467 389 A2, WO 93/241150, U.S. Pat. No. 5,612,052; WO 97/40085, WO 94/155587, U.S. Pat. No. 5,672,659, U.S. Pat. No. 5,893,985, U.S. Pat. No. 5,134,122, U.S. Pat. No. 5,192,741, U.S. Pat.
- sustained release formulations microparticles of peptide are combined with microparticles of polymer.
- One or more sustained release implants can be placed in the large intestine, the small intestine or both.
- the agents can be administered, e.g., by intravenous injection, intramuscular injection, subcutaneous injection, or by other routes.
- the agents can be administered orally, e.g., as a tablet, gel, paste, slurry, liquid, powder or in some other form.
- Orally administered compositions can include binders, flavoring agents, and humectants.
- the agents can be included in dentifrices or oral washes.
- oral formulations can include abrasives and foaming agents.
- the agents can also be administered transdermally or in the form a suppository.
- the agents can be a free acid or base, or a pharmacologically acceptable salt thereof. Solids can be dissolved or dispersed immediately prior to administration or earlier. In some circumstances the preparations include a preservative to prevent the growth of microorganisms.
- the pharmaceutical forms suitable for injection can include sterile aqueous or organic solutions or dispersions which include, e.g., water, an alcohol, an organic solvent, an oil or other solvent or dispersant (e.g., glycerol, propylene glycol, polyethylene glycol, and vegetable oils). Pharmaceutical agents can be sterilized by filter sterilization or by other suitable means.
- Suitable pharmaceutical compositions in accordance with the invention will generally include an amount of the active compound(s) with an acceptable pharmaceutical diluent or excipient, such as a sterile aqueous solution, to give a range of final concentrations, depending on the intended use.
- an acceptable pharmaceutical diluent or excipient such as a sterile aqueous solution.
- the techniques of preparation are generally well known in the art, as exemplified by Remington's Pharmaceutical Sciences (18th Edition, Mack Publishing Company, 1995).
- the agents described herein and combination therapy agents can be packaged as a kit that includes single or multiple doses of two or more agents, each packaged or formulated individually, or single or multiple doses of two or more agents packaged or formulated in combination.
- one or more agents can be present in first container, and the kit can optionally include one or more agents in a second container.
- the container or containers are placed within a package, and the package can optionally include administration or dosage instructions.
- a kit can include additional components such as syringes or other means for administering the agents as well as diluents or other means for formulation.
- the peptides described herein can be used in combination therapy with an analgesic agent, e.g., an analgesic compound or an analgesic peptide.
- analgesic agent e.g., an analgesic compound or an analgesic peptide.
- the analgesic agent can optionally be covalently attached to a peptide described herein.
- analgesic agents are: Ca channel blockers, 5HT receptor antagonists (for example 5HT3, 5HT4 and 5HT1 receptor antagonists), opioid receptor agonists (loperamide, fedotozine, and fentanyl), NK1 receptor antagonists, CCK receptor agonists (e.g., loxiglumide), NK1 receptor antagonists, NK3 receptor antagonists, norepinephrine-serotonin reuptake inhibitors (NSRI), vanilloid and cannabanoid receptor agonists, and sialorphin.
- 5HT receptor antagonists for example 5HT3, 5HT4 and 5HT1 receptor antagonists
- opioid receptor agonists loperamide, fedotozine, and fentanyl
- NK1 receptor antagonists e.g., CCK receptor agonists (e.g., loxiglumide)
- NK1 receptor antagonists e.g., loxiglumide
- NK1 receptor antagonists e.g.,
- sialorphin-related peptides including those comprising the amino acid sequence QHNPR (SEQ ID NO:111), including: VQHNPR (SEQ ID NO:112); VRQHNPR (SEQ ID NO:113); VRGQHNPR (SEQ ID NO:114); VRGPQHNPR (SEQ ID NO:115); VRGPRQHNPR (SEQ ID NO:116); VRGPRRQHNPR (SEQ ID NO:117); and RQHNPR (SEQ ID NO:118).
- Sialorphin-related peptides bind to neprilysin and inhibit neprilysin-mediated breakdown of substance P and Met-enkephalin.
- compounds or peptides that are inhibitors of neprilysin are useful analgesic agents which can be administered with the peptides of the invention in a co-therapy or linked to the peptides of the invention, e.g., by a covalent bond.
- analgesic agents which can be administered with the peptides of the invention in a co-therapy or linked to the peptides of the invention, e.g., by a covalent bond.
- Sialophin and related peptides are described in U.S. Pat. No. 6,589,750; U.S. 20030078200 A1; and WO 02/051435 A2.
- Opioid receptor antagonists and agonists can be administered with the peptides of the invention in co-therapy or linked to the peptide of the invention, e.g., by a covalent bond.
- opioid receptor antagonists such as naloxone, naltrexone, methyl nalozone, nalmefene, cypridime, beta funaltrexamine, naloxonazine, naltrindole, and nor-binaltorphimine are thought to be useful in the treatment of IBS. It can be useful to formulate opioid antagonists of this type is a delayed and sustained release formulation such that initial release of the antagonist is in the mid to distal small intestine and/or ascending colon.
- Enkephalin pentapeptide (HOE825; Tyr-D-Lys-Gly-Phe-L-homoserine) is an agonist of the mu and delta opioid receptors and is thought to be useful for increasing intestinal motility ( Eur. J Pharm. 219:445, 1992), and this peptide can be used in conjunction with the peptides of the invention. Also useful is trimebutine which is thought to bind to mu/delta/kappa opioid receptors and activate release of motilin and modulate the release of gastrin, vasoactive intestinal peptide, gastrin and glucagons.
- Kappa opioid receptor agonists such as fedotozine, ketocyclazocine, and compounds described in WO 03/097051 A2 can be used with or linked to the peptides of the invention.
- mu opioid receptor agonists such as morphine, diphenyloxylate, frakefamide (H-Tyr-D-Ala-Phe(F)-Phe-NH 2 ; WO 01/019849 A1) and loperamide can be used.
- Tyr-Arg is a dipeptide that acts by stimulating the release of met-enkephalins to elicit an analgesic effect ( J. Biol. Chem 262:8165, 1987).
- Kyotorphin can be used with or linked to the peptides of the invention.
- CCK receptor agonists such as caerulein from amphibians and other species are useful analgesic agents that can be used with or linked to the peptides of the invention.
- Conotoxin peptides represent a large class of analgesic peptides that act at voltage gated Ca channels, NMDA receptors or nicotinic receptors. These peptides can be used with or linked to the peptides of the invention.
- Peptide analogs of thymulin can have analgesic activity and can be used with or linked to the peptides of the invention.
- CCK (CCKa or CCKb) receptor antagonists including loxiglumide and dexloxiglumide (the R-isomer of loxiglumide) (WO 88/05774) can have analgesic activity and can be used with or linked to the peptides of the invention.
- 5-HT4 agonists such as tegaserod/zelnorm and hydrogen acetate.
- 5-HT4 agonists such as tegaserod/zelnorm and hydrogenacetate.
- Such agonists are described in: EP1321142 A1, WO 03/053432A1, EP 505322 A1, EP 505322 B1, U.S. Pat. No. 5,510,353, EP 507672 A1, EP 507672 B1, and U.S. P 5,273,983.
- Calcium channel blockers such as ziconotide and related compounds described in, for example, EP625162B1, U.S. Pat. No. 5,364,842, U.S. Pat. No. 5,587,454, U.S. Pat 5,824,645, U.S. Pat. No. 5,859,186, U.S. Pat. No. 5,994,305, U.S. Pat. No. 6,087,091, U.S. Pat. No. 6,136,786, WO 93/13128 A1, EP 1336409 A1, EP 835126 A1, EP 835126 B1, U.S. Pat. No. 5,795,864, U.S. Pat. No. 5,891,849, U.S. Pat. No. 6,054,429, WO 97/01351 A1, can be used with or linked to the peptides of the invention.
- NK-1, NK-2, and NK-3 receptors can be can be used with or linked to the peptides of the invention.
- NK1 receptor antagonists such as: aprepitant (Merck & Co Inc), vofopitant, ezlopitant (Pfizer, Inc.), R-673 (Hoffmann-La Roche Ltd), SR-14033 and related compounds described in, for example, EP 873753 A1, US 20010006972 A1, US 20030109417 A1, WO 01/52844 A1, can be used with or linked to the peptides of the invention.
- NK-2 receptor antagonists such as nepadutant (Menarini Ricerche SpA), saredutant (Sanofi-Synthelabo), SR-144190 (Sanofi-Synthelabo) and UK-290795 (Pfizer Inc) can be used with or linked to the peptides of the invention.
- NK3 receptor antagonists such as osanetant (Sanofi-Synthelabo), talnetant and related compounds described in, for example, WO 02/094187 A2, EP 876347 A1, WO 97/21680 A1, U.S. Pat. No. 6,277,862, WO 98/11090, WO 95/28418, WO 97/19927, and Boden et al. ( J Med Chem. 39:1664-75, 1996) can be used with or linked to the peptides of the invention.
- Norepinephrine-serotonin reuptake inhibitors such as milnacipran and related compounds described in WO 03/077897 A1 can be used with or linked to the peptides of the invention.
- Vanilloid receptor antagonists such as arvanil and related compounds described in WO 01/64212 A1 can be used with or linked to the peptides of the invention.
- the resulting peptide may also include at least one trypsin or chymotrypsin cleavage site.
- the analgesic peptide may be preceded by (if it is at the carboxy terminus) or followed by (if it is at the amino terminus) a chymotrypsin or trypsin cleavage site that allows release of the analgesic peptide.
- analgesic peptides include: AspPhe, endomorphin-1, endomorphin-2, nocistatin, dalargin, lupron, zicnotide, and substance P.
- the peptides of the invention can be used for the treatment or prevention of cancer, pre-cancerous growths, or metastatic growths.
- they can be used for the prevention or treatment of: colorectal/local metastasized colorectal cancer, gastrointestinal tract cancer, lung cancer, cancer or pre-cancerous growths or metastatic growths of epithelial cells, polyps, breast, colorectal, lung, ovarian, pancreatic, prostatic, renal, stomach, bladder, liver, esophageal and testicular carcinoma, carcinoma (e.g., basal cell, basosquamous, Brown-Pearce, ductal carcinoma, Ehrlich tumor, Krebs, Merkel cell, small or non-small cell lung, oat cell, papillary, bronchiolar, squamous cell, transitional cell, Walker), leukemia (e.g., B-cell, T-cell, HTLV, acute or chronic lymphocytic, mast cell, myeloid), histiocyton
- nonchroinaffin pinealoma, rhabdomyoma, rhabdomyosarcoma, Sertoli cell tumor, teratoma, theca cell tumor, and other diseases in which cells have become dysplastic, immortalized, or transformed.
- the peptides of the invention can be used for the treatment or prevention of: Familial Adenomatous Polyposis (FAP) (autosomal dominant syndrome) that precedes colon cancer, hereditary nonpolyposis colorectal cancer (HNPCC), and inherited autosomal dominant syndrome.
- FAP Familial Adenomatous Polyposis
- HNPCC hereditary nonpolyposis colorectal cancer
- the peptides can be used in combination therapy with radiation or chemotherapeutic agents, an inhibitor of a cGMP-dependent phosphodiesterase or a selective cyclooxygenase-2 inhibitor (a number of selective cyclooxygenase-2 inhibitors are described in WO02062369, hereby incorporated by reference).
- the peptides can be for treatment or prevention of inflammation.
- they can be used alone or in combination with inhibitor of cGMP-dependent phosphodiesterase or a selective cyclooxygenase-2 inhibitor for treatment of: organ inflammation, IBD (e.g, Crohn's disease, ulcerative colitis), asthma, nephritis, hepatitis, pancreatitis, bronchitis, cystic fibrosis, ischemic bowel diseases, intestinal inflammations/allergies, coeliac disease, proctitis, eosnophilic gastroenteritis, mastocytosis, and other inflammatory disorders.
- IBD e.g, Crohn's disease, ulcerative colitis
- asthma e.g, Crohn's disease, ulcerative colitis
- nephritis hepatitis
- pancreatitis bronchitis
- cystic fibrosis ischemic bowel diseases
- intestinal inflammations/allergies coeliac disease
- the peptides can also be used to treat or prevent insulin-related disorders, for example: II diabetes mellitus, hyperglycemia, obesity, disorders associated with disturbances in glucose or electrolyte transport and insulin secretion in cells, or endocrine disorders. They can be also used in insulin resistance treatment and post-surgical and non-post surgery decrease in insulin responsiveness.
- the peptides can be used to prevent or treat respiratory disorders, including, inhalation, ventilation and mucus secretion disorders, pulmonary hypertension, chronic obstruction of vessels and airways, and irreversible obstructions of vessels and bronchi.
- the peptides can be used in combination therapy with a phosphodiesterase inhibitor (examples of such inhibitors can be found in U.S. Pat. No. 6,333,354, hereby incorporated by reference).
- the peptides can also be used to prevent or treat: retinopathy, nephropathy, diabetic angiopathy, and edema formation
- the peptides can also be used to prevent or treat neurological disorders, for example, headache, anxiety, movement disorders, aggression, psychosis, seizures, panic attacks, hysteria, sleep disorders, depression, schizoaffective disorders, sleep apnea, attention deficit syndromes, memory loss, and narcolepsy. They may also be used as a sedative.
- neurological disorders for example, headache, anxiety, movement disorders, aggression, psychosis, seizures, panic attacks, hysteria, sleep disorders, depression, schizoaffective disorders, sleep apnea, attention deficit syndromes, memory loss, and narcolepsy. They may also be used as a sedative.
- the peptides and detectabley labeled peptides can be used as markers to identify, detect, stage, or diagnosis diseases and conditions of the small intestine, including: Crohn's disease, colitis, inflammatory bowel disease, tumors, benign tumors, such as benign stromal tumors, adenoma, angioma, adenomatous (pedunculated and sessile) polyps, malignant, carcinoid tumors, endocrine cell tumors, lymphoma, adenocarcinoma, foregut, midgut, and hindgut carcinoma, gastroinstestinal stromal tumor (GIST), such as leiomyoma, cellular leiomyoma, leiomyoblastoma, and leiomyosarcoma, gastrointestinal autonomic nerve tumor, malabsorption syndromes, celiac diseases, diverticulosis, Meckel's diverticulum, colonic diverticula, megacolon, Hirschsprung's disease,
- the peptides can be conjugated to another molecule (e.g, a diagnostic or therapeutic molecule) to target cells bearing the GCC receptor, e.g., cystic fibrosis lesions and specific cells lining the intestinal tract.
- a diagnostic or therapeutic molecule e.g., cystic fibrosis lesions and specific cells lining the intestinal tract.
- they can be used to target radioactive moieties or therapeutic moieties to the intestine to aid in imaging and diagnosing or treating colorectal/metastasized or local colorectal cancer and to deliver normal copies of the p53 tumor suppressor gene to the intestinal tract.
- the peptides can be used alone or in combination therapy to treat erectile dysfunction.
- the peptides can be used alone or in combination therapy to treat inner ear disorders, e.g., to treat Meniere's disease, including symptoms of the disease such as vertigo, hearing loss, tinnitus, sensation of fullness in the ear, and to maintain fluid homeostasis in the inner ear.
- the peptides can be used alone or in combination therapy to treat disorders associated with fluid and sodium retention, e.g., diseases of the electrolyte-water/electrolyte transport system within the kidney, gut and urogenital system, congestive heart failure, hypertension,
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Diabetes (AREA)
- Biomedical Technology (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Hematology (AREA)
- Gastroenterology & Hepatology (AREA)
- Obesity (AREA)
- Urology & Nephrology (AREA)
- Cardiology (AREA)
- Pulmonology (AREA)
- Psychiatry (AREA)
- Endocrinology (AREA)
- Pain & Pain Management (AREA)
- Heart & Thoracic Surgery (AREA)
- Hospice & Palliative Care (AREA)
- Oncology (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Child & Adolescent Psychology (AREA)
- Nutrition Science (AREA)
Priority Applications (9)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/766,735 US20040266989A1 (en) | 2003-01-28 | 2004-01-28 | Methods and compositions for the treatment of gastrointestinal disorders |
US10/796,719 US7304036B2 (en) | 2003-01-28 | 2004-03-09 | Methods and compositions for the treatment of gastrointestinal disorders |
US10/845,895 US20060281682A1 (en) | 2003-01-28 | 2004-05-14 | Methods and compositions for the treatment of gastrointestinal disorders |
US10/899,806 US7371727B2 (en) | 2003-01-28 | 2004-07-27 | Methods and compositions for the treatment of gastrointestinal disorders |
US11/054,071 US7772188B2 (en) | 2003-01-28 | 2005-02-08 | Methods and compositions for the treatment of gastrointestinal disorders |
US11/930,696 US7704947B2 (en) | 2003-01-28 | 2007-10-31 | Methods and compositions for the treatment of gastrointestinal disorders |
US12/120,023 US7910546B2 (en) | 2003-01-28 | 2008-05-13 | Methods and compositions for the treatment of gastrointestinal disorders |
US12/754,138 US8080526B2 (en) | 2003-01-28 | 2010-04-05 | Methods and compositions for the treatment of gastrointestinal disorders |
US12/788,979 US8110553B2 (en) | 2003-01-28 | 2010-05-27 | Methods and compositions for the treatment of gastrointestinal disorders |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US44309803P | 2003-01-28 | 2003-01-28 | |
US47128803P | 2003-05-15 | 2003-05-15 | |
US51946003P | 2003-11-12 | 2003-11-12 | |
US10/766,735 US20040266989A1 (en) | 2003-01-28 | 2004-01-28 | Methods and compositions for the treatment of gastrointestinal disorders |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/796,719 Continuation-In-Part US7304036B2 (en) | 2003-01-28 | 2004-03-09 | Methods and compositions for the treatment of gastrointestinal disorders |
US11/930,696 Division US7704947B2 (en) | 2003-01-28 | 2007-10-31 | Methods and compositions for the treatment of gastrointestinal disorders |
Publications (1)
Publication Number | Publication Date |
---|---|
US20040266989A1 true US20040266989A1 (en) | 2004-12-30 |
Family
ID=32854294
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/766,735 Abandoned US20040266989A1 (en) | 2003-01-28 | 2004-01-28 | Methods and compositions for the treatment of gastrointestinal disorders |
US11/930,696 Expired - Lifetime US7704947B2 (en) | 2003-01-28 | 2007-10-31 | Methods and compositions for the treatment of gastrointestinal disorders |
US12/754,138 Expired - Lifetime US8080526B2 (en) | 2003-01-28 | 2010-04-05 | Methods and compositions for the treatment of gastrointestinal disorders |
Family Applications After (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/930,696 Expired - Lifetime US7704947B2 (en) | 2003-01-28 | 2007-10-31 | Methods and compositions for the treatment of gastrointestinal disorders |
US12/754,138 Expired - Lifetime US8080526B2 (en) | 2003-01-28 | 2010-04-05 | Methods and compositions for the treatment of gastrointestinal disorders |
Country Status (29)
Country | Link |
---|---|
US (3) | US20040266989A1 (pt) |
EP (3) | EP1911763B1 (pt) |
JP (3) | JP4584911B2 (pt) |
KR (2) | KR101227627B1 (pt) |
CN (2) | CN101787073B (pt) |
AT (2) | ATE365174T1 (pt) |
AU (2) | AU2004210161B2 (pt) |
BE (1) | BE2013C032I2 (pt) |
BR (2) | BRPI0407071B8 (pt) |
CA (1) | CA2514507C (pt) |
CY (5) | CY1110905T1 (pt) |
DE (2) | DE602004028678D1 (pt) |
DK (3) | DK1911763T3 (pt) |
ES (3) | ES2350123T3 (pt) |
FR (2) | FR13C0030I1 (pt) |
HK (1) | HK1078768A1 (pt) |
HU (1) | HUS1300022I1 (pt) |
IL (2) | IL169863A (pt) |
LT (1) | LTC1594517I2 (pt) |
LU (2) | LU92201I2 (pt) |
MX (1) | MXPA05008097A (pt) |
NL (1) | NL300593I2 (pt) |
NO (2) | NO334112B1 (pt) |
NZ (2) | NZ570134A (pt) |
PT (3) | PT2246360E (pt) |
RU (2) | RU2353383C2 (pt) |
SG (2) | SG192300A1 (pt) |
SI (3) | SI2246360T1 (pt) |
WO (1) | WO2004069165A2 (pt) |
Cited By (21)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005087797A1 (en) * | 2004-03-09 | 2005-09-22 | Microbia, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
US20050266028A1 (en) * | 2004-05-25 | 2005-12-01 | University Of Georgia Research Foundation, Inc. | Compositions and methods for modulating an immune response |
US20060094658A1 (en) * | 2003-06-13 | 2006-05-04 | Currie Mark G | Method and compositions for the treatment of gastrointestinal disorders |
US20060258593A1 (en) * | 2003-01-28 | 2006-11-16 | Currie Mark G | Methods and compositions for the treatment of gastrointestinal disorders |
US20060281682A1 (en) * | 2003-01-28 | 2006-12-14 | Currie Mark G | Methods and compositions for the treatment of gastrointestinal disorders |
US20070010450A1 (en) * | 2003-06-13 | 2007-01-11 | Microbia, Inc., A Massachusetts Corporation | Methods and compositions for the treatment of gastrointestinal disorders |
WO2007041278A2 (en) | 2005-09-29 | 2007-04-12 | Societe De Conseils De Recherches Et D'applications Scientifiques S.A.S. | Composition and methods for stimulating gastrointestinal motility |
US20070249717A1 (en) * | 2004-10-26 | 2007-10-25 | Ajinomoto Co. Inc | Preventive/therapeutic agent for visceral pain |
US7304036B2 (en) | 2003-01-28 | 2007-12-04 | Microbia, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
WO2007022531A3 (en) * | 2005-08-19 | 2008-01-24 | Microbia Inc | Methods and compositions for the treatment of gastrointestinal disorders |
WO2008106429A3 (en) * | 2007-02-26 | 2008-11-20 | Microbia Inc | Methods and compositions for the treatment of heart failure and other disorders |
US20090005534A1 (en) * | 2003-01-28 | 2009-01-01 | Microbia, Inc. | Methods and Compositions for the Treatment of Gastrointestinal Disorders |
US20090305993A1 (en) * | 2006-02-24 | 2009-12-10 | Ironwood Pharmaceuticals, Inc. | Methods and composition for the treatment of gastrointestinal disorders |
EP2152266A1 (en) * | 2007-05-04 | 2010-02-17 | Ironwood Pharmaceuticals, Inc. | Compositions and methods for treating disorders associated with salt or fluid retention |
US20100048489A1 (en) * | 2008-08-15 | 2010-02-25 | Ironwood Pharmaceuticals Inc. | Stable Solid Formulation of A GC-C Receptor Agonist Polypeptide Suitable for Oral Administration |
US20110059903A1 (en) * | 2009-08-06 | 2011-03-10 | Ironwood Pharmaceuticals, Inc. | Formulations Comprising Linaclotide |
WO2011145062A1 (en) | 2010-05-21 | 2011-11-24 | Link Research & Grants Corporation | Treatment of tinnitus and related auditory dysfunctions |
US8933030B2 (en) | 2010-02-17 | 2015-01-13 | Ironwwod Pharmaceuticals, Inc. | Treatments for gastrointestinal disorders |
US9708371B2 (en) | 2011-08-17 | 2017-07-18 | Ironwood Pharmaceuticals, Inc. | Treatments for gastrointestinal disorders |
US10675325B2 (en) | 2010-08-11 | 2020-06-09 | Ironwood Pharmaceuticals, Inc. | Stable formulations of linaclotide |
WO2021191865A1 (en) * | 2020-03-26 | 2021-09-30 | Dusa Pharmaceuticals, Inc. | Management of dermal neurofibromatosis lesions |
Families Citing this family (37)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA2441970C (en) | 2001-03-29 | 2013-01-22 | Synergy Pharmaceuticals, Inc. | Guanylate cyclase receptor agonists for the treatment of tissue inflammation and carcinogenesis |
EP2527360B1 (en) | 2007-06-04 | 2015-10-28 | Synergy Pharmaceuticals Inc. | Agonists of guanylate cyclase useful for the treatment of gastrointestinal disorders, inflammation, cancer and other disorders |
US20100120694A1 (en) | 2008-06-04 | 2010-05-13 | Synergy Pharmaceuticals, Inc. | Agonists of Guanylate Cyclase Useful for the Treatment of Gastrointestinal Disorders, Inflammation, Cancer and Other Disorders |
US8207295B2 (en) | 2008-06-04 | 2012-06-26 | Synergy Pharmaceuticals, Inc. | Agonists of guanylate cyclase useful for the treatment of gastrointestinal disorders, inflammation, cancer and other disorders |
US8969514B2 (en) | 2007-06-04 | 2015-03-03 | Synergy Pharmaceuticals, Inc. | Agonists of guanylate cyclase useful for the treatment of hypercholesterolemia, atherosclerosis, coronary heart disease, gallstone, obesity and other cardiovascular diseases |
WO2010005515A2 (en) * | 2008-06-30 | 2010-01-14 | Ironwood Pharmaceuticals Incorporated | Protein expression methods |
ES2624828T3 (es) | 2008-07-16 | 2017-07-17 | Synergy Pharmaceuticals Inc. | Agonistas de la guanilato ciclasa útiles para el tratamiento de trastornos gastrointestinales, inflamación, cáncer y otros |
MX2011005245A (es) | 2008-11-19 | 2011-06-17 | Forest Lab Holdings Ltd | Forma cristalina de linaclotida. |
US20100221329A1 (en) | 2008-12-03 | 2010-09-02 | Synergy Pharmaceuticals, Inc. | Formulations of guanylate cyclase c agonists and methods of use |
EP2417152B1 (en) | 2009-04-10 | 2013-10-02 | Corden Pharma Colorado, Inc. | Process for isolating linaclotide |
US20130045239A1 (en) * | 2009-08-13 | 2013-02-21 | Ironwood Pharmaceuticals, Inc. | Method for Modulating the Pharmacodynamic Effect of Orally Administered Guanylate Cyclase Receptor Agonists |
BR112012011730A2 (pt) * | 2009-11-09 | 2016-03-08 | Ironwood Pharmaceuticals Inc | tratamentos para distúrbios gastrointestinais |
US8735360B2 (en) | 2009-12-07 | 2014-05-27 | Ironwood Pharmaceuticals, Inc. | Treatments for gastrointestinal disorders |
EP2605786A4 (en) * | 2010-06-09 | 2014-03-12 | Combimab Inc | THERAPEUTIC PEPTIDES |
JP6393037B2 (ja) | 2010-09-15 | 2018-09-19 | シナジー ファーマシューティカルズ インコーポレイテッド | グアニル酸シクラーゼcアゴニストの製剤および使用方法 |
US9616097B2 (en) | 2010-09-15 | 2017-04-11 | Synergy Pharmaceuticals, Inc. | Formulations of guanylate cyclase C agonists and methods of use |
WO2012155101A1 (en) | 2011-05-11 | 2012-11-15 | Ironwood Pharmaceuticals, Inc. | Treatments for gastrointestinal disorders |
WO2012155114A1 (en) | 2011-05-11 | 2012-11-15 | Ironwood Pharmaceuticals, Inc. | Peptides derived from uroguanylin and their use in gastrointestinal disorders |
US9617305B2 (en) | 2011-06-08 | 2017-04-11 | Ironwood Pharmaceuticals, Inc. | Treatments for gastrointestinal disorders |
US9527887B2 (en) | 2011-06-08 | 2016-12-27 | Ironwood Pharmaceutical, Inc. | Treatments for gastrointestinal disorders |
MD480Z5 (ro) * | 2011-07-07 | 2012-09-30 | Эльвира АНДОН | Metodă de tratament al colitei ulceroase nespecifice acute |
EA022546B1 (ru) * | 2011-09-28 | 2016-01-29 | Федеральное Государственное Бюджетное Учреждение Науки Институт Биоорганической Химии Им. Академиков М.М. Шемякина И Ю.А. Овчинникова Российской Академии Наук | Способ торможения роста карциномы эрлиха у лабораторного животного |
US20140018307A1 (en) * | 2012-07-12 | 2014-01-16 | Forest Laboratories Holdings Ltd. | Linaclotide compositions |
RU2528641C2 (ru) * | 2012-08-22 | 2014-09-20 | Государственное бюджетное образовательное учреждение высшего профессионального образования "Воронежская государственная медицинская академия им. Н.Н. Бурденко" Министерства здравоохранения и социального развития Российской Федерации | Способ лечения больных с синдромом диспепсии в сочетании с избыточной массой тела |
CN102875655B (zh) * | 2012-09-29 | 2014-12-17 | 深圳翰宇药业股份有限公司 | 一种合成利那洛肽的方法 |
EP2950803A1 (en) | 2013-01-30 | 2015-12-09 | Sandoz AG | Crystalline form of linaclotide |
WO2014151206A1 (en) | 2013-03-15 | 2014-09-25 | Synergy Pharmaceuticals Inc. | Agonists of guanylate cyclase and their uses |
EP3884935B1 (en) | 2013-08-09 | 2023-06-14 | Ardelyx, Inc. | Compounds and methods for inhibiting phosphate transport |
EA201792401A1 (ru) * | 2015-05-01 | 2018-05-31 | Айронвуд Фармасьютикалз, Инк. | Композиции для очищения толстого кишечника и лечения желудочно-кишечных расстройств |
US20190071504A1 (en) * | 2016-03-15 | 2019-03-07 | The Regents Of The University Of California | Methods And Compositions For Treating And Preventing Disease Associated With Alpha 8 Beta 1 Integrin |
CN107929718A (zh) * | 2017-10-19 | 2018-04-20 | 南京星银药业集团有限公司 | Glp‑1类似物及gc‑c受体激动剂组合物缓释制剂及其制备方法 |
CA3115178A1 (en) * | 2018-10-23 | 2020-04-30 | Abk Biomedical Incorporated | Delivery device |
CN109467606A (zh) * | 2018-11-15 | 2019-03-15 | 大连理工大学 | 一种大肠杆菌肠毒素STa-LTB-STb融合蛋白及其编码基因和应用 |
CN114340631A (zh) | 2019-05-21 | 2022-04-12 | 阿德利克斯股份有限公司 | 用于降低患者的血清磷酸盐的组合 |
RU2712761C1 (ru) * | 2019-07-02 | 2020-01-31 | Федеральное государственное бюджетное научное учреждение "Томский национальный исследовательский медицинский центр Российской академии наук" (Томский НИМЦ) | Средство для стимуляции регенерации эндотелия легких при сочетании метаболического синдрома и хронической обструктивной болезни легких |
CN111265653B (zh) * | 2020-02-09 | 2023-05-09 | 华中科技大学同济医学院附属协和医院 | 心房利钠肽在制备炎症性肠病治疗药物中的应用 |
WO2023144292A1 (en) | 2022-01-28 | 2023-08-03 | Fresenius Kabi Ipsum S.R.L. | Process for the preparation of linaclotide |
Citations (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US32684A (en) * | 1861-07-02 | Stump-extkactob | ||
US73628A (en) * | 1868-01-21 | mitchell | ||
US121961A (en) * | 1871-12-19 | Improvement in devices for supporting pipe-cores | ||
US152868A (en) * | 1874-07-07 | Improvement in type-setting machines | ||
US232013A (en) * | 1880-09-07 | Henry h | ||
US258687A (en) * | 1882-05-30 | Grain-binder | ||
US266989A (en) * | 1882-11-07 | Automatic fire | ||
US5140102A (en) * | 1991-09-23 | 1992-08-18 | Monsanto Company | Pentadecapeptide, guanylin, which stimulates intestinal guanylate cyclase |
US5395490A (en) * | 1993-05-14 | 1995-03-07 | Intertec, Ltd. | Method for treating materials by the application of electromagnetic energy at resonant absorption frequencies |
US5489670A (en) * | 1993-10-29 | 1996-02-06 | G. D. Searle & Co. | Human uroguanylin |
US5969097A (en) * | 1992-06-23 | 1999-10-19 | G. D. Searle & Co. | Human guanylin |
US6060037A (en) * | 1993-10-26 | 2000-05-09 | Thomas Jefferson University | Compositions that specifically bind to colorectal cancer cells and methods of using the same |
Family Cites Families (58)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
IE52535B1 (en) | 1981-02-16 | 1987-12-09 | Ici Plc | Continuous release pharmaceutical compositions |
US6342373B1 (en) * | 1983-11-21 | 2002-01-29 | Ucp Gen-Pharma Ag | Process for preparing recombinant eglin, protease inhibitor |
IT1217123B (it) | 1987-02-05 | 1990-03-14 | Rotta Research Lab | Derivati otticamente attivi dell acido 5 pentilammino 5 oxo pentanoico r ad attivita antagonista della colecistochinina e procedimento per la loro preparazione |
GB2209937B (en) | 1987-09-21 | 1991-07-03 | Depiopharm S A | Water insoluble polypeptides |
CH679207A5 (pt) | 1989-07-28 | 1992-01-15 | Debiopharm Sa | |
CA2046830C (en) | 1990-07-19 | 1999-12-14 | Patrick P. Deluca | Drug delivery system involving inter-action between protein or polypeptide and hydrophobic biodegradable polymer |
HUT64023A (en) | 1991-03-22 | 1993-11-29 | Sandoz Ag | Process for producing aminoguanidine derivatives and pharmaceutical compositions comprising such compounds |
FR2674849B1 (fr) | 1991-04-02 | 1994-12-23 | Logeais Labor Jacques | Nouveaux derives de n-cyclohexyl benzamides ou thiobenzamides, leurs preparations et leurs applications en therapeutique. |
CH683149A5 (fr) | 1991-07-22 | 1994-01-31 | Debio Rech Pharma Sa | Procédé pour la préparation de microsphères en matériau polymère biodégradable. |
CA2124958C (en) * | 1991-12-02 | 2007-02-13 | Vanitha Ramakrishnan | Inhibitory immunoglobulin polypeptides to human pdgf beta receptor |
WO1993013128A1 (en) | 1991-12-30 | 1993-07-08 | Neurex Corporation | Methods of producing analgesia and enhancing opiate analgesia |
US5824645A (en) | 1991-12-30 | 1998-10-20 | Neurex Corporation | Method of treating inflammation |
GB9211268D0 (en) | 1992-05-28 | 1992-07-15 | Ici Plc | Salts of basic peptides with carboxyterminated polyesters |
RU2146128C1 (ru) | 1993-01-06 | 2000-03-10 | Кинертон Лимитед | Ионный конъюгат с длительным периодом высвобождения пептида, способ синтезирования ионного конъюгата, способ синтезирования микрочастиц |
US5672659A (en) | 1993-01-06 | 1997-09-30 | Kinerton Limited | Ionic molecular conjugates of biodegradable polyesters and bioactive polypeptides |
US5610145A (en) | 1994-04-15 | 1997-03-11 | Warner-Lambert Company | Tachykinin antagonists |
US5612052A (en) | 1995-04-13 | 1997-03-18 | Poly-Med, Inc. | Hydrogel-forming, self-solvating absorbable polyester copolymers, and methods for use thereof |
US5795864A (en) | 1995-06-27 | 1998-08-18 | Neurex Corporation | Stable omega conopetide formulations |
US6054429A (en) | 1996-03-08 | 2000-04-25 | Elan Pharmaceuticals, Inc. | Epidural method of producing analgesia |
ATE235914T1 (de) | 1995-06-27 | 2003-04-15 | Elan Pharm Inc | Zusammensetzungen zur erzielung von analgesie und zur hemmung der progression neuropathischer schmerzerkrankungen |
IL124522A0 (en) | 1995-11-24 | 1998-12-06 | Smithkline Beecham Spa | Quinoline derivatives |
GB9524104D0 (en) | 1995-11-24 | 1996-01-24 | Smithkline Beecham Spa | Novel compounds |
PL329598A1 (en) | 1996-04-23 | 1999-03-29 | Kinerton Ltd | Acidic lactic acid polymers |
US6589750B2 (en) | 1997-02-20 | 2003-07-08 | Institut Pasteur | Therapeutic use of the SMR1 protein, the SMR1 maturation products, specifically the QHNPR pentapeptide as well as its biologically active derivatives |
DE59814173D1 (de) | 1997-02-28 | 2008-04-03 | Nycomed Gmbh | Synergistische kombination von pde-hemmern und adenylatcyclase-agonisten bzw. guanylcyclyse-agonisten |
US5893985A (en) | 1997-03-14 | 1999-04-13 | The Lincoln Electric Company | Plasma arc torch |
NZ329807A (en) | 1997-04-23 | 2000-07-28 | Pfizer | NK-1 receptor antagonists and P receptor antagonists 2-Diarylmethyl-3-amino-1-azabicyclo[2.2.2]octane derivatives and amino substituted N-containing rings as agents for treating irritable bowel syndrome |
ATE273996T1 (de) | 1997-09-12 | 2004-09-15 | Pharis Biotec Gmbh | Zusammensetzung zur therapie von diabetes mellitus und fettsucht |
US20010006972A1 (en) | 1998-04-21 | 2001-07-05 | Stephen A. Williams | Nk-1 receptor antagonists for the treatment of symptoms of irritable bowel syndrome |
IT1304152B1 (it) | 1998-12-10 | 2001-03-08 | Mediolanum Farmaceutici Srl | Composizioni comprendenti un peptide ed acido polilattico-glicolicoatte alla preparazione di impianti sottocutanei aventi un prolungato |
ATE291927T1 (de) | 1999-06-23 | 2005-04-15 | Pasteur Institut | Peptide zur behandlung von beeinträchtigten zwischenmenschlischen störungen und verhaltenstörungen |
KR20020031407A (ko) | 1999-08-18 | 2002-05-01 | 다푸르 가브리에 | 펩타이드의 서방형 제제 |
SE9903291D0 (sv) | 1999-09-15 | 1999-09-15 | Astra Ab | New process |
EP1220872A1 (en) | 1999-10-06 | 2002-07-10 | Pharmacia Corporation | Uroguanylin as an intestinal cancer inhibiting agent |
DE60013630T2 (de) | 1999-11-01 | 2005-09-15 | John Cardiff Rhodes | Arzneimittel zur behandlung von darmverstopfung und reizkolon |
AUPQ514600A0 (en) | 2000-01-18 | 2000-02-10 | James Cook University | Brain injury treatment |
AU3580001A (en) | 2000-03-01 | 2001-09-12 | University College London | Modulators of the endocannabinoid uptake and of the vallinoid receptors |
PT1216707E (pt) | 2000-12-22 | 2005-06-30 | Pasteur Institut | Novas utilizacoes terapeuticas para um smr-1-peptideo |
CA2435835A1 (en) | 2001-02-02 | 2002-08-15 | Pharmacia Corporation | Uroguanylin and cyclooxygenase-2 inhibitor combinations for inhibition of intestinal cancer |
CA2441970C (en) * | 2001-03-29 | 2013-01-22 | Synergy Pharmaceuticals, Inc. | Guanylate cyclase receptor agonists for the treatment of tissue inflammation and carcinogenesis |
WO2002079235A2 (en) | 2001-03-30 | 2002-10-10 | University Of Copenhagen | Compositions and methods for modulating guanylyl cyclase signaling receptor (gc-c) activity and for treating meniere's disease |
MY134211A (en) | 2001-05-18 | 2007-11-30 | Smithkline Beecham Corp | Novel use |
WO2002098912A2 (de) * | 2001-06-05 | 2002-12-12 | Yalcin Cetin | Luftseitig verabreichte guanylat cyclase c liganden für atemwegserkrankungen |
FR2830451B1 (fr) | 2001-10-09 | 2004-04-30 | Inst Nat Sante Rech Med | Utilisation de peptides analogues de la thymuline(pat)pour la fabrication de medicaments contre la douleur |
EP1321142A1 (en) | 2001-12-21 | 2003-06-25 | Novartis AG | Solid pharmaceutical composition for oral administration of Tegaserod |
US20040121961A1 (en) * | 2002-02-04 | 2004-06-24 | Jaime Masferrer | Uroguanylin and cyclooxygenase-2 inhibitor combinations for inhibition of intestinal cancer |
US20030232013A1 (en) | 2002-02-22 | 2003-12-18 | Gary Sieckman | Therapeutic and diagnostic targeting of cancers cells with tumor homing peptides |
EP1531846A4 (en) | 2002-02-27 | 2006-04-19 | Us Gov Health & Human Serv | CONJUGATES OF LIGAND, LINK AND CYTOTOXIC AGENS, AND RELATED COMPOSITIONS AND USE PROCESSES |
CA2479350A1 (en) | 2002-03-15 | 2003-09-25 | Cypress Bioscience, Inc. | Ne and 5-ht reuptake inhibitors for treating visceral pain syndromes |
CN101310723A (zh) | 2002-05-17 | 2008-11-26 | 迪欧加药品公司 | 有效的选择性阿片受体调制剂化合物的用途 |
US7371727B2 (en) * | 2003-01-28 | 2008-05-13 | Microbia, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
MXPA05008097A (es) * | 2003-01-28 | 2006-02-08 | Microbia Inc | Metodos y composiciones para el tratamiento de desordenes gastrointestinales. |
US20060281682A1 (en) * | 2003-01-28 | 2006-12-14 | Currie Mark G | Methods and compositions for the treatment of gastrointestinal disorders |
US7304036B2 (en) * | 2003-01-28 | 2007-12-04 | Microbia, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
US7772188B2 (en) * | 2003-01-28 | 2010-08-10 | Ironwood Pharmaceuticals, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
WO2004071436A2 (en) | 2003-02-10 | 2004-08-26 | Thomas Jefferson University | The use of gcc ligands |
CA2619650A1 (en) | 2005-08-19 | 2007-02-22 | Microbia, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
-
2004
- 2004-01-28 MX MXPA05008097A patent/MXPA05008097A/es active IP Right Grant
- 2004-01-28 EP EP07011869A patent/EP1911763B1/en not_active Expired - Lifetime
- 2004-01-28 PT PT10170038T patent/PT2246360E/pt unknown
- 2004-01-28 SG SG2012003802A patent/SG192300A1/en unknown
- 2004-01-28 NZ NZ570134A patent/NZ570134A/en not_active IP Right Cessation
- 2004-01-28 SI SI200431918T patent/SI2246360T1/sl unknown
- 2004-01-28 DK DK07011869.0T patent/DK1911763T3/da active
- 2004-01-28 DE DE602004028678T patent/DE602004028678D1/de not_active Expired - Lifetime
- 2004-01-28 US US10/766,735 patent/US20040266989A1/en not_active Abandoned
- 2004-01-28 SI SI200431521T patent/SI1911763T1/sl unknown
- 2004-01-28 CN CN2009102662250A patent/CN101787073B/zh not_active Expired - Lifetime
- 2004-01-28 KR KR1020117019764A patent/KR101227627B1/ko active IP Right Grant
- 2004-01-28 DE DE602004007105T patent/DE602004007105T2/de not_active Expired - Lifetime
- 2004-01-28 PT PT07011869T patent/PT1911763E/pt unknown
- 2004-01-28 ES ES07011869T patent/ES2350123T3/es not_active Expired - Lifetime
- 2004-01-28 AU AU2004210161A patent/AU2004210161B2/en active Active
- 2004-01-28 DK DK10170038.3T patent/DK2246360T3/da active
- 2004-01-28 SG SG200705302-8A patent/SG168407A1/en unknown
- 2004-01-28 KR KR1020057013966A patent/KR101227626B1/ko active IP Right Grant
- 2004-01-28 BR BRPI0407071A patent/BRPI0407071B8/pt active IP Right Grant
- 2004-01-28 AT AT04706011T patent/ATE365174T1/de active
- 2004-01-28 EP EP04706011A patent/EP1594517B1/en not_active Expired - Lifetime
- 2004-01-28 AT AT07011869T patent/ATE477268T1/de active
- 2004-01-28 PT PT04706011T patent/PT1594517E/pt unknown
- 2004-01-28 CN CN200480008533A patent/CN100589839C/zh not_active Expired - Lifetime
- 2004-01-28 CA CA2514507A patent/CA2514507C/en not_active Expired - Lifetime
- 2004-01-28 EP EP10170038A patent/EP2246360B1/en not_active Expired - Lifetime
- 2004-01-28 DK DK04706011T patent/DK1594517T3/da active
- 2004-01-28 NZ NZ541595A patent/NZ541595A/en not_active IP Right Cessation
- 2004-01-28 SI SI200430401T patent/SI1594517T1/sl unknown
- 2004-01-28 RU RU2005127058/15A patent/RU2353383C2/ru active
- 2004-01-28 JP JP2006503109A patent/JP4584911B2/ja not_active Expired - Lifetime
- 2004-01-28 ES ES10170038T patent/ES2387848T3/es not_active Expired - Lifetime
- 2004-01-28 WO PCT/US2004/002390 patent/WO2004069165A2/en active Application Filing
- 2004-01-28 ES ES04706011T patent/ES2285417T3/es not_active Expired - Lifetime
- 2004-01-28 BR BR122018074353A patent/BR122018074353B8/pt active IP Right Grant
- 2004-01-28 RU RU2008147983/15A patent/RU2543350C2/ru active
-
2005
- 2005-07-25 IL IL169863A patent/IL169863A/en active IP Right Grant
- 2005-08-18 NO NO20053864A patent/NO334112B1/no not_active IP Right Cessation
- 2005-11-23 HK HK05110618A patent/HK1078768A1/xx not_active IP Right Cessation
-
2007
- 2007-08-09 CY CY20071101072T patent/CY1110905T1/el unknown
- 2007-10-31 US US11/930,696 patent/US7704947B2/en not_active Expired - Lifetime
-
2009
- 2009-11-10 AU AU2009235993A patent/AU2009235993B2/en active Active
-
2010
- 2010-04-05 US US12/754,138 patent/US8080526B2/en not_active Expired - Lifetime
- 2010-06-22 JP JP2010141519A patent/JP5563384B2/ja not_active Expired - Lifetime
- 2010-11-04 CY CY20101101000T patent/CY1111058T1/el unknown
-
2012
- 2012-08-09 IL IL221380A patent/IL221380A0/en active IP Right Grant
- 2012-09-19 CY CY20121100859T patent/CY1113217T1/el unknown
-
2013
- 2013-02-28 JP JP2013038602A patent/JP5748791B2/ja not_active Expired - Lifetime
- 2013-04-05 NO NO20130460A patent/NO336768B1/no not_active IP Right Cessation
- 2013-05-22 LT LTPA2013013C patent/LTC1594517I2/lt unknown
- 2013-05-22 LU LU92201C patent/LU92201I2/fr unknown
- 2013-05-22 NL NL300593C patent/NL300593I2/nl unknown
- 2013-05-22 HU HUS1300022 patent/HUS1300022I1/hu unknown
- 2013-05-22 LU LU92200C patent/LU92200I2/fr unknown
- 2013-05-23 FR FR13C0030C patent/FR13C0030I1/fr active Active
- 2013-05-23 FR FR13C0029C patent/FR13C0029I2/fr active Active
- 2013-05-24 CY CY2013021C patent/CY2013021I1/el unknown
- 2013-05-24 CY CY2013022C patent/CY2013022I1/el unknown
- 2013-05-24 BE BE2013C032C patent/BE2013C032I2/nl unknown
Patent Citations (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US32684A (en) * | 1861-07-02 | Stump-extkactob | ||
US73628A (en) * | 1868-01-21 | mitchell | ||
US121961A (en) * | 1871-12-19 | Improvement in devices for supporting pipe-cores | ||
US152868A (en) * | 1874-07-07 | Improvement in type-setting machines | ||
US232013A (en) * | 1880-09-07 | Henry h | ||
US258687A (en) * | 1882-05-30 | Grain-binder | ||
US266989A (en) * | 1882-11-07 | Automatic fire | ||
US5140102A (en) * | 1991-09-23 | 1992-08-18 | Monsanto Company | Pentadecapeptide, guanylin, which stimulates intestinal guanylate cyclase |
US5969097A (en) * | 1992-06-23 | 1999-10-19 | G. D. Searle & Co. | Human guanylin |
US5395490A (en) * | 1993-05-14 | 1995-03-07 | Intertec, Ltd. | Method for treating materials by the application of electromagnetic energy at resonant absorption frequencies |
US6060037A (en) * | 1993-10-26 | 2000-05-09 | Thomas Jefferson University | Compositions that specifically bind to colorectal cancer cells and methods of using the same |
US5489670A (en) * | 1993-10-29 | 1996-02-06 | G. D. Searle & Co. | Human uroguanylin |
Cited By (49)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7304036B2 (en) | 2003-01-28 | 2007-12-04 | Microbia, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
US20090005534A1 (en) * | 2003-01-28 | 2009-01-01 | Microbia, Inc. | Methods and Compositions for the Treatment of Gastrointestinal Disorders |
US8080526B2 (en) | 2003-01-28 | 2011-12-20 | Ironwood Pharmaceuticals, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
US7371727B2 (en) | 2003-01-28 | 2008-05-13 | Microbia, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
US20060281682A1 (en) * | 2003-01-28 | 2006-12-14 | Currie Mark G | Methods and compositions for the treatment of gastrointestinal disorders |
US20090191611A1 (en) * | 2003-01-28 | 2009-07-30 | Currie Mark G | Methods and Compositions for the Treatment of Gastrointestinal Disorders |
US20110124583A1 (en) * | 2003-01-28 | 2011-05-26 | Ironwood Pharmaceuticals, Inc. | Methods and Compositions for the Treatment of Gastrointestinal Disorders |
US7910546B2 (en) | 2003-01-28 | 2011-03-22 | Ironwood Pharmaceuticals, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
US7704947B2 (en) | 2003-01-28 | 2010-04-27 | Ironwood Pharmaceuticals, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
US20090062207A1 (en) * | 2003-01-28 | 2009-03-05 | Currie Mark G | Methods and compositions for the treatment of gastrointestinal disorders |
US20060258593A1 (en) * | 2003-01-28 | 2006-11-16 | Currie Mark G | Methods and compositions for the treatment of gastrointestinal disorders |
US7772188B2 (en) | 2003-01-28 | 2010-08-10 | Ironwood Pharmaceuticals, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
US20060094658A1 (en) * | 2003-06-13 | 2006-05-04 | Currie Mark G | Method and compositions for the treatment of gastrointestinal disorders |
US7494979B2 (en) | 2003-06-13 | 2009-02-24 | Ironwood Pharmaceuticals, Inc. | Method for treating congestive heart failure and other disorders |
US8101579B2 (en) | 2003-06-13 | 2012-01-24 | Ironwood Pharmaceuticals, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
US20070010450A1 (en) * | 2003-06-13 | 2007-01-11 | Microbia, Inc., A Massachusetts Corporation | Methods and compositions for the treatment of gastrointestinal disorders |
US20100234301A1 (en) * | 2003-06-13 | 2010-09-16 | Ironwood Pharmaceuticals, Inc. | Methods and Compositions for the Treatment of Gastrointestinal Disorders |
US9840536B2 (en) | 2003-06-13 | 2017-12-12 | Ironwood Pharmaceuticals, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
US7745409B2 (en) | 2004-03-09 | 2010-06-29 | Ironwood Pharmaceuticals, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
WO2005087797A1 (en) * | 2004-03-09 | 2005-09-22 | Microbia, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
KR101202727B1 (ko) | 2004-03-09 | 2012-11-20 | 아이언우드 파마슈티컬스, 인코포레이티드 | 위장병 치료 방법 및 위장병 치료용 조성물 |
US20050266028A1 (en) * | 2004-05-25 | 2005-12-01 | University Of Georgia Research Foundation, Inc. | Compositions and methods for modulating an immune response |
US20070249717A1 (en) * | 2004-10-26 | 2007-10-25 | Ajinomoto Co. Inc | Preventive/therapeutic agent for visceral pain |
US20090253634A1 (en) * | 2005-08-19 | 2009-10-08 | Microbia, Inc. | Methods and Compositions for the Treatment of Gastrointestinal Disorders |
WO2007022531A3 (en) * | 2005-08-19 | 2008-01-24 | Microbia Inc | Methods and compositions for the treatment of gastrointestinal disorders |
EP3586846A1 (en) | 2005-09-29 | 2020-01-01 | Ipsen Pharma | Compositions and methods for stimulating gastrointestinal motility |
WO2007041278A2 (en) | 2005-09-29 | 2007-04-12 | Societe De Conseils De Recherches Et D'applications Scientifiques S.A.S. | Composition and methods for stimulating gastrointestinal motility |
US20090305993A1 (en) * | 2006-02-24 | 2009-12-10 | Ironwood Pharmaceuticals, Inc. | Methods and composition for the treatment of gastrointestinal disorders |
US8779090B2 (en) | 2007-02-26 | 2014-07-15 | Ironwood Pharmaceuticals, Inc. | Methods and compositions for the treatment of heart failure and other disorders |
WO2008106429A3 (en) * | 2007-02-26 | 2008-11-20 | Microbia Inc | Methods and compositions for the treatment of heart failure and other disorders |
US20100215779A1 (en) * | 2007-05-04 | 2010-08-26 | Currie Mark G | Compositions and Methods for Treating Disorders Associated with Salt or Fluid Retention |
EP2671584A3 (en) * | 2007-05-04 | 2014-03-26 | Ironwood Pharmaceuticals, Inc. | Compositions and methods for treating disorders associated with salt or fluid retention |
EP2152266A1 (en) * | 2007-05-04 | 2010-02-17 | Ironwood Pharmaceuticals, Inc. | Compositions and methods for treating disorders associated with salt or fluid retention |
US20120040025A9 (en) * | 2007-05-04 | 2012-02-16 | Currie Mark G | Compositions and Methods for Treating Disorders Associated with Salt or Fluid Retention |
EP2152266A4 (en) * | 2007-05-04 | 2010-07-28 | Ironwood Pharmaceuticals Inc | COMPOSITIONS AND METHODS OF TREATING DISORDERS RELATED TO SALT OR LIQUID RETENTION |
EP2671584A2 (en) * | 2007-05-04 | 2013-12-11 | Ironwood Pharmaceuticals, Inc. | Compositions and methods for treating disorders associated with salt or fluid retention |
US8802628B2 (en) * | 2008-08-15 | 2014-08-12 | Ironwood Pharmaceuticals, Inc. | Stable solid formulation of a GC-C receptor agonist polypeptide suitable for oral administration |
AU2009282446B2 (en) * | 2008-08-15 | 2016-03-31 | Ironwood Pharmaceuticals, Inc. | Linaclotide-containing formulations for oral administration |
US20100048489A1 (en) * | 2008-08-15 | 2010-02-25 | Ironwood Pharmaceuticals Inc. | Stable Solid Formulation of A GC-C Receptor Agonist Polypeptide Suitable for Oral Administration |
CN102186490A (zh) * | 2008-08-15 | 2011-09-14 | 硬木药品公司 | 适合口服给药的鸟苷酸环化酶-c受体激动剂多肽的稳定的固体制剂 |
CN114668711A (zh) * | 2008-08-15 | 2022-06-28 | 硬木药品公司 | 适合口服给药的鸟苷酸环化酶-c受体激动剂多肽的稳定的固体制剂 |
US8748573B2 (en) | 2009-08-06 | 2014-06-10 | Ironwood Pharmaceuticals, Inc. | Formulations comprising linaclotide |
US20110059903A1 (en) * | 2009-08-06 | 2011-03-10 | Ironwood Pharmaceuticals, Inc. | Formulations Comprising Linaclotide |
US8933030B2 (en) | 2010-02-17 | 2015-01-13 | Ironwwod Pharmaceuticals, Inc. | Treatments for gastrointestinal disorders |
WO2011145062A1 (en) | 2010-05-21 | 2011-11-24 | Link Research & Grants Corporation | Treatment of tinnitus and related auditory dysfunctions |
US10675325B2 (en) | 2010-08-11 | 2020-06-09 | Ironwood Pharmaceuticals, Inc. | Stable formulations of linaclotide |
US10702576B2 (en) | 2010-08-11 | 2020-07-07 | Ironwood Pharmaceuticals, Inc. | Stable formulations of linaclotide |
US9708371B2 (en) | 2011-08-17 | 2017-07-18 | Ironwood Pharmaceuticals, Inc. | Treatments for gastrointestinal disorders |
WO2021191865A1 (en) * | 2020-03-26 | 2021-09-30 | Dusa Pharmaceuticals, Inc. | Management of dermal neurofibromatosis lesions |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8080526B2 (en) | Methods and compositions for the treatment of gastrointestinal disorders | |
US8110553B2 (en) | Methods and compositions for the treatment of gastrointestinal disorders | |
US7910546B2 (en) | Methods and compositions for the treatment of gastrointestinal disorders | |
US20060281682A1 (en) | Methods and compositions for the treatment of gastrointestinal disorders |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: MICROBIA, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:CURRIE, MARK G.;MAHAJAN-MIKLOS, SHALINA;REEL/FRAME:015063/0399;SIGNING DATES FROM 20040217 TO 20040219 |
|
AS | Assignment |
Owner name: MICROBIA, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:NORMAN, THEA;MILNE, G. TODD;REEL/FRAME:016984/0683 Effective date: 20050610 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |