EP3790575A1 - Compositions solides comprenant un agoniste de glp-1 et un sel d'acide n-(8-(2-hydroxybenzoyl)amino)caprylique - Google Patents
Compositions solides comprenant un agoniste de glp-1 et un sel d'acide n-(8-(2-hydroxybenzoyl)amino)capryliqueInfo
- Publication number
- EP3790575A1 EP3790575A1 EP19720693.1A EP19720693A EP3790575A1 EP 3790575 A1 EP3790575 A1 EP 3790575A1 EP 19720693 A EP19720693 A EP 19720693A EP 3790575 A1 EP3790575 A1 EP 3790575A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- glp
- ethoxy
- agonist
- composition
- salt
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 239000003877 glucagon like peptide 1 receptor agonist Substances 0.000 title claims abstract description 170
- WWZKQHOCKIZLMA-UHFFFAOYSA-N octanoic acid Chemical compound CCCCCCCC(O)=O WWZKQHOCKIZLMA-UHFFFAOYSA-N 0.000 title claims abstract description 86
- 150000003839 salts Chemical class 0.000 title claims abstract description 82
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 title claims abstract description 71
- 239000005635 Caprylic acid (CAS 124-07-2) Substances 0.000 title claims abstract description 43
- 229960002446 octanoic acid Drugs 0.000 title claims abstract description 43
- 239000008247 solid mixture Substances 0.000 title claims description 7
- 239000000203 mixture Substances 0.000 claims abstract description 263
- 238000000034 method Methods 0.000 claims abstract description 78
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 39
- 239000003752 hydrotrope Substances 0.000 claims description 125
- QUCDWLYKDRVKMI-UHFFFAOYSA-M sodium;3,4-dimethylbenzenesulfonate Chemical compound [Na+].CC1=CC=C(S([O-])(=O)=O)C=C1C QUCDWLYKDRVKMI-UHFFFAOYSA-M 0.000 claims description 109
- DFPAKSUCGFBDDF-UHFFFAOYSA-N Nicotinamide Chemical group NC(=O)C1=CC=CN=C1 DFPAKSUCGFBDDF-UHFFFAOYSA-N 0.000 claims description 96
- GHMLBKRAJCXXBS-UHFFFAOYSA-N resorcinol Chemical compound OC1=CC=CC(O)=C1 GHMLBKRAJCXXBS-UHFFFAOYSA-N 0.000 claims description 78
- 229960003966 nicotinamide Drugs 0.000 claims description 48
- 235000005152 nicotinamide Nutrition 0.000 claims description 48
- 239000011570 nicotinamide Substances 0.000 claims description 48
- 239000000314 lubricant Substances 0.000 claims description 47
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 claims description 36
- 239000007787 solid Substances 0.000 claims description 32
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 26
- 125000001424 substituent group Chemical group 0.000 claims description 24
- DLSWIYLPEUIQAV-UHFFFAOYSA-N Semaglutide Chemical compound CCC(C)C(NC(=O)C(Cc1ccccc1)NC(=O)C(CCC(O)=O)NC(=O)C(CCCCNC(=O)COCCOCCNC(=O)COCCOCCNC(=O)CCC(NC(=O)CCCCCCCCCCCCCCCCC(O)=O)C(O)=O)NC(=O)C(C)NC(=O)C(C)NC(=O)C(CCC(N)=O)NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)C(CC(C)C)NC(=O)C(Cc1ccc(O)cc1)NC(=O)C(CO)NC(=O)C(CO)NC(=O)C(NC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(NC(=O)C(Cc1ccccc1)NC(=O)C(NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)C(C)(C)NC(=O)C(N)Cc1cnc[nH]1)C(C)O)C(C)O)C(C)C)C(=O)NC(C)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CCCNC(N)=N)C(=O)NCC(O)=O DLSWIYLPEUIQAV-UHFFFAOYSA-N 0.000 claims description 19
- 108010060325 semaglutide Proteins 0.000 claims description 19
- 229950011186 semaglutide Drugs 0.000 claims description 19
- 235000019359 magnesium stearate Nutrition 0.000 claims description 18
- 159000000000 sodium salts Chemical class 0.000 claims description 18
- 206010012601 diabetes mellitus Diseases 0.000 claims description 14
- 238000004519 manufacturing process Methods 0.000 claims description 14
- 208000008589 Obesity Diseases 0.000 claims description 12
- 230000001965 increasing effect Effects 0.000 claims description 12
- 235000020824 obesity Nutrition 0.000 claims description 12
- 239000008186 active pharmaceutical agent Substances 0.000 claims description 11
- 238000012545 processing Methods 0.000 claims description 9
- 238000003801 milling Methods 0.000 claims description 6
- 102000009027 Albumins Human genes 0.000 claims description 4
- 108010088751 Albumins Proteins 0.000 claims description 4
- YSDQQAXHVYUZIW-QCIJIYAXSA-N Liraglutide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCNC(=O)CC[C@H](NC(=O)CCCCCCCCCCCCCCC)C(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 YSDQQAXHVYUZIW-QCIJIYAXSA-N 0.000 claims description 4
- 108010019598 Liraglutide Proteins 0.000 claims description 4
- 229960002701 liraglutide Drugs 0.000 claims description 4
- BYNVYIUJKRRNNC-UHFFFAOYSA-N docosanoic acid;propane-1,2,3-triol Chemical compound OCC(O)CO.CCCCCCCCCCCCCCCCCCCCCC(O)=O BYNVYIUJKRRNNC-UHFFFAOYSA-N 0.000 claims 1
- 238000002360 preparation method Methods 0.000 abstract description 15
- 230000008569 process Effects 0.000 abstract description 13
- 239000003814 drug Substances 0.000 abstract description 4
- 125000001301 ethoxy group Chemical group [H]C([H])([H])C([H])([H])O* 0.000 description 128
- 101800004266 Glucagon-like peptide 1(7-37) Proteins 0.000 description 77
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 73
- GCYXWQUSHADNBF-AAEALURTSA-N preproglucagon 78-108 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 GCYXWQUSHADNBF-AAEALURTSA-N 0.000 description 64
- 239000008187 granular material Substances 0.000 description 37
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 description 28
- 239000000556 agonist Substances 0.000 description 28
- 150000001408 amides Chemical group 0.000 description 27
- 238000002156 mixing Methods 0.000 description 26
- 238000005469 granulation Methods 0.000 description 25
- 230000036515 potency Effects 0.000 description 25
- 230000003179 granulation Effects 0.000 description 24
- 125000000738 acetamido group Chemical group [H]C([H])([H])C(=O)N([H])[*] 0.000 description 23
- -1 C20 fatty acid Chemical class 0.000 description 22
- 229940124447 delivery agent Drugs 0.000 description 21
- WXTMDXOMEHJXQO-UHFFFAOYSA-N 2,5-dihydroxybenzoic acid Chemical compound OC(=O)C1=CC(O)=CC=C1O WXTMDXOMEHJXQO-UHFFFAOYSA-N 0.000 description 20
- 102000008100 Human Serum Albumin Human genes 0.000 description 20
- 108091006905 Human Serum Albumin Proteins 0.000 description 20
- 238000011282 treatment Methods 0.000 description 20
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 19
- WQGWDDDVZFFDIG-UHFFFAOYSA-N pyrogallol Chemical compound OC1=CC=CC(O)=C1O WQGWDDDVZFFDIG-UHFFFAOYSA-N 0.000 description 18
- 239000007921 spray Substances 0.000 description 17
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 description 16
- 102400000322 Glucagon-like peptide 1 Human genes 0.000 description 16
- 108090000765 processed proteins & peptides Proteins 0.000 description 16
- 238000007908 dry granulation Methods 0.000 description 15
- 238000007792 addition Methods 0.000 description 14
- 230000002265 prevention Effects 0.000 description 14
- 238000010521 absorption reaction Methods 0.000 description 12
- 239000000463 material Substances 0.000 description 12
- 241000282472 Canis lupus familiaris Species 0.000 description 11
- 238000003556 assay Methods 0.000 description 11
- 150000001875 compounds Chemical class 0.000 description 11
- 238000012217 deletion Methods 0.000 description 11
- 230000037430 deletion Effects 0.000 description 11
- 238000009490 roller compaction Methods 0.000 description 11
- 238000006467 substitution reaction Methods 0.000 description 11
- 238000012360 testing method Methods 0.000 description 11
- 239000003795 chemical substances by application Substances 0.000 description 10
- 229960005219 gentisic acid Drugs 0.000 description 10
- 239000003112 inhibitor Substances 0.000 description 10
- 238000003780 insertion Methods 0.000 description 10
- 230000037431 insertion Effects 0.000 description 10
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 10
- LDHMAVIPBRSVRG-UHFFFAOYSA-O 1-methylnicotinamide Chemical compound C[N+]1=CC=CC(C(N)=O)=C1 LDHMAVIPBRSVRG-UHFFFAOYSA-O 0.000 description 9
- DFPAKSUCGFBDDF-ZQBYOMGUSA-N [14c]-nicotinamide Chemical compound N[14C](=O)C1=CC=CN=C1 DFPAKSUCGFBDDF-ZQBYOMGUSA-N 0.000 description 9
- IMNDHOCGZLYMRO-UHFFFAOYSA-N n,n-dimethylbenzamide Chemical compound CN(C)C(=O)C1=CC=CC=C1 IMNDHOCGZLYMRO-UHFFFAOYSA-N 0.000 description 9
- 229940079877 pyrogallol Drugs 0.000 description 9
- 239000004094 surface-active agent Substances 0.000 description 9
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 9
- FJKROLUGYXJWQN-UHFFFAOYSA-N 4-hydroxybenzoic acid Chemical compound OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 8
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 8
- WXMKPNITSTVMEF-UHFFFAOYSA-M sodium benzoate Chemical compound [Na+].[O-]C(=O)C1=CC=CC=C1 WXMKPNITSTVMEF-UHFFFAOYSA-M 0.000 description 8
- 239000004299 sodium benzoate Substances 0.000 description 8
- 235000010234 sodium benzoate Nutrition 0.000 description 8
- DMBUODUULYCPAK-UHFFFAOYSA-N 1,3-bis(docosanoyloxy)propan-2-yl docosanoate Chemical compound CCCCCCCCCCCCCCCCCCCCCC(=O)OCC(OC(=O)CCCCCCCCCCCCCCCCCCCCC)COC(=O)CCCCCCCCCCCCCCCCCCCCC DMBUODUULYCPAK-UHFFFAOYSA-N 0.000 description 7
- 239000005557 antagonist Substances 0.000 description 7
- 125000004063 butyryl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 7
- WWZKQHOCKIZLMA-UHFFFAOYSA-M octanoate Chemical compound CCCCCCCC([O-])=O WWZKQHOCKIZLMA-UHFFFAOYSA-M 0.000 description 7
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 7
- 238000001694 spray drying Methods 0.000 description 7
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 6
- 125000000539 amino acid group Chemical group 0.000 description 6
- 239000011230 binding agent Substances 0.000 description 6
- 239000002775 capsule Substances 0.000 description 6
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 description 6
- 238000007906 compression Methods 0.000 description 6
- NKLCHDQGUHMCGL-UHFFFAOYSA-N cyclohexylidenemethanone Chemical group O=C=C1CCCCC1 NKLCHDQGUHMCGL-UHFFFAOYSA-N 0.000 description 6
- NCYVXEGFNDZQCU-UHFFFAOYSA-N nikethamide Chemical compound CCN(CC)C(=O)C1=CC=CN=C1 NCYVXEGFNDZQCU-UHFFFAOYSA-N 0.000 description 6
- 229960001755 resorcinol Drugs 0.000 description 6
- QZAYGJVTTNCVMB-UHFFFAOYSA-N serotonin Chemical compound C1=C(O)C=C2C(CCN)=CNC2=C1 QZAYGJVTTNCVMB-UHFFFAOYSA-N 0.000 description 6
- 229940048842 sodium xylenesulfonate Drugs 0.000 description 6
- KVCGISUBCHHTDD-UHFFFAOYSA-M sodium;4-methylbenzenesulfonate Chemical compound [Na+].CC1=CC=C(S([O-])(=O)=O)C=C1 KVCGISUBCHHTDD-UHFFFAOYSA-M 0.000 description 6
- NASFKTWZWDYFER-UHFFFAOYSA-N sodium;hydrate Chemical compound O.[Na] NASFKTWZWDYFER-UHFFFAOYSA-N 0.000 description 6
- 238000005550 wet granulation Methods 0.000 description 6
- WMBWREPUVVBILR-WIYYLYMNSA-N (-)-Epigallocatechin-3-o-gallate Chemical compound O([C@@H]1CC2=C(O)C=C(C=C2O[C@@H]1C=1C=C(O)C(O)=C(O)C=1)O)C(=O)C1=CC(O)=C(O)C(O)=C1 WMBWREPUVVBILR-WIYYLYMNSA-N 0.000 description 5
- YBBLOADPFWKNGS-UHFFFAOYSA-N 1,1-dimethylurea Chemical compound CN(C)C(N)=O YBBLOADPFWKNGS-UHFFFAOYSA-N 0.000 description 5
- UUJAFUUULNATAB-UHFFFAOYSA-N 4-hydroxybenzoic acid;sodium Chemical compound [Na].OC(=O)C1=CC=C(O)C=C1 UUJAFUUULNATAB-UHFFFAOYSA-N 0.000 description 5
- WMBWREPUVVBILR-UHFFFAOYSA-N GCG Natural products C=1C(O)=C(O)C(O)=CC=1C1OC2=CC(O)=CC(O)=C2CC1OC(=O)C1=CC(O)=C(O)C(O)=C1 WMBWREPUVVBILR-UHFFFAOYSA-N 0.000 description 5
- 108010004460 Gastric Inhibitory Polypeptide Proteins 0.000 description 5
- 102100039994 Gastric inhibitory polypeptide Human genes 0.000 description 5
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 5
- 102000004877 Insulin Human genes 0.000 description 5
- 108090001061 Insulin Proteins 0.000 description 5
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 5
- WHNWPMSKXPGLAX-UHFFFAOYSA-N N-Vinyl-2-pyrrolidone Chemical compound C=CN1CCCC1=O WHNWPMSKXPGLAX-UHFFFAOYSA-N 0.000 description 5
- ABBQHOQBGMUPJH-UHFFFAOYSA-M Sodium salicylate Chemical compound [Na+].OC1=CC=CC=C1C([O-])=O ABBQHOQBGMUPJH-UHFFFAOYSA-M 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 230000006835 compression Effects 0.000 description 5
- 239000003623 enhancer Substances 0.000 description 5
- 229940030275 epigallocatechin gallate Drugs 0.000 description 5
- 108010063245 glucagon-like peptide 1 (7-36)amide Proteins 0.000 description 5
- 238000009474 hot melt extrusion Methods 0.000 description 5
- 239000004615 ingredient Substances 0.000 description 5
- 229940125396 insulin Drugs 0.000 description 5
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 5
- 239000008108 microcrystalline cellulose Substances 0.000 description 5
- 229940016286 microcrystalline cellulose Drugs 0.000 description 5
- 244000309715 mini pig Species 0.000 description 5
- 239000006186 oral dosage form Substances 0.000 description 5
- 229940069328 povidone Drugs 0.000 description 5
- 239000011734 sodium Substances 0.000 description 5
- 229910052708 sodium Inorganic materials 0.000 description 5
- 229960003885 sodium benzoate Drugs 0.000 description 5
- 229960004025 sodium salicylate Drugs 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- TUSDEZXZIZRFGC-UHFFFAOYSA-N 1-O-galloyl-3,6-(R)-HHDP-beta-D-glucose Natural products OC1C(O2)COC(=O)C3=CC(O)=C(O)C(O)=C3C3=C(O)C(O)=C(O)C=C3C(=O)OC1C(O)C2OC(=O)C1=CC(O)=C(O)C(O)=C1 TUSDEZXZIZRFGC-UHFFFAOYSA-N 0.000 description 4
- 229940090248 4-hydroxybenzoic acid Drugs 0.000 description 4
- 208000028399 Critical Illness Diseases 0.000 description 4
- 239000001263 FEMA 3042 Substances 0.000 description 4
- LRBQNJMCXXYXIU-PPKXGCFTSA-N Penta-digallate-beta-D-glucose Natural products OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-PPKXGCFTSA-N 0.000 description 4
- 241000700159 Rattus Species 0.000 description 4
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 4
- 238000000498 ball milling Methods 0.000 description 4
- 238000010241 blood sampling Methods 0.000 description 4
- 235000014113 dietary fatty acids Nutrition 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- 239000000194 fatty acid Substances 0.000 description 4
- 229930195729 fatty acid Natural products 0.000 description 4
- 239000012530 fluid Substances 0.000 description 4
- 239000008103 glucose Substances 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- BVOCPVIXARZNQN-UHFFFAOYSA-N nipecotamide Chemical compound NC(=O)C1CCCNC1 BVOCPVIXARZNQN-UHFFFAOYSA-N 0.000 description 4
- 229910052757 nitrogen Inorganic materials 0.000 description 4
- XAEFZNCEHLXOMS-UHFFFAOYSA-M potassium benzoate Chemical compound [K+].[O-]C(=O)C1=CC=CC=C1 XAEFZNCEHLXOMS-UHFFFAOYSA-M 0.000 description 4
- YGSDEFSMJLZEOE-UHFFFAOYSA-N salicylic acid Chemical compound OC(=O)C1=CC=CC=C1O YGSDEFSMJLZEOE-UHFFFAOYSA-N 0.000 description 4
- 229920002258 tannic acid Polymers 0.000 description 4
- LRBQNJMCXXYXIU-NRMVVENXSA-N tannic acid Chemical compound OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-NRMVVENXSA-N 0.000 description 4
- 229940033123 tannic acid Drugs 0.000 description 4
- 235000015523 tannic acid Nutrition 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- DVSLBDBGAXXLKZ-UHFFFAOYSA-N 2,3-diethylbenzamide Chemical compound CCC1=CC=CC(C(N)=O)=C1CC DVSLBDBGAXXLKZ-UHFFFAOYSA-N 0.000 description 3
- 229920002261 Corn starch Polymers 0.000 description 3
- 102100021752 Corticoliberin Human genes 0.000 description 3
- 239000000055 Corticotropin-Releasing Hormone Substances 0.000 description 3
- 108010022152 Corticotropin-Releasing Hormone Proteins 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- 208000002705 Glucose Intolerance Diseases 0.000 description 3
- 101000788682 Homo sapiens GATA-type zinc finger protein 1 Proteins 0.000 description 3
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 3
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 description 3
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 102000034527 Retinoid X Receptors Human genes 0.000 description 3
- 108010038912 Retinoid X Receptors Proteins 0.000 description 3
- ZZXDRXVIRVJQBT-UHFFFAOYSA-M Xylenesulfonate Chemical compound CC1=CC=CC(S([O-])(=O)=O)=C1C ZZXDRXVIRVJQBT-UHFFFAOYSA-M 0.000 description 3
- 239000013543 active substance Substances 0.000 description 3
- 239000012615 aggregate Substances 0.000 description 3
- 125000003118 aryl group Chemical group 0.000 description 3
- 238000010923 batch production Methods 0.000 description 3
- FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 3
- 150000001768 cations Chemical class 0.000 description 3
- 239000001913 cellulose Substances 0.000 description 3
- 235000010980 cellulose Nutrition 0.000 description 3
- 229920002678 cellulose Polymers 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 239000008120 corn starch Substances 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 235000019700 dicalcium phosphate Nutrition 0.000 description 3
- 238000001125 extrusion Methods 0.000 description 3
- 239000000945 filler Substances 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 239000012943 hotmelt Substances 0.000 description 3
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 3
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 3
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 3
- 230000002473 insulinotropic effect Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 230000036470 plasma concentration Effects 0.000 description 3
- 201000009104 prediabetes syndrome Diseases 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 125000001501 propionyl group Chemical group O=C([*])C([H])([H])C([H])([H])[H] 0.000 description 3
- 229940044601 receptor agonist Drugs 0.000 description 3
- 239000000018 receptor agonist Substances 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 229940076279 serotonin Drugs 0.000 description 3
- 238000007873 sieving Methods 0.000 description 3
- 208000011580 syndromic disease Diseases 0.000 description 3
- 239000000454 talc Substances 0.000 description 3
- 229910052623 talc Inorganic materials 0.000 description 3
- 235000012222 talc Nutrition 0.000 description 3
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 3
- 229940071104 xylenesulfonate Drugs 0.000 description 3
- UUUHXMGGBIUAPW-UHFFFAOYSA-N 1-[1-[2-[[5-amino-2-[[1-[5-(diaminomethylideneamino)-2-[[1-[3-(1h-indol-3-yl)-2-[(5-oxopyrrolidine-2-carbonyl)amino]propanoyl]pyrrolidine-2-carbonyl]amino]pentanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-3-methylpentanoyl]pyrrolidine-2-carbon Chemical compound C1CCC(C(=O)N2C(CCC2)C(O)=O)N1C(=O)C(C(C)CC)NC(=O)C(CCC(N)=O)NC(=O)C1CCCN1C(=O)C(CCCN=C(N)N)NC(=O)C1CCCN1C(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C1CCC(=O)N1 UUUHXMGGBIUAPW-UHFFFAOYSA-N 0.000 description 2
- 102100040214 Apolipoprotein(a) Human genes 0.000 description 2
- 101710115418 Apolipoprotein(a) Proteins 0.000 description 2
- 229920003084 Avicel® PH-102 Polymers 0.000 description 2
- KXLUWEYBZBGJRZ-POEOZHCLSA-N Canin Chemical compound O([C@H]12)[C@]1([C@](CC[C@H]1C(=C)C(=O)O[C@@H]11)(C)O)[C@@H]1[C@@]1(C)[C@@H]2O1 KXLUWEYBZBGJRZ-POEOZHCLSA-N 0.000 description 2
- 206010007558 Cardiac failure chronic Diseases 0.000 description 2
- 208000024172 Cardiovascular disease Diseases 0.000 description 2
- GPFVKTQSZOQXLY-UHFFFAOYSA-N Chrysartemin A Natural products CC1(O)C2OC2C34OC3(C)CC5C(CC14)OC(=O)C5=C GPFVKTQSZOQXLY-UHFFFAOYSA-N 0.000 description 2
- 102100032165 Corticotropin-releasing factor-binding protein Human genes 0.000 description 2
- JVHXJTBJCFBINQ-ADAARDCZSA-N Dapagliflozin Chemical compound C1=CC(OCC)=CC=C1CC1=CC([C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)=CC=C1Cl JVHXJTBJCFBINQ-ADAARDCZSA-N 0.000 description 2
- 102000016622 Dipeptidyl Peptidase 4 Human genes 0.000 description 2
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 2
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 description 2
- 108010086246 Glucagon-Like Peptide-1 Receptor Proteins 0.000 description 2
- 102100032882 Glucagon-like peptide 1 receptor Human genes 0.000 description 2
- 229940089838 Glucagon-like peptide 1 receptor agonist Drugs 0.000 description 2
- 102000018997 Growth Hormone Human genes 0.000 description 2
- 108010051696 Growth Hormone Proteins 0.000 description 2
- 239000004354 Hydroxyethyl cellulose Substances 0.000 description 2
- UQSXHKLRYXJYBZ-UHFFFAOYSA-N Iron oxide Chemical compound [Fe]=O UQSXHKLRYXJYBZ-UHFFFAOYSA-N 0.000 description 2
- 208000035180 MODY Diseases 0.000 description 2
- 239000000637 Melanocyte-Stimulating Hormone Substances 0.000 description 2
- 108010007013 Melanocyte-Stimulating Hormones Proteins 0.000 description 2
- 101710151321 Melanostatin Proteins 0.000 description 2
- 102100040200 Mitochondrial uncoupling protein 2 Human genes 0.000 description 2
- 102400000064 Neuropeptide Y Human genes 0.000 description 2
- 102100038991 Neuropeptide Y receptor type 2 Human genes 0.000 description 2
- 101710197945 Neuropeptide Y receptor type 2 Proteins 0.000 description 2
- 102000028435 Neuropeptide Y4 receptor Human genes 0.000 description 2
- 108010002245 Neuropeptide Y4 receptor Proteins 0.000 description 2
- 102000004270 Peptidyl-Dipeptidase A Human genes 0.000 description 2
- 108090000882 Peptidyl-Dipeptidase A Proteins 0.000 description 2
- 102000007562 Serum Albumin Human genes 0.000 description 2
- 108010071390 Serum Albumin Proteins 0.000 description 2
- 235000021355 Stearic acid Nutrition 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- 206010051379 Systemic Inflammatory Response Syndrome Diseases 0.000 description 2
- GWEVSGVZZGPLCZ-UHFFFAOYSA-N Titan oxide Chemical compound O=[Ti]=O GWEVSGVZZGPLCZ-UHFFFAOYSA-N 0.000 description 2
- 102000018594 Tumour necrosis factor Human genes 0.000 description 2
- 108050007852 Tumour necrosis factor Proteins 0.000 description 2
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 2
- 150000001413 amino acids Chemical class 0.000 description 2
- 230000036528 appetite Effects 0.000 description 2
- 235000019789 appetite Nutrition 0.000 description 2
- 206010003119 arrhythmia Diseases 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 159000000007 calcium salts Chemical class 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 239000001768 carboxy methyl cellulose Substances 0.000 description 2
- 230000000747 cardiac effect Effects 0.000 description 2
- JUFFVKRROAPVBI-PVOYSMBESA-N chembl1210015 Chemical group C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@]3(O[C@@H](C[C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C3)C(O)=O)O2)O)[C@@H](CO)O1)NC(C)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 JUFFVKRROAPVBI-PVOYSMBESA-N 0.000 description 2
- AOXOCDRNSPFDPE-UKEONUMOSA-N chembl413654 Chemical compound C([C@H](C(=O)NCC(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@H](CCSC)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](C)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)CNC(=O)[C@@H](N)CCC(O)=O)C1=CC=C(O)C=C1 AOXOCDRNSPFDPE-UKEONUMOSA-N 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- ZPUCINDJVBIVPJ-LJISPDSOSA-N cocaine Chemical compound O([C@H]1C[C@@H]2CC[C@@H](N2C)[C@H]1C(=O)OC)C(=O)C1=CC=CC=C1 ZPUCINDJVBIVPJ-LJISPDSOSA-N 0.000 description 2
- 208000029078 coronary artery disease Diseases 0.000 description 2
- 108010083720 corticotropin releasing factor-binding protein Proteins 0.000 description 2
- 238000002425 crystallisation Methods 0.000 description 2
- 230000008025 crystallization Effects 0.000 description 2
- 229960003834 dapagliflozin Drugs 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- 229940095079 dicalcium phosphate anhydrous Drugs 0.000 description 2
- 239000007884 disintegrant Substances 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 239000002706 dry binder Substances 0.000 description 2
- 238000001035 drying Methods 0.000 description 2
- 229960003345 empagliflozin Drugs 0.000 description 2
- OBWASQILIWPZMG-QZMOQZSNSA-N empagliflozin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1C1=CC=C(Cl)C(CC=2C=CC(O[C@@H]3COCC3)=CC=2)=C1 OBWASQILIWPZMG-QZMOQZSNSA-N 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- MVPICKVDHDWCJQ-UHFFFAOYSA-N ethyl 3-pyrrolidin-1-ylpropanoate Chemical compound CCOC(=O)CCN1CCCC1 MVPICKVDHDWCJQ-UHFFFAOYSA-N 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 230000037406 food intake Effects 0.000 description 2
- 235000012631 food intake Nutrition 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 229940049654 glyceryl behenate Drugs 0.000 description 2
- 125000003976 glyceryl group Chemical group [H]C([*])([H])C(O[H])([H])C(O[H])([H])[H] 0.000 description 2
- 238000000227 grinding Methods 0.000 description 2
- 239000000122 growth hormone Substances 0.000 description 2
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 description 2
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 2
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 208000017169 kidney disease Diseases 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 201000006950 maturity-onset diabetes of the young Diseases 0.000 description 2
- 239000004570 mortar (masonry) Substances 0.000 description 2
- URPYMXQQVHTUDU-OFGSCBOVSA-N nucleopeptide y Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 URPYMXQQVHTUDU-OFGSCBOVSA-N 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 2
- 239000008203 oral pharmaceutical composition Substances 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 208000033808 peripheral neuropathy Diseases 0.000 description 2
- 229920001983 poloxamer Polymers 0.000 description 2
- 201000010065 polycystic ovary syndrome Diseases 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- AQHHHDLHHXJYJD-UHFFFAOYSA-N propranolol Chemical compound C1=CC=C2C(OCC(O)CNC(C)C)=CC=CC2=C1 AQHHHDLHHXJYJD-UHFFFAOYSA-N 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000000697 serotonin reuptake Effects 0.000 description 2
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 2
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 2
- 229920003109 sodium starch glycolate Polymers 0.000 description 2
- 239000008109 sodium starch glycolate Substances 0.000 description 2
- 229940079832 sodium starch glycolate Drugs 0.000 description 2
- 229940045902 sodium stearyl fumarate Drugs 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 229910001220 stainless steel Inorganic materials 0.000 description 2
- 239000010935 stainless steel Substances 0.000 description 2
- 239000008117 stearic acid Substances 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 230000009747 swallowing Effects 0.000 description 2
- 239000008399 tap water Substances 0.000 description 2
- 235000020679 tap water Nutrition 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 229910021642 ultra pure water Inorganic materials 0.000 description 2
- 239000012498 ultrapure water Substances 0.000 description 2
- HMJIYCCIJYRONP-UHFFFAOYSA-N (+-)-Isradipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OC(C)C)C1C1=CC=CC2=NON=C12 HMJIYCCIJYRONP-UHFFFAOYSA-N 0.000 description 1
- QKDRXGFQVGOQKS-CRSSMBPESA-N (2s,3r,4r,5s,6r)-2-[4-chloro-3-[(4-ethoxyphenyl)methyl]phenyl]-6-methylsulfanyloxane-3,4,5-triol Chemical compound C1=CC(OCC)=CC=C1CC1=CC([C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](SC)O2)O)=CC=C1Cl QKDRXGFQVGOQKS-CRSSMBPESA-N 0.000 description 1
- BTCRKOKVYTVOLU-SJSRKZJXSA-N (2s,3r,4r,5s,6r)-2-[4-chloro-3-[[4-(2-cyclopropyloxyethoxy)phenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1C1=CC=C(Cl)C(CC=2C=CC(OCCOC3CC3)=CC=2)=C1 BTCRKOKVYTVOLU-SJSRKZJXSA-N 0.000 description 1
- BIDNLKIUORFRQP-XYGFDPSESA-N (2s,4s)-4-cyclohexyl-1-[2-[[(1s)-2-methyl-1-propanoyloxypropoxy]-(4-phenylbutyl)phosphoryl]acetyl]pyrrolidine-2-carboxylic acid Chemical compound C([P@@](=O)(O[C@H](OC(=O)CC)C(C)C)CC(=O)N1[C@@H](C[C@H](C1)C1CCCCC1)C(O)=O)CCCC1=CC=CC=C1 BIDNLKIUORFRQP-XYGFDPSESA-N 0.000 description 1
- METKIMKYRPQLGS-GFCCVEGCSA-N (R)-atenolol Chemical compound CC(C)NC[C@@H](O)COC1=CC=C(CC(N)=O)C=C1 METKIMKYRPQLGS-GFCCVEGCSA-N 0.000 description 1
- KWTSXDURSIMDCE-QMMMGPOBSA-N (S)-amphetamine Chemical compound C[C@H](N)CC1=CC=CC=C1 KWTSXDURSIMDCE-QMMMGPOBSA-N 0.000 description 1
- TWBNMYSKRDRHAT-RCWTXCDDSA-N (S)-timolol hemihydrate Chemical compound O.CC(C)(C)NC[C@H](O)COC1=NSN=C1N1CCOCC1.CC(C)(C)NC[C@H](O)COC1=NSN=C1N1CCOCC1 TWBNMYSKRDRHAT-RCWTXCDDSA-N 0.000 description 1
- SGTNSNPWRIOYBX-UHFFFAOYSA-N 2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile Chemical compound C1=C(OC)C(OC)=CC=C1CCN(C)CCCC(C#N)(C(C)C)C1=CC=C(OC)C(OC)=C1 SGTNSNPWRIOYBX-UHFFFAOYSA-N 0.000 description 1
- RUVRGYVESPRHSZ-UHFFFAOYSA-N 2-[2-(2-azaniumylethoxy)ethoxy]acetate Chemical compound NCCOCCOCC(O)=O RUVRGYVESPRHSZ-UHFFFAOYSA-N 0.000 description 1
- 125000003816 2-hydroxybenzoyl group Chemical group OC1=C(C(=O)*)C=CC=C1 0.000 description 1
- ZCSHACFHMFHFKK-UHFFFAOYSA-N 2-methyl-1,3,5-trinitrobenzene;2,4,6-trinitro-1,3,5-triazinane Chemical compound [O-][N+](=O)C1NC([N+]([O-])=O)NC([N+]([O-])=O)N1.CC1=C([N+]([O-])=O)C=C([N+]([O-])=O)C=C1[N+]([O-])=O ZCSHACFHMFHFKK-UHFFFAOYSA-N 0.000 description 1
- UIAGMCDKSXEBJQ-IBGZPJMESA-N 3-o-(2-methoxyethyl) 5-o-propan-2-yl (4s)-2,6-dimethyl-4-(3-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate Chemical compound COCCOC(=O)C1=C(C)NC(C)=C(C(=O)OC(C)C)[C@H]1C1=CC=CC([N+]([O-])=O)=C1 UIAGMCDKSXEBJQ-IBGZPJMESA-N 0.000 description 1
- SWLAMJPTOQZTAE-UHFFFAOYSA-N 4-[2-[(5-chloro-2-methoxybenzoyl)amino]ethyl]benzoic acid Chemical class COC1=CC=C(Cl)C=C1C(=O)NCCC1=CC=C(C(O)=O)C=C1 SWLAMJPTOQZTAE-UHFFFAOYSA-N 0.000 description 1
- RZTAMFZIAATZDJ-HNNXBMFYSA-N 5-o-ethyl 3-o-methyl (4s)-4-(2,3-dichlorophenyl)-2,6-dimethyl-1,4-dihydropyridine-3,5-dicarboxylate Chemical compound CCOC(=O)C1=C(C)NC(C)=C(C(=O)OC)[C@@H]1C1=CC=CC(Cl)=C1Cl RZTAMFZIAATZDJ-HNNXBMFYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 206010002383 Angina Pectoris Diseases 0.000 description 1
- 102000007592 Apolipoproteins Human genes 0.000 description 1
- 108010071619 Apolipoproteins Proteins 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 230000024704 B cell apoptotic process Effects 0.000 description 1
- 208000031729 Bacteremia Diseases 0.000 description 1
- XPCFTKFZXHTYIP-PMACEKPBSA-N Benazepril Chemical compound C([C@@H](C(=O)OCC)N[C@@H]1C(N(CC(O)=O)C2=CC=CC=C2CC1)=O)CC1=CC=CC=C1 XPCFTKFZXHTYIP-PMACEKPBSA-N 0.000 description 1
- 229940123208 Biguanide Drugs 0.000 description 1
- 108010051479 Bombesin Proteins 0.000 description 1
- 102000013585 Bombesin Human genes 0.000 description 1
- 201000006474 Brain Ischemia Diseases 0.000 description 1
- 206010006550 Bulimia nervosa Diseases 0.000 description 1
- 101100335894 Caenorhabditis elegans gly-8 gene Proteins 0.000 description 1
- 229940127291 Calcium channel antagonist Drugs 0.000 description 1
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 206010008120 Cerebral ischaemia Diseases 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 101800001982 Cholecystokinin Proteins 0.000 description 1
- 102100025841 Cholecystokinin Human genes 0.000 description 1
- 229920001268 Cholestyramine Polymers 0.000 description 1
- 229920002911 Colestipol Polymers 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 229920002785 Croscarmellose sodium Polymers 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- XUIIKFGFIJCVMT-GFCCVEGCSA-N D-thyroxine Chemical compound IC1=CC(C[C@@H](N)C(O)=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-GFCCVEGCSA-N 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 208000002249 Diabetes Complications Diseases 0.000 description 1
- 206010012655 Diabetic complications Diseases 0.000 description 1
- 206010052337 Diastolic dysfunction Diseases 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 208000032928 Dyslipidaemia Diseases 0.000 description 1
- 231100000491 EC50 Toxicity 0.000 description 1
- 239000004150 EU approved colour Substances 0.000 description 1
- 208000030814 Eating disease Diseases 0.000 description 1
- 108010061435 Enalapril Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- MCIACXAZCBVDEE-CUUWFGFTSA-N Ertugliflozin Chemical compound C1=CC(OCC)=CC=C1CC1=CC([C@@]23O[C@@](CO)(CO2)[C@@H](O)[C@H](O)[C@H]3O)=CC=C1Cl MCIACXAZCBVDEE-CUUWFGFTSA-N 0.000 description 1
- 239000004386 Erythritol Substances 0.000 description 1
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 1
- 208000007530 Essential hypertension Diseases 0.000 description 1
- 108010011459 Exenatide Proteins 0.000 description 1
- 208000019454 Feeding and Eating disease Diseases 0.000 description 1
- 102400001370 Galanin Human genes 0.000 description 1
- 101800002068 Galanin Proteins 0.000 description 1
- 229940099498 Gastric inhibitory polypeptide receptor agonist Drugs 0.000 description 1
- 102400000921 Gastrin Human genes 0.000 description 1
- 108010052343 Gastrins Proteins 0.000 description 1
- 208000018522 Gastrointestinal disease Diseases 0.000 description 1
- 241000237858 Gastropoda Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 239000001828 Gelatine Substances 0.000 description 1
- HEMJJKBWTPKOJG-UHFFFAOYSA-N Gemfibrozil Chemical compound CC1=CC=C(C)C(OCCCC(C)(C)C(O)=O)=C1 HEMJJKBWTPKOJG-UHFFFAOYSA-N 0.000 description 1
- 102000051325 Glucagon Human genes 0.000 description 1
- 108060003199 Glucagon Proteins 0.000 description 1
- FAEKWTJYAYMJKF-QHCPKHFHSA-N GlucoNorm Chemical compound C1=C(C(O)=O)C(OCC)=CC(CC(=O)N[C@@H](CC(C)C)C=2C(=CC=CC=2)N2CCCCC2)=C1 FAEKWTJYAYMJKF-QHCPKHFHSA-N 0.000 description 1
- 102000004366 Glucosidases Human genes 0.000 description 1
- 108010056771 Glucosidases Proteins 0.000 description 1
- 102000017011 Glycated Hemoglobin A Human genes 0.000 description 1
- 108010014663 Glycated Hemoglobin A Proteins 0.000 description 1
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 101500028774 Homo sapiens Glucagon-like peptide 1 Proteins 0.000 description 1
- 101001015516 Homo sapiens Glucagon-like peptide 1 receptor Proteins 0.000 description 1
- 101500028773 Homo sapiens Glucagon-like peptide 1(7-37) Proteins 0.000 description 1
- 206010058179 Hypertensive emergency Diseases 0.000 description 1
- 206010022562 Intermittent claudication Diseases 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- 102000007330 LDL Lipoproteins Human genes 0.000 description 1
- 108010007622 LDL Lipoproteins Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 208000007177 Left Ventricular Hypertrophy Diseases 0.000 description 1
- 102000016267 Leptin Human genes 0.000 description 1
- 108010092277 Leptin Proteins 0.000 description 1
- 239000004367 Lipase Substances 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 208000017170 Lipid metabolism disease Diseases 0.000 description 1
- 102000057248 Lipoprotein(a) Human genes 0.000 description 1
- 108010033266 Lipoprotein(a) Proteins 0.000 description 1
- 108010007859 Lisinopril Proteins 0.000 description 1
- WHSOLWOTCHFFBK-ZQGJOIPISA-N Luseogliflozin Chemical compound C1=CC(OCC)=CC=C1CC1=CC([C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)S2)O)=C(OC)C=C1C WHSOLWOTCHFFBK-ZQGJOIPISA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 108010008364 Melanocortins Proteins 0.000 description 1
- 229920003091 Methocel™ Polymers 0.000 description 1
- 101710112393 Mitochondrial uncoupling protein 2 Proteins 0.000 description 1
- 229920000881 Modified starch Polymers 0.000 description 1
- PCZOHLXUXFIOCF-UHFFFAOYSA-N Monacolin X Natural products C12C(OC(=O)C(C)CC)CC(C)C=C2C=CC(C)C1CCC1CC(O)CC(=O)O1 PCZOHLXUXFIOCF-UHFFFAOYSA-N 0.000 description 1
- HSHXDCVZWHOWCS-UHFFFAOYSA-N N'-hexadecylthiophene-2-carbohydrazide Chemical compound CCCCCCCCCCCCCCCCNNC(=O)c1cccs1 HSHXDCVZWHOWCS-UHFFFAOYSA-N 0.000 description 1
- 241000275031 Nica Species 0.000 description 1
- ZBBHBTPTTSWHBA-UHFFFAOYSA-N Nicardipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OCCN(C)CC=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 ZBBHBTPTTSWHBA-UHFFFAOYSA-N 0.000 description 1
- 102000002512 Orexin Human genes 0.000 description 1
- 102400000319 Oxyntomodulin Human genes 0.000 description 1
- 101800001388 Oxyntomodulin Proteins 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 102000004257 Potassium Channel Human genes 0.000 description 1
- TUZYXOIXSAXUGO-UHFFFAOYSA-N Pravastatin Natural products C1=CC(C)C(CCC(O)CC(O)CC(O)=O)C2C(OC(=O)C(C)CC)CC(O)C=C21 TUZYXOIXSAXUGO-UHFFFAOYSA-N 0.000 description 1
- 206010038563 Reocclusion Diseases 0.000 description 1
- 208000017442 Retinal disease Diseases 0.000 description 1
- 206010038923 Retinopathy Diseases 0.000 description 1
- RYMZZMVNJRMUDD-UHFFFAOYSA-N SJ000286063 Natural products C12C(OC(=O)C(C)(C)CC)CC(C)C=C2C=CC(C)C1CCC1CC(O)CC(=O)O1 RYMZZMVNJRMUDD-UHFFFAOYSA-N 0.000 description 1
- 229910006069 SO3H Inorganic materials 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- BCKXLBQYZLBQEK-KVVVOXFISA-M Sodium oleate Chemical compound [Na+].CCCCCCCC\C=C/CCCCCCCC([O-])=O BCKXLBQYZLBQEK-KVVVOXFISA-M 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 208000007107 Stomach Ulcer Diseases 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 206010071436 Systolic dysfunction Diseases 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- 102000011923 Thyrotropin Human genes 0.000 description 1
- 108010061174 Thyrotropin Proteins 0.000 description 1
- ZXOCGDDVNPDRIW-NHFZGCSJSA-N Tofogliflozin Chemical compound O.C1=CC(CC)=CC=C1CC1=CC=C(CO[C@@]23[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O)C2=C1 ZXOCGDDVNPDRIW-NHFZGCSJSA-N 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 108010021111 Uncoupling Protein 2 Proteins 0.000 description 1
- 102000008200 Uncoupling Protein 3 Human genes 0.000 description 1
- 108010021098 Uncoupling Protein 3 Proteins 0.000 description 1
- ICMGLRUYEQNHPF-UHFFFAOYSA-N Uraprene Chemical compound COC1=CC=CC=C1N1CCN(CCCNC=2N(C(=O)N(C)C(=O)C=2)C)CC1 ICMGLRUYEQNHPF-UHFFFAOYSA-N 0.000 description 1
- 108010059705 Urocortins Proteins 0.000 description 1
- 102000005630 Urocortins Human genes 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- VJHCJDRQFCCTHL-UHFFFAOYSA-N acetic acid 2,3,4,5,6-pentahydroxyhexanal Chemical compound CC(O)=O.OCC(O)C(O)C(O)C(O)C=O VJHCJDRQFCCTHL-UHFFFAOYSA-N 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 229960002213 alprenolol Drugs 0.000 description 1
- PAZJSJFMUHDSTF-UHFFFAOYSA-N alprenolol Chemical compound CC(C)NCC(O)COC1=CC=CC=C1CC=C PAZJSJFMUHDSTF-UHFFFAOYSA-N 0.000 description 1
- 150000003863 ammonium salts Chemical class 0.000 description 1
- 229940025084 amphetamine Drugs 0.000 description 1
- 239000003392 amylase inhibitor Substances 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 239000003945 anionic surfactant Substances 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 239000000883 anti-obesity agent Substances 0.000 description 1
- 230000000561 anti-psychotic effect Effects 0.000 description 1
- 229940125708 antidiabetic agent Drugs 0.000 description 1
- 239000003472 antidiabetic agent Substances 0.000 description 1
- 229940030600 antihypertensive agent Drugs 0.000 description 1
- 239000002220 antihypertensive agent Substances 0.000 description 1
- 239000003524 antilipemic agent Substances 0.000 description 1
- 229940125710 antiobesity agent Drugs 0.000 description 1
- 230000006793 arrhythmia Effects 0.000 description 1
- 229960002274 atenolol Drugs 0.000 description 1
- 125000003910 behenoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 229960004530 benazepril Drugs 0.000 description 1
- KKBIUAUSZKGNOA-HNAYVOBHSA-N benzyl (2s)-2-[[(2s)-2-(acetylsulfanylmethyl)-3-(1,3-benzodioxol-5-yl)propanoyl]amino]propanoate Chemical compound O=C([C@@H](NC(=O)[C@@H](CSC(C)=O)CC=1C=C2OCOC2=CC=1)C)OCC1=CC=CC=C1 KKBIUAUSZKGNOA-HNAYVOBHSA-N 0.000 description 1
- FFBHFFJDDLITSX-UHFFFAOYSA-N benzyl N-[2-hydroxy-4-(3-oxomorpholin-4-yl)phenyl]carbamate Chemical compound OC1=C(NC(=O)OCC2=CC=CC=C2)C=CC(=C1)N1CCOCC1=O FFBHFFJDDLITSX-UHFFFAOYSA-N 0.000 description 1
- 229950003611 bexagliflozin Drugs 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 150000004283 biguanides Chemical class 0.000 description 1
- 208000014679 binge eating disease Diseases 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- DNDCVAGJPBKION-DOPDSADYSA-N bombesin Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC=1NC2=CC=CC=C2C=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1NC(=O)CC1)C(C)C)C1=CN=CN1 DNDCVAGJPBKION-DOPDSADYSA-N 0.000 description 1
- OZVBMTJYIDMWIL-AYFBDAFISA-N bromocriptine Chemical compound C1=CC(C=2[C@H](N(C)C[C@@H](C=2)C(=O)N[C@]2(C(=O)N3[C@H](C(N4CCC[C@H]4[C@]3(O)O2)=O)CC(C)C)C(C)C)C2)=C3C2=C(Br)NC3=C1 OZVBMTJYIDMWIL-AYFBDAFISA-N 0.000 description 1
- 229960002802 bromocriptine Drugs 0.000 description 1
- 239000000480 calcium channel blocker Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 229960001713 canagliflozin Drugs 0.000 description 1
- VHOFTEAWFCUTOS-TUGBYPPCSA-N canagliflozin hydrate Chemical compound O.CC1=CC=C([C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)C=C1CC(S1)=CC=C1C1=CC=C(F)C=C1.CC1=CC=C([C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)C=C1CC(S1)=CC=C1C1=CC=C(F)C=C1 VHOFTEAWFCUTOS-TUGBYPPCSA-N 0.000 description 1
- FAKRSMQSSFJEIM-RQJHMYQMSA-N captopril Chemical compound SC[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O FAKRSMQSSFJEIM-RQJHMYQMSA-N 0.000 description 1
- 229960000830 captopril Drugs 0.000 description 1
- 235000011089 carbon dioxide Nutrition 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 239000003093 cationic surfactant Substances 0.000 description 1
- 206010008118 cerebral infarction Diseases 0.000 description 1
- 230000001055 chewing effect Effects 0.000 description 1
- 229940107137 cholecystokinin Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 229960001214 clofibrate Drugs 0.000 description 1
- KNHUKKLJHYUCFP-UHFFFAOYSA-N clofibrate Chemical compound CCOC(=O)C(C)(C)OC1=CC=C(Cl)C=C1 KNHUKKLJHYUCFP-UHFFFAOYSA-N 0.000 description 1
- 229960003920 cocaine Drugs 0.000 description 1
- 208000010877 cognitive disease Diseases 0.000 description 1
- 229960002604 colestipol Drugs 0.000 description 1
- GMRWGQCZJGVHKL-UHFFFAOYSA-N colestipol Chemical compound ClCC1CO1.NCCNCCNCCNCCN GMRWGQCZJGVHKL-UHFFFAOYSA-N 0.000 description 1
- 239000008119 colloidal silica Substances 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 238000011284 combination treatment Methods 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 229920001531 copovidone Polymers 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 229960005168 croscarmellose Drugs 0.000 description 1
- 239000001767 crosslinked sodium carboxy methyl cellulose Substances 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 229940096516 dextrates Drugs 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 229960001767 dextrothyroxine Drugs 0.000 description 1
- 229940061607 dibasic sodium phosphate Drugs 0.000 description 1
- 150000004683 dihydrates Chemical class 0.000 description 1
- HSUGRBWQSSZJOP-RTWAWAEBSA-N diltiazem Chemical compound C1=CC(OC)=CC=C1[C@H]1[C@@H](OC(C)=O)C(=O)N(CCN(C)C)C2=CC=CC=C2S1 HSUGRBWQSSZJOP-RTWAWAEBSA-N 0.000 description 1
- 229960004166 diltiazem Drugs 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 235000014632 disordered eating Nutrition 0.000 description 1
- 229960001389 doxazosin Drugs 0.000 description 1
- RUZYUOTYCVRMRZ-UHFFFAOYSA-N doxazosin Chemical compound C1OC2=CC=CC=C2OC1C(=O)N(CC1)CCN1C1=NC(N)=C(C=C(C(OC)=C2)OC)C2=N1 RUZYUOTYCVRMRZ-UHFFFAOYSA-N 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 201000006549 dyspepsia Diseases 0.000 description 1
- 229960000873 enalapril Drugs 0.000 description 1
- GBXSMTUPTTWBMN-XIRDDKMYSA-N enalapril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(O)=O)CC1=CC=CC=C1 GBXSMTUPTTWBMN-XIRDDKMYSA-N 0.000 description 1
- 229950006535 ertugliflozin Drugs 0.000 description 1
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 1
- 229940009714 erythritol Drugs 0.000 description 1
- 235000019414 erythritol Nutrition 0.000 description 1
- 229960001519 exenatide Drugs 0.000 description 1
- 229960003580 felodipine Drugs 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 238000005243 fluidization Methods 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 229960002490 fosinopril Drugs 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- 235000011087 fumaric acid Nutrition 0.000 description 1
- 230000030136 gastric emptying Effects 0.000 description 1
- 230000030135 gastric motility Effects 0.000 description 1
- 210000005095 gastrointestinal system Anatomy 0.000 description 1
- 238000003304 gavage Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960003627 gemfibrozil Drugs 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 208000004104 gestational diabetes Diseases 0.000 description 1
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 1
- 229960004666 glucagon Drugs 0.000 description 1
- 238000007446 glucose tolerance test Methods 0.000 description 1
- 230000004190 glucose uptake Effects 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 230000004116 glycogenolysis Effects 0.000 description 1
- 230000005484 gravity Effects 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 239000003395 histamine H3 receptor antagonist Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 239000008172 hydrogenated vegetable oil Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000003165 hydrotropic effect Effects 0.000 description 1
- 239000002471 hydroxymethylglutaryl coenzyme A reductase inhibitor Substances 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- 201000001421 hyperglycemia Diseases 0.000 description 1
- 239000012729 immediate-release (IR) formulation Substances 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 208000021156 intermittent vascular claudication Diseases 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 229950000991 ipragliflozin Drugs 0.000 description 1
- AHFWIQIYAXSLBA-RQXATKFSSA-N ipragliflozin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1C1=CC=C(F)C(CC=2SC3=CC=CC=C3C=2)=C1 AHFWIQIYAXSLBA-RQXATKFSSA-N 0.000 description 1
- 229960004427 isradipine Drugs 0.000 description 1
- 210000004731 jugular vein Anatomy 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229940039781 leptin Drugs 0.000 description 1
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 description 1
- 235000019421 lipase Nutrition 0.000 description 1
- 230000037356 lipid metabolism Effects 0.000 description 1
- 229960002394 lisinopril Drugs 0.000 description 1
- CZRQXSDBMCMPNJ-ZUIPZQNBSA-N lisinopril dihydrate Chemical compound O.O.C([C@H](N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(O)=O)C(O)=O)CC1=CC=CC=C1 CZRQXSDBMCMPNJ-ZUIPZQNBSA-N 0.000 description 1
- 229960004844 lovastatin Drugs 0.000 description 1
- PCZOHLXUXFIOCF-BXMDZJJMSA-N lovastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)[C@@H](C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 PCZOHLXUXFIOCF-BXMDZJJMSA-N 0.000 description 1
- QLJODMDSTUBWDW-UHFFFAOYSA-N lovastatin hydroxy acid Natural products C1=CC(C)C(CCC(O)CC(O)CC(O)=O)C2C(OC(=O)C(C)CC)CC(C)C=C21 QLJODMDSTUBWDW-UHFFFAOYSA-N 0.000 description 1
- 229950004397 luseogliflozin Drugs 0.000 description 1
- 229940037627 magnesium lauryl sulfate Drugs 0.000 description 1
- HBNDBUATLJAUQM-UHFFFAOYSA-L magnesium;dodecyl sulfate Chemical compound [Mg+2].CCCCCCCCCCCCOS([O-])(=O)=O.CCCCCCCCCCCCOS([O-])(=O)=O HBNDBUATLJAUQM-UHFFFAOYSA-L 0.000 description 1
- 201000005857 malignant hypertension Diseases 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 229950004994 meglitinide Drugs 0.000 description 1
- 239000002865 melanocortin Substances 0.000 description 1
- 239000000155 melt Substances 0.000 description 1
- 229960002237 metoprolol Drugs 0.000 description 1
- IUBSYMUCCVWXPE-UHFFFAOYSA-N metoprolol Chemical compound COCCC1=CC=C(OCC(O)CNC(C)C)C=C1 IUBSYMUCCVWXPE-UHFFFAOYSA-N 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- SLZIZIJTGAYEKK-CIJSCKBQSA-N molport-023-220-247 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)CN)[C@@H](C)O)C1=CNC=N1 SLZIZIJTGAYEKK-CIJSCKBQSA-N 0.000 description 1
- PXZWGQLGAKCNKD-DPNMSELWSA-N molport-023-276-326 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 PXZWGQLGAKCNKD-DPNMSELWSA-N 0.000 description 1
- 150000004682 monohydrates Chemical class 0.000 description 1
- 238000000465 moulding Methods 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 201000001119 neuropathy Diseases 0.000 description 1
- 230000007823 neuropathy Effects 0.000 description 1
- 229960001783 nicardipine Drugs 0.000 description 1
- 229960001597 nifedipine Drugs 0.000 description 1
- HYIMSNHJOBLJNT-UHFFFAOYSA-N nifedipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OC)C1C1=CC=CC=C1[N+]([O-])=O HYIMSNHJOBLJNT-UHFFFAOYSA-N 0.000 description 1
- 229960000715 nimodipine Drugs 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 230000002474 noradrenergic effect Effects 0.000 description 1
- 230000000966 norepinephrine reuptake Effects 0.000 description 1
- 229940006093 opthalmologic coloring agent diagnostic Drugs 0.000 description 1
- 231100000822 oral exposure Toxicity 0.000 description 1
- 108060005714 orexin Proteins 0.000 description 1
- RVTZCBVAJQQJTK-UHFFFAOYSA-N oxygen(2-);zirconium(4+) Chemical compound [O-2].[O-2].[Zr+4] RVTZCBVAJQQJTK-UHFFFAOYSA-N 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 239000000049 pigment Substances 0.000 description 1
- 229960002508 pindolol Drugs 0.000 description 1
- PHUTUTUABXHXLW-UHFFFAOYSA-N pindolol Chemical compound CC(C)NCC(O)COC1=CC=CC2=NC=C[C]12 PHUTUTUABXHXLW-UHFFFAOYSA-N 0.000 description 1
- 229960000540 polacrilin potassium Drugs 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 230000018656 positive regulation of gluconeogenesis Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 108020001213 potassium channel Proteins 0.000 description 1
- WVWZXTJUCNEUAE-UHFFFAOYSA-M potassium;1,2-bis(ethenyl)benzene;2-methylprop-2-enoate Chemical compound [K+].CC(=C)C([O-])=O.C=CC1=CC=CC=C1C=C WVWZXTJUCNEUAE-UHFFFAOYSA-M 0.000 description 1
- 229920003124 powdered cellulose Polymers 0.000 description 1
- 235000019814 powdered cellulose Nutrition 0.000 description 1
- 229960002965 pravastatin Drugs 0.000 description 1
- TUZYXOIXSAXUGO-PZAWKZKUSA-N pravastatin Chemical compound C1=C[C@H](C)[C@H](CC[C@@H](O)C[C@@H](O)CC(O)=O)[C@H]2[C@@H](OC(=O)[C@@H](C)CC)C[C@H](O)C=C21 TUZYXOIXSAXUGO-PZAWKZKUSA-N 0.000 description 1
- 229960001289 prazosin Drugs 0.000 description 1
- IENZQIKPVFGBNW-UHFFFAOYSA-N prazosin Chemical compound N=1C(N)=C2C=C(OC)C(OC)=CC2=NC=1N(CC1)CCN1C(=O)C1=CC=CO1 IENZQIKPVFGBNW-UHFFFAOYSA-N 0.000 description 1
- 238000003825 pressing Methods 0.000 description 1
- 229960003912 probucol Drugs 0.000 description 1
- FYPMFJGVHOHGLL-UHFFFAOYSA-N probucol Chemical compound C=1C(C(C)(C)C)=C(O)C(C(C)(C)C)=CC=1SC(C)(C)SC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 FYPMFJGVHOHGLL-UHFFFAOYSA-N 0.000 description 1
- 229960003712 propranolol Drugs 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 229960001455 quinapril Drugs 0.000 description 1
- JSDRRTOADPPCHY-HSQYWUDLSA-N quinapril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](CC2=CC=CC=C2C1)C(O)=O)CC1=CC=CC=C1 JSDRRTOADPPCHY-HSQYWUDLSA-N 0.000 description 1
- 229960003401 ramipril Drugs 0.000 description 1
- HDACQVRGBOVJII-JBDAPHQKSA-N ramipril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](C[C@@H]2CCC[C@@H]21)C(O)=O)CC1=CC=CC=C1 HDACQVRGBOVJII-JBDAPHQKSA-N 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 239000003488 releasing hormone Substances 0.000 description 1
- 229950011516 remogliflozin etabonate Drugs 0.000 description 1
- UAOCLDQAQNNEAX-ABMICEGHSA-N remogliflozin etabonate Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](COC(=O)OCC)O[C@H]1OC1=NN(C(C)C)C(C)=C1CC1=CC=C(OC(C)C)C=C1 UAOCLDQAQNNEAX-ABMICEGHSA-N 0.000 description 1
- 229960002354 repaglinide Drugs 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 230000036186 satiety Effects 0.000 description 1
- 235000019627 satiety Nutrition 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 230000002295 serotoninergic effect Effects 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 235000012239 silicon dioxide Nutrition 0.000 description 1
- 229960002855 simvastatin Drugs 0.000 description 1
- RYMZZMVNJRMUDD-HGQWONQESA-N simvastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)C(C)(C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 RYMZZMVNJRMUDD-HGQWONQESA-N 0.000 description 1
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 235000011083 sodium citrates Nutrition 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- UOENJXXSKABLJL-UHFFFAOYSA-M sodium;8-[(2-hydroxybenzoyl)amino]octanoate Chemical compound [Na+].OC1=CC=CC=C1C(=O)NCCCCCCCC([O-])=O UOENJXXSKABLJL-UHFFFAOYSA-M 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 239000012453 solvate Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 229950005268 sotagliflozin Drugs 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000013222 sprague-dawley male rat Methods 0.000 description 1
- 238000005507 spraying Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 229960004274 stearic acid Drugs 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000007916 tablet composition Substances 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- VCKUSRYTPJJLNI-UHFFFAOYSA-N terazosin Chemical compound N=1C(N)=C2C=C(OC)C(OC)=CC2=NC=1N(CC1)CCN1C(=O)C1CCCO1 VCKUSRYTPJJLNI-UHFFFAOYSA-N 0.000 description 1
- 229960001693 terazosin Drugs 0.000 description 1
- 229960004605 timolol Drugs 0.000 description 1
- 108091004331 tirzepatide Proteins 0.000 description 1
- BTSOGEDATSQOAF-SMAAHMJQSA-N tirzepatide Chemical group CC[C@H](C)[C@@H](C(N[C@@H](C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCNC(COCCOCCNC(COCCOCCNC(CC[C@H](C(O)=O)NC(CCCCCCCCCCCCCCCCCCC(O)=O)=O)=O)=O)=O)C(N[C@@H](C)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](C(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC1=CNC2=C1C=CC=C2)C(N[C@@H](CC(C)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(NCC(NCC(N(CCC1)[C@@H]1C(N[C@@H](CO)C(N[C@@H](CO)C(NCC(N[C@@H](C)C(N(CCC1)[C@@H]1C(N(CCC1)[C@@H]1C(N(CCC1)[C@@H]1C(N[C@@H](CO)C(N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)NC([C@H](CCCCN)NC([C@H](CC(O)=O)NC([C@H](CC(C)C)NC(C(C)(C)NC([C@H]([C@@H](C)CC)NC([C@H](CO)NC([C@H](CC(C=C1)=CC=C1O)NC([C@H](CC(O)=O)NC([C@H](CO)NC([C@H]([C@@H](C)O)NC([C@H](CC1=CC=CC=C1)NC([C@H]([C@@H](C)O)NC(CNC([C@H](CCC(O)=O)NC(C(C)(C)NC([C@H](CC(C=C1)=CC=C1O)N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O BTSOGEDATSQOAF-SMAAHMJQSA-N 0.000 description 1
- 229940121512 tirzepatide Drugs 0.000 description 1
- 239000004408 titanium dioxide Substances 0.000 description 1
- 229950006667 tofogliflozin Drugs 0.000 description 1
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 150000004684 trihydrates Chemical class 0.000 description 1
- 210000001364 upper extremity Anatomy 0.000 description 1
- 229960001130 urapidil Drugs 0.000 description 1
- 239000000777 urocortin Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 229960001722 verapamil Drugs 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- XOOUIPVCVHRTMJ-UHFFFAOYSA-L zinc stearate Chemical compound [Zn+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O XOOUIPVCVHRTMJ-UHFFFAOYSA-L 0.000 description 1
- 229910001928 zirconium oxide Inorganic materials 0.000 description 1
- 239000002888 zwitterionic surfactant Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/20—Pills, tablets, discs, rods
- A61K9/2072—Pills, tablets, discs, rods characterised by shape, structure or size; Tablets with holes, special break lines or identification marks; Partially coated tablets; Disintegrating flat shaped forms
- A61K9/2077—Tablets comprising drug-containing microparticles in a substantial amount of supporting matrix; Multiparticulate tablets
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/16—Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction
- A61K9/1605—Excipients; Inactive ingredients
- A61K9/1617—Organic compounds, e.g. phospholipids, fats
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/08—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
- A61K47/10—Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/08—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
- A61K47/14—Esters of carboxylic acids, e.g. fatty acid monoglycerides, medium-chain triglycerides, parabens or PEG fatty acid esters
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
- A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
- A61K47/183—Amino acids, e.g. glycine, EDTA or aspartame
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/22—Heterocyclic compounds, e.g. ascorbic acid, tocopherol or pyrrolidones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0053—Mouth and digestive tract, i.e. intraoral and peroral administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/20—Pills, tablets, discs, rods
- A61K9/2004—Excipients; Inactive ingredients
- A61K9/2013—Organic compounds, e.g. phospholipids, fats
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
Definitions
- the present invention relates to solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid, their method of preparation and their use in medicine.
- Human GLP-1 and analogues thereof have a low oral bioavailability. Exposure and bioavailability of human GLP-1 and analogues thereof is very low following oral
- Human GLP-1 and analogues thereof can only reach therapeutically relevant plasma concentration after oral administration if formulated with certain absorption enhancers in a specific amount.
- SNAC sodium N-(8-(2- hydroxybenzoyl)amino)caprylate
- WO 2010/020978 discloses an oral pharmaceutical composition comprising a protein and N-(8-[2-hydroxybenzoyl) amino)caprylate (SNAC).
- Patent applications disclosing oral dosage forms of GLP-1 analogues containing a salt of N-(8-(2- hydroxybenzoyl)amino)caprylate include WO2012/080471 , WO2013/189988,
- the present invention in an aspect relates to a composition
- a composition comprising a GLP-1 agonist, an absorption enhancer or delivery agent and a hydrotrope.
- the composition according to the invention comprises balanced amounts of the delivery agent and the hydrotrope.
- the provided compositions display an accelerated absorption, enabling fast and efficient uptake of the active pharmaceutical ingredient.
- compositions providing accelerate absorption of the GLP-1 agonist within 15-30 minutes after administration and thereby improved exposure of the GLP-1 agonist by oral administration.
- the inventors have surprisingly found that an increased exposure of GLP-1 agonists is observed when compositions are prepared with a hydrotrope.
- An aspect of the invention relates to a composition
- a composition comprising
- hydrotrope is capable of increasing the solubility of SNAC at least 2-fold, such as 5-fold or such as at least 10-fold.
- GLP-1 agonist such as Semaglutide, GLP-1 agonist B or GLP-1 agonist C.
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- a further aspect relates to a method for producing a solid pharmaceutical composition comprising the steps of;
- compositions described herein relate to the medical use of compositions described herein.
- An embodiment relates to pharmaceutical use of compositions described herein, such as compositions for oral administration.
- the composition is a pharmaceutical composition for use in a method of treating diabetes and/or obesity.
- the invention relates to a method of treating diabetes or obesity comprising administering the composition as defined herein to a patient in need thereof.
- Fig. 1 shows dose dependent effect of nicotinamide (A) and resorcinol (B) on SNAC solubility at pH 6.
- Fig. 2 shows the dose corrected exposure during the first 30 minutes observed in dogs after dosing of formulations with two different GLP-1 agonists, GLP-1 agonist A and B, respectively.
- Compositions according to the invention all demonstrate an increased dose- corrected exposure relative to the reference compositions.
- compositions comprising a GLP- 1 agonist and an absorption enhancer or delivery agent and a hydrotrope.
- the composition may be in the form suitable for oral administration, such as in a solid form exemplified by a tablet, sachet or capsule.
- the composition is an oral composition, or a pharmaceutical composition, such as an oral pharmaceutical composition.
- the provided compositions display an accelerated absorption, enabling fast and efficient uptake of the active pharmaceutical ingredient.
- GLP-1 agonist refers to a compound, which fully or partially activates the human GLP-1 receptor. The term is thus equal to the term“GLP-1 receptor agonist” used in other documents.
- GLP-1 agonist as well as the specific GLP-1 agonists described herein also encompass salt forms thereof.
- the GLP-1 agonist should display“GLP-1 activity” which refers to the ability of the compound, i.e. a GLP-1 analogue or a compound comprising a GLP-1 analogue, to bind to the GLP-1 receptor and initiate a signal transduction pathway resulting in insulinotropic action or other physiological effects as is known in the art.
- the“GLP-1 agonist” binds to a GLP-1 receptor, e.g. , with an affinity constant (K D ) or activate the receptor with a potency (EC50) of below 1 pM, e.g. below 100 nM as measured by methods known in the art (see e.g.
- the GLP-1 agonist may be administered to an animal with increased blood glucose (e.g. obtained using an Intravenous Glucose Tolerance Test (IVGTT).
- IVGTT Intravenous Glucose Tolerance Test
- a person skilled in the art will be able to determine a suitable glucose dosage and a suitable blood sampling regime, e.g. depending on the species of the animal, for the IVGTT) and measure the plasma insulin concentration over time.
- Suitable assays have been described in such as WO2015/155151.
- EC50 half maximal effective concentration
- EC 5 o is used as a measure of the potency of a compound and represents the concentration where 50% of its maximal effect is observed. Due to the albumin binding effects of GLP-1 agonists comprising a substituent as described herein, it is important to pay attention to if the assay includes human serum albumin or not.
- the in vitro potency of the GLP-1 agonist may be determined as described in 2015/155151 , example 29 without Human Serum Albumin (HSA), and the EC 5 o determined.
- HSA Human Serum Albumin
- the potency (EC50) as determined (without HSA) is 5-1000 pM, such as 10-750 pM, 10-500 pM or 10-200 pM.
- the EC50 (without HSA) is at most 500 pM, such as at most 300 pM, such as at most 200 pM.
- the EC50 (without HSA) is comparable to human GLP-1 (7-37).
- the EC50 (without HSA) is at most 50 pM. In a further such embodiment the EC50 is at most 40 pM, such as at most 30 pM such as at most 20 pM, such as at most 10 pM. In one embodiment the EC50 is around 10 pM.
- the binding of the GLP-1 agonist to albumin may be measured using the in vitro potency assay of Example 29 including HSA.
- An increase of the in vitro potency, EC 5 o value, in the presence of serum albumin reflects the affinity to serum albumin.
- the potency (EC50) as determined (with 1 % HSA) is 5-1000 pM, such as 100-750 pM, 200-500 pM or 100-400 pM. In one embodiment the EC50 (with 1 % HSA) is at most 750 pM, such as at most 500 pM, such as at most 400 pM, such as at most 300 or such as at most 250 pM.
- the fold variation in relation to a known GLP-1 receptor agonist may be calculated as EC50(test analogue)/EC50(known analogue), and if this ration is such as 0.5- 1.5, or 0.8-1.2 the potencies are considered to be equivalent.
- the potency, EC50 (without HSA), is equivalent to the potency of liraglutide.
- the potency, EC50 (without HSA), is equivalent to the potency of semaglutide.
- the potency, EC50 (without HSA), is equivalent to the potency of GLP-1 agonist B. In one embodiment the potency, EC50 (without HSA), is equivalent to the potency of GLP-1 agonist C.
- the potency, EC50 (with 1 % HSA), is equivalent to the potency of liraglutide.
- the potency, EC50 (with 1 % HSA), is equivalent to the potency of semaglutide.
- the potency, EC50 (with 1 % HSA), is equivalent to the potency of GLP-1 agonist B.
- the potency, EC50 (with 1 % HSA), is equivalent to the potency of GLP-1 agonist C.
- a GLP-1 agonist is a bifunctional molecule such as co-agonist, or tri-agonist.
- the GLP-1 agonist is also a Gastric inhibitory polypeptide receptor agonist (GIP agonist). In one embodiment the GLP-1 agonist is Tirzepatide.
- GIP agonist Gastric inhibitory polypeptide receptor agonist
- the GLP-1 agonist is a GLP-1 analogue, optionally comprising one substituent.
- analogue as used herein referring to a GLP-1 peptide (hereafter“peptide”) means a peptide wherein at least one amino acid residue of the peptide has been substituted with another amino acid residue and/or wherein at least one amino acid residue has been deleted from the peptide and/or wherein at least one amino acid residue has been added to the peptide and/or wherein at least one amino acid residue of the peptide has been modified. Such addition or deletion of amino acid residues may take place at the N- terminal of the peptide and/or at the C-terminal of the peptide.
- GLP-1 agonist designates an analogue of GLP-1 (7-37) wherein the naturally occurring Ala in position 8 has been substituted with Aib.
- GLP-1 agonist comprises a maximum of twelve, such as a maximum of 10, 8 or 6, amino acids which have been altered, e.g., by substitution, deletion, insertion and/or modification, compared to e.g. GLP-1 (7-37).
- the analogue comprises up to 10 substitutions, deletions, additions and/or insertions, such as up to 9 substitutions, deletions, additions and/or insertions, up to 8 substitutions, deletions, additions and/or insertions, up to 7 substitutions, deletions, additions and/or insertions, up to 6 substitutions, deletions, additions and/or insertions, up to 5 substitutions, deletions, additions and/or insertions, up to 4 substitutions, deletions, additions and/or insertions or up to 3 substitutions, deletions, additions and/or insertions, compared to e.g. GLP-1 (7-37). Unless otherwise stated the GLP-1 comprises only L-amino acids.
- GLP-1 analogue or“analogue of GLP-1” as used herein refers to a peptide, or a compound, which is a variant of the human Glucagon-Like Peptide-1 (GLP-1 (7-37)).
- GLP-1 (7-37) has the sequence HAEGTFTSDV
- the term“variant” refers to a compound which comprises one or more amino acid substitutions, deletions, additions and/or insertions.
- the GLP-1 agonist exhibits at least 60%, 65%, 70%, 80% or 90% sequence identity to GLP-1 (7-37) over the entire length of GLP-1 (7-37).
- sequence identity As an example of a method for determination of sequence identity between two analogues the two peptides [Aib8]GLP-1 (7-37) and GLP-1 (7-37) are aligned.
- the sequence identity of [Aib8]GLP-1 (7-37) relative to GLP-1 (7-37) is given by the number of aligned identical residues minus the number of different residues divided by the total number of residues in GLP-1 (7-37).
- sequence identity is (31-1 )/31 .
- the C-terminal of the GLP-1 agonist is an amide.
- the GLP-1 agonist is GLP-1 (7-37) or GLP-1 (7-36)amide. In some embodiments the GLP-1 agonist is exendin-4, the sequence of which is
- HGEGTFITSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID No: 2).
- the GLP-1 agonist is an exendin-4 analogue or an engineered peptide thereof, as disclosed in WO2013009545 and references therein.
- the GLP-1 agonist In order to prolong the effect of the GLP-1 agonist it is preferred that the GLP-1 agonist have an extended half-life.
- the half-life can be determined by method known in the art an in an appropriate model, such as in Male Sprague Dawley rats or minipigs as described in W02012/1401 17.
- Half-life in rats may be determined as in Example 39 and the half-life in minipigs may be determined as in Example 37 therein.
- the GLP-1 agonist according to the invention has a half-life above 2 hours in rat. In one embodiment the GLP-1 agonist according to the invention has a half-life above 4 hours, such as above 6 hours, such as above 8 hours, such as above 10 hours, such as above 12 hours or such as above 15 hours in rat.
- the GLP-1 agonist according to the invention has a half-life above 24 hours in minipig. In one embodiment the GLP-1 agonist according to the invention has a half-life above 30 hours, such as above 36 hours, such as above 42 hours, such as above 48 hours, such as above 54 hours or such as above 60 hours in minipig.
- the GLP-1 agonist has a molecular weight of at most 50 000 Da, such as at most 40 000 Da, such as at most 30 000 Da. In one embodiment the GLP-1 agonist has a molecular weight of at most 20 000, such as at most 10 000 Da, such as at most 7 500 Da, such as at most 5 000 Da.
- the GLP-1 agonist has a molar mass of at most 50 000 g/mol, such as at most 40 000 g/mol, such as at most 30 000 g/mol.
- the GLP-1 agonist has a molar mass of at most 10 000 g/mol, such as at most 8 000 g/mol, such as at most 6 000 g/mol.
- the GLP-1 agonist comprises one substituent which is covalently attached to the peptide.
- the substituent comprises a fatty acid or a fatty diacid.
- the substituent comprises a C16, C18 or C20 fatty acid.
- the substituent comprises a C16, C18 or C20 fatty diacid.
- the substituent comprises formula (X) (X), wherein n is at least 13, such as n is 13, 14, 15, 16, 17,
- the substituent comprises formula (X), wherein n is in the range of 13 to 19, such as in the range of 13 to 17. In some embodiments the substituent comprises formula (X), wherein n is 13, 15 or 17. In some embodiments the substituent comprises formula (X), wherein n is 13. In some embodiments the substituent comprises formula (X), wherein n is 15. In some embodiments the substituent comprises formula (X), wherein n is 17.
- the substituent comprises formula (Xla)
- the substituent comprises formula (Xla) or formula (Xlb), wherein m is in the range of 6 to 14, such as in the range of 8 to 1 1. In some embodiments the substituent comprises formula (Xla) or formula (Xlb), wherein m is 8, 10 or 12. In some embodiments the substituent comprises formula (Xla) or formula (Xlb), wherein m is 9. In some embodiments the substituent comprises formula (Xla) or formula (Xlb), wherein m is 11. In some embodiments the substituent comprises one or more 8-amino-3,6- dioxaoctanoic acid (OEG), such as two OEG.
- OEG 8-amino-3,6- dioxaoctanoic acid
- the substituent is [2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-(17- carboxyheptadecanoylamino) butyrylamino]ethoxy ⁇ ethoxy)acetylamino]
- the substituent is [2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-( ⁇ trans-4- [(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl ⁇
- the GLP-1 agonist is semaglutide, also known as N- epsilon26-[2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-(17-carboxyheptadecanoylamino)
- the GLP-1 agonist is GLP-1 agonist B, which is diacylated
- the GLP-1 agonist is GLP-1 agonist C which is Diacylated
- the term GLP-1 agonist is meant to encompass the GLP-1 agonist and any pharmaceutically acceptable salt, amide, or ester thereof.
- the composition comprises the GLP-1 agonist or a pharmaceutically acceptable salt, amide, or ester thereof.
- the composition comprises the GLP-1 agonist and one or more pharmaceutically acceptable counter ions.
- the GLP-1 agonist is selected from one or more of the GLP-1 agonists mentioned in W093/19175, W096/29342, WO98/08871 , WO99/43707,
- the GLP-1 agonist is selected from the group consisting of N- epsilon37 ⁇ 2-[2-(2- ⁇ 2-[2-((R)-3-carboxy-3- ⁇ [1-(19-carboxynonadecanoyl) piperidine-4- carbonyl]amino ⁇ propionylamino)ethoxy]ethoxy ⁇ acetylamino)ethoxy]ethoxy ⁇ acetyl
- N-epsilon26 [2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-( ⁇ 4-[(19-carboxy- nonadecanoylamino)methyl]cyclohexanecarbonyl ⁇ amino)butyrylamino] ethoxy ⁇ ethoxy) acetylamino]ethoxy ⁇ ethoxy)acetyl[Aib8, Lys 26JGLP-1 (7-37)amide; N-epsilon26 [2-(2-[2-(2-(2-(S)-2-[trans-4-((9-carboxynonadecanoylamino] methyl) cyclohexylcarbonyla
- a delivery agent or absorption enhancer is for the present invention an excipient capable of increasing the oral exposure of the GLP-1 agonist.
- the delivery agent used in the present invention is a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid (also referred to herein as a salt of NAC), which contains the anion N-(8-(2-hydroxybenzoyl)amino)caprylate.
- NAC N-(8-(2- hydroxybenzoyl)amino)caprylic acid
- the structural formula of N-(8-(2- hydroxybenzoyl)amino)caprylate is shown in formula (I).
- the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid comprises one monovalent cation, two monovalent cations or one divalent cation.
- the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is selected from the group consisting of the sodium salt, potassium salt and/or calcium salt of of N-(8-(2- hydroxybenzoyl)amino)caprylic acid.
- the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is selected from the group consisting of the sodium salt, potassium salt and/or the ammonium salt.
- the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is the sodium salt or the potassium salt.
- Salts of N-(8-(2-hydroxybenzoyl)amino)caprylate may be prepared using the method described in e.g. W096/030036, WO00/046182, W001/092206 or W02008/028859.
- the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid may be crystalline and/or amorphous.
- the delivery agent comprises the anhydrate
- the delivery agent is a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid as described in W02007/121318.
- the delivery agent is sodium N-(8-(2- hydroxybenzoyl)amino)caprylate (referred to as“SNAC” herein), also known as sodium 8- (salicyloylamino)octanoate.
- SNAC sodium N-(8-(2- hydroxybenzoyl)amino)caprylate
- composition or pharmaceutical composition of the present invention is a solid or dry composition suited for administration by the oral route as described further herein below.
- the composition comprises at least one pharmaceutically acceptable excipient.
- excipient as used herein broadly refers to any component other than the active therapeutic ingredient(s) or active pharmaceutical ingredient(s) (API(s)).
- the excipient may be a pharmaceutically inert substance, an inactive substance, and/or a therapeutically or medicinally none active substance.
- the excipient may serve various purposes, e.g. as a carrier, vehicle, filler, binder, lubricant, glidant, disintegrant, flow control agent, crystallization inhibitors solubilizer, stabilizer, colouring agent, flavouring agent, surfactant, emulsifier or combinations of thereof and/or to improve administration, and/or absorption of the therapeutically active substance(s) or active pharmaceutical ingredient(s).
- the amount of each excipient used may vary within ranges conventional in the art.
- the excipients may be selected from binders, such as polyvinyl pyrrolidone (povidone), etc.; fillers such as cellulose powder, microcrystalline cellulose, cellulose derivatives like hydroxymethylcellulose, hydroxyethylcellulose, hydroxypropylcellulose and hydroxy-propylmethylcellulose, dibasic calcium phosphate, corn starch, pregelatinized starch, etc.; lubricants and/or glidants such as stearic acid, magnesium stearate, sodium stearylfumarate, glycerol tribehenate, etc.; flow control agents such as colloidal silica, talc, etc.; crystallization inhibitors such as Povidone, etc.;
- binders such as polyvinyl pyrrolidone (povidone), etc.
- fillers such as cellulose powder, microcrystalline cellulose, cellulose derivatives like hydroxymethylcellulose, hydroxyethylcellulose, hydroxypropylcellulose and hydroxy-propylmethyl
- solubilizers such as Pluronic, Povidone, etc.
- colouring agents including dyes and pigments such as iron oxide red or yellow, titanium dioxide, talc, etc.
- pH control agents such as citric acid, tartaric acid, fumaric acid, sodium citrate, dibasic calcium phosphate, dibasic sodium phosphate, etc.
- surfactants and emulsifiers such as Pluronic, polyethylene glycols, sodium carboxymethyl cellulose, polyethoxylated and hydrogenated castor oil, etc.; and mixtures of two or more of these excipients and/or adjuvants.
- the composition may comprise a binder, such as povidone; starches; celluloses and derivatives thereof, such as microcrystalline cellulose, e.g., Avicel PH from FMC
- the binder may be selected from the group consisting of dry binders and/or wet granulation binders. Suitable dry binders are, e.g., cellulose powder and microcrystalline cellulose, such as Avicel PH 102 and Avicel PH 200. In some embodiments the composition comprises Avicel, such as Aavicel PH 102.
- Suitable binders for wet granulation or dry granulation are corn starch, polyvinyl pyrrolidone (povidon), vinylpyrrolidone-vinylacetate copolymer (copovidone) and cellulose derivatives like hydroxymethylcellulose, hydroxyethylcellulose, hydroxypropylcellulose and hydroxyl- propylmethylcellulose.
- the composition comprises povidone.
- the composition comprises a filler which may be selected from lactose, mannitol, erythritol, sucrose, sorbitol, calcium phosphate, such as
- the composition comprises microcrystalline cellulose, such as Avicel PH 102 or Avicel PH 200.
- the composition comprises a lubricant and/or a glidant.
- the composition comprises a lubricant and/or a glidant, such as talc, magnesium stearate, calcium stearate, zinc stearate, glyceryl behenate, glyceryl
- the composition comprises magnesium stearate or glyceryl debehenate (such as the product Compritol® 888 ATO).
- the composition comprises a disintegrant, such as sodium starch glycolate, polacrilin potassium, sodium starch glycolate, crospovidon, croscarmellose, sodium carboxymethylcellulose or dried corn starch.
- the composition may comprise one or more surfactants, for example a surfactant, at least one surfactant, or two different surfactants.
- surfactant refers to any molecules or ions that are comprised of a water-soluble (hydrophilic) part, and a fat-soluble (lipophilic) part.
- the surfactant may e.g. be selected from the group consisting of anionic surfactants, cationic surfactants, nonionic surfactants, and/or zwitterionic surfactants.
- An aspect of the invention relates to a composition
- a composition comprising a GLP-1 agonist, an absorption enhancer or delivery agent and a hydrotrope.
- the composition of the present invention further comprises one or more hydrotropes.
- Hydrotropes like a surfactant includes both a hydrophilic part and a hydrophobic and can form micelles and self-aggregate, however they solubilize solutes without micellar solubilization.
- the inventors have found that that absorption of the GLP-1 agonist and thus the plasma exposure can be increased by including a hydrotrope in the compositions.
- the hydrotrope increases the solubility of the delivery agent, such as a salt of NAC, as exemplified by SNAC herein. As shown by Assay I herein hydrotropes can increase the solubility of SNAC in water.
- the hydrotrope is capable of increasing the solubility of SNAC. In one embodiment the hydrotrope is capable of increasing the solubility of a salt of NAC, such as SNAC, at least 2-fold at a concentration of 200 mg/ml at pH 6 at room temperature. In further embodiments, the hydrotrope increases solubility of a salt of NAC, such as SNAC, at least 3-, 4- or 5-fold when measured as described in Assay I herein. In a further embodiment, the hydrotrope increase the solubility of SNAC at least 5-fold, such as 8-fold or such as 10- fold when measured as described in Assay I.
- the hydrotrope or hydrotropes are selected from the group consisting of: Nipecotamide, Nicotinamide, p-hydroxybenzoic acid sodium, N,N dimethyl urea, N,N dimethyl benzamide, N,N diethyl nicotinamide, Sodium salicylate, Resorcinol, Sodium benzoate, Sodium Xylenesulfonate, Sodium p-toluenesulfonate, 1- Methylnicotinamide, Pyrogallol, Pyrocathecol, Epigallocatechin gallate, Tannic acid and Gentisic acid sodium salt hydrate.
- the hydrotrope or hydrotropes are selected from the group consisting of: Nipecotamide, Nicotinamide, p-hydroxybenzoic acid sodium, N,N dimethyl urea, N,N dimethyl benzamide, N,N diethyl nicotinamide, Sodium salicylate, Resorcinol, Sodium benzoate, Sodium Xylenesulfonate, Sodium p-toluenesulfonate, 1 - Methylnicotinamide, Pyrogallol, Pyrocathecol, Epigallocatechin gallate, Tannic acid and Gentisic acid sodium salt hydrate.
- the hydrotrope or hydrotropes are selected from the group consisting of: Nicotinamide, p-hydroxybenzoic acid sodium, N,N dimethyl urea, N,N dimethyl benzamide, N,N diethyl nicotinamide, Sodium salicylate, Resorcinol, Sodium benzoate, Sodium Xylenesulfonate, Sodium p-toluenesulfonate, 1 -Methylnicotinamide, Pyrogallol, Pyrocathecol, Epigallocatechin gallate and Gentisic acid sodium salt hydrate.
- the hydrotrope or hydrotropes are selected from the group consisting of: Nicotinamide, N,N dimethyl benzamide, N,N diethyl nicotinamide, Resorcinol, Sodium benzoate, Sodium Xylenesulfonate, Sodium p-toluenesulfonate, 1 - Methylnicotinamide, Pyrogallol, Pyrocathecol and Gentisic acid sodium salt hydrate.
- the molecular weight of the hydrotrope is at most 400 g/mol or such as at most 250 g/mol.
- the molecular weight of the hydrotrope is at least 80 g/mol or such as at least 100 g/mol
- the hydrotrope comprises an aromatic ring structure.
- the hydrotrope has a similar molecular structure as nicotinamide and Resorcinol, which both comprises an aromatic ring structure.
- physiologically acceptable salt thereof such as the sodium, potassium, chloride or sulphate salt.
- X is CH or N
- R 1 , R 2 and R 3 are independently selected from: -H, -OH, -CO2H, -CON(R 4 )2, -SO3H and -CH3 , wherein R 4 is -H, -CHs or -CH2-CH3
- X is CH or N
- R 1 is selected from -OH, -S0 3 H and CON(R 4 ) 2, wherein R 4 is -H, -CH 3 or -CH 2 -CH 3 ,
- R2 is selected from: -OH and-H and
- R3 is selected from: -H, -OH and -CH 3 or a physiologically acceptable salt thereof.
- the hydrotrope has the structure of Chem I, wherein
- X is CH
- R1 is is selected from: -OH and -S0 3 H,
- R2 and R3 are independently selected from: -H, -OH and -CH 3 or a physiologically acceptable salt thereof.
- X is CH or N
- R 2 and R 3 are independently selected from: -H, -OH and -CH 3
- R 5 is selected from: -OH and N(R 4 ) 2 , wherein R4 is -H, -CH 3 or -CH 2 -CH 3
- the one or more hydrotrope has the structure of Chem II wherein,
- X is CH
- R5 is -OH
- R2 and R3 are independently selected from: -OH and -H or a physiologically acceptable salt thereof.
- the one or more hydrotrope has the structure of Chem II as defined above, with the proviso that the hydrotrope is not sodium benzoate.
- the one or more hydrotrope has the structure of Chem II, wherein
- X is N
- R 5 is selected from: -OH and N(R 4 )2, wherein R4 is -H, -CH3 or -CH2-CH3
- R 2 and R 3 are independently selected from: -H, -OH and -CH3 or
- the one or more hydrotrope has the structure of Chem II, wherein
- R 5 is NH2
- R 2 and R 3 are independently selected from: -H, -OH and -CH3 or
- R 2 and R 3 are independently selected from -H and -CH3.
- R2 and R3 are independently selected from: -H and -OH.
- the hydrotrope or hydrotropes is/are selected from the group consisting of: Resorcinol, Pyrocatechol, Pyrogallol, Gentisic acid, Xylenesulfonate, p- toluenesulfonate, Nicotinamide, Dimethylbenzamide, Diethylbenzamide, 1- methylnicotinamide, Salicyclic acid, P-Hydroxybenzoic acid and Benzoate.
- the hydrotrope or hydrotropes is/are selected from the group consisting of: Resorcinol, Pyrocatechol, Pyrogallol, Gentisic acid, Xylenesulfonate, p- toluenesulfonate, Nicotinamide, Dimethylbenzamide, Diethylbenzamide, 1- methylnicotinamide, Salicyclic acid and P-Hydroxybenzoic acid.
- hydrotrope or hydrotropes is/are selected from the group consisting of: Resorcinol, Pyrocatechol and Pyrogallol, In one embodiment the hydrotrope or hydrotropes is/are selected from the group consisting of: Xylenesulfonate and p-toluenesulfonate
- hydrotrope or hydrotropes is/are selected from the group consisting of: Nicotinamide, Dimethylbenzamide, Diethylbenzamide and 1 - methylnicotinamide,
- hydrotrope or hydrotropes is/are selected from the group consisting of: Gentisic acid, Salicyclic acid, P-Hydroxybenzoic acid and Benzoate.
- hydrotrope or hydrotropes is/are selected from the group consisting of: Gentisic acid, Salicyclic acid and P-Hydroxybenzoic acid.
- hydrotrope or hydrotropes are nicotinamide and/or Resorcinol. In one embodiment the hydrotrope is nicotinamide.
- the hydrotrope is not sodium benzoate.
- the composition of the invention comprises a GLP-1 agonist, a delivery agent and a hydrotrope.
- compositions consisting of specific ingredients, the GLP-1 agonist, the delivery agent and the hydrotrope and optionally a lubricant, the term consisting is to be understood to nevertheless encompass trace amounts of any substance with no effect on the function of the composition.
- Such substances can be impurities remaining in preparation of the GLP-1 agonist, from the production of the salt of NAC, the hydrotrope preparation or minimal amounts (below 1 %) of any pharmaceutical acceptable excipient that do not affect the quality or absorption of the formulation.
- the pharmaceutical composition comprises a balanced amount of the hydrotrope relative to the amount of the delivering agent.
- the effect of the hydrotrope has been observed over a range of concentrations.
- the ratio of salt of NAC/hydrotrope is at least 0.5, such as at least 0.75 or such as at least 1.
- the ratio of salt of NAC/hydrotrope is 0.5-10.0 or such as such as 0.5-8 or such as 0.5-5.
- the ratio of salt of NAC/hydrotrope is 0.5-10.0 or such as 0.75-10.0, 0.5-8.0 or 1-2.0.
- the ratio of SNAC/Nicotinamide is at least 0.5, such as at least 0.75, such as at least 1.
- the ratio of salt of SNAC/Nicotinamide (w/w) is 0.5-10.0 or such as 0.5-8 or such as 0.5-5. In one embodiment the ratio of salt of SNAC/Nicotinamide (w/w) is 0.5-10.0 or such as 0.75-10.0, 0.5-8.0 or 1-2.0.
- the ratio of SNAC/Resorcinol (w/w) is at least 0.5, such as at least 0.75, such as at least 1. In one embodiment the ratio of salt of SNAC/Resorcinol (w/w) is 0.5-10.0 or such as 0.75-10.0, 0.5-8.0 or such as 1-2.0.
- the ratio of hydrotrope/salt of NAC is at least 0.1 , such as at least 0.2 or such as at least 0.3. In one embodiment the ratio of hydrotrope/salt of NAC (w/w) is 0.1-5.0 or such as 0.1-4.0, 0.2-3.0 or 0.25-2.0.
- the ratio of Nicotinamide/SNAC/ (w/w) is at least 0.1 -5.0 or such as 0.1 -4.0, 0.2-3.0 or 0.25-2.0. In one embodiment the ratio of Nicotinamide/SNAC (w/w) is 0.1-5.0 or such as 0.1-4.0, 0.2-3.0 or 0.25-2.0.
- the ratio of Resorcinol/SNAC/ (w/w) is at least 0.1 -5.0 or such as 0.1 -4.0, 0.2-3.0 or 0.25-2.0. In one embodiment the ratio of Resorcinol/SNAC (w/w) is 0.1 -5.0 or such as 0.1-4.0, 0.2-3.0 or 0.25-2.0.
- the amount of lubricant maybe be considered relative to the total amount of the other excipients, here hydrotrope and delivery agent, and not including the GLP-1 agonist. Relatively small amounts of the lubricant are usually included, such as less than 5 % of the total weight of the other excipients.
- the composition comprises less than 5 w/w % lubricant of the total amount of delivery agent and hydrotrope. In one embodiment the composition comprises 0.25- 5%, such as 1-4 w/w % lubricant of the total amount of delivery agent and hydrotrope. In further embodiments the composition comprises 0.25- 5%, such as1 -4 w/w % lubricant of the amount of salt of NAC, such as SNAC, and nicotinamide or resorcinol.
- the pharmaceutical composition according to the invention is preferably produced in a dosage form suitable for oral administration as described herein below.
- the absolute amounts of the ingredients of the composition of the invention are provided with reference to the content in a dosage unit i.e. per tablet, capsule or sachet.
- compositions of the invention may in a further embodiment comprise at most 1000 mg of said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid (NAC) per dose unit.
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- the invention relates to a composition wherein a dose unit comprises at most 500 mg of said salt.
- the amount of the salt of N-(8-(2-hydroxybenzoyl) amino)caprylic acid per dose unit is at least 0.15 mmol, such as selected from the group consisting of at least 0.20 mmol, at least 0.25 mmol, at least 0.30 mmol, at least 0.35 mmol, at least 0.40 mmol, at least 0.45 mmol, at least 0.50 mmol, at least 0.55 mmol and at least 0.60 mmol.
- the amount of the salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid per dosage unit of the composition is up to 2 mmol, such as up to 1.5 mmol, up to 1 mmol, up to 0.75 mmol, up to 0.6 mmol, up to 0.5 mmol, up to 0.4 mmol, up to 0.3 mmol and up to 0.2 mmol.
- the amount of the salt of N-(8-(2-hydroxybenzoyl) amino)caprylic acid per dose unit of the composition is in the range of 0.20 - 1.5 mmol, , 0.25-1.0 mmol 0.30-0.75 mmol or such as 0.45-0.65 mmol.
- the amount of SNAC in the composition is at least 50 mg, such as at least 75 mg, at least 100 mg, at least 125 mg, at least 150 mg, at least 175 mg, at least 200 mg, at least 225 mg, at least 250 mg, at least 275 mg and at least 300 mg per dose unit.
- the amount of SNAC in the composition is up to 575 mg, such as up to 550 mg, up to 525 mg, up to 500 mg, up to 475 mg, up to 450 mg, up to 425 mg, up to 400 mg, up to 375 mg, up to 350 mg, up to 325 mg per dose unit, or up to 300 mg per dose unit.
- the amount of SNAC in the composition is in the range of 75- 400 mg, such as from 80-350 mg, such as from around 100 to around 300 mg per dose unit.
- a dose unit of the pharmaceutical compositions of the invention comprises 0.1-100 mg of the GLP-1 agonist.
- a dose unit of the composition comprises an amount of GLP- 1 agonist is in the range of 0.1 - 50 mg, 0.2 to 50 mg, 0.5 to 50 mg or 1 to 40 mg.
- a dose unit of the composition comprises an amount of GLP- 1 agonist is in the range of 0.1 - 50 mg, 0.1 - 40 mg, 0.1 - 30 mg or 0.1 - 20 mg.
- a dose unit comprises 0.5-5 mg of the GLP-1 agonist, such as 0.75- 4 1 ⁇ 2 mg, such as 1 , 1 1 ⁇ 2, 2, 2 1 ⁇ 2 or 3 mg or 3 1 ⁇ 2, 4, 4 1 ⁇ 2 mg, such as 1-3 or 3-5 mg of the GLP-1 agonist per dose unit.
- a dose unit comprises 2 to 20 mg of the GLP-1 agonist, such as 2-15 mg, such as 2, 3, 4 or 5 mg, or such as 8, 10, 12 or 14 mg, such as 15 mg or such as 20 mg of the GLP-1 agonist per dose unit.
- a dose unit comprises 5 to 50 mg of the GLP-1 agonist, such as 10-45 mg, such as 20, 30 or 40 mg, or such as 25, 35, or 45 mg, or such as 30-50 mg or such as 20-40 mg of the GLP-1 agonist per dose unit.
- the amount of the hydrotrope is to be balanced with the amount of the delivering agents, such as SNAC, but in general a dose unit of the compositions of the invention comprises 10-600 mg of the hydrotrope.
- a dose unit comprises 20-400 mg, such as 40-300, such as 50- 200 mg, such as 50-175 mg of the hydrotrope.
- a dose unit comprises 100-600 mg, such as 100-500, such as 150-400 mg, such as 150-300 mg of the hydrotrope.
- a unit dose of the composition according to the invention comprises 50-600 mg nicotinamide and/or resorcinol.
- a dose unit comprises 50-400 mg, such as 50-300, such as 50- 200 mg, such as 50-175 mg nicotinamide and/or resorcinol.
- a unit dose of the composition according to the invention comprises 50-600 mg nicotinamide.
- a dose unit comprises 50- 400 mg, such as 50-300, such as 50-200 mg, such as 50-175 mg nicotinamide.
- GLP-1 agonist such as GLP-1 agonist is Semaglutide, GLP-1 agonist B or GLP-1 agonist C.
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- GLP-1 agonist such as GLP-1 agonist is Semaglutide, GLP-1 agonist B or GLP-1 agonist C.
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- the amount of GLP-1 agonist may be varied depending on identity of the GLP-1 agonist and the effect desired, i.e. a higher content may be relevant for treating obesity compared to diabetes.
- a unit dose of the composition comprises 200-400 mg SNAC, 0.5-10 mg GLP-1 agonist, 100-400 mg hydrotrope and 2-3 mg lubricant.
- a unit dose of the composition comprises 200-400 mg SNAC, 1 1 ⁇ 2 -10 mg GLP-1 agonist, 100-400 mg hydrotrope and 2-3 mg lubricant.
- a unit dose of the composition comprises 200-400 mg SNAC, 5-50 mg GLP-1 agonist, 100-400 mg hydrotrope and 2-3 mg lubricant.
- a unit dose of the composition comprises 200-400 mg SNAC, 0.5-10 mg GLP-1 agonist, 100-400 mg nicotinamide and 2-3 mg lubricant.
- a unit dose of the composition comprises 200-400 mg SNAC, 1 1 ⁇ 2 -10 mg GLP-1 agonist, 100-400 mg nicotinamide and 2-3 mg lubricant.
- a unit dose of the composition comprises 200-400 mg SNAC, 5-50 mg GLP-1 agonist, 100-400 mg nicotinamide and 2-3 mg lubricant.
- GLP-1 agonist such as GLP-1 agonist is Semaglutide, GLP-1 agonist B or GLP-1 agonist C.
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- the amount of GLP-1 agonist may be varied depending on identity of the GLP-1 agonist and the effect desired, i.e. a higher content may be relevant for treating obesity compared to diabetes.
- a unit dose of the composition comprises 80-120 mg SNAC, 0.5-5 mg GLP-1 agonist, 20-200 mg hydrotrope and 1-3 mg lubricant.
- a unit dose of the composition comprises 80-120 mg SNAC, 1 1 ⁇ 2 -10 mg GLP-1 agonist, 20-200 mg hydrotrope and 1-3 mg lubricant.
- a unit dose of the composition comprises 80-120 mg SNAC, 5-50 mg GLP-1 agonist, 20-200 mg hydrotrope and 1-3 mg lubricant.
- a unit dose of the composition comprises 80-120 mg SNAC, 0.5-5 mg GLP-1 agonist, 20-200 mg nicotinamide and 1-3 mg lubricant. In a preferred embodiment a unit dose of the composition comprises 80-120 mg SNAC, 1 1 ⁇ 2 -10 mg GLP-1 agonist, 20-200 mg nicotinamide and 1-3 mg lubricant.
- a unit dose of the composition comprises 80-120 mg SNAC, 5-50 mg GLP-1 agonist, 20-200 mg nicotinamide and 1-3 mg lubricant.
- compositions may be administered in several dosage forms, for example as a tablet; a coated tablet; a sachet or a capsule such as hard or soft gelatine capsule and all such compositions are considered solid oral dosage forms.
- the composition may further be compounded in a drug carrier or drug delivery system, e.g. in order to improve stability and/or solubility or further improve exposure.
- the composition may be a freeze-dried or spray-dried composition.
- the composition may be in the form of a dose unit, such as tablet.
- the weight of the unit dose is in the range of 50 mg to 1000 mg, such as in the range of 50-750 mg, or such as about 100-500 mg.
- the weight of the dose unit is in the range of 75 mg to 350 mg, such as in the range of 50-300 mg or 100-400 mg.
- the composition may comprise a granular part and/or an extra- granular part, wherein the granular part has been granulated and the extra-granular part has been added after granulation.
- the granular part may comprise one or more of the GLP-1 agonist, the delivery agent and/or the hydrotrope.
- the granular part may comprise a further excipient, such as a lubricant and/or glidant.
- the granular part comprises the delivery agent and the hydrotrope.
- the hydrotrope is included in the granular part, the extra- granular part or both.
- the granular part comprises magnesium stearate or glyceryl dibehenate.
- the GLP-1 agonist may be included in the granular part or the extra-granular part.
- the extra-granular part comprises the GLP-1 agonist.
- the extra-granular part may further comprise a lubricant and/or a glidant.
- the granular part may comprise a lubricant and/or a glidant.
- the granular part and the extra-granular part comprise a lubricant and/or a glidant.
- the lubricant and/or a glidant is magnesium stearate or glyceryl dibehenate.
- composition according to the invention may be performed according to methods known in the art.
- the various components are weighed, optionally delumped or sieved and then combined.
- the mixing of the components may be carried out until a homogeneous blend is obtained.
- granules refers broadly to pharmaceutical ingredients in the form of particles, granules and aggregates which are used in the preparation of solid dose formulations. Generally, granules are obtained by processing a powder or a blend to obtain a solid which is subsequently broken down to obtain granules of the desired size.
- granules are to be used in the tabletting material, granules may be produced in a manner known to a person skilled in the art, for example using wet granulation methods known for the production of "built-up" granules or "broken-down" granules.
- Methods for the formation of built-up granules may operate continuously and comprise, for example simultaneously spraying the granulation mass with granulation solution and drying, for example in a drum granulator, in pan granulators, on disc granulators, in a fluidized bed, by spray-drying or spray-solidifying, or operate discontinuously, for example in a fluidized bed, in a rotary fluid bed, in a batch mixer, such as a high shear mixer or a low shear mixer, or in a spray-drying drum.
- Methods for the production of broken-down granules which may be carried out discontinuously and in which the granulation mass first forms a wet aggregate with the granulation solution, which is subsequently comminuted or by other means formed into granules of the desired size and the granules may then be dried.
- Suitable equipment for the granulation step are planetary mixers, low shear mixers, high shear mixers, extruders and spheronizers, such as an apparatus from the companies Loedige, Glatt, Diosna, Fielder, Collette, Aeschbach, Alexanderwerk, Ytron, Wyss & Probst, Werner & Pfleiderer, HKD,
- Granules may be also formed by dry granulation techniques in which one or more of the excipient(s) and/or the active pharmaceutical ingredient is compressed to form relatively large moldings, for example slugs or ribbons, which are comminuted by grinding, and the ground material serves as the tabletting material to be later compacted.
- Suitable equipment for dry granulation is roller compaction equipment from Gerteis, but not limited hereto, such as Gerteis MICRO-PACTOR, MINI-PACTOR and MARCO-PACTOR.
- Further methods of obtaining granules can include hot melt extrusion, spray drying, spray granulation and/or ball milling.
- composition comprises a granulate of ii) and iii).
- the granular part comprises both the delivery agent and the hydrotrope
- these excipients may be co-processed prior to or in the preparation of the granules.
- the granulation maybe be obtained by various methods as described above, wherein ii) and iii) are initially mixed either as powders or by the preparation of a solution comprising both ingredients.
- Granules of ii) and iii) may then be obtained by dry granulation of the blend, such as by roller compaction.
- the blend may be hot melt extruded to obtain an extrudate which is subsequently milled to obtain the granules. This material can then be used directly or in dry granulation/roller compaction process to obtain the final granules.
- a solution of ii) and iii) is prepared and subject to spray granulation whereby granules are directly obtained.
- the solution can be used in a fluid bed spray granulation process.
- spray drying can be used followed by dry granulation/roller compaction to obtain the granules.
- one or more sieving step(s) can be included prior to the final dry granulation step/roller compaction or tablet compression.
- a tablet press may be used to compact the tabletting material into a solid oral dosage form, for example a tablet.
- the tabletting material is filled (e.g. force fed or gravity fed) into a die cavity.
- the tabletting material is then compacted by a set of punches applying pressure. Subsequently, the resulting tablet is ejected from the tablet press.
- the above mentioned tabletting process is subsequently referred to herein as the "compression process".
- Suitable tablet presses include, but are not limited to, rotary tablet presses and eccentric tablet presses.
- tablet presses include, but are not limited to, the Fette 102i (Fette GmbH), the Korsch XL100, the Korsch PH 106 rotary tablet press (Korsch AG, Germany), the Korsch EK-0 eccentric tabletting press (Korsch AG, Germany) and the Manesty F-Press (Manesty Machines Ltd., United Kingdom).
- the invention relates to a method of preparation a composition according to the invention.
- the method of preparing a tablet comprises; a) granulation of a mixture comprising the delivery agent and the hydrotrope b) blending of the granulates of a) with a GLP-1 agonist, and then c) compression of the blend into tablets.
- the granulation may be a wet or dry granulation.
- a lubricant such as magnesium stearate or glyceryl behenate may be included in steps a), b) and/or c).
- the invention relates to a method for producing a solid pharmaceutical composition comprising the steps of;
- the method is for producing a solid pharmaceutical composition comprising the steps of;
- the method may as described herein include further steps, such as a step of admixing the extrudate of ii) with an active pharmaceutical ingredient and optionally any further excipients and preparing said solid pharmaceutical composition using the mixture.
- the present invention also relates to a composition of the invention for use as a medicament.
- the composition of the invention may be used for the following medical treatments, all preferably relating one way or the other to diabetes:
- diabetes such as hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, non-insulin dependent diabetes, MODY (maturity onset diabetes of the young), gestational diabetes, and/or for reduction of HbA1 C;
- diabetes such as hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, non-insulin dependent diabetes, MODY (maturity onset diabetes of the young), gestational diabetes, and/or for reduction of HbA1 C
- diabetes such as hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, non-insulin dependent diabetes, MODY (maturity onset diabetes of the young), gestational diabetes, and/or for reduction of HbA1 C
- delaying or preventing diabetic disease progression such as progression in type 2 diabetes, delaying the progression of impaired glucose tolerance (IGT) to insulin requiring type 2 diabetes, and/or delaying the progression of non-insulin requiring type 2 diabetes to insulin requiring type 2 diabetes;
- ITT impaired glucose tolerance
- diabetes prevention and/or treatment of diabetic complications, such as neuropathy, including peripheral neuropathy; nephropathy; or retinopathy;
- lowering triglycerides lowering cholesterol; increasing HDL; lowering plasma levels of lipoprotein a (Lp(a)) in a human; inhibiting generation of apolipoprotein a (apo(a)) in vitro and/or in vivo;
- cardiovascular diseases such as syndrome X; atherosclerosis; myocardial infarction; coronary heart disease; stroke, cerebral ischemia; an early cardiac or early cardiovascular disease, such as left ventricular hypertrophy; coronary artery disease; essential hypertension; acute hypertensive emergency; cardiomyopathy; heart insufficiency; exercise tolerance; chronic heart failure; arrhythmia; cardiac dysrhythmia; syncopy; atheroschlerosis; mild chronic heart failure; angina pectoris; cardiac bypass reocclusion; intermittent claudication (atheroschlerosis oblitterens); diastolic dysfunction; and/or systolic dysfunction;
- cardiovascular diseases such as syndrome X; atherosclerosis; myocardial infarction; coronary heart disease; stroke, cerebral ischemia; an early cardiac or early cardiovascular disease, such as left ventricular hypertrophy; coronary artery disease; essential hypertension; acute hypertensive emergency; cardiomyopathy; heart insufficiency; exercise tolerance; chronic heart failure; arrhythm
- x prevention and/or treatment of critical illness, such as treatment of a critically ill patient, a critical illness poly-nephropathy (CIPNP) patient, and/or a potential CIPNP patient; prevention of critical illness or development of CIPNP; prevention, treatment and/or cure of systemic inflammatory response syndrome (SIRS) in a patient; and/or for the prevention or reduction of the likelihood of a patient suffering from bacteraemia, septicaemia, and/or septic shock during hospitalisation; and/or
- CIPNP critical illness poly-nephropathy
- SIRS systemic inflammatory response syndrome
- the indication is selected from the group consisting of (i)-(iii) and (v)-(iix), such as indications (i), (ii), and/or (iii); or indication (v), indication (vi), indication (vii), and/or indication (iix).
- the indication is (i).
- the indication is (v).
- the indication is (iix).
- the indications are type 2 diabetes and/or obesity.
- the invention further relates to a method of treatment of an individual in need thereof, comprising administering a therapeutically active amount of a composition according to the present invention to said individual.
- a therapeutically active amount of a composition according to the present invention to said individual.
- one or more dose units may be administered to said individual in need.
- the invention further relates to a method of treating a subject in need thereof, comprising administering a therapeutically effective amount of a composition according to the present invention to said subject.
- the method of treatment is for treatment of diabetes or obesity and/or the further indications specified above.
- a method for treating diabetes comprising administering to a subject in need thereof a therapeutically effective amount of a
- composition comprising a GLP-1 agonist, a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid (NAC), a hydrotrope and optionally, a lubricant.
- GLP-1 agonist a GLP-1 agonist
- NAC N-(8-(2- hydroxybenzoyl)amino)caprylic acid
- hydrotrope optionally, a lubricant.
- a method for treating diabetes comprising administering to a subject in need thereof a therapeutically effective amount of a
- GLP-1 agonist such as GLP-1 agonist is Semaglutide, GLP-1 agonist B or GLP-1 agonist C.
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- the GLP-1 agonist is semaglutide having a formula of N- epsilon26-[2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-(17-carboxy- heptadecanoylamino)butyrylamino]ethoxy ⁇ ethoxy)acetylamino]ethoxy ⁇ ethoxy)acetyl]
- N-(8-(2-hydroxybenzoyl)amino)caprylic acid (NAC) is sodium N-(8-(2-hydroxybenzoyl)amino)caprylic acid (SNAC).
- the GLP-1 agonist is N £27 -[2-[2-[[2-[2-[2-[[(4S)-4-carboxy- 4-[10-(4-carboxyphenoxy)decanoylamino]butanoyl]amino]
- compositions including magnesium stearate.
- the composition is administered orally and is in a form of a table, capsule or a sachet.
- one or more dose units may be administered to said subject in need.
- the treatment with a composition according to the present invention may also be combined with one or more additional active pharmaceutical ingredient(s), e.g. selected from antidiabetic agents, antiobesity agents, appetite regulating agents, antihypertensive agents, agents for the treatment and/or prevention of complications resulting from or associated with diabetes and agents for the treatment and/or prevention of complications and disorders resulting from or associated with obesity.
- additional active pharmaceutical ingredient(s) e.g. selected from antidiabetic agents, antiobesity agents, appetite regulating agents, antihypertensive agents, agents for the treatment and/or prevention of complications resulting from or associated with diabetes and agents for the treatment and/or prevention of complications and disorders resulting from or associated with obesity.
- Examples of these pharmacologically active substances are: Insulin, sulphonylureas, biguanides, meglitinides, glucosidase inhibitors, glucagon antagonists, DPP-IV (dipeptidyl peptidase-IV) inhibitors, sodium glucose linked transporter 2 (SGLT2) inhibitors; canagliflozin, dapagliflozin, empagliflozin, ertugliflozin, ipragliflozin, tofogliflozin, luseogliflozin, bexagliflozin, remogliflozin etabonate and sotagliflozin, particulally dapagliflozin and empagliflozin, inhibitors of hepatic enzymes involved in stimulation of gluconeogenesis and/or glycogenolysis, glucose uptake modulators, compounds modifying the lipid metabolism such as antihyperlipidemic agents as HMG CoA inhibitor
- composition comprising
- N-(8-(2-hydroxybenzoyl)amino)caprylic acid (NAC) N-(8-(2-hydroxybenzoyl)amino)caprylic acid (NAC)
- composition according to embodiment 1 wherein the hydrotrope is selected from the group of hydrotropes consisting of: Nipecotamide, Nicotinamide, p- hydroxybenzoic acid sodium, N,N dimethyl urea, N,N dimethyl benzamide, N,N diethyl nicotinamide, Sodium salicylate, Resorcinol, Sodium benzoate, Sodium Xylenesulfonate, Sodium p-toluenesulfonate, 1-Methylnicotinamide, Pyrogallol, Pyrocathecol, Epigallocatechin gallate, Tannic acid and Gentisic acid sodium salt hydrate.
- the hydrotrope is selected from the group of hydrotropes consisting of: Nipecotamide, Nicotinamide, p- hydroxybenzoic acid sodium, N,N dimethyl urea, N,N dimethyl benzamide, N,N diethyl nicotinamide, Sodium salicylate, Resorcinol, Sodium be
- composition according to embodiment 1 wherein the hydrotrope is selected from the group of hydrtropes consisting of: Nipecotamide, Nicotinamide, p-hydroxybenzoic acid sodium, N,N dimethyl urea, N,N dimethyl benzamide, N,N diethyl nicotinamide, Sodium salicylate, Resorcinol, Sodium Xylenesulfonate, Sodium p-toluenesulfonate, 1-Methylnicotinamide, Pyrogallol, Pyrocathecol, Epigallocatechin gallate, Tannic acid and Gentisic acid sodium salt hydrate.
- the hydrotrope is selected from the group of hydrtropes consisting of: Nipecotamide, Nicotinamide, p-hydroxybenzoic acid sodium, N,N dimethyl urea, N,N dimethyl benzamide, N,N diethyl nicotinamide, Sodium salicylate, Resorcinol, Sodium Xylenesulf
- composition according to embodiment 8, 9 or 10, where in the solubility is
- composition according to embodiment 1 wherein the hydrotrope is Nicotinamide or Resocinol.
- composition according to embodiment 1 wherein the hydrotrope is Nicotinamide.
- composition comprises a lubricant. 20. The composition according to any of the previous embodiments, wherein the composition comprises 0.25-5 w/w % lubricant of the total amount of other excipients.
- composition comprises a lubricant selected from magnesium stearate and glyceryl dibehenate.
- composition comprises 0.25-5 w/w % magnesium stearate of the total amount of SNAC and nicotinamide.
- composition according to any of the previous embodiments wherein the GLP-1 agonist comprises a C16, C18 or C20 fatty acid or a C16, C18 or C20 fatty diacid.
- the GLP-1 agonist is selected from the group consisting of: liraglutide, semaglutide, GLP-1 agonist B and GLP-1 agonist C.
- composition according to any of the previous embodiments, wherein the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid (NAC) is selected from the group consisting of the sodium salt, potassium salt and/or calcium salt of of N-(8-(2- hydroxybenzoyl)amino)caprylic acid.
- GLP-1 agonist such as Semaglutide, GLP-1 agonist B or GLP-1 agonist C.
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- SNAC sodium salt of NAC
- composition according to any of the previous embodiments, wherein a dose unit comprises at most 1000 mg of said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid (NAC).
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- composition according to any of the previous embodiments, wherein a unit dosage comprises
- GLP-1 agonist such as Semaglutide, GLP-1 agonist B or GLP-1 agonist C.
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- composition according to any of the previous embodiments, wherein a unit dosage comprises i) 0.1-30 mg, such as 0.1-20 mg Semaglutide
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- composition according to any of the previous embodiments 1-36, wherein a unit dosage comprises
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- composition according to any of the previous embodiments 1-36, wherein a unit dosage comprises
- 0.1-30 mg such as 0.1-20 mg GLP-1 agonist with the following structure
- NAC N-(8-(2-hydroxybenzoyl)amino)caprylic acid
- composition comprises a granulate comprising ii).
- composition comprises a granulate comprising ii) and iii).
- composition according to any of the embodiments 41 , 42 and 43, wherein the granulate is obtained by hot melt extrusion and milling, spray granulation, wet granulation or dry granulation.
- composition according to any of the embodiments 43, 44 or 45 wherein a solution of ii) and iii) is prepared prior to granulation.
- composition according to embodiment 46, wherein the granulate is obtained by spray granulation or wet granulation.
- composition according to embodiment 43, 44 or 45 , wherein the granulate is obtained hot melt extrusion and milling.
- composition according to embodiment 45 wherein the blend of ii) and iii) is hot melt extruded. 51. The composition according to embodiment 50, wherein the extrudate is milled.
- composition according to any of the embodiment 41-51 , wherein the granulate is obtained by roller compaction.
- extrudate is sieved through a screen of 50-500 pm.
- composition according to embodiment 48, wherein the spray dried product is sieved through a screen of 50-500 pm.
- composition according to embodiment 41-46, wherein the granulate is obtained by spray granulation.
- composition according to embodiment 56 wherein a solution of ii) and iii) is processed by spouted bed or fluid bed spray granulation.
- composition comprises an extra-granular part.
- 63. The composition according to any of the embodiments 1-62, wherein the composition is produced by a method comprising the steps of:
- composition consisting of:
- a lubricant such as magnesium stearate.
- composition according embodiment 64 wherein the GLP-1 agonist is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Semaglutide GLP-1 agonist B or GLP-1 agonist C.
- composition according embodiment 64, wherein ii) is the sodium salt of NAC (SNAC).
- composition is a pharmaceutical composition.
- composition according to embodiment 67, wherein the composition is for oral administration.
- composition according to embodiment 67, wherein the composition is a solid composition, such as a tablet, a capsule or a sachet for oral administration.
- composition is a pharmaceutical composition for use in a method of treating diabetes and/or obesity.
- a method for producing a solid pharmaceutical composition comprising the steps of; i) obtaining a blend comprising a salt of NAC and a hydrotrope,
- a method for producing a solid pharmaceutical composition comprising the steps of; i) obtaining a blend comprising a salt of NAC and a hydrotrope,
- a method for producing a solid pharmaceutical composition comprising the steps of i) obtaining a blend comprising a salt of NAC and a hydrotrope,
- a method for producing a solid pharmaceutical composition comprising the steps of i) obtaining a blend comprising a salt of NAC and a hydrotrope,
- a method for treatment of diabetes or obesity comprising administering to a subject in need a therapeutically effective amount of a composition according to embodiments 1- 70 or a composition produced by any of the method of embodiments 71-76.
- hydrotropes were selected for testing. Hydrotropes are weighed off and dissolved in 5 ml_ ultrapure water (200 mg/mL) and pH was titrated to pH 6 by addition of 2M HCI. Subsequently SNAC (200 mg) is added to the samples and placed on magnetic stirrers (400 rpm). The pH is maintained at pH 6 throughout the experiment by addition of 2M HCI.
- Nicotinamide and resorcinol was weighed off and dissolved in 5 ml_ ultrapure water to the final concentrations shown in Figure 1A & B and pH was titrated to pH 6 by addition of 2M HCI. Subsequently SNAC (200 mg) was added to the samples placed on magnetic stirrers (400 rpm) and pH is maintained at pH 6 throughout the experiment by addition of 2M HCI. After 4 hours of incubation samples were filtered through 0.45 pm syringe filters and the concentration of SNAC in solution is determined using a RP-HPLC method for detection of SNAC. The sample content is calculated based on the peak area of the SNAC peak in the chromatogram relative to the peak area of the SNAC references. The results are shown in figure 1 demonstrating a concentration dependent effect on SNAC solubility of both hydrotropes.
- PK studies in Beagle dogs are conducted to determine the exposure of the GLP-1 agonists after peroral administration of different dosage forms.
- the dogs are fasted overnight and from 0 to 4 h after dosing. Besides, the dogs are restricted to water 1 hour before dosing until 4 hours after dosing, but otherwise have ad libitum access to water during the whole period.
- the GLP-1 agonist tablets used for the per oral studies described herein are immediate release SNAC-based tablets dosed orally.
- the tablets containing the GLP-1 agonist are administered in the following manner: 10 min prior to tablet administration the dogs are dosed subcutaneously with approximately 3 nmol/kg of SEQ ID NO: 3). The tablets are placed in the back of the mouth of the dog to prevent chewing. The mouth is then closed and 10 mL of tap water is given by a syringe to facilitate swallowing of the tablet. Alternatively, 40 mL of water is administered by gavage just prior to tablet dosing, where after the tablet is dosed and 10 mL of tap water is given by a syringe to facilitate swallowing of the tablet. Blood sampling
- Blood is sampled at predefined time points for up till 10 hr post dosing to adequately cover the full plasma concentration-time absorption profile of the GLP-1 agonist.
- 0.8 ml_ of whole blood is collected in a 1.5 ml_ EDTA coated tube, and the tube is gently turned to allowing mixing of the sample with the EDTA.
- Blood samples (for example 0.8 ml_) are collected in EDTA buffer (8mM) and then centrifuged at 4°C and 2000G for 10 minutes. Plasma is pipetted into Micronic tubes on dry ice, and kept at -20°C until analysis.
- Blood samples are taken as appropriate, for example from a venflon in the cephalic vein in the front leg for the first 2 hours and then with syringe from the jugular vein for the rest of the time points (the first few drops are allowed to drain from the venflon to avoid heparin saline from the venflon in the sample).
- Blending is carried out by manual geometric mixing nicotinamide or resorcinol with SNAC followed by blending on a turbula mixer (7 min, 25 rpm). In cases where the magnesium stearate is not included in the initial blending step it was added in a secondary blending step by manual geometric mixing followed by blending on a turbula mixer (2 min, 25 rpm).
- Dry granulation is carried out by roller compaction on a Gerteis MICRO-PACTOR.
- the roller speed is set at 1 rpm and roller compaction force at 6 kN/cm, fill depth is 8 mm.
- Subsequent to dry granulation hand sieving of ribbons into granules using an 800 pm wire mesh screen is carried out.
- Hot melt extrusion is carried out on a Thermo Scientific Process 1 1 twin screw extruder. SNAC and nicotinamide or resorcinol are blended on a turbula prior to feeding into the extruder (7 min 25 rpm). The equipment is operated at process temperatures varying between 200 ° C to 105 ° C along the barrel to facilitate the melt extrusion. The screw speed is varied between 50 - 1000 rpm and material is fed into the extruder using a gravimetric feeder at varying feed rates and extruded through a 2 mm diameter circular die. The resulting extrudates are manually sieved into granules using a final mesh screen between 350 and 149 miti.
- Spray drying is carried out on a BOchi B-290 spray drier mounted with a 1.5 mm nozzle (0.7 mm tip and 0.7 mm needle).
- the equipment is operated at a pump speed between 5-18 %, 100% aspirator, 40-42 mm nitrogen pressure and inlet air temperature ranged between 72-120 ° C.
- the collected spray dried product is sieved through a 90 pm screen before further processing by roller compaction (method 2).
- the spray solution was composed of SNAC and nicotinamide (combined solid content ranging from 93-323 mg/ml_).
- Spray granulation is carried out on a Mini-Glatt fluid bed using a top spray configuration (0.5 mm nozzle, 0.35 bar nozzle air pressure) with satisfactory fluidisation air pressure and 40-50 ° C process inlet air temperature.
- a top spray configuration 0.5 mm nozzle, 0.35 bar nozzle air pressure
- a secondary spray granulation batch process is carried out using the material collected from the initial batch process as starting material and a post process drying in the equipment is carried out.
- the final material was sieved through a ⁇ 500 pm screen.
- the spray solution was composed of SNAC and nicotinamide (combined solid content 500 mg/ml_).
- Ball milling is carried out either on a Fritsch pulverisette 6 planetary ball mill using a 250 ml_ zirconium oxide bowl and 55 (10 mm) agate grinding balls for up to 3 hours at 300 rpm.
- Cryo ball milling is carried out on a Retsch MM200 ball mill with 10 ml_ stainless steel vessels and a single 20 mm stainless steel ball.
- the filled sample chamber is submerged in liquid nitrogen until the nitrogen stops boiling and subsequently milled for 15 min at 20 1/s, this process was repeated four times. For both milling methods the collected product is sieved through a 90 pm screen before further processing.
- Blending is carried out by manual geometric mixing the intermediate granulate with GLP-1 agonist followed by blending on a turbula mixer (7 min, 25 rpm).
- compositions including magnesium stearate or glyceryl dibehenate it was sieved through a 125 pm or 355 mih mesh and added in a secondary blending step by manual geometric mixing followed by blending on a turbula mixer (2 min, 25 rpm).
- Tablets are produced on a Kilian Style One or a Fette 1021 mounted with a single set of punches, resulting in 6.5 mm c 1 1 mm, 7.2 mm c 12 mm or 8.5 mm x 16 mm oval compound cup tablets having no score.
- Punch size is chose according to the total tablet weight.
- the press speed is set to 10% and for Fette 102i the press speed is set at 20 rpm.
- the fill volume is adjusted to obtain tablets having target weights based on composition. Compression forces around 3 to 25 kN are applied to obtain tablets with a crushing strength of around 20-120 N respective to the tablet size.
- GLP-1 agonist A is semaglutide
- GLP-1 agonist B is Diacylated
- [Aib8,Arg34,Lys37]GLP-1 (7-37) (Example 2 of WO201 1/080103) and GLP-1 agonist C is Diacylated-[Aib8,Glu22,Arg26,Lys27,Glu30,Arg34,Lys36]-GLP-1-(7-37)-peptidyl-Glu-Gly (Example 31 of W02012/1401 17).
- Semaglutide can be prepared according to the method described in W02006/097537, Example 4.
- GLP-1 agonists B and C can be prepared as described in WO201 1/080103 and W02012/1401 17, respectively.
- SNAC was prepared according to the method described in W02008/028859.
- test compositions A, B and C were generally prepared as described in WO2013/139694.
- Tablets with different amounts of GLP-1 agonist, SNAC and further excipients were prepared.
- the content of the prepared compositions is provided in Table 3 (Table 3.1 and Table 3.2).
- Reference compositions A, B and C were generally prepared as described in WO2013/139694.
- the test composition B14 was prepared as described in method 5, 7 and 8 above.
- the test compositions B1 1 -13 and A3 were prepared as described in method 2, 4, 7 and 8 above.
- test compositions B1 , B6-10, A1 -2, and C1 -C4 were generally prepared as described in method 3, 7 and 8 above, with minor variations in the process as specified below.
- Composition B1 was not sieved post extrusion; instead the extrudates were submerged in liquid nitrogen and reduced in particle size using a mortar and pestle. GLP-1 derivative was added into the mortar and co-ground to prepare the blend that was compressed into tablets.
- test compositions B5 and B17 were generally prepared as described in method 1 , 2, 7 and 8 above, with minor variations in the process as specified below.
- SNAC without resorcinol or nicotinamide
- SNAC without resorcinol or nicotinamide
- Fines ⁇ 90 pm
- composition B5 resorcinol was sieved through a 350 pm mesh prior to blending in method 7.
- test compositions B 15-16 were generally prepared as described in method 2, 6, 7 and 8 above, with minor variations in the as process as specified below.
- To prepare test compositions B15-16 the following procedure was followed; SNAC and nicotinamide were mixed by manual geometric mixing followed by blending on a turbula mixer (7 min, 25 rpm).
- the resulting blends were milled according to method 6 (B15 ball milled & B16 cryo ball milled) followed by roller compaction as described in method 1 .
- the obtained granulates were further processed into tablets according to method 7 and 8.
- test compositions B2-4 and B 18-19 were generally prepared as described in method 1 , 2, 7, and 8 above, with minor variations in the process as specified below. To prepare test compositions B2-4 and B18-19 the following procedure was followed;
- magnesium stearate was passed through a 355 pm or finer sieve. SNAC and nicotinamide (B18-B19) or resorcinol (B2-B4) were sieved ⁇ 53pm and the correct amounts of excipients was weighed off. The excipients were blended according to method 1 with the following variations. In composition B2 magnesium stearate was added in the secondary blending step (62.5% of the composition, remainder was added in method 7. In composition B3 magnesium stearate was added in the secondary blending step. In composition B18 62.5% of the total magnesium stearate was included (remainder was added in method 7) and blending time on the turbula mixer was increased to 15 min. These blends were then roller compacted according to method 2 followed by preparation of the final tablets according to method 7 and 8.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Diabetes (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Endocrinology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Immunology (AREA)
- Child & Adolescent Psychology (AREA)
- Emergency Medicine (AREA)
- Physiology (AREA)
- Nutrition Science (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Medicinal Preparation (AREA)
Abstract
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP18171046 | 2018-05-07 | ||
PCT/EP2019/061502 WO2019215063A1 (fr) | 2018-05-07 | 2019-05-06 | Compositions solides comprenant un agoniste de glp-1 et un sel d'acide n-(8-(2-hydroxybenzoyl)amino)caprylique |
Publications (1)
Publication Number | Publication Date |
---|---|
EP3790575A1 true EP3790575A1 (fr) | 2021-03-17 |
Family
ID=62134107
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP19720693.1A Pending EP3790575A1 (fr) | 2018-05-07 | 2019-05-06 | Compositions solides comprenant un agoniste de glp-1 et un sel d'acide n-(8-(2-hydroxybenzoyl)amino)caprylique |
Country Status (19)
Country | Link |
---|---|
US (2) | US11622996B2 (fr) |
EP (1) | EP3790575A1 (fr) |
JP (2) | JP7164628B2 (fr) |
KR (1) | KR20210008353A (fr) |
CN (1) | CN112153979A (fr) |
AR (1) | AR115283A1 (fr) |
AU (1) | AU2019264783A1 (fr) |
BR (1) | BR112020021717A2 (fr) |
CA (1) | CA3097944A1 (fr) |
CL (1) | CL2020002797A1 (fr) |
CO (1) | CO2020014570A2 (fr) |
IL (2) | IL277857B1 (fr) |
MA (1) | MA52556A (fr) |
MX (1) | MX2020011308A (fr) |
PE (1) | PE20211794A1 (fr) |
PH (1) | PH12020551691A1 (fr) |
SG (1) | SG11202009978WA (fr) |
TW (1) | TWI829687B (fr) |
WO (1) | WO2019215063A1 (fr) |
Families Citing this family (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN110642935A (zh) * | 2019-09-25 | 2020-01-03 | 成都奥达生物科技有限公司 | 一种替瑞帕肽类似物 |
CN115461044A (zh) | 2020-04-29 | 2022-12-09 | 诺和诺德股份有限公司 | 包含glp-1激动剂和组氨酸的固体组合物 |
TW202227474A (zh) | 2020-12-18 | 2022-07-16 | 丹麥商諾佛 儂迪克股份有限公司 | Glp-1及澱粉素受體之共促效劑 |
CN113171446B (zh) * | 2021-05-06 | 2022-03-29 | 合肥天汇孵化科技有限公司 | 利拉鲁肽组合物及其用途 |
CN117561072A (zh) * | 2021-06-25 | 2024-02-13 | 甘李药业股份有限公司 | 含glp-1化合物的药物组合物 |
WO2023065231A1 (fr) * | 2021-10-21 | 2023-04-27 | Guangzhou Dazhou Biomedicine Ltd. | Administration orale d'agents thérapeutiques |
TW202346324A (zh) | 2022-05-10 | 2023-12-01 | 丹麥商諾佛 儂迪克股份有限公司 | 前藥及其用途 |
WO2024008904A2 (fr) * | 2022-07-08 | 2024-01-11 | Novo Nordisk A/S | Composés isvd hautement puissants capables de remplacer fviii(a) |
WO2024133739A1 (fr) | 2022-12-22 | 2024-06-27 | Novo Nordisk A/S | Agonistes du récepteur de l'amyline |
Family Cites Families (96)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP3122128B2 (ja) * | 1989-12-21 | 2001-01-09 | ノボ ノルディスク アクティーゼルスカブ | ペプチド製剤 |
DK39892D0 (da) | 1992-03-25 | 1992-03-25 | Bernard Thorens | Peptid |
US6284727B1 (en) | 1993-04-07 | 2001-09-04 | Scios, Inc. | Prolonged delivery of peptides |
JPH10511365A (ja) * | 1994-12-23 | 1998-11-04 | ノボ ノルディスク アクティーゼルスカブ | 遅延性glp−1組成物 |
US5869602A (en) | 1995-03-17 | 1999-02-09 | Novo Nordisk A/S | Peptide derivatives |
US5650386A (en) | 1995-03-31 | 1997-07-22 | Emisphere Technologies, Inc. | Compositions for oral delivery of active agents |
DE19530865A1 (de) | 1995-08-22 | 1997-02-27 | Michael Dr Med Nauck | Wirkstoff sowie Mittel zur parenteralen Ernährung |
PL192359B1 (pl) | 1996-08-30 | 2006-10-31 | Novo Nordisk As | Pochodna GLP-1(7-37) lub analogu GLP-1(7-37), środek farmaceutyczny oraz zastosowanie pochodnej GLP-1(7-37) lub analogu GLP-1(7-37) |
EP1056775B1 (fr) | 1998-02-27 | 2010-04-28 | Novo Nordisk A/S | Derives de gpl-1 et de l'extendine au profil d'action etendu |
EP1062240B1 (fr) | 1998-02-27 | 2010-04-28 | Novo Nordisk A/S | Derives de glp-1 modifies a l'extremite n-terminale |
DE69916811T2 (de) | 1998-02-27 | 2005-04-14 | Novo Nordisk A/S | Glp-1 derivate mit einem helix-gehalt über 25 %, die partiell strukturierte mizellenartige aggregate bilden |
ATE466027T1 (de) | 1998-02-27 | 2010-05-15 | Novo Nordisk As | Abkömmlinge von glp-1 analogen |
BR9913857A (pt) | 1998-09-17 | 2001-06-12 | Lilly Co Eli | Formulações de proteìna |
DE60023841T2 (de) | 1999-02-05 | 2006-05-24 | Emisphere Technologies, Inc. | Verfahren zur herstellung alkylierter salicylamide |
WO2000062759A1 (fr) | 1999-04-16 | 2000-10-26 | Novo Nordisk A/S | Formulation pharmaceutique seche et moulable |
WO2001092206A1 (fr) | 2000-06-02 | 2001-12-06 | Emisphere Technologies, Inc. | Procede de preparation de salicylamides |
US6573237B2 (en) | 2001-03-16 | 2003-06-03 | Eli Lilly And Company | Protein formulations |
US7144863B2 (en) | 2001-06-01 | 2006-12-05 | Eli Lilly And Company | GLP-1 formulations with protracted time action |
EP2409569B1 (fr) | 2002-02-20 | 2017-08-16 | Emisphere Technologies, Inc. | Méthode d'adminstration de molécules peptidiques du type glucagon (GLP-1) |
CN1787830A (zh) * | 2003-05-14 | 2006-06-14 | 爱密斯菲尔科技公司 | 用于传送肽yy和pyy激动剂的组合物 |
AU2004241242A1 (en) * | 2003-05-14 | 2004-12-02 | Emisphere Technologies, Inc. | Compositions for delivering peptide YY and PYY agonists |
TW200526254A (en) | 2003-09-19 | 2005-08-16 | Novo Nordisk As | Novel GLP-1 derivatives |
JP2007537142A (ja) | 2003-12-18 | 2007-12-20 | ノボ ノルディスク アクティーゼルスカブ | アルブミン様物質に結合した新規のglp−1類似物 |
AU2004298424A1 (en) | 2003-12-18 | 2005-06-30 | Novo Nordisk A/S | Novel GLP-1 compounds |
US20060286129A1 (en) * | 2003-12-19 | 2006-12-21 | Emisphere Technologies, Inc. | Oral GLP-1 formulations |
AU2005231359A1 (en) | 2004-03-31 | 2005-10-20 | Centocor, Inc. | Human GLP-1 mimetibodies, compositions, methods and uses |
CN1968919A (zh) * | 2004-04-16 | 2007-05-23 | 爱密斯菲尔科技公司 | 用于递送活性剂的8-(2-羟基苯氧基)辛基二乙醇胺和其盐 |
WO2005107773A2 (fr) * | 2004-05-06 | 2005-11-17 | Emisphere Technologies, Inc. | Forme de dosage solide d'heparine mouillee |
TW200611704A (en) | 2004-07-02 | 2006-04-16 | Bristol Myers Squibb Co | Human glucagon-like-peptide-1 modulators and their use in the treatment of diabetes and related conditions |
ES2564167T3 (es) | 2004-07-08 | 2016-03-18 | Novo Nordisk A/S | Conjugados de polipéptidos de acción prolongada que contienen una fracción tetrazol |
BRPI0513101A (pt) * | 2004-07-12 | 2008-04-29 | Emisphere Tech Inc | forma unitária de dosagem para administração bucal, uso da forma unitária de dosagem e método para preparar a forma unitária de dosagem |
JP2008515856A (ja) | 2004-10-07 | 2008-05-15 | ノボ ノルディスク アクティーゼルスカブ | 遅延性glp−1化合物 |
EP1799711B1 (fr) | 2004-10-07 | 2012-06-20 | Novo Nordisk A/S | Composes d'exendin-4 a action prolongee |
BRPI0519241A2 (pt) | 2004-12-22 | 2009-01-06 | Centocor Inc | agonistas, composiÇÕes, mÉtodos e usos de glp-1 |
ES2326906T3 (es) | 2004-12-22 | 2009-10-21 | Eli Lilly And Company | Formulaciones de proteinas de fusion analogas al glp-1. |
WO2006084164A2 (fr) * | 2005-02-01 | 2006-08-10 | Emisphere Technologies, Inc. | Systeme d'administration a retention gastrique et a liberation lente |
US8603972B2 (en) | 2005-03-18 | 2013-12-10 | Novo Nordisk A/S | Extended GLP-1 compounds |
TWI362392B (en) | 2005-03-18 | 2012-04-21 | Novo Nordisk As | Acylated glp-1 compounds |
EP1909824B1 (fr) | 2005-04-08 | 2011-05-18 | Amylin Pharmaceuticals, Inc. | Formulations pharmaceutiques comprenant un peptide incretine et un solvant polaire aprotique |
EP1968645A4 (fr) | 2005-12-22 | 2009-11-04 | Centocor Ortho Biotech Inc | Corps mimetiques humains glp-1 et compositions pour traiter l'obesite et les troubles associes, procedes et utilisations |
WO2007121318A2 (fr) | 2006-04-12 | 2007-10-25 | Emisphere Technologies, Inc. | Préparations destinées à l'administration d'insuline |
US8679540B2 (en) | 2006-06-09 | 2014-03-25 | Flamel Technologies | Pharmaceutical formulations for the prolonged release of active principle(s), and their applications, especially therapeutic applications |
TW200821386A (en) | 2006-07-18 | 2008-05-16 | Centocor Inc | Human GLP-1 mimetibodies, compositions, methods and uses |
WO2008019143A2 (fr) | 2006-08-04 | 2008-02-14 | Amylin Pharmaceuticals, Inc | Utilisation d'exendines et d'agonistes d'exendines et d'agonistes du récepteur glp-1 pour modifier la dimension de particule et la composition de sous-classe de lipoprotéines |
WO2008019147A2 (fr) | 2006-08-04 | 2008-02-14 | Amylin Pharmaceuticals, Inc. | Utilisation d'exendines et d'agonistes d'exendines et d'agonistes des récepteurs du glp-1 pour modifier la concentration de fibrinogène |
US20090318353A1 (en) | 2006-08-25 | 2009-12-24 | Novo Nordisk A/S | Acylated Exendin-4 Compounds |
BRPI0716539A2 (pt) | 2006-09-07 | 2016-11-01 | Emisphere Tech Inc | métodos para sintetização de ácido n-(8-[2-hidroxibenzoil]amino) caprílico e de sal de sódio deste |
WO2008070547A1 (fr) * | 2006-12-01 | 2008-06-12 | Emisphere Technologies Inc. | Formulations améliorées à base d'aciclovir |
TW200843794A (en) | 2006-12-21 | 2008-11-16 | Centocor Inc | Use of long-acting GLP-1 receptor agonists to improve insulin sensitivity and lipid profiles |
EP1980245A1 (fr) | 2007-04-11 | 2008-10-15 | Cephalon France | Composition pharmaceutique bicouche lyophilisée et ses procédés de fabrication et d'utilisation |
US20100080829A1 (en) | 2007-04-11 | 2010-04-01 | Cephalon France | Lyophilized pharmaceutical compositions and methods of making and using same |
GB0707662D0 (en) * | 2007-04-20 | 2007-05-30 | Astrazeneca Ab | Chemical compounds |
WO2009030738A1 (fr) | 2007-09-05 | 2009-03-12 | Novo Nordisk A/S | Dérivés de glucagon-like peptide-1 et leur utilisation pharmaceutique |
JP2010538049A (ja) | 2007-09-05 | 2010-12-09 | ノボ・ノルデイスク・エー/エス | 切断型glp−1誘導体及びその治療的使用 |
US20100261637A1 (en) | 2007-09-05 | 2010-10-14 | Novo Nordisk A/S | Peptides derivatized with a-b-c-d- and their therapeutical use |
EP2231191A2 (fr) | 2007-12-11 | 2010-09-29 | ConjuChem Biotechnologies Inc. | Formulation de conjugués de peptides insulinotropes |
JP2009274983A (ja) * | 2008-05-14 | 2009-11-26 | Kowa Co | ニコチン酸アミドを含有する経口医薬組成物 |
US8071537B2 (en) | 2008-06-25 | 2011-12-06 | Endo Pharmaceuticals Solutions Inc. | Implantable device for the sustained release of a polypeptide |
AU2009283821B2 (en) | 2008-08-18 | 2014-05-29 | Entera Bio Ltd. | Methods and compositions for oral administration of proteins |
EP3685837A1 (fr) | 2008-09-04 | 2020-07-29 | Amylin Pharmaceuticals, LLC | Formulations à libération prolongée à base de supports non aqueux |
US8425968B2 (en) | 2009-06-19 | 2013-04-23 | Pepsico., Inc. | Beverage preservative system containing pimaricin-cyclodextrin complex |
US20120065255A1 (en) * | 2009-10-19 | 2012-03-15 | Nagesh Palepu | Cabazitaxel formulations and methods of preparing thereof |
AU2010317995B2 (en) | 2009-11-13 | 2014-04-17 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition comprising a GLP-1 agonist, an insulin, and methionine |
CN102711804B (zh) | 2009-11-13 | 2015-09-16 | 赛诺菲-安万特德国有限公司 | 包含glp-1激动剂和甲硫氨酸的药物组合物 |
PL2513140T3 (pl) | 2009-12-16 | 2016-04-29 | Novo Nordisk As | Podwójnie acylowane pochodne glp-1 |
WO2011084618A2 (fr) | 2009-12-16 | 2011-07-14 | Nod Pharmaceuticals, Inc. | Compositions et procédés d'administration de médicaments par voie orale |
AU2011220867B2 (en) * | 2010-02-24 | 2014-05-15 | Emisphere Technologies, Inc. | Oral B12 therapy |
WO2011109784A1 (fr) | 2010-03-05 | 2011-09-09 | Conjuchem, Llc | Formulation de conjugués peptidiques insulinotropiques |
US9708383B2 (en) | 2010-11-09 | 2017-07-18 | Novo Nordisk A/S | Double-acylated GLP-1 derivatives |
EP3326620B1 (fr) | 2010-12-16 | 2020-03-04 | Novo Nordisk A/S | Compositions solides comportant un agoniste glp-1 et du sel de n-(8-(2-hydroxybenzoyl)amino)caprylate |
CN102718858B (zh) | 2011-03-29 | 2014-07-02 | 天津药物研究院 | 胰高血糖素样肽-1类似物单体、二聚体及其制备方法与应用 |
HUE031405T2 (en) | 2011-04-12 | 2017-07-28 | Novo Nordisk As | Double-acylated GLP-1 derivatives |
CN103906528A (zh) | 2011-06-24 | 2014-07-02 | 安米林药品有限责任公司 | 用glp-1受体激动剂的缓释制剂治疗糖尿病的方法 |
WO2013009545A1 (fr) | 2011-07-08 | 2013-01-17 | Amylin Pharmaceuticals, Inc. | Polypeptides génétiquement modifiés ayant une durée d'action accrue avec une immunogénéicité réduite |
EP2827845B1 (fr) * | 2012-03-22 | 2018-12-26 | Novo Nordisk A/S | Compositions comprenant un agent d'administration et préparation associée |
MY171146A (en) | 2012-03-22 | 2019-09-27 | Novo Nordisk As | Compositions of glp-1 peptides and preparation thereof |
EP2863895B1 (fr) * | 2012-06-20 | 2021-04-14 | Novo Nordisk A/S | Composition de comprimé comprenant un peptide et un agent délivrant |
JP6224586B2 (ja) | 2012-07-10 | 2017-11-01 | 武田薬品工業株式会社 | 注射用製剤 |
UA116217C2 (uk) | 2012-10-09 | 2018-02-26 | Санофі | Пептидна сполука як подвійний агоніст рецепторів glp1-1 та глюкагону |
BR112015014510A2 (pt) | 2012-12-21 | 2017-11-21 | Sanofi Sa | agonistas de glp1/gip duais ou de glp1/gip/glucagon trigonais |
BR112015026325A2 (pt) | 2013-05-02 | 2017-07-25 | Novo Nordisk As | dosagem oral de compostos glp-1 |
CN103405753B (zh) | 2013-08-13 | 2016-05-11 | 上海仁会生物制药股份有限公司 | 稳定的促胰岛素分泌肽水针药物组合物 |
WO2015086732A1 (fr) | 2013-12-13 | 2015-06-18 | Sanofi | Analogues peptidiques de l'exendine 4 |
WO2015086729A1 (fr) | 2013-12-13 | 2015-06-18 | Sanofi | Agonistes mixtes des récepteurs glp-1/gip |
AR099569A1 (es) * | 2014-02-28 | 2016-08-03 | Novo Nordisk As | Derivados de insulina y los usos médicos de estos |
WO2015155151A1 (fr) | 2014-04-07 | 2015-10-15 | Novo Nordisk A/S | Composés glp -1 à double acylation |
DK3006045T3 (en) | 2014-10-07 | 2017-07-17 | Cyprumed Gmbh | Pharmaceutical formulations for oral administration of peptide or protein drugs |
US20180263915A1 (en) | 2015-01-29 | 2018-09-20 | Novo Nordisk A/S | Pharmaceutical Composition for Oral GLP-1 Administration Comprising a Tablet Core and Immediate Release Coating |
US20180169010A1 (en) | 2015-06-16 | 2018-06-21 | Sun Pharma Advanced Research Company Limited | Long acting liraglutide compositions |
WO2017060500A1 (fr) | 2015-10-07 | 2017-04-13 | Cyprumed Gmbh | Formulations pharmaceutiques pour l'administration par voie orale de médicaments peptidiques |
EP3423481B1 (fr) | 2016-03-03 | 2020-10-07 | Novo Nordisk A/S | Dérivés glp-1 et leurs utilisations |
WO2018065634A1 (fr) | 2016-10-07 | 2018-04-12 | Cyprumed Gmbh | Compositions pharmaceutiques pour l'administration par voie nasale de médicaments de type peptide ou protéine |
EP3532068A4 (fr) * | 2016-10-31 | 2020-04-29 | Suda Ltd | Administration de principes actifs par voie muqueuse |
TWI797133B (zh) | 2017-06-09 | 2023-04-01 | 丹麥商諾佛 儂迪克股份有限公司 | 用於經口投予的固體組成物 |
KR102647171B1 (ko) | 2018-02-02 | 2024-03-15 | 노보 노르디스크 에이/에스 | Glp-1 작용제 및 n-(8-(2-하이드록시벤조일)아미노)카프릴산의 염을 포함하는 고형 조성물 |
EP4364751A3 (fr) | 2018-04-05 | 2024-06-26 | Sun Pharmaceutical Industries Limited | Nouveaux analogues de glp-1 |
-
2019
- 2019-05-03 TW TW108115351A patent/TWI829687B/zh active
- 2019-05-06 EP EP19720693.1A patent/EP3790575A1/fr active Pending
- 2019-05-06 MA MA052556A patent/MA52556A/fr unknown
- 2019-05-06 IL IL277857A patent/IL277857B1/en unknown
- 2019-05-06 WO PCT/EP2019/061502 patent/WO2019215063A1/fr unknown
- 2019-05-06 AU AU2019264783A patent/AU2019264783A1/en active Pending
- 2019-05-06 MX MX2020011308A patent/MX2020011308A/es unknown
- 2019-05-06 SG SG11202009978WA patent/SG11202009978WA/en unknown
- 2019-05-06 BR BR112020021717-4A patent/BR112020021717A2/pt unknown
- 2019-05-06 AR ARP190101193A patent/AR115283A1/es unknown
- 2019-05-06 PE PE2020001685A patent/PE20211794A1/es unknown
- 2019-05-06 CA CA3097944A patent/CA3097944A1/fr active Pending
- 2019-05-06 US US17/053,511 patent/US11622996B2/en active Active
- 2019-05-06 CN CN201980031030.XA patent/CN112153979A/zh active Pending
- 2019-05-06 KR KR1020207033262A patent/KR20210008353A/ko active Search and Examination
- 2019-05-06 JP JP2020562662A patent/JP7164628B2/ja active Active
-
2020
- 2020-10-13 PH PH12020551691A patent/PH12020551691A1/en unknown
- 2020-10-28 CL CL2020002797A patent/CL2020002797A1/es unknown
- 2020-11-24 CO CONC2020/0014570A patent/CO2020014570A2/es unknown
-
2022
- 2022-10-19 JP JP2022167761A patent/JP2022191439A/ja active Pending
- 2022-11-16 US US17/988,271 patent/US20230087952A1/en active Pending
-
2024
- 2024-05-05 IL IL312620A patent/IL312620A/en unknown
Also Published As
Publication number | Publication date |
---|---|
IL277857A (en) | 2020-11-30 |
AR115283A1 (es) | 2020-12-16 |
CN112153979A (zh) | 2020-12-29 |
MX2020011308A (es) | 2020-11-18 |
SG11202009978WA (en) | 2020-11-27 |
US11622996B2 (en) | 2023-04-11 |
IL312620A (en) | 2024-07-01 |
MA52556A (fr) | 2021-03-17 |
CL2020002797A1 (es) | 2021-02-19 |
WO2019215063A8 (fr) | 2020-07-02 |
PH12020551691A1 (en) | 2021-07-19 |
WO2019215063A1 (fr) | 2019-11-14 |
JP7164628B2 (ja) | 2022-11-01 |
CA3097944A1 (fr) | 2019-11-14 |
PE20211794A1 (es) | 2021-09-09 |
BR112020021717A2 (pt) | 2021-01-26 |
AU2019264783A1 (en) | 2020-12-10 |
IL277857B1 (en) | 2024-06-01 |
TWI829687B (zh) | 2024-01-21 |
JP2021523149A (ja) | 2021-09-02 |
CO2020014570A2 (es) | 2021-03-08 |
KR20210008353A (ko) | 2021-01-21 |
JP2022191439A (ja) | 2022-12-27 |
US20230087952A1 (en) | 2023-03-23 |
TW202015722A (zh) | 2020-05-01 |
US20210236601A1 (en) | 2021-08-05 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11833248B2 (en) | Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid | |
US20230087952A1 (en) | Solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid | |
US20220265777A1 (en) | Solid compositions comprising a glp-1 agonist, an sglt2 inhibitor and a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid | |
US20220395559A1 (en) | Solid compositions comprising a glp-1 agonist, an sglt2 inhibitor and a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid | |
US20230165939A1 (en) | Solid compositions comprising a glp-1 agonist and histidine | |
RU2804318C2 (ru) | Твердые композиции, содержащие агонист glp-1 и соль n-(8-(2-гидроксибензоил)амино)каприловой кислоты | |
RU2807183C2 (ru) | Твердые композиции, содержащие агонист glp-1, соль n-(8-(2-гидроксибензоил)амино)каприловой кислоты и смазывающее вещество | |
WO2024110614A1 (fr) | Administration orale d'agents thérapeutiques peptidiques, tels que glp-1 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
17P | Request for examination filed |
Effective date: 20201207 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
AX | Request for extension of the european patent |
Extension state: BA ME |
|
REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40039302 Country of ref document: HK |
|
DAX | Request for extension of the european patent (deleted) | ||
RAV | Requested validation state of the european patent: fee paid |
Extension state: MA Effective date: 20201207 Extension state: TN Effective date: 20201207 |