WO2023211228A1 - 항―wars1 항체를 포함하는 염증성 질환의 예방 또는 치료용 약학 조성물 - Google Patents

항―wars1 항체를 포함하는 염증성 질환의 예방 또는 치료용 약학 조성물 Download PDF

Info

Publication number
WO2023211228A1
WO2023211228A1 PCT/KR2023/005824 KR2023005824W WO2023211228A1 WO 2023211228 A1 WO2023211228 A1 WO 2023211228A1 KR 2023005824 W KR2023005824 W KR 2023005824W WO 2023211228 A1 WO2023211228 A1 WO 2023211228A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
gkb101
group
seq
wars1
Prior art date
Application number
PCT/KR2023/005824
Other languages
English (en)
French (fr)
Inventor
진미림
강병철
최윤희
장진아
윤희경
투이 트램 응우옌투이
Original Assignee
주식회사 미림진
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 미림진 filed Critical 주식회사 미림진
Publication of WO2023211228A1 publication Critical patent/WO2023211228A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y601/00—Ligases forming carbon-oxygen bonds (6.1)
    • C12Y601/01—Ligases forming aminoacyl-tRNA and related compounds (6.1.1)
    • C12Y601/01002—Tryptophan-tRNA ligase (6.1.1.2)

Definitions

  • the present invention relates to a pharmaceutical composition for the prevention or treatment of diseases containing as an active ingredient an antibody that specifically binds to the WARS1 protein.
  • Aminoacyl-tRNA synthetase is an enzyme that mediates the reaction of specifically binding amino acids to tRNA, and plays a central role in protein production. Recently, it has been known that the ARS is involved in various life phenomena such as apoptosis, angiogenesis, and inflammatory response in addition to protein production.
  • human tryptophanyl-tRNA synthetase 1 WARS1 is an aminoacyl-tRNA synthetase that links tryptophan with the tRNA that recognizes tryptophan, and has recently been used as a host defense mechanism against infection.
  • WARS1 functions as an endogenous ligand for TLR4 and TLR2, activating macrophages and inducing activation of innate immunity. Additionally, WARS1 initiates the production of proinflammatory cytokines and chemokines, including TNF- ⁇ , IL-6, MIP-1 ⁇ , and IL-8, and triggers infiltration of neutrophils. Afterwards, expression of the WARS1 gene is induced by IFN- ⁇ to maintain continuous secretion of WARS1.
  • ARSs including WARS1
  • WARS1 have many similarities in protein structure, so antibodies obtained through immune reactions often show cross-reactivity with other ARSs and do not produce highly sensitive antibodies.
  • the present inventors found that in patients with inflammatory diseases such as chronic obstructive pulmonary disease (COPD), inflammatory bowel disease (IBD), rheumatoid arthritis (RA), and atopic dermatitis (AD), Efforts were made to discover antibodies or fragments thereof that specifically bind to WARS1, whose expression level significantly increases. As a result, the present invention was completed by producing a novel anti-WARS1 antibody that specifically binds to WARS1 and inhibits the inflammatory response, and confirming its pharmacological activity.
  • COPD chronic obstructive pulmonary disease
  • IBD inflammatory bowel disease
  • RA rheumatoid arthritis
  • AD atopic dermatitis
  • one aspect of the present invention is H-CDR1 comprising the amino acid sequence of SEQ ID NO: 3, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and H-CDR2 comprising the amino acid sequence of SEQ ID NO: 7.
  • a disease comprising an antibody or fragment thereof as an active ingredient. Provides a pharmaceutical composition for the prevention or treatment of.
  • Another aspect of the present invention is a heavy chain variable region comprising H-CDR1 containing the amino acid sequence of SEQ ID NO: 3, H-CDR2 containing the amino acid sequence of SEQ ID NO: 5, and H-CDR3 containing the amino acid sequence of SEQ ID NO: 7. ; and a light chain variable region comprising L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, L-CDR3 comprising the amino acid sequences of SEQ ID NO: 14 and SEQ ID NO: 16.
  • H-CDR1 comprising the amino acid sequence of SEQ ID NO: 3
  • H-CDR2 comprising the amino acid sequence of SEQ ID NO: 5
  • H-CDR3 comprising the amino acid sequence of SEQ ID NO: 7. area
  • a light chain variable region comprising L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12 and L-CDR3 comprising the amino acid sequences of SEQ ID NO: 14 and SEQ ID NO: 16.
  • Administering an anti-WARS1 antibody or fragment thereof to a subject Provides a method for preventing or treating a disease comprising the steps of:
  • the anti-WARS1 antibody according to the present invention can be effectively used for the treatment of inflammatory diseases such as chronic obstructive pulmonary disease, inflammatory bowel disease, rheumatoid arthritis, and atopic dermatitis.
  • Figure 1 is a schematic diagram of a vector for expressing the heavy chain of the GKB101 antibody.
  • Figure 2 is a schematic diagram of a vector for expressing the light chain of the GKB101 antibody.
  • FIG. 3 shows BAL cells (A), lung cells (B), and Peyer's patches in bronchoalveolar lavage fluid (BALF) of mice after administration of saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model.
  • COPD_CTL saline
  • COPD_Dexa Dexa
  • GKB101 antibody GKB101 antibody
  • Roflumilast in a COPD mouse model.
  • Figure 4 shows neutrophils in the bronchoalveolar lavage fluid (BALF) of mice administered with saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model, followed by immunostaining using cytospin and observed under an optical microscope. This is a drawing showing the results. At this time, the normal group is the untreated group.
  • BALF bronchoalveolar lavage fluid
  • Figure 5 shows the results of counting the number of white blood cells in the blood of mice after administration of saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model (A), and the frequency (%) by counting neutrophils and lymphocytes.
  • COPD_CTL saline
  • COPD_Dexa Dexa
  • GKB101 antibody or Roflumilast in a COPD mouse model
  • FIG. 6 shows CXCL-1 (A), MIP2 (B), and IL-17 (C) in bronchoalveolar lavage fluid of mice after administration of saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model. ) and a graph showing the concentration of TNF- ⁇ (D). At this time, Normal is the untreated group.
  • Figure 7 is a graph showing the concentration of SDMA in mouse serum after administration of physiological saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model. At this time, Normal is the untreated group.
  • Figures 8a and 8b show inflammatory cytokines (MUC5AC(A), TRPA1(B), CXCL- This graph shows the results of confirming gene expression of 1(C), TARC(D), COX-2(E), TNF- ⁇ (F), TRPV1(G), and NOS-II(H) through q-PCR. . At this time, Normal is the untreated group.
  • Figure 9 shows the pathological morphology of mouse lung tissue after administration of saline solution (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model.
  • COPD_CTL saline solution
  • COPD_Dexa Dexa
  • GKB101 antibody GKB101 antibody
  • Roflumilast in a COPD mouse model.
  • Figure 10 is a diagram showing the results of observing mouse airway tissue under an optical microscope using PAS staining after administering physiological saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model. At this time, Normal is the untreated group.
  • FIG 11 shows the expression of CXCL-1 in mouse lung tissue after administration of saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model using immunohistochemistry using a fluorescence microscope. This is a drawing showing the observed results. At this time, normal (Nr) is the untreated group.
  • Figure 12 shows the expression of CXCL-1 in mouse lung tissue after administration of saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model using immunohistochemistry using a fluorescence microscope. This is a graph that quantifies the observed results. At this time, Normal is the untreated group.
  • FIG. 13 shows the expression of TNF- ⁇ in mouse lung tissue after administration of saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model using immunohistochemistry using a fluorescence microscope. This is a drawing showing the observed results. At this time, normal (Nr) is the untreated group.
  • Figure 14 shows the expression of TNF- ⁇ in mouse lung tissue after administration of saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model using immunohistochemistry using a fluorescence microscope. This is a graph that quantifies the observed results. At this time, Normal is the untreated group.
  • Figure 15 shows the expression of IRAK-1 protein in mouse lung tissue after administration of saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model, using immunohistochemistry using a fluorescence microscope. This is a drawing showing the results of observation. At this time, normal (Nr) is the untreated group.
  • Figure 16 shows the expression of IRAK-1 protein in mouse lung tissue after administration of saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model, using immunohistochemistry using a fluorescence microscope. This is a graph that quantifies the observed results. At this time, Normal is the untreated group.
  • Figures 17a to 17d show immune cells (lymphocytes, neutrophils, eosinophils, and This diagram shows the results of analyzing the absolute cell numbers of activated macrophages (activated macrophages) and immune cells using a flow cytometer. At this time, Normal is the untreated group.
  • a ⁇ F Total number of immune cells
  • G ⁇ K Absolute number of immune cells (number of immune cells included per 10 5 cells of total cells)
  • Figures 18a to 18d show immune cell types (lymphocytes, neutrophils, eosinophils, and activated macrophages) in mouse lung tissue after administration of saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model.
  • COPD_CTL saline
  • COPD_Dexa Dexa
  • GKB101 antibody or Roflumilast in a COPD mouse model.
  • a ⁇ F Total number of immune cells
  • G ⁇ L Absolute number of immune cells (number of immune cells included per 10 5 cells of total cells)
  • Figures 19a and 19b show immune cells (lymphocytes, neutrophils, eosinophils, and activated macrophages) and immune cells in mouse peyer's patches after administration of saline (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model.
  • COPD_CTL saline
  • COPD_Dexa Dexa
  • GKB101 antibody or Roflumilast in a COPD mouse model.
  • This diagram shows the results of analyzing the absolute cell number of cells using a flow cytometer. At this time, Normal is the untreated group.
  • a ⁇ D Total number of immune cells
  • E ⁇ H Absolute number of immune cells (number of immune cells included per 10 5 cells of total cells)
  • Figure 20 shows the frequency (%) of the results of analyzing immune cells in peripheral blood cells of mice through flow cytometry after administering saline solution (COPD_CTL), Dexa (COPD_Dexa), GKB101 antibody, or Roflumilast in a COPD mouse model. It's a graph. At this time, Normal is the untreated group.
  • Figure 21 is a diagram showing the composition of an experimental group to confirm the effect of GKB101 antibody on improving inflammatory bowel disease using a DSS (dextran sulfate sodium-induced colitis) mouse model.
  • Figure 22 is a diagram showing the criteria for determining a clinical index for assigning a clinical activity index (DAI) to evaluate the effect of GKB101 antibody on improving inflammatory bowel disease using a DSS mouse model.
  • DAI clinical activity index
  • Figure 23 is a graph showing the results of evaluating the clinical activity index of each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in the DSS mouse model. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001 vs IgG1 treatment group
  • Figure 24 is a graph showing the area under curve (AUC) of the results of evaluating the clinical activity index of each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in the DSS mouse model. *P ⁇ 0.05, **P ⁇ 0.01, ***P ⁇ 0.001 vs PBS treatment group
  • Figure 25 is a graph showing the results of evaluating the weight loss score of each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in the DSS mouse model. *P ⁇ 0.05 vs PBS treatment group
  • Figure 26 is a graph showing the area under curve (AUC) of the weight loss score of each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in the DSS mouse model.
  • AUC area under curve
  • Figure 27 is a graph showing the results of evaluating the stool consistency score of each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in the DSS mouse model. *P ⁇ 0.05, **P ⁇ 0.01, ***P ⁇ 0.001 vs PBS treatment group
  • Figure 28 is a graph showing the AUC of the stool consistency score of each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in the DSS mouse model. *P ⁇ 0.05, **P ⁇ 0.01, ***P ⁇ 0.001 vs PBS treatment group
  • Figure 29 is a graph showing the results of evaluating the intestinal bleeding score of each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in a DSS mouse model. *P ⁇ 0.05, **P ⁇ 0.01, ***P ⁇ 0.001 vs PBS treatment group
  • Figure 30 is a graph showing the AUC of the results of evaluating the intestinal bleeding score of each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in a DSS mouse model. *P ⁇ 0.05, **P ⁇ 0.01, ***P ⁇ 0.001 vs PBS treatment group
  • Figure 31 is a diagram showing the results of measuring the length of colon tissue in each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in a DSS mouse model. At this time, Normal is the untreated group.
  • Figure 32 is a graph showing the results of measuring the length of colon tissue in each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in a DSS mouse model. At this time, Normal is the untreated group. *P ⁇ 0.05, ***P ⁇ 0.001 vs PBS treatment group
  • Figure 33 is a graph showing the results of measuring the weight of colon tissue of each administration group with stool removed after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in a DSS mouse model. *P ⁇ 0.05, **P ⁇ 0.001, ***P ⁇ 0.001 vs PBS treatment group
  • Figure 34 is a diagram showing the items and index standards for morphological evaluation of colonic tissue in each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in the DSS mouse model.
  • Figure 35 is a diagram showing the results of staining colon tissue with H&E for morphological evaluation of colon tissue in each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in a DSS mouse model. Scale bars: 1000 ⁇ m (X9.2) and 100 ⁇ m (X200).
  • Figure 36 is a graph showing the morphological evaluation results of colonic tissue in each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in the DSS mouse model. *P ⁇ 0.05, **P ⁇ 0.001, ***P ⁇ 0.001 vs PBS treatment group
  • Figure 37 is a graph showing the correlation between the DAI score or DAI score-AUC of each administration group and the morphological evaluation results after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in a DSS mouse model.
  • Figure 38 is a graph showing the correlation between DAI score or DAI score-AUC and morphological evaluation results for each individual subject after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in a DSS mouse model.
  • Figure 39 is a graph showing the results of measuring the weight of spleen tissue in each administration group after administration of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in the DSS mouse model.
  • Figure 40 is a graph showing the results of measuring the body weight of each administration group during the administration period of PBS, Isotype IgG1, GKB101 antibody, or anti-TNF- ⁇ antibody in the DSS mouse model.
  • Figures 41A and 41B are graphs showing the results of analyzing the correlation between the concentration of WARS1 protein in the synovial fluid of rheumatoid arthritis (RA) patients and the severity of the disease.
  • A is the result of comparing the expression level of WARS1 in the synovial fluid of patients with osteoarthritis (OA) and rheumatoid arthritis
  • B is the result of comparing the degree of fibrous tissue (pannus) formation in the synovium and the expression level of WARS1 in synovial fluid of patients with rheumatoid arthritis
  • C is the result of comparing the degree of neovascularization in the synovium and the expression level of WARS1 in the synovial fluid of patients with rheumatoid arthritis
  • D is the result of comparing the number of infiltrated white blood cells (WBC) and WARS1 expression level in the synovial fluid of patients with rheumatoid arthritis
  • E is the result of analyzing the correlation between
  • Figure 42 is a diagram showing an experimental schedule for verifying the effect of GKB101 antibody on improving rheumatoid arthritis using a CIA (collagen-induced arthritis) mouse model.
  • Figure 43 is a diagram showing the results of observing the CIA mouse foot after administering Vehicle (PBS), Isotype IgG1, or GKB101 antibody to the CIA mouse model, and a graph showing the clinical arthritis index and AUC for the clinical arthritis index analysis results. ***p ⁇ 0.001 vs GKB101 antibody administration group
  • Figure 45 is a graph showing the results of measuring the body weight of CIA mice while administering Vehicle (PBS), Isotype IgG1, or GKB101 antibodies to the CIA mouse model. At this time, Normal is the untreated group.
  • PBS Vehicle
  • Isotype IgG1 Isotype IgG1
  • GKB101 GKB101 antibodies
  • Figure 46 is a graph showing the results of measuring the concentrations of WARS1 and inflammatory cytokines in serum and foot joints after administering Vehicle (PBS), Isotype IgG1, or GKB101 antibodies to a CIA mouse model. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001 vs IgG administration group
  • Figure 47 is a diagram showing an experimental schedule for verifying the effect of GKB101 antibody on improving rheumatoid arthritis using a CIA mouse model.
  • Figure 49 shows the results of observing the CIA mouse foot after administering PBS (control, vehicle), Isotype IgG1, MTX, anti-TNF- ⁇ antibody, TLR4 inhibitor (TAK242, TLR4i), or GKB101 antibody to the CIA mouse model. It is a drawing.
  • Figure 50 shows analysis of immune cells infiltrated within the foot joint of the mouse after administering Vehicle (PBS), Isotype IgG1, MTX, anti-TNF- ⁇ antibody, TLR4 inhibitor (TAK242, TLR4i), or GKB101 antibody to the CIA mouse model.
  • PBS Vehicle
  • Isotype IgG1, MTX anti-TNF- ⁇ antibody
  • TLR4 inhibitor TLR4i
  • GKB101 antibody GKB101 antibody
  • Figures 51a and 51b show inflammatory cytokines in the foot joints of mice after administering Vehicle (PBS), Isotype IgG1, MTX, anti-TNF- ⁇ antibody, TLR4 inhibitor (TAK242, TLR4i), or GKB101 antibody to the CIA mouse model. and a graph showing the results of measuring the concentration of chemokine.
  • PBS Vehicle
  • Isotype IgG1, MTX anti-TNF- ⁇ antibody
  • TLR4 inhibitor TLR4 inhibitor
  • GKB101 antibody GKB101 antibody
  • Figure 52 shows cartilage destruction factor (MMP3) in the foot joint of the mouse after administering Vehicle (PBS), Isotype IgG1, MTX, anti-TNF- ⁇ antibody, TLR4 inhibitor (TAK242, TLR4i), or GKB101 antibody to the CIA mouse model.
  • MMP3 cartilage destruction factor
  • PBS Vehicle
  • Isotype IgG1, MTX anti-TNF- ⁇ antibody
  • TLR4 inhibitor TLR4 inhibitor
  • GKB101 antibody GKB101 antibody
  • Figure 53 shows clinical arthritis severity (CAI, clinical arthritis index) after administering Vehicle (PBS), Isotype IgG1, MTX, anti-TNF- ⁇ antibody, TLR4 inhibitor (TAK242, TLR4i), or GKB101 antibody to the CIA mouse model.
  • CAI clinical arthritis severity
  • PBS Vehicle
  • Isotype IgG1, MTX anti-TNF- ⁇ antibody
  • TLR4 inhibitor TLR4i
  • GKB101 antibody GKB101 antibody
  • Figure 54 shows the clinical arthritis incidence (%) after administering Vehicle (PBS), Isotype IgG1, MTX, anti-TNF- ⁇ antibody, TLR4 inhibitor (TAK242, TLR4i), or GKB101 antibody to the CIA mouse model. This is a graph showing the analysis results. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001
  • Figures 55a and 55b are graphs showing the correlation between the measured concentrations of WARS1 and cytokines in the blood of atopic patients.
  • Figure 56 is a graph showing the correlation between the concentrations of WARS1 and TARC (thymus and activation-regulated chemokine) in the blood of atopic patients.
  • Figure 57 is a graph showing the results confirming the expression of WARS1 and CXCL-8/IL-8 according to GKB101 antibody treatment in human keratinocytes infected with Staphylococcus aureus . *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001
  • Figure 58 is Staphylococcus aureus This graph shows the results of confirming the expression of WARS1 and CXCL-8/IL-8 in infected human dermal fibroblasts according to GKB101 antibody treatment. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001
  • Figure 59 is a diagram showing an experimental schedule for evaluating the anti-inflammatory activity of GKB101 antibody using an atopic mouse model.
  • Figures 61a and 61b show the results of observing immune cells infiltrated into the epidermis and dermis by H&E staining the back surface of the mouse after administering Isotype IgG1 or GKB101 antibody to an atopic mouse model; It's a graph. At this time, Naive is the untreated group. *p ⁇ 0.05, **p ⁇ 0.01
  • Figure 62 is a graph showing the results of measuring the concentration of WARS1 and inflammatory cytokines in the back tissue of the mouse after administering Isotype IgG1 or GKB101 antibody to an atopic mouse model. At this time, Naive is the untreated group. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001.
  • Figure 63 is a graph showing the results of measuring the concentrations of WARS1 and IgE in the serum of mice after administering isotype IgG1 or GKB101 antibodies to an atopic mouse model. At this time, Naive is the untreated group. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001
  • composition comprising anti-WARS1 antibody
  • one aspect of the present invention is a heavy chain comprising H-CDR1 containing the amino acid sequence of SEQ ID NO: 3, H-CDR2 containing the amino acid sequence of SEQ ID NO: 5, and H-CDR3 containing the amino acid sequence of SEQ ID NO: 7. variable region; and a light chain variable region comprising L-CDR1 containing the amino acid sequence of SEQ ID NO: 12 and L-CDR3 containing the amino acid sequences of SEQ ID NO: 14 and SEQ ID NO: 16.
  • Anti-WARS1 antibody or fragment thereof as an active ingredient is provided.
  • a pharmaceutical composition for preventing or treating diseases including:
  • the term “antibody” refers to an immunoglobulin molecule that reacts immunologically with a specific antigen, and refers to a protein molecule that specifically recognizes the antigen.
  • the heavy and light chains of immunoglobulins may each include a constant region (C) and a variable region (V).
  • the light and heavy chain variable regions of immunoglobulins include three variable regions called complementarity determining regions (CDRs) and four framework regions (FRs).
  • CDR complementarity determining regions
  • FRs framework regions
  • WARS refers to tryptophanyl-tRNA synthetase, and is also known as tryptophan-tRNA ligase, TrpRS, WRS, etc. .
  • WARS is an enzyme that mediates the aminoacylation reaction between the amino acid tryptophan and tRNA.
  • WARS is encoded by the WARS gene in humans, and the amino acid sequence and mRNA base sequence of the protein are known as GenBank accession number NP_004175.2 (protein), GenBank accession number NM_004184.3 (mRNA base sequence), etc.
  • the anti-WARS1 antibody of the present invention may be an antibody or fragment thereof that specifically binds to WARS1.
  • the fragment of the antibody of the present invention may be Fab, F(ab') 2 , Fd, sdFv, Fv, dAb, scFv, sdAb, tetramer, etc., and contains an antigen binding site capable of specifically binding to WARS1. It can include any form.
  • the antibody includes a heavy chain variable region comprising H-CDR1 containing the amino acid sequence of SEQ ID NO: 3, H-CDR2 containing the amino acid sequence of SEQ ID NO: 5, and H-CDR3 containing the amino acid sequence of SEQ ID NO: 7; And L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, L-CDR2 comprising the amino acid sequence represented by SEQ ID NO: 14, and L-CDR3 comprising the amino acid sequence represented by SEQ ID NO: 16 below. It may be composed of a light chain variable region.
  • the heavy chain variable region may include the amino acid sequence of SEQ ID NO: 9.
  • the light chain variable region may include the amino acid sequence of SEQ ID NO: 18.
  • the antibody or fragment thereof may include a heavy chain region including the amino acid sequence of SEQ ID NO: 22 and a light chain region including SEQ ID NO: 23.
  • the antibody or fragment thereof may include an immunoglobulin Fc region.
  • the Fc region of the immunoglobulin includes the heavy chain constant region 2 (CH2) and heavy chain constant region 3 (CH3) of the immunoglobulin, but does not include the variable regions of the heavy and light chains and the light chain constant region (CL) of the immunoglobulin. refers to proteins that do not The immunoglobulin Fc region may be derived from IgG1, IgA, IgE, IgD, or IgM.
  • the Fc region of the immunoglobulin may be not only a wild-type Fc region, but also an Fc region variant.
  • the term "Fc region variant" used herein refers to a variant that has a glycosylation pattern different from that of the wild-type Fc region, has an increased sugar chain compared to the wild-type Fc region, has a decreased sugar chain compared to the wild-type Fc region, or has a sugar chain removed ( It may be in a deglycosylated form. Additionally, an aglycosylated Fc region is also included.
  • the Fc region or variant may have an adjusted number of sialic acids, fucosylation, and glycosylation through culture conditions or genetic manipulation of the host.
  • the sugar chain of the Fc region of immunoglobulin can be modified by conventional methods such as chemical methods, enzymatic methods, and genetic engineering methods using microorganisms.
  • the Fc region variant may be a mixture of the Fc regions of immunoglobulins IgG1, IgA, IgE, IgD, or IgM. Additionally, the Fc region variant may be a form in which some amino acids in the Fc region are replaced with other amino acids.
  • the Fc region may include the amino acid sequence of SEQ ID NO: 21.
  • the antibody of the present invention is a fusion protein comprising the light chain variable region (VL) and light chain constant region (CL) of the anti-WARS1 antibody, and the heavy chain variable region (VH), heavy chain constant region 1 (CH1), and Fc of the anti-WARS1 antibody. It may contain a fusion protein containing a region.
  • the anti-WARS1 antibody may include (I) and (II).
  • N' is the N terminus
  • the X is the antigen binding site of the anti-WARS1 antibody or fragment thereof and consists of X' and
  • the X' is an antigen binding site of the heavy chain of an anti-WARS1 antibody or fragment thereof and includes a variable region (VH) and a CH1 region,
  • the X'' is a light chain antigen binding site of an anti-WARS1 antibody or fragment thereof and includes a variable region (VL) and a constant region (CL),
  • the linker is a peptide linker
  • the o is O or 1.
  • anti-WARS1 antibody or fragment thereof, antigen binding site, variable region, and constant region are the same as described above.
  • the peptide linker may be composed of 1 to 50 consecutive amino acids or 3 to 30 consecutive amino acids. In one embodiment, the peptide linker may consist of 23 amino acids. Additionally, the peptide linker may contain at least one cysteine. Specifically, it may contain one, two or three cysteines. Additionally, the peptide linker may be derived from the hinge of immunoglobulin. For example, the hinge can be selected from the hinge regions of various IgG1 subtype antibodies. Additionally, the hinge may be a form in which some amino acids in the hinge region derived from immunoglobulin are replaced with other amino acids, or may be a sequence in which some amino acid sequences are added. In one embodiment, the peptide linker may be a peptide linker consisting of the amino acid sequence of SEQ ID NO: 20.
  • the pharmaceutical composition containing the anti-WARS1 antibody or fragment thereof as an active ingredient can be used for the prevention or treatment of diseases such as inflammatory diseases.
  • diseases such as inflammatory diseases.
  • the anti-WARS1 antibody or fragment thereof is the same as described above.
  • inflammation is a response to protect the living body against harmful factors, and involves immune cells, blood vessels, and inflammatory mediators to suppress cell damage, remove damaged tissue and necrotic cells, and It includes a series of processes to reproduce.
  • Inflammatory disease is a general term for diseases whose main lesion is inflammation.
  • chronic obstructive pulmonary disease used in this specification is a type of obstructive pulmonary disease in which airflow is chronically poor. Main symptoms include difficulty breathing, cough, and phlegm, and the majority of patients with chronic bronchitis develop chronic obstructive pulmonary disease. The most common cause of chronic obstructive pulmonary disease is smoking, but other factors such as air pollution and genetics also contribute to a lesser extent. These irritants cause an inflammatory response in the lungs, narrowing the small airways and causing emphysema, which destroys lung tissue.
  • COPD chronic obstructive pulmonary disease
  • inflammatory bowel disease refers to a disease that causes chronic inflammation in the gastrointestinal tract, including infectious enteritis such as bacterial, viral, amoebic, and tuberculous enteritis, ischemic bowel disease, It can include all inflammatory diseases that occur in all intestines, such as radiation enteritis.
  • infectious enteritis such as bacterial, viral, amoebic, and tuberculous enteritis
  • ischemic bowel disease It can include all inflammatory diseases that occur in all intestines, such as radiation enteritis.
  • the cause of inflammatory bowel disease has not been clearly identified, but it is known to be influenced by genetic and environmental factors and mediated by immunological abnormalities.
  • the inflammatory bowel disease may include, but is not limited to, Crohn's disease, ulcerative colitis, intestinal Bechet's disease, etc.
  • rheumatoid arthritis is a disease caused by inflammation of the tissue called synovial membrane surrounding joints. Therefore, it can occur in any joint where synovium is present. Initially, inflammation occurs in the synovium surrounding the joint, but gradually the inflammation spreads to the surrounding cartilage and bone, resulting in destruction and deformation of the joint. The exact cause of rheumatoid arthritis is not known, and it is a type of autoimmune disease in which the body's immune system abnormally attacks the body, causing inflammation.
  • atopic dermatitis is a skin eczema disease that is accompanied by severe itching and chronically recurs. It is one of the representative allergic diseases along with asthma, allergic rhinitis, and chronic urticaria. Infantile eczema, commonly called fever, can be seen as the beginning of atopic dermatitis.
  • Atopic dermatitis is known to be caused by a combination of various causes, including genetic predisposition, environmental factors, immunological abnormalities, and abnormalities in the skin barrier. Recently, it has been known that the increase in consumption of instant food and the increase in allergens due to indoor and outdoor pollution are closely related to the development of atopic dermatitis.
  • treatment can be used to include both therapeutic treatment and preventive treatment, and includes both application and any form of medication to treat diseases in mammals, including humans.
  • the term also includes inhibiting or slowing the progression of a disease; Restoring or repairing damaged or missing function, thereby partially or completely relieving a disease; or stimulating inefficient processes; It includes the meaning of alleviating serious diseases.
  • prevention may be used to mean alleviating or reducing the pathological condition or disease of an individual.
  • the preferred dosage of the pharmaceutical composition varies depending on the patient's condition and weight, degree of disease, drug form, administration route and period, but can be appropriately selected by a person skilled in the art.
  • the antibody or fragment thereof may be included in any amount (effective amount) depending on the use, formulation, purpose of formulation, etc., as long as it can exhibit a disease treatment effect.
  • a typical effective amount is Silver will be determined within the range of 0.001% by weight to 20.0% by weight based on the total weight of the composition.
  • “effective amount” refers to the amount of an active ingredient that can improve the condition of a disease or induce a treatment effect, especially an improvement in the condition of a disease or a treatment effect. Such effective amounts can be determined experimentally within the scope of the ordinary ability of those skilled in the art.
  • “enhanced efficacy” e.g., improvement in efficacy
  • administration means introducing a predetermined substance into an individual by an appropriate method, and the composition may be administered through any general route as long as it can reach the target tissue. It may be administered intraperitoneally, intravenously, intramuscularly, subcutaneously, intradermally, orally, topically, intranasally, intrapulmonaryly, or rectally, but is not limited thereto.
  • the term "therapeutically effective amount” or “pharmaceutically effective amount” refers to the amount of a compound or composition effective in preventing or treating a target disease, which means treating the disease at a reasonable benefit/risk ratio applicable to medical treatment. It refers to an amount that is sufficient for treatment and does not cause side effects.
  • the level of the effective amount is determined by factors including the patient's health status, type and severity of the disease, activity of the drug, sensitivity to the drug, administration method, administration time, administration route and excretion rate, treatment period, combination or concurrent use of drugs, and It may be determined based on other factors well known in the medical field.
  • a therapeutically effective amount refers to an amount of drug that is effective in treating a disease.
  • the pharmaceutical composition may further include a pharmaceutically acceptable carrier.
  • the pharmaceutically acceptable carrier may be any carrier that is a non-toxic material suitable for delivery to a patient. Distilled water, alcohol, fats, waxes and inert solids may be included as carriers. Pharmacologically acceptable adjuvants (buffers, dispersants) may also be included in the pharmaceutical composition.
  • the pharmaceutical composition may be prepared into a parenteral formulation according to the route of administration by a conventional method known in the art, including a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable means that it does not inhibit the activity of the active ingredient and does not have toxicity beyond what is acceptable for the subject of application (prescription).
  • the pharmaceutical composition When the pharmaceutical composition is prepared as a parenteral formulation, it can be formulated in the form of injections, transdermal administration, nasal inhalation, and suppositories along with a suitable carrier according to methods known in the art.
  • suitable carriers can be sterilized water, ethanol, polyols such as glycerol or propylene glycol, or mixtures thereof, preferably Ringer's solution, IgG1 (phosphate buffered saline) containing triethanol amine, or sterile for injection.
  • Isotonic solutions such as water or 5% dextrose can be used.
  • the formulation of pharmaceutical compositions it is known in the art, and specifically, references can be made to the literature [Remington's Pharmaceutical Sciences (19th ed., 1995)]. The above documents are considered part of this specification.
  • the preferred dosage of the pharmaceutical composition is in the range of 0.01 ⁇ g/kg to 10 g/kg, or 0.01 mg/kg to 1 g/kg per day, depending on the patient's condition, weight, gender, age, patient's severity, and route of administration. It can be. Administration can be done once a day or divided into several times. These dosages should not be construed as limiting the scope of the invention in any respect.
  • the subjects to which the pharmaceutical composition can be applied are mammals and humans, and humans are particularly preferred.
  • the pharmaceutical composition of the present invention may further include any compounds or natural extracts known to have a disease treatment effect.
  • Another aspect of the present invention provides the use of the anti-WARS1 antibody or antigen-binding fragment thereof for producing a medicament for preventing or treating diseases.
  • the disease, prevention, treatment, anti-WARS1 antibody or fragment thereof are the same as described above.
  • Another aspect of the present invention provides a use of the anti-WARS1 antibody or antigen-binding fragment thereof for preventing or treating diseases.
  • the disease, prevention, treatment, anti-WARS1 antibody or fragment thereof are the same as described above.
  • Another aspect of the present invention provides a method for preventing or treating a disease comprising administering the anti-WARS1 antibody or antigen-binding fragment thereof to a subject.
  • the disease, prevention, treatment, anti-WARS1 antibody or fragment thereof, and administration are the same as described above.
  • the subject may be a mammal, preferably a human.
  • the individual may be a patient suffering from a disease or an individual who is likely to suffer from a disease.
  • the administration route, dosage, and frequency of administration of the antibody or fragment thereof may be administered to the subject in various methods and amounts depending on the patient's condition and the presence or absence of side effects, and the optimal administration method, dosage, and frequency of administration can be determined by a person skilled in the art. You can select an appropriate range.
  • the preferred dosage of the anti-WARS1 antibody or antigen-binding fragment thereof is in the range of 0.01 ⁇ g/kg to 10 g/kg per day, or 0.01 mg/kg, depending on the patient's condition, weight, gender, age, patient severity, and route of administration. It may range from kg to 1 g/kg. Administration can be done once a day or divided into several times. These dosages should not be construed as limiting the scope of the invention in any respect.
  • the antibody or antigen-binding fragment thereof may be administered in combination with any compound or natural extract known to have a disease treatment effect, or may be formulated in the form of a combination preparation with other drugs.
  • the vector was introduced into ExpiHEK293 cells using Expifectamine 293 reagent (Thermo Fisher) at a ratio of 1:1, and heavy and light chains were expressed together in the same cell. After introducing the vector, the culture was shaken for about 5 days, the cell culture was centrifuged, the supernatant was recovered, and the antibody was separated and purified.
  • the recovered supernatant was loaded on a Hitrap MabselectSure column (GE Healthcare Life Sciences) and washed with IgG1 to remove non-specific binding. Proteins that specifically bind to the column were separated using 100mM Citrate buffer (pH 3.0) + 300mM NaCl. The eluate obtained by FPLC (fast protein liquid chromatography) was loaded onto size exclusion chromatography (GE Healthcare Life Sciences) to obtain high purity antibodies. The purified anti-WARS1 antibody was named “GKB101” (Table 4).
  • Example 2.1 Capture of standard cigarette smoke
  • the weight of the cigarette holder containing the Cambridge filter was measured before combustion according to ISO4387 regulations, and the cigarette smoke condensate burned by the method of Example 2.1 was measured by measuring the weight of the cigarette holder in which cigarette smoke was collected by the Cambridge filter after combustion.
  • the total particulate matter (TPM) content was measured and calculated (ISO4387, 2000).
  • TPM weight was 16.0621 mg for 19 cigarettes, 15.9135 mg for 20 cigarettes, and 15.5380 mg/cig for 20 cigarettes. Therefore, the total number of standard cigarette samples was 59 cigarettes and the TPM weight was 47.5136 mg.
  • the Cambridge filters in which cigarette smoke condensate was collected by the method of Example 2.1 were separated from the cigarette holders and placed in 100 ml Erlenmeyer flasks, and 50 ml of isopropanol as an extraction solvent was added and mixed. The mixture was left at room temperature for more than 8 hours to extract cigarette smoke condensate.
  • the extract was filtered after extraction and concentrated using a vacuum filtration concentrator, and the concentrates in three Erlenmeyer flasks were collected in a scintillation vial and completely concentrated using nitrogen gas.
  • TPM total particulate matter
  • TPM(mg/cig) (W FHA - W FBH )/N
  • TPM Total particulate matter
  • WFHA Weight of Filter Holder after smoking
  • WFHB Weight of Filer Holder before smoking
  • N Number of cigarettes smoked per trap (cig.)
  • Example 3 Verification of the inhibitory effect of GKB101 antibody on respiratory damage using a mouse model of chronic obstructive pulmonary disease
  • mice Male 7-week-old specific pathogen-free (SPF) BALB/c mice (18 g to 20 g) were supplied by Orient Bio. Animals were provided with sufficient solid feed (no antibiotics, Samyang Feed Co.) and water until the day of the experiment, and were acclimatized for one week in an environment with a temperature of 22 ⁇ 2°C, humidity of 55 ⁇ 15%, and 12 hours (light-dark cycle). It was used in the experiment. In addition, approval was obtained from Daejeon University's Institutional Animal Care and Use Committee (IACUC) to review the ethical and scientific validity and efficient management of animal experiments.
  • IACUC Institutional Animal Care and Use Committee
  • the LPS/CS mixture for establishing a mouse model of chronic obstructive pulmonary disease is 100 ⁇ g/ml of lipopolysaccharide (LPS) and 4 mg of standard cigarette smoking extract (CSE) in 1:1 ratio. Prepared by mixing 1.
  • the LPS/CS mixture was injected into the nose and mouth of the mouse at a total of 100 ⁇ l (50 ⁇ l each) once a week for 3 weeks.
  • a COPD mouse model is created by inhalation using the INT (intra-nazal-trachea) injection method.
  • the experimental groups were (i) untreated normal group (normal, Nr), (ii) control group administered LPS/CS and saline (COPD-CTRL), (iii) LPS/CS and dexamethasone (5 mg) /kg, p.o) administered experimental group (COPD-DEXA.), (iv) LPS/CS and GKB101 antibody (1 mg/kg, i.p) administered experimental group (COPD-GKB101 (1 mg/kg, i.p), (v) Experimental group administered LPS/CS and GKB101 antibody (3 mg/kg, i.p) (COPD-GKB101 (3 mg/kg, i.p); (vi) LPS/CS and GKB101 antibody (9 mg/kg, i.p) ) was administered (COPD-GKB101, 9 mg/kg, i.p.) and (vii) an experimental group administered LPS/CS and Roflumilast (30 mg/kg, p.o.) (COPD-Roflumilast).
  • mice in each group were separated to evaluate the effect of GKB101 antibody on suppressing respiratory damage.Each test substance (including physiological saline) was pretreated 1 hour before LPS/CS treatment.
  • Example 3.1 Bronchoalveolar lavage fluid, lung cell isolation and total cell count measurement
  • BAL bronchoalveolar lavage
  • alveolar lavage fluid was collected after washing the bronchial tubes and lung tissue with 1 ml of PBS through mouse airway intubation.
  • the lavage fluid was used as bronchoalveolar lavage (BAL) fluid (BALF).
  • lung tissue was removed, protein lysis buffer was added to a concentration of 100 ⁇ g/ml, and the tissue was dissolved. The lysate was centrifuged at 13,000 rpm, and only the supernatant was collected and used as a lung tissue sample. Lung cells were counted through Cytospin and Diff-Quick staining.
  • the total number of white blood cells (WBCs) was observed to be similar in both the control group (COPD-CTL) and the GKB101 antibody administration group. Additionally, no significant changes were observed in the Roflumilast administered group. It was confirmed that the neutrophil frequency (%) decreased in the GKB101 antibody administered group compared to the control group (COPD-CTL). On the other hand, the lymphocyte frequency (%) significantly increased in the GKB101 antibody administration group (1 mg/kg and 3 mg/kg) compared to the control group (COPD-CTL). In addition, the monocyte frequency (%) was significantly decreased in a concentration-dependent manner in the GKB101 antibody administered group compared to the control group (COPD-CTL).
  • Example 3.3 Analysis of inflammatory cytokine concentration in bronchoalveolar lavage fluid
  • the concentration of inflammatory cytokines in bronchoalveolar lavage fluid obtained from the experimental mice in Example 3 was measured using ELISA.
  • the concentrations of CXCL-1, MIP2, IL-17, and TNF- ⁇ in bronchoalveolar lavage fluid were all positive in the GKB101 antibody administered group (9 mg/kg) compared to the control group (COPD-CTL).
  • the concentrations of MIP2 and IL-17 were significantly decreased in the GKB101 antibody treatment group at all concentrations compared to the control group.
  • the cough-related genes MUC5AC and TARC, and the inflammation-related gene CXCL-1 in the lung tissue of the GKB101 antibody administered group (9 mg/kg) compared to the control group (COPD-CTL) and Cox-2 gene expression was confirmed to be significantly reduced.
  • the expression of TRPA1 and TRPV1 among cough-related genes, and TNF- ⁇ and NOS-II among inflammation-related genes decreased compared to the control group (COPD-CTL), but there was no statistical significance.
  • lung tissue obtained from the experimental mouse in Example 3 was stained with H&E and observed through an optical microscope.
  • the extracted airway tissue and lung tissue were fixed by reacting in 4% paraformaldehyde for one day, and paraffin tissue section slides were produced.
  • the paraffin tissue section slides were each washed three times with xylene solution and 100% ethanol to remove paraffin.
  • the slide from which the paraffin was removed was observed by the following method. After reacting the slide in hematoxylin solution for 5 minutes, the slide was sequentially washed in running water and 1% hydrochloric acid. Next, the slide was washed in running water and then neutralized with 1% ammonia solution (diluted in 70% ethanol). The slide was washed in running water and reacted in an eosin solution for 2 minutes. After the reaction was completed, the slide was sequentially washed with 70% to 100% ethanol solution and reacted in xylene solution for 3 minutes. At this time, the reaction process in the xylene solution was performed a total of three times. Finally, the tissue section slide was encapsulated with a cover slide and the shape of the tissue was observed under an optical microscope.
  • Masson Trichrome staining and observation It was performed by the following method.
  • the paraffin-removed slide was reacted in Bouin's solution at 60°C, taken out, cooled, and sequentially reacted in Weigert's Hematoxylin solution, Briebrich Scarlet solution, Phosphotungstic phosphomolybdic acid, and Aniline blue solution.
  • Weigert's Hematoxylin solution a 1% acetic acid solution
  • the lung tissue section slide was encapsulated with a cover slide and the degree of collagen deposition in the tissue was confirmed under an optical microscope.
  • the GKB101 antibody administration group (3 mg/kg and 9 mg/kg) and the positive control group Dexa.
  • the thickness of the airway in the 3 mg/kg group and the Roflumilast group decreased close to normal, and the infiltration of inflammatory immune cells around the bronchial tubes and granulocyte cells (neutrophils, eosinophils) and It was confirmed that the number of activated macrophages was significantly reduced.
  • M-T Masson Trichrome
  • the airway epithelial cell layer obtained in the mouse experiment of Example 3 was stained using the periodic acid-Schiff (PAS)-Alcian Blue (AB) staining method, and the airway The morphology of the tissue was observed under an optical microscope. PAS-AB staining was performed in the same manner as Example 3.6.
  • tissue slides were prepared using the lung tissue obtained from the experimental mouse in Example 3 in the same manner as in Example 3.6, and then the expression of CXCL-1 and TNF- ⁇ was examined. was confirmed through immunohistochemistry (IHC). At this time, the nuclei were stained using Hoechst.
  • IRAK-1 protein expression increased around the lung airway in the control group (COPD-CTL) compared to the normal group (Balb/c_Nr), and in the GKB101 antibody administered group (1 mg/kg) , 3 mg/kg, 9 mg/kg), IRAK-1 protein expression was significantly decreased in a concentration-dependent manner compared to the control group (COPD_CTL).
  • the positive control group Dexa IRAK-1 protein expression in lung tissue was significantly decreased in the administration group (p ⁇ 0.05) and Roflumilast administration group (p ⁇ 0.01) compared to the control group (COPD-CTL).
  • Example 3.10 Analysis of immune cells in bronchoalveolar lavage fluid and lung tissue
  • bronchoalveolar lavage fluid and immune cells in lung tissue obtained from the experimental mice in Example 3 were analyzed through flow cytometry.
  • the isolated PBMCs, BAL cells, lung cells, and Peyer's patch cells were diluted to a concentration of 5 ⁇ 10 5 cells and subjected to immunofluorescence staining at 4°C.
  • the antibodies used at this time were PE-anti-CD3e antibody (553064, BD Pharmingen), FITC-anti-CD8 antibody (553031, BD Pharmingen), PE-anti-CD4 antibody (553047, BD Pharmingen), and PE-anti-Gr-1.
  • BD Pharmingen antibodies (553128, BD Pharmingen), FITC-anti-CD69 antibody (55732, BD Pharmingen), FITC-anti-CD11b antibody (553310, BD Pharmingen) and PE-anti-B220 antibody (561878, BD Pharmingen).
  • FITC-anti-CD69 antibody 55732, BD Pharmingen
  • FITC-anti-CD11b antibody 553310, BD Pharmingen
  • PE-anti-B220 antibody 561878, BD Pharmingen
  • the absolute number of inflammatory CD4+ and CD8+ cells infiltrated in the BAL of the GKB101 antibody-administered group was significantly decreased in a concentration-dependent manner compared to the control group (COPD-CTL).
  • the absolute cell number of neutrophils (Gr-1 + SiglecF - neutrophils) infiltrated in the BAL of the GKB101 antibody administered group was significantly decreased in a concentration-dependent manner.
  • Example 3.10.2 Analysis of inflammatory cells in lung tissue
  • inflammatory lymphocytes CD4 + CD44 high + CD62L - , B220 + CD21 + /CD35 +
  • the absolute cell number of iBALT-forming lymphocytes was significantly decreased in a concentration-dependent manner.
  • L in Figure 18 shows the absolute cell number of neutrophils (Gr-1 + SiglecF - neutrophils) infiltrated in the lung.
  • the GKB101 antibody administration group decreased and statistical significance was shown in the high concentration group.
  • the positive control Dexa The absolute cell count of inflammatory lymphocytes (CD4 + CD44 high+ CD62L - , B220 + CD21 + /CD35 + : iBALT forming lymphocytes) in the administration group (p ⁇ 0.05) and Roflumilast administration group (p ⁇ 0.01) compared to the control group (COPD-CTL). There was a statistically significant decrease.
  • Peyer's patch is an immune tissue of the small intestine mucosa and is responsible for local immunity against antigens invading the intestinal cavity.
  • it is known to be an immune organ involved in the activity of intestinal lactic acid bacteria, the activation of T cells, B cells, dendritic cells, and M2 macrophages, and the differentiation and maturation of IgA-producing progenitor cells.
  • -CTL the control group
  • B220 - CD11c + represents the dendritic cell frequency (%) and increased in a concentration-dependent manner in the GKB101 antibody administered group compared to the control group (COPD-CTL).
  • the DSS mouse model (dextran sulfate sodium-induced colitis model) was used as a mouse model for inflammatory bowel disease.
  • Mice were 6-10 week old female B57BL/6 mice (Orient Bio), and were raised in an SPF (specific pathogen free) laboratory animal room maintained at a constant temperature and humidity of 21-23°C and relative humidity of 40-45%. .
  • SPF specific pathogen free laboratory animal room maintained at a constant temperature and humidity of 21-23°C and relative humidity of 40-45%.
  • the number of experimental animals per cage was less than 4, and cages were exchanged and fed three times a week.
  • Dissolve DSS (MP biomedical, reagent-grade, MW 36-50 KDa, cat no. 160110) in sterile water at a concentration of 2.5%, and replace 100 ml of 2.5% DSS solution per mouse cage once every two days. supplied. Clinical examinations were performed regularly until the end of the experiment to check the degree of inflammation and measure body weight. At this time, if the body weight decreased by more than 25% from the test start date, euthanasia was performed for ethical reasons. The experiment was terminated 7 to 8 days from the start of the experiment when the clinical index of the control group was judged to have reached its maximum.
  • test group was divided into a total of 7 groups (Figure 21). DSS administration began on day 0, and from days 1, 3, and 5, PBS (control group), Isotype IgG1 (5 mg/kg, Bio /kg, Bio At this time, the vehicle, PBS, was orally administered.
  • DAI clinical activity index
  • the positive control group, the anti-TNF- ⁇ antibody administration group and the GKB101 antibody administration group were all significant compared to the control group (PBS).
  • the clinical activity index decreased.
  • the GKB101 antibody administration group showed an effect of improving intestinal diseases in a dose-dependent manner.
  • there was no statistical significance in the positive control group (anti-TNF- ⁇ antibody) but a significant reduction effect was shown in the GKB101 antibody administration group (10 mg/kg and 15 mg/kg).
  • the GKB101 antibody showed a better reduction of clinical indicators than the anti-TNF- ⁇ antibody, which is widely used as a standard treatment in clinical practice, at a concentration of 10 mg/kg or more.
  • colonic tissue was removed from the experimental mouse of Example 4, and intestinal length and weight were measured.
  • the colon length was reduced by about 44.5% in the control group compared to the normal group, but the positive control group (anti-TNF- ⁇ antibody) and GKB101 antibody administration group (10 mg/kg, 15 mg /kg), it was confirmed that damage to the colon length was significantly reduced compared to the control group.
  • the colon length of the GKB101 administration group (10 mg/kg, 15 mg/kg) was maintained longer than that of the positive control group (anti-TNF- ⁇ antibody).
  • a statistically significant increase in the weight of the colon was observed only in the GKB101 antibody administered group (15 mg/kg) compared to the control group.
  • GKB101 antibody inhibits colon damage in a concentration-dependent manner, and in particular, it was confirmed that it can exhibit a superior inhibitory effect when administered at a concentration of 10 mg/kg or more.
  • Example 4.2 Histomorphological evaluation through histopathological analysis of colitis tissue.
  • colon tissue was extracted from the experimental mouse of Example 4, stained with H&E, and the morphology of the colon tissue was observed (200X magnification). The observed results were scored according to the item and indicator standards in Figure 34, and the scores for the evaluation items were added to finally evaluate the form of the organization ( Figure 34). At this time, H&E staining was performed in the same manner as Example 3.6.
  • the GKB101 antibody administered group showed a significant therapeutic effect in a concentration-dependent manner compared to the control group (PBS) or the antibody negative control group (Isotype IgG1). It was. In addition, it showed a statistically significant superior therapeutic effect compared to anti-TNF- ⁇ antibody, a widely used clinical treatment for ulcerative colitis.
  • DAI clinical disease activity index
  • total histological score was confirmed for each treatment group and individual mouse, and the GKB101 antibody administration group and positive control group (anti-TNF- It was confirmed that the DAI of ⁇ antibody) was well reflected by histomorphological quantitative evaluation indices.
  • Example 4.4 Due to repeated administration of GKB101 antibody in vivo Safety assessment
  • mouse body weight was measured every day from the start date of administration (day 0) to just before the end of administration (day 7).
  • RA rheumatoid arthritis
  • WARS1 protein in the synovial fluid of rheumatoid arthritis patients was confirmed.
  • the concentration of WARS1 in the gliding fluid was measured using ELISA.
  • GKB101 antibody was coated at a concentration of 1 ⁇ g/ml on a 96-well plate (Maxisorp, Thermo fisher), and then blocked with PBS containing 1% BSA for 1 hour at room temperature.
  • the lubricant was diluted by 1/2 and added to each coated well, reacted at room temperature for 1 hour, and then washed four times with PBST (PBS+Tween20).
  • PBST PBS+Tween20
  • Anti-WARS1 antibody (anti-WARS antibody, abFrontier) was added to each well, reacted at room temperature for 1 hour, and then washed four times with PBST. After reacting with HRP-attached secondary antibody (anti-human IgG1 antibody, cell signaling) for 1 hour, the reaction was washed with PBST, developed with TMB substrate (BD), and the OD value was measured at 490 nm (VersaMax Microplate reader). .
  • the concentration of WARS1 in the gliding cavity of patients with osteoarthritis (OA) and patients with rheumatoid arthritis (RA) was first compared.
  • the concentration of WARS1 was statistically significantly higher in patients with rheumatoid arthritis compared to patients with osteoarthritis. It was confirmed that there was an increase.
  • the degree of formation of fibrous tissue (pannus) or new blood vessels formed within the synovium of patients with rheumatoid arthritis was measured using GSUS (greyscale ultrasound) and compared with the concentration of WARS1. As a result, the higher the concentration of WARS1, the more fibrous tissue and new blood vessels.
  • the concentration of WARS1 is determined by the concentration of white blood cells and various immune cells (neutrophils, lymphocytes), inflammatory factors (ESR, CRP), and inflammatory cytokines (IL-6) and chemokines (IL-8) infiltrated in the synovial fluid. A positive correlation was shown.
  • Example 6 Verification of the effect of GKB101 antibody on improving rheumatoid arthritis using a rheumatoid arthritis mouse model
  • RA rheumatoid arthritis
  • CIA collagen-induced arthritis
  • mice used were male DBA/1J mice aged 6 to 10 weeks, and were raised in an SPF laboratory animal room maintained at constant temperature and humidity at a temperature of 21 to 23°C and a relative humidity of 40 to 45%.
  • the number of experimental animals per cage was less than 6, and cages were exchanged and fed twice a week.
  • the stimulant for inducing arthritis was dissolved in 10 mM acetic acid to a concentration of 2 mg/ml, bovine type II collagen, and then dissolved in Complete Freund's adjuvant (CFA, 2 mg/ml). mg/mL) and 1:1 (v/v).
  • CFA Complete Freund's adjuvant
  • Primary immunization was performed by intradermally injecting 100 ⁇ l of collagen prepared by the above method into the tail of each mouse. 21 days after the first immunization, IFA (incomplete Freund's adjuvant) and type 2 collagen were mixed at a ratio of 1:1 (v/v) to emulsify, and then intradermally injected into the tail of each mouse (100 ⁇ l) for the second immunization. proceeded. Mice that underwent secondary immunization were randomly divided into experimental groups and the experiment was performed.
  • mice were used per experimental group.
  • the experimental group was divided into a control group (Vehicle, PBS), an antibody negative control group (Isotype IgG1, 15 mg/kg), and a GKB101 antibody (15 mg/kg) administration group (FIG. 42).
  • 5 mice were used per group, with the control group (Vehicle, PBS), antibody negative control group (Isotype IgG1, 15 mg/kg), and positive control group anti-TNF- ⁇ antibody (15 mg/kg), TLR4
  • the group was divided into groups administered inhibitor (TAK242, 5 mg/kg), MTX (2 mg/kg), and GKB101 antibody (15 mg/kg).
  • Administration was conducted once every three days (total of four times) starting from the day of the second immunization (day 21), and the administration route was intraperitoneal administration (Figure 47).
  • the results of analyzing the AUC of CAI also showed similar patterns to the results during the administration period.
  • the control group and the Isotype IgG1 administration group showed similar levels of inflammatory activity, and the GKB101 antibody administration group significantly decreased compared to the control or Isotype IgG1 administration group (control vs. GKB101 antibody administration group, 98.7 ⁇ 6.5 vs 59.4 ⁇ 16.9, p ⁇ 0.001; Isotype IgG1 administration group vs GKB101 antibody administration group, 90.2 ⁇ 13.3 vs 59.4 ⁇ 16.9, p ⁇ 0.001).
  • the frequency (%) of feet with arthritis with a CAI score of 2 or more was confirmed to show a pattern similar to the CAI increase, and in the Isotype IgG1 administration group, the frequency of arthritis progressed to a level similar to that of the control group.
  • the GKB101 antibody administration group a statistically significant decrease was confirmed when compared to the control group or the Isotype IgG1 administration group (Isotype IgG1 administration group vs. GKB101 administration group, 67.50 ⁇ 16.87 vs 27.50 ⁇ 18.45, p ⁇ 0.05, control vs. GKB101 antibody administration group, 75.00 ⁇ 17.8 vs 27.50 ⁇ 18.45, p ⁇ 0.01).
  • the AUC analysis results of arthritis incidence also confirmed a significant decrease in the GKB101 antibody administration group compared to the control group and the Isotype IgG1 administration group (control vs. GKB101 antibody administration group, 542.5 ⁇ 112.0 vs 208.8 ⁇ 182.8, p ⁇ 0.01; Isotype IgG1 administered group vs. GKB101 antibody administered group, 423.8 ⁇ 148.9 vs 208.8 ⁇ 182.8, p ⁇ 0.01) (Figure 54).
  • Example 6.2 Histological analysis of foot joint tissue.
  • Example 6 In order to confirm the improving effect of GKB101 antibody on rheumatoid arthritis (RA) using the CIA mouse model, the foot joints of the experimental mice of Example 6 (first experiment, Figure 42) were observed by H&E staining. The histological score was measured based on histological evaluation criteria of a total of 4 items (synovial hyperplasia, pannus formation, cartilage destruction, and bone erosion). At this time, H&E staining was performed in the same manner as Example 3.6.
  • Example 6.4 Analysis of inflammatory cytokine and chemokine concentrations in serum and ankle joints
  • WARS1 inflammatory cytokines, and chemokines in serum and foot joints were measured by ELISA.
  • WARS1 was measured by the method in Example 5.
  • Concentrations of mCXCL2/MIP-2, mIL-6, and mMIP1 ⁇ were measured using mouse CXCL2/MIP-2 ELISA (R&D systems), mouse IL-6 ELISA (BioLegend), and mouse MIP1- ⁇ ELISA (R&D systems) kits. , the method was carried out according to the manufacturer's method.
  • the foot joint of the mouse was cut and then 1 mg/ml of collagenase solution (in 2% FBS+RPMI1640 medium) was added and reacted in a shaking incubator (180 rpm, 20 minutes) at 37°C.
  • the above process was repeated four times to obtain cells in the foot joint.
  • the cells obtained by the above method were analyzed in a flow cytometer and analyzed as percentage (%), and then the total cell number was applied to calculate the absolute cell number in each tissue.
  • the obtained cells were incubated with APC-anti-CD45 antibody (Invitrogen, 47-0451-82), PE-cy5-anti CD11b antibody (Invitrogen, 15-0112-82), and APC-anti-F4/80 antibody (Invitrogen, 17 -4801-82), APC-anti-CD4 antibody (Invitrogen, 17-0042-82), and eFluorscence450-anti-CD3e antibody (Invitrogen, 48-0031-82) were treated and reacted in sample tubes, respectively, and then incubated with FACS buffer. Washed.
  • the sample was fixed/permeabilized using fix/perm buffer (Invitrogen, 00-5523-00), and Alexa488-anti-iNos antibody (Invitrogen, 53-5920-82) and PE-Cy7-anti were added to the sample tube again.
  • -CD206 antibody Invitrogen, 25-2061-82
  • PE-Cy7-anti-IL-17a antibody Invitrogen, 25-7177-82
  • FITC-anti-IFN ⁇ antibody Invitrogen, 11-7311-82
  • the total number of immune cells and polarization of M1/M2 macrophages were confirmed to be similar to the control group in the Isotype IgG1 administration group, and in the GKB101 antibody administration group, it was confirmed that they decreased to a similar level as the positive control group, TLR4i or MTX administration group. .
  • Th1 and Th2 cells decreased to a level similar to that of the anti-TNF- ⁇ antibody or MTX administered group (FIG. 50). All of the above results were expressed as standard deviation (SEM) and were analyzed using the ANOVA statistical program. #p ⁇ 0.05, ##p ⁇ 0.01, ###p ⁇ 0.001, #: vs control group, *: vs IgG1 administration group, ⁇ : vs anti-TNF- ⁇ antibody administration group
  • Example 6.7 of inflammatory cytokines and chemokines in the foot joint. concentration analysis
  • Example 6 In order to confirm the improving effect of GKB101 antibody on rheumatoid arthritis (RA) using the CIA mouse model, the concentration of inflammatory cytokines and chemokines in the foot joints of the experimental mice of Example 6 (Experiment 2, Figure 47) was measured by ELISA. It was measured using At this time, protein in the foot joint was obtained in the same manner as in Example 6.7.
  • Concentrations of inflammatory cytokines and chemokines were measured using mouse IL-17 DuoSet ELISA (R&D Systems) and mouse IL-17F DuoSet ELISA (R&D Systems) kits.
  • TNF- ⁇ , IL-6, CCL3/MIP- ⁇ , and CXCL2/MIP-2 ⁇ were measured using Milliplex MAP Mouse Cytokine/Chemokine Magnetic Bead Panel, Milliplex, MCYTOMAG-70K (Millipore). All measurements were conducted according to the measurement method provided by the manufacturer.
  • the concentrations of TNF- ⁇ , IL-6, IL-17F, CXCL2/MIP-2 ⁇ , and CCL3 (MIP-1 ⁇ ) in the GKB101 antibody administered group decreased to a level similar to that of the positive control group, MTX or TLR4i administered group, and the anti- The concentration of inflammatory cytokines and chemokines decreased more significantly than that of the TNF- ⁇ antibody ( Figures 51a and 51b). All data were expressed as standard deviation (SEM) and analyzed using the ANOVA statistical program. #p ⁇ 0.05, ##p ⁇ 0.01, ###p ⁇ 0.001, #: vs control group, *: vs IgG1 administration group
  • the concentrations of cartilage destruction factor and osteoclast differentiation factor were measured using mouse total MMP-3 DuoSet ELISA (R&D Systems) and mouse TRANCE/RANKL/TNFSF11 DuoSet ELISA (R&D Systems) kits. All measurements were conducted according to the measurement method provided by the manufacturer.
  • the concentration of MMP3, a cartilage destruction factor, and RANKL, an osteoclast differentiation factor, in the Isotype IgG1 administered group was confirmed to be at a similar level to the control group.
  • the concentration of MMP3 was decreased.
  • the concentration of RANKL was not reduced.
  • the concentrations of both MMP3 and RANKL were significantly reduced (Figure 52). All data were expressed as standard deviation (SEM) and analyzed using the ANOVA statistical program. #p ⁇ 0.05, ##p ⁇ 0.01, ###p ⁇ 0.001, #: vs control group, *: vs IgG1 administration group, ⁇ : vs anti-TNF- ⁇ antibody administration group
  • WARS1 was measured in 14 atopic patients and 54 normal subjects.
  • WARS1 was measured in the same manner as in Example 5.
  • the WARS1 concentration in the blood of atopic patients (AD) was significantly increased compared to the normal group (HC). Additionally, the concentrations of IL-6, IL-8, TNF- ⁇ , IFN- ⁇ , and MIP-1 ⁇ were also significantly increased.
  • Staphylococcus aureus was used as an infectious agent to induce an inflammatory response in skin cell lines.
  • the Staphylococcus aureus was cultured on BHI agar plates 3 days before use and prepared through primary and secondary culture. Keratinocytes and dermal fibroblasts were used as human skin cell lines.
  • the above cell lines were inoculated into each 48-well plate at a concentration of 1 ⁇ 10 5 cells/well and cultured for 24 hours in medium containing 10% FBS without penicillin-streptomycin. On the day of infection, the medium of the cells was replaced with DMEM medium and infected with Staphylococcus aureus at 0, 0.1, 1, or 10 moi (multiplicity of infection).
  • each well was treated with GKB101 antibody at a concentration of 0 ⁇ g, 2.5 ⁇ g, or 5 ⁇ g. 24 hours later, the concentrations of WARS1 and CXCL-8/IL-8 in the cell culture were measured using ELISA.
  • the concentration of WARS1 was measured in the same manner as in Example 5, and CXCL-8/IL-8 was measured using the CXCL2/MIP-2 ELISA kit (R&D). All of the above measurement results were analyzed using the ANOVA statistical program. ***p ⁇ 0.001, **p ⁇ 0.01, ***p ⁇ 0.001.
  • mice used were male NC/Nga mice aged 6 to 10 weeks, and were raised in an SPF laboratory animal room maintained at constant temperature and humidity at a temperature of 21 to 23°C and a relative humidity of 40 to 45%.
  • the number of experimental animals per cage was less than 3, and cages were exchanged and food was supplied once a week.
  • Biostir AD ointment was applied twice a week for a total of 13 times over 6 weeks, and Stapylococcus aureus was applied to the dorsal area a total of 7 times at a dose of 4 ⁇ 10 7 CFU/100 ⁇ l per animal starting from the 21st day.
  • GKB101 antibody (5 mg/kg) or Isotype IgG1 (5 mg/kg) was administered intraperitoneally twice a week for a total of 11 times (Figure 59).
  • Example 8.1 Comparison of inflammation degree and thickness of back tissue
  • the degree of inflammation and skin thickness of the back tissue of the experimental mouse of Example 8 were observed. At this time, the skin thickness of the back tissue was measured a total of three times with a caliper at the area where inflammation was induced and presented as the average value.
  • the degree of inflammation-induced progression tended to decrease in the GKB101 antibody administered group compared to the Isotype IgG1 administered group.
  • the thickness increased more than twice in the Isotype IgG1 administration group compared to the normal group (naive) (p ⁇ 0.001).
  • the thickness of the back tissue was significantly increased compared to the normal group (naive) (p ⁇ 0.001), but the thickness of the epidermis was confirmed to be significantly decreased compared to the isotype IgG1 administered group (p ⁇ 0.05) ( Figure 60).
  • the back tissue of the experimental mouse of Example 8 was stained with H&E and the pathological form of the tissue was observed.
  • Tissue slides were produced.
  • the paraffin block produced through the above process was sectioned to a thickness of 10 um using a microtome.
  • Tissue slides were stained with H&E through a standard tissue processing process, and then tissue changes were observed using an optical microscope. H&E staining was performed in the same manner as Example 3.6.
  • the Isotype IgG1 administration group was significantly thicker compared to the normal group (naive) (p ⁇ 0.01).
  • the back tissue thickness of the GKB101 antibody administered group significantly increased compared to the normal group (p ⁇ 0.01), but significantly decreased compared to the Isotype IgG1 administered group (control group) (p ⁇ 0.001).
  • Protein expression in the back tissue was first extracted from the skin tissue protein of the back tissue, and then the protein expression in the skin was measured.
  • concentration of WARS1 was measured using the same method as in Example 5, and IgE and CXCL2/MIP-2 (IL-8 homologue) were measured using mouse IgE ELISA kit (BioLegend) and mCXCL2/MIP-2 ELISA kit (R&D systems), respectively. It was measured using .
  • the expression of WARS1 in back tissue showed no difference between the isotype IgG1 administered group and the naive group, but was significantly decreased in the GKB101 antibody administered group (p ⁇ 0.01).
  • Inflammatory cytokines CXCL-8/IL-8, IL-6, and IL-17 significantly increased (p ⁇ 0.01) in the Isotype IgG1 administered group compared to the normal group, and tended to decrease in the GKB101 antibody administered group.
  • the expression of WARS1 in serum was observed to increase in the Isotype IgG1 administered group compared to the normal group (naive), and was confirmed to be significantly decreased in the GKB101 antibody administered group (p ⁇ 0.01) (FIG. 62).
  • the concentration of IgE was significantly increased in the isotype IgG1 administered group compared to the normal group (naive) (p ⁇ 0.001).
  • the GKB101 antibody administered group also showed a similar level of IgE concentration as the Isotype IgG1 administered group ( Figure 63).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Pain & Pain Management (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Rheumatology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)

Abstract

본 발명의 항-WARS1 항체를 유효성분으로 포함하는 약학 조성물에 관한 것이다. 본 발명에 의한 항-WARS1 항체를 만성폐쇄성폐질환, 염증성 장질환, 류마티스 관절염, 아토피 피부염 마우스 모델에 각각 투여한 결과, 각각의 모델 마우스에서 염증 반응을 억제하여 질환에 대한 치료효과를 나타내었다. 따라서, 본 발명에 의한 항-WARS1 항체는 만성폐쇄성폐질환, 염증성 장질환, 류마티스 관절염, 아토피 피부염 등과 같은 염증성 질환의 치료 용도로 효과적으로 사용될 수 있다.

Description

항―WARS1 항체를 포함하는 염증성 질환의 예방 또는 치료용 약학 조성물
본 발명은 WARS1 단백질에 특이적으로 결합하는 항체를 유효성분으로 포함하는 질환의 예방 또는 치료용 약학 조성물에 관한 것이다.
아미노아실 티알엔에이 합성효소(aminoacyl-tRNA synthetase, ARS)는 아미노산을 특이적으로 tRNA에 결합시키는 반응을 매개하는 효소로서, 단백질 생성에 중추적인 역할을 담당한다. 최근, 상기 ARS가 단백질 생성 외에도 세포사멸(apoptosis), 혈관형성(angiogenesis), 염증반응 등 다양한 생명현상에 관여하고 있음이 알려져 있다. ARS 중 인간 트립토파닐 티알엔에이 합성효소 1(tryptophanyl-tRNA synthetase 1, WARS1)은 트립토판을 인지하는 tRNA와 트립토판을 연결하는 아미노아실 티알엔에이 합성효소로서, 최근에는 감염에 대한 숙주 방어 기전에 있어서의 WARS1의 역할에 대해 관심이 높아지고 있다. 본 발명자들은 이전에, 단핵구가 세균 감염 후 수분 이내에 신규(de novo) 합성 없이 세포 내 존재하는 WARS1을 세포 밖으로 분비한다는 것을 보고하였다(Young Ha Ahn. et al. Nature Microbiology (2016) 2:16191).
분비된 WARS1은 TLR4와 TLR2의 내생 리간드로 기능함으로써, 대식세포를 활성화하여 선천적인 면역의 활성화를 유도한다. 또한, WARS1은 TNF-α, IL-6, MIP-1α, IL-8을 포함하는 전염증성 사이토카인 및 케모카인 생산을 개시하고 호중구의 침윤을 유발한다. 이후 WARS1 유전자의 발현이 IFN-γ에 의해 유도되어 WARS1의 지속적인 분비를 유지한다.
이를 반영하여 세균, 바이러스 및/또는 곰팡이에 의한 감염성 및/또는 염증성 질환의 치료를 위해 항-WARS1 항체를 개발하는 전략을 생각해 볼 수 있다. 그러나, WARS1을 포함하는 ARS들은 단백질 구조상 유사한 점이 많아, 면역반응으로 얻어지는 항체는 다른 ARS에도 교차 반응을 보이는 등 고감도의 항체가 생성되지 않는 경우가 많다.
따라서, 다른 ARS에 대한 교차 반응 없이 WARS1에만 특이적으로 결합하여 WARS1을 효과적으로 중화할 수 있는 항체의 개발이 절실한 상황이다.
본 발명자들은 만성폐쇄성폐질환(chronic obstructive pulmonary disease: COPD), 염증성 장질환(inflammatory bowel disease:IBD), 류마티스 관절염(rheumatoid arthritis:RA), 아토피 피부염(atopic dermatitis:AD) 등과 같은 염증 질환 환자에서 그 발현량이 현저히 증가하는 WARS1에 특이적으로 결합하는 항체 또는 이의 단편을 발굴하고자 노력하였다. 그 결과, WARS1에 특이적으로 결합하면서 염증 반응을 억제하는 신규한 항-WARS1 항체를 제조하고, 그의 약리 활성을 확인함으로써 본 발명을 완성하였다..
상기 목적을 달성하기 위하여, 본 발명의 일 측면은 서열번호 3의 아미노산 서열을 포함하는 H-CDR1, 서열번호 5의 아미노산 서열을 포함하는 H-CDR2 및 서열변호 7의 아미노산 서열을 포함하는 H-CDR3을 포함하는 중쇄 가변영역; 및 서열번호 12의 아미노산 서열을 포함하는 L-CDR1, 서열번호 14 및 서열번호 16의 아미노산 서열을 포함하는 L-CDR3을 포함하는 경쇄 가변영역;으로 이루어진 항체 또는 이의 단편을 유효성분으로 포함하는 질환의 예방 또는 치료용 약학 조성물을 제공한다.
본 발명의 다른 측면은 서열번호 3의 아미노산 서열을 포함하는 H-CDR1, 서열번호 5의 아미노산 서열을 포함하는 H-CDR2 및 서열변호 7의 아미노산 서열을 포함하는 H-CDR3을 포함하는 중쇄 가변영역; 및 서열번호 12의 아미노산 서열을 포함하는 L-CDR1, 서열번호 14 및 서열번호 16의 아미노산 서열을 포함하는 L-CDR3을 포함하는 경쇄 가변영역;으로 이루어진 항-WARS1 항체 또는 이의 단편의 질환의 예방 또는 치료 용도를 제공한다.
본 발명의 또 다른 측면은 서열번호 3의 아미노산 서열을 포함하는 H-CDR1, 서열번호 5의 아미노산 서열을 포함하는 H-CDR2 및 서열변호 7의 아미노산 서열을 포함하는 H-CDR3을 포함하는 중쇄 가변영역; 및 서열번호 12의 아미노산 서열을 포함하는 L-CDR1, 서열번호 14 및 서열번호 16의 아미노산 서열을 포함하는 L-CDR3을 포함하는 경쇄 가변영역;으로 이루어진 항-WARS1 항체 또는 이의 단편을 개체에 투여하는 단계를 포함하는 질환의 예방 또는 치료 방법을 제공한다.
본 발명에 의한 항-WARS1 항체를 만성폐쇄성폐질환(COPD), 염증성 장질환(IBD), 류마티스 관절염(RA), 아토피 피부염(AD) 마우스 모델에 각각 투여한 결과, 각각의 모델 마우스에서 염증 반응을 억제하여 질환에 대한 치료 효과를 나타내었다. 따라서, 본 발명에 의한 항-WARS1 항체는 만성폐쇄성폐질환, 염증성 장질환, 류마티스 관절염, 아토피 피부염 등과 같은 염증성 질환의 치료 용도로 효과적으로 사용될 수 있다.
도 1은 GKB101 항체의 중쇄를 발현시키기 위한 벡터의 모식도이다.
도 2는 GKB101 항체의 경쇄를 발현시키기 위한 벡터의 모식도이다.
도 3은 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스의 기관지 폐포 세척액(BALF) 내의 BAL세포(A), 폐세포(B), Peyer's patch세포(C) 및 호중구(D)의 총 수를 확인한 결과를 나타낸 그래프이다. 이때, Normal은 무처리군이다.
도 4는 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스의 기관지 폐포세척액(BALF) 내의 호중구를 cytospin을 이용하여 면역염색한 후 광학 현미경으로 관찰한 결과를 나타낸 도면이다. 이때, 정상군은 무처리군이다.
도 5는 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스의 혈액 내 백혈구 수를 계수한 결과(A), 호중구 및 림프구를 계수하여 빈도수(%)로 나타낸 결과(B), 및 단핵구, 호중구 및 호산구를 계수하여 빈도수(%)(C)로 나타낸 그래프이다. 이때, Normal은 무처리군이다.
도 6은 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스의 기관지 폐포세척액 내의 CXCL-1(A), MIP2(B), IL-17(C) 및 TNF-α(D)의 농도를 측정하여 나타낸 그래프이다. 이때, Normal은 무처리군이다.
도 7은 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 혈청 내의 SDMA 농도를 측정하여 나타낸 그래프이다. 이때, Normal은 무처리군이다.
도 8a 및 도 8b는 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 폐조직 내의 염증성 사이토카인(MUC5AC(A), TRPA1(B), CXCL-1(C), TARC(D), COX-2(E), TNF-α(F), TRPV1(G), NOS-II(H)의 유전자 발현을 q-PCR을 통해 확인한 결과를 나타낸 그래프이다. 이때, Normal은 무처리군이다.
도 9는 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 폐조직의 병리학적 형태를 H&E 염색, M-T(Masson's trichrome) 염색 및 PAS(periodic acid-Schiff) 염색 방법을 이용하여 광학 현미경으로 관찰한 결과를 나타낸 도면이다. 이때, Normal은 무처리군이다.
도 10은 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 기도조직을 PAS 염색을 이용하여 광학 현미경으로 관찰한 결과를 나타낸 도면이다. 이때, Normal은 무처리군이다.
도 11은 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 폐조직에서 CXCL-1의 발현을 면역조직화학염색법(immunohistochemistry)을 이용하여 형광 현미경으로 관찰한 결과를 나타낸 도면이다. 이때, normal(Nr)은 무처리군이다.
도 12는 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 폐조직에서 CXCL-1의 발현을 면역조직화학염색법(immunohistochemistry)을 이용하여 형광 현미경으로 관찰한 결과를 정량화하여 나타낸 그래프이다. 이때, Normal은 무처리군이다.
도 13은 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 폐조직에서 TNF-α의 발현을 면역조직화학염색법(immunohistochemistry)을 이용하여 형광 현미경으로 관찰한 결과를 나타낸 도면이다. 이때, normal(Nr)은 무처리군이다.
도 14는 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 폐조직에서 TNF-α의 발현을 면역조직화학염색법(immunohistochemistry)을 이용하여 형광 현미경으로 관찰한 결과를 정량화하여 나타낸 그래프이다. 이때, Normal은 무처리군이다.
도 15는 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 폐조직에서 IRAK-1 단백질의 발현을 면역조직화학염색법(immunohistochemistry)을 이용하여 형광 현미경으로 관찰한 결과를 나타낸 도면이다. 이때, normal(Nr)은 무처리군이다.
도 16은 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 폐조직에서 IRAK-1 단백질의 발현을 면역조직화학염색법(immunohistochemistry)을 이용하여 형광 현미경으로 관찰한 결과를 정량화하여 나타낸 그래프이다. 이때, Normal은 무처리군이다.
도 17a 내지 도 17d는 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 기관지 폐포세척액(BALF) 및 폐조직 내의 면역세포(림프구, 호중구, 호산구 및 활성화된 대식세포) 및 면역세포의 절대세포 수를 유세포 분석기를 통해 분석한 결과를 나타낸 도면이다. 이때, Normal은 무처리군이다. A~F: 면역세포 총 수, G~K: 면역세포 절대수(전체 세포의 105 세포 당 포함된 면역세포의 수)
도 18a 내지 도 18d는 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 폐조직 내의 면역세포 유형(림프구, 호중구, 호산구 및 활성화된 대식세포) 및 면역세포의 절대세포 수를 유세포 분석기를 통해 분석한 결과를 나타낸 그래프이다. 이때, Normal은 무처리군이다. A~F: 면역세포 총 수, G~L: 면역세포 절대수(전체 세포의 105 세포 당 포함된 면역세포의 수)
도 19a 및 도 19b는 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스 peyer's patch 내의 면역세포(림프구, 호중구, 호산구 및 활성화된 대식세포) 및 면역세포의 절대세포 수를 유세포 분석기를 통해 분석한 결과를 나타낸 도면이다. 이때, Normal은 무처리군이다. A~D: 면역세포 총 수, E~H: 면역세포 절대수(전체 세포의 105 세포 당 포함된 면역세포의 수)
도 20은 COPD 마우스 모델에서 생리식염수(COPD_CTL), Dexa(COPD_Dexa), GKB101 항체 또는 Roflumilast를 투여한 뒤, 마우스의 말초혈액 세포 내의 면역세포를 유세포 분석기를 통해 분석한 결과를 빈도수(%)로 나타낸 그래프이다. 이때, Normal은 무처리군이다.
도 21은 DSS(dextran sulfate sodium-induced colitis) 마우스 모델을 이용하여 GKB101 항체의 염증성 장질환 개선 효과를 확인하기 위한 실험군 구성을 나타낸 도면이다.
도 22는 DSS 마우스 모델을 이용한 GKB101 항체의 염증성 장질환 개선 효과를 평가하기 위한 임상활성지수(disease activity index: DAI)를 부여하는 임상지표 결정 기준을 나타낸 도면이다.
도 23은 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 임상활성지수를 평가한 결과를 나타낸 그래프이다. *p<0.05, **p<0.01, ***p<0.001 vs IgG1 처리군
도 24는 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 임상활성지수를 평가한 결과의 AUC(area under curve)를 나타낸 그래프이다. *P<0.05, **P<0.01, ***P<0.001 vs PBS 처리군
도 25는 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 체중감소 스코어를 평가한 결과를 나타낸 그래프이다. *P<0.05 vs PBS 처리군
도 26은 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 체중감소 스코어를 평가한 결과의 AUC(area under curve)를 나타낸 그래프이다.
도 27은 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 대변의 일관성(stool consistency) 스코어를 평가한 결과를 나타낸 그래프이다. *P<0.05, **P<0.01, ***P<0.001 vs PBS 처리군
도 28은 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 대변의 일관성(stool consistency) 스코어를 평가한 결과의 AUC를 나타낸 그래프이다. *P<0.05, **P<0.01, ***P<0.001 vs PBS 처리군
도 29는 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 장 출혈(intestinal bleeding) 스코어를 평가한 결과를 나타낸 그래프이다. *P<0.05, **P<0.01, ***P<0.001 vs PBS 처리군
도 30은 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 장 출혈(intestinal bleeding) 스코어를 평가한 결과의 AUC를 나타낸 그래프이다. *P<0.05, **P<0.01, ***P<0.001 vs PBS 처리군
도 31은 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 대장 조직의 길이를 측정한 결과를 나타낸 도면이다. 이때, Normal은 무처리군이다.
도 32는 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 대장 조직의 길이를 측정한 결과를 나타낸 그래프이다. 이때, Normal은 무처리군이다. *P<0.05, ***P<0.001 vs PBS 처리군
도 33은 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 대변이 제거된 각 투여군의 대장 조직의 무게를 측정한 결과를 나타낸 그래프이다. *P<0.05, **P<0.001, ***P<0.001 vs PBS 처리군
도 34는 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 대장 조직의 형태학적 평가를 위한 항목 및 지표 기준을 나타낸 도면이다.
도 35는 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 대장 조직의 형태학적 평가를 위해 대장 조직을 H&E로 염색하여 관찰한 결과를 나타낸 도면이다. Scale bars: 1000 μm(X9.2) 및 100 μm(X200).
도 36은 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 대장 조직의 형태학적 평가 결과를 나타낸 그래프이다. *P<0.05, **P<0.001, ***P<0.001 vs PBS 처리군
도 37은 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 DAI 스코어 또는 DAI 스코어-AUC와 형태학적 평가 결과의 상관 관계를 나타내는 그래프이다.
도 38은 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각각의 개별 개체에 대한 DAI 스코어 또는 DAI 스코어-AUC와 형태학적 평가 결과의 상관 관계를 나타내는 그래프이다.
도 39는 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 후, 각 투여군의 비장 조직의 무게를 측정한 결과를 나타낸 그래프이다.
도 40은 DSS 마우스 모델에서 PBS, Isotype IgG1, GKB101 항체 또는 항-TNF-α 항체 투여 기간 동안, 각 투여군의 체중을 측정한 결과를 나타낸 그래프이다.
도 41a 및 도 41b는 류마티스 관절염(RA) 환자의 활강액 내 WARS1 단백질의 농도 및 병증의 심각도의 상관관계를 분석한 결과를 나타낸 그래프이다. 이때, A는 퇴행성 관절염(osteoarthritis:OA) 및 류마티스 관절염 환자의 활강액 내 WARS1 발현량을 비교한 결과; B는 류마티스 관절염 환자의 활막 안의 섬유조직(pannus) 형성정도 및 활강액 내 WARS1의 발현량을 비교한 결과; C는 류마티스 관절염 환자의 활막 내 신생혈관생성 정도 및 활강액 내 WARS1의 발현량을 비교한 결과; D는 류마티스 관절염 환자 활강액 내 침윤된 백혈구(WBC) 수 및 WARS1 발현정도를 비교한 결과;E는 염증인자(ESR, CRP) 및 WARS1 발현량의 상관관계를 분석한 결과; F는 WARS1의 발현량 및 면역세포(호중구, 림프구)의 침윤과의 상관관계를 분석한 결과; 및 G는 IL-6 및 IL-8, 및 WARS1의 발현량의 상관관계를 분석한 결과를 나타낸 그래프이다.
도 42는 CIA(collagen-induced arthritis) 마우스 모델을 이용하여 GKB101 항체의 류마티스 관절염 개선 효과를 검증하기 위한 실험 스케쥴을 나타낸 도면이다.
도 43은 CIA 마우스 모델에 Vehicle(PBS), Isotype IgG1 또는 GKB101 항체를 투여한 후, CIA 마우스 족부를 관찰한 결과를 나타낸 도면, 임상 관절염 지수, 임상 관절염 지수 분석 결과에 대한 AUC를 나타낸 그래프이다. ***p<0.001 vs GKB101 항체 투여군
도 44는 CIA 마우스 모델에 Vehicle(PBS), Isotype IgG1 또는 GKB101 항체를 투여한 후, 마우스의 관절 조직을 H&E 염색하여 관찰한 결과를 나타낸 도면(X200, scale bar: 100 um) 및 그래프이다. *p<0.05, **p<0.01, ***p<0.001 vs GKB101 항체 투여군
도 45는 CIA 마우스 모델에 Vehicle(PBS), Isotype IgG1 또는 GKB101 항체를 투여하는 동안 CIA 마우스의 체중을 측정한 결과를 나타낸 그래프이다. 이때, Normal은 무처리군이다.
도 46은 CIA 마우스 모델에 Vehicle(PBS), Isotype IgG1 또는 GKB101 항체를 투여한 후, 혈청(plasma) 및 족부 관절 내의 WARS1 및 염증성 사이토카인의 농도를 측정한 결과를 나타낸 그래프이다. *p<0.05, **p<0.01, ***p<0.001 vs IgG 투여군
도 47은 CIA 마우스 모델을 이용하여 GKB101 항체의 류마티스 관절염 개선 효과를 검증하기 위한 실험 스케쥴을 나타낸 도면이다.
도 48은 CIA 마우스 모델에 PBS(control, Vehicle), Isotype IgG1, MTX, 항-TNF-α 항체, TLR4 억제제(TAK242, TLR4i) 또는 GKB101 항체를 투여한 후, 임상 관절염 지수를 분석한 결과를 나타낸 그래프이다.
도 49는 CIA 마우스 모델에 PBS(control, Vehicle), Isotype IgG1, MTX, 항-TNF-α 항체, TLR4 억제제(TAK242, TLR4i) 또는 GKB101 항체를 투여한 후, CIA 마우스 족부를 관찰한 결과를 나타낸 도면이다.
도 50은 CIA 마우스 모델에 Vehicle(PBS), Isotype IgG1, MTX, 항-TNF-α 항체, TLR4 억제제(TAK242, TLR4i) 또는 GKB101 항체를 투여한 후, 마우스의 족부 관절 내 침윤된 면역세포를 분석하여 나타낸 그래프이다. #: vs control(vehicle), *: vs IgG1 투여군, §: vs 항-TNF-α 항체 투여군
도 51a 및 도 51b는 CIA 마우스 모델에 Vehicle(PBS), Isotype IgG1, MTX, 항-TNF-α 항체, TLR4 억제제(TAK242, TLR4i) 또는 GKB101 항체를 투여한 후, 마우스의 족부 관절 내에 염증성 사이토카인 및 케모카인의 농도를 측정한 결과를 나타낸 그래프이다. #: vs Control(vehicle), *: vs IgG1 투여군
도 52는 CIA 마우스 모델에 Vehicle(PBS), Isotype IgG1, MTX, 항-TNF-α 항체, TLR4 억제제(TAK242, TLR4i) 또는 GKB101 항체를 투여한 후, 마우스의 족부 관절 내에 연골파쇄인자(MMP3) 및 파골세포 분화인자(RANKL)의 농도를 측정한 결과를 나타낸 그래프이다. #: vs Control(vehicle), *: vs IgG1 투여군, §: vs 항-TNF-α 항체 투여군
도 53은 CIA 마우스 모델에 Vehicle(PBS), Isotype IgG1, MTX, 항-TNF-α 항체, TLR4 억제제(TAK242, TLR4i) 또는 GKB101 항체를 투여한 후, 임상적 관절염 심각도(CAI, clinical arthritis index)를 분석하기 위한 임상지표 기준을 나타낸 도면이다.
도 54는 CIA 마우스 모델에 Vehicle(PBS), Isotype IgG1, MTX, 항-TNF-α 항체, TLR4 억제제(TAK242, TLR4i) 또는 GKB101 항체를 투여한 후, 임상적 관절염 발생률(arthritis incidence, %)을 분석한 결과를 나타낸 그래프이다. *p<0.05, **p<0.01, ***p<0.001
도 55a 및 도 55b는 아토피 환자의 혈중 WARS1 및 사이토카인의 농도를 측정하여 상관관계를 나타낸 그래프이다.
도 56은 아토피 환자의 혈중 WARS1 및 TARC(thymus and activation-regulated chemokine)의 농도를 측정하여 상관관계를 나타낸 그래프이다.
도 57은 Staphylococcus aureus로 감염시킨 인간 유래 각질 형성 세포주(human keratinocyte)에서 GKB101 항체 처리에 따른 WARS1 및 CXCL-8/IL-8의 발현을 확인한 결과를 나타낸 그래프이다. *p<0.05, **p<0.01, ***p<0.001
도 58은 Staphylococcus aureus로 감염시킨 인간 진피 섬유아세포주(human dermal fibroblast)에서 GKB101 항체 처리에 따른 WARS1 및 CXCL-8/IL-8의 발현을 확인한 결과를 나타낸 그래프이다. *p<0.05, **p<0.01, ***p<0.001
도 59는 아토피 마우스 모델을 이용한 GKB101 항체의 항염 활성을 평가하기 위한 실험 스케쥴을 나타낸 도면이다.
도 60은 아토피 마우스 모델에 Isotype IgG1 또는 GKB101 항체를 투여한 뒤, 마우스의 등표면의 염증 유발 정도를 관찰한 결과를 나타낸 도면 및 그래프이다. 이때, Naive는 무처리군이다. *p<0.05, ##p<0.01, ###p<0.001 (#: vs Naive)
도 61a 및 도 61b는 아토피 마우스 모델에 Isotype IgG1 또는 GKB101 항체를 투여한 뒤, 마우스의 등표면을 H&E 염색하여 표피(epidermis) 및 진피(dermis)에 침윤된 면역세포를 관찰한 결과를 나타낸 도면 및 그래프이다. 이때, Naive는 무처리군이다. *p<0.05, **p<0.01
도 62는 아토피 마우스 모델에 Isotype IgG1 또는 GKB101 항체를 투여한 뒤, 마우스의 등조직 내 WARS1 및 염증성 사이토카인의 농도를 측정한 결과를 나타낸 그래프이다. 이때, Naive는 무처리군이다. *p<0.05, **p<0.01, ***p<0.001.
도 63은 아토피 마우스 모델에 Isotype IgG1 또는 GKB101 항체를 투여한 뒤, 마우스의 혈청 내 WARS1 및 IgE의 농도를 측정한 결과를 나타낸 그래프이다. 이때, Naive는 무처리군이다. *p<0.05, **p<0.01, ***p<0.001
항-WARS1 항체를 포함하는 약학 조성물
항-WARS1 항체
본 발명은 WARS1에 특이적으로 결합하는 항체 또는 이의 단편을 포함하는 약학 조성물을 제공한다.
또한, 본 발명의 일 측면은 서열번호 3의 아미노산 서열을 포함하는 H-CDR1, 서열번호 5의 아미노산 서열을 포함하는 H-CDR2 및 서열변호 7의 아미노산 서열을 포함하는 H-CDR3을 포함하는 중쇄 가변영역; 및 서열번호 12의 아미노산 서열을 포함하는 L-CDR1, 서열번호 14 및 서열번호 16의 아미노산 서열을 포함하는 L-CDR3을 포함하는 경쇄 가변영역;으로 이루어진 항-WARS1 항체 또는 이의 단편을 유효성분으로 포함하는 질환의 예방 또는 치료용 약학 조성물을 제공한다.
본 명세서에서 사용하는 용어, "항체"는 특정 항원과 면역학적으로 반응하는 면역글로불린 분자로, 항원을 특이적으로 인식하는 단백질 분자를 의미한다. 면역글로불린의 중쇄 및 경쇄는 각각 불변영역(constant region, C) 및 가변영역(variable region, V)을 포함할 수 있다. 면역글로불린의 경쇄 및 중쇄 가변영역은, 상보성 결정 영역(complementarity determining region, CDR)이라 불리는 3개의 다변가능한 영역 및 4개의 구조 영역(framework region, FR)을 포함한다. 상기 CDR은 주로 항원의 에피토프에 결합하는 항원 결합 부위이다.
본 명세서에서 사용하는 용어, "WARS"는 트립토파닐 티알엔에이 합성효소(tryptophanyl-tRNA synthetase)를 의미하며, 트립토판 티알엔에이 연결효소(tryptophan-tRNA ligase), TrpRS, WRS 등으로도 알려져 있다. WARS는 아미노산 트립토판과 tRNA의 아미노아실레이션(aminoacylation) 반응을 매개하는 효소이다. WARS는 인간에서는 WARS 유전자에 의해 암호화되며, 단백질의 아미노산 서열과 mRNA 염기 서열은 GenBank accession number NP_004175.2(단백질), GenBank accession number NM_004184.3(mRNA 염기서열) 등으로 공지되어 있다. WARS는 cytoplasmic form(WARS1 또는 tryptophanyl-tRNA synthetase 1, cytoplasmic)과 mitochondrial form(WARS2 또는 tryptophanyl-tRNA synthetase 2, mitochondrial)의 두 가지 아형(isoform)이 있다. 본 발명에서 WARS는 WARS1일 수 있다. 상기 WARS1은 제한되지는 않으나, 바람직하게는 서열번호 24의 아미노산 서열을 포함하는 인간 WARS1인 것일 수 있다.
본 발명의 항-WARS1 항체는 상기 WARS1에 특이적으로 결합하는 항체 또는 이의 단편일 수 있다. 또한, 본 발명의 항체의 단편은 Fab, F(ab')2, Fd, sdFv, Fv, dAb, scFv, sdAb, 테트라머 등일 수 있으며, WARS1에 특이적으로 결합할 수 있는 항원 결합 부위를 포함하는 것이면 어떠한 형태도 포함할 수 있다.
상기 항체는 서열번호 3의 아미노산 서열을 포함하는 H-CDR1, 서열번호 5의 아미노산 서열을 포함하는 H-CDR2 및 서열변호 7의 아미노산 서열을 포함하는 H-CDR3을 포함하는 중쇄 가변영역; 및 서열번호 12의 아미노산 서열을 포함하는 L-CDR1, 하기의 서열번호 14로 표현되는 아미노산 서열을 포함하는 L-CDR2 및 하기의 서열번호 16으로 표현되는 아미노산 서열을 포함하는 L-CDR3을 포함하는 경쇄 가변영역;으로 이루어진 것일 수 있다.
구체적으로, 상기 중쇄 가변영역은 서열번호 9의 아미노산 서열을 포함하는 것일 수 있다. 또한, 상기 경쇄 가변영역은 서열번호 18의 아미노산 서열을 포함하는 것일 수 있다.
본 발명의 일 구체예로 상기 항체 또는 이의 단편은 서열번호 22의 아미노산 서열을 포함하는 중쇄 영역 및 서열번호 23을 포함하는 경쇄 영역을 포함하는 것일 수 있다.
본 발명에서 상기 항체 또는 이의 단편은 면역글로불린 Fc 영역을 포함할 수 있다. 이때, 상기 면역글로불린의 Fc 영역은 면역글로불린의 중쇄 불변영역 2(CH2) 및 중쇄 불변영역 3(CH3)을 포함하며, 면역글로불린의 중쇄 및 경쇄의 가변영역 및 경쇄 불변영역(CL)은 포함하지 않는 단백질을 의미한다. 상기 면역글로불린 Fc 영역은 IgG1, IgA, IgE, IgD 또는 IgM 유래 일 수 있다.
또한, 상기 면역글로불린의 Fc 영역은 야생형 Fc 영역 뿐만 아니라, Fc 영역 변이체일 수 있다. 또한, 본 명세서에서 사용하는 용어 "Fc 영역 변이체"는 야생형 Fc 영역의 당쇄 형태(glycosylation pattern)와 다르거나, 야생형 Fc 영역에 비해 증가된 당쇄, 야생형 Fc 영역에 비해 감소한 당쇄, 또는 당쇄가 제거(deglycosylated)된 형태일 수 있다. 또한, 무당쇄(aglycosylated) Fc 영역도 포함된다. Fc 영역 혹은 변이체는 배양조건 혹은 호스트의 유전자 조작을 통해 조정된 숫자의 시알산(sialic acid), 퓨코실화(fucosylation), 당화(glycosylation)를 갖도록 한 것일 수 있다.
또한, 화학적 방법, 효소적 방법 및 미생물을 사용한 유전공학적 엔지니어링 방법 등과 같이 통상적인 방법으로 면역글로불린의 Fc 영역의 당쇄를 변형시킬 수 있다. 또한, 상기 Fc 영역 변이체는 면역글로불린 IgG1, IgA, IgE, IgD 또는 IgM의 Fc 영역이 혼합된 형태일 수 있다. 또한, 상기 Fc 영역 변이체는 상기 Fc 영역의 일부 아미노산이 다른 아미노산으로 치환된 형태일 수 있다.
본 발명의 일 구체예에서 상기 Fc 영역은 서열번호 21의 아미노산 서열을 포함할 수 있다.
본 발명의 항체는 항-WARS1 항체의 경쇄 가변영역(VL) 및 경쇄 불변영역(CL)을 포함하는 융합단백질과 항-WARS1 항체의 중쇄 가변영역(VH), 중쇄 불변영역 1(CH1) 및 Fc 영역을 포함하는 융합단백질을 포함할 수 있다.
구체적으로, 상기 항-WARS1 항체는 (I) 및 (II)를 포함하는 것일 수 있다.
N'-X'-[링커]o-Fc 영역 단편 또는 이의 변이체-C' (I); 및
N'-X''-C' (II)
이때, 상기 구조식 (I) 및 (II)에 있어서,
상기 N'은 N 말단이고,
상기 C'는 C 말단이며,
상기 X는 항-WARS1 항체 또는 이의 단편의 항원 결합 부위로서 X' 및 X''으로 이루어지며,
상기 X'는 항-WARS1 항체 또는 이의 단편 중쇄의 항원 결합 부위로 가변영역(VH) 및 CH1 영역을 포함하며,
상기 X''는 항-WARS1 항체 또는 이의 단편의 경쇄 항원 결합 부위로 가변영역(VL) 및 불변영역(CL)을 포함하고,
상기 링커는 펩타이드 링커이며,
상기 o는 O 또는 1이다.
이때, 항-WARS1 항체 또는 이의 단편, 항원 결합 부위, 가변영역 및 불변영역은 상술한 바와 동일하다.
상기 펩타이드 링커는 1 내지 50개의 연속된 아미노산 또는 3 내지 30개의 연속된 아미노산으로 이루어질 수 있다. 일 구체예로 상기 펩타이드 링커는 23개의 아미노산으로 이루어질 수 있다. 또한, 펩타이드 링커는 적어도 하나의 시스테인을 포함할 수 있다. 구체적으로, 하나, 두 개 또는 세 개의 시스테인을 포함할 수 있다. 또한, 상기 펩타이드 링커는 면역글로불린의 힌지에서 유래된 것일 수 있다. 예를 들어, 상기 힌지는 다양한 IgG1하위 유형 항체의 힌지 영역으로부터 선택될 수 있다. 또한, 상기 힌지는 면역글로불린 유래의 힌지 영역의 일부 아미노산이 다른 아미노산으로 치환된 형태이거나, 일부 아미노산 서열이 추가된 서열일 수 있다. 일 구체예에서는, 상기 펩타이드 링커는 서열번호 20의 아미노산 서열로 이루어진 펩타이드 링커일 수 있다.
항-WARS1 항체의 용도
본 발명에서 상기 항-WARS1 항체 또는 이의 단편을 유효성분으로 포함하는 약학 조성물은 염증성 질환과 같은 질환의 예방 또는 치료의 용도로 사용될 수 있다. 여기서, 항-WARS1 항체 또는 이의 단편은 상술한 바와 동일하다.
본 명세서에서 사용하는 용어, "염증"은 유해인자에 대해 생체를 보호하기 위한 반응으로, 면역세포, 혈관 및 염증 매개체들이 관여하여 세포의 손상을 억제하고, 손상된 조직 및 괴사 세포를 제거하며, 조직을 재생하는 일련의 과정을 포함한다. "염증성 질환"은 염증을 주 병변으로 하는 질병을 총칭하는 것이다.
구체적으로 상기 질환은 만성폐쇄성폐질환(chronic obstructive pulmonary disease:COPD), 염증성 장질환(inflammatory bowel disease:IBD), 류마티스 관절염(rheumatoid arthritis:RA) 및 피부염으로 이루어진 군에서 선택되는 어느 하나인 것일 수 있다. 이때, 상기 피부염은 아토피성 피부염(atopic dermatitis:AD)일 수 있다.
본 명세서에서 사용하는 용어, "만성폐쇄성폐질환(chronic obstructive pulmonary disease: COPD)"은 만성적으로 기류의 상태가 불량한 폐쇄성 폐질환의 한 종류이다. 주요 증상으로는 호흡곤란, 기침, 가래 등이 있으며, 만성기관지염 환자 중 대다수에게서 만성 폐쇄성 폐질환이 나타난다. 만성 폐쇄성 폐질환의 가장 흔한 원인은 흡연이며, 대기오염과 유전과 같은 다른 요소들도 더 적은 비율로 영향을 끼친다. 이러한 자극원들에 의해 폐에 염증반응이 발생해 소기도가 좁아지고 폐조직이 파괴되는 폐기종의 원인이 된다.
본 명세서에서 사용하는 용어, "염증성 장질환(inflammatory bowel disease: IBD)"은 위장관 내에 만성적인 염증을 유발하는 질환으로, 세균성, 바이러스성, 아메바성, 결핵성 장염 등의 감염성 장염과 허혈성 장질환, 방사선 장염 등 모든 장에서 발생하는 염증성 질환을 모두 포함할 수 있다. 염증성 장질환의 원인은 명확히 규명되지 않았으나, 유전적 및 환경적 영향을 받으며, 면역학적 이상에 의해 매개되는 것으로 알려져 있다. 상기 염증성 장질환은 크론병(Crohn's disease), 궤양성 대장염(ulcerative colitis), 장형 베체트병(intestinal Bechet's disease) 등일 수 있으나 이에 제한되지 않는다.
본 명세서에서 사용하는 용어, "류마티스 관절염(rheumatoid arthritis:RA)"은 관절 주위를 둘러싸고 있는 활막이라는 조직의 염증으로 인해 발생하는 질환이다. 따라서, 활막이 존재하는 모든 관절에서 발생할 수 있다. 초기에는 관절을 싸고 있는 활막에 염증이 발생하지만 점차 주위의 연골과 뼈로 염증이 퍼져 관절의 파괴와 변형을 초래하게 된다. 류마티스 관절염의 발병원인은 정확히 알려져 있지 않으며, 인체 내 면역체계가 자신의 몸을 비정상적으로 공격하여 염증이 발생하는 자가 면역 질환의 일종이다.
본 명세서에서 사용하는 용어, "아토피성 피부염(atopic dermatitis:AD)"은 심한 가려움증을 동반하고 만성적으로 재발하는 피부 습진 질환이다. 천식, 알레르기 비염, 만성 두드러기와 함께 대표적인 알레르기 질환 중 하나로, 보통 태열이라고 부르는 영아기 습진은 아토피 피부염의 시작으로 볼 수 있다. 아토피성 피부염은 유전적인 소인과 환경적인 요인, 면역학적 이상 및 피부 보호막의 이상 등 여러 원인이 복합적으로 작용하여 나타나는 것으로 알려져 있다. 최근에는 인스턴트식품 섭취의 증가, 실내외 공해에 의한 알레르기 물질의 증가 등이 아토피성 피부염 발병과 밀접한 관련이 있는 것으로 알려졌다.
본 명세서에서 사용하는 용어, "치료"는 치료학적 처리 및 예방적 처리를 모두 포함하는 의미로 사용될 수 있으며, 인간을 포함한 포유류에서 질환을 치료하기 위한 적용이나 어떠한 형태의 투약을 모두 포함한다. 또한, 상기 용어는 질환의 진행을 억제하거나 늦추는 것을 포함하며; 손상되거나, 결손된 기능을 회복시키거나, 수리하여, 질환을 부분적이거나 완전하게 완화시키거나; 또는 비효율적인 프로세스를 자극하거나; 심각한 질환을 완화하는 의미를 포함한다. 이때, "예방"은 개체의 병리학적 상태 또는 질환을 완화시키거나 감소시키는 의미로 사용될 수 있다.
상기 약학 조성물의 바람직한 투여량은 환자의 상태 및 체중, 질병의 정도, 약물형태, 투여경로 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있다. 본 발명의 질환의 예방 또는 치료용 약학 조성물에서 상기 항체 또는 이의 단편은 질환의 치료 효과를 나타낼 수 있는 한, 용도, 제형, 배합 목적 등에 따라 임의의 양(유효량)으로 포함될 수 있는데, 통상적인 유효량은 조성물 전체 중량을 기준으로 할 때 0.001 중량% 내지 20.0 중량% 범위 내에서 결정될 것이다. 여기서 "유효량"이란 질환의 상태 개선 또는 치료(treatment) 효과, 특히 질환의 상태 개선 또는 치료 효과를 유도할 수 있는 유효성분의 양을 말한다. 이러한 유효량은 당업자의 통상의 능력 범위 내에서 실험적으로 결정될 수 있다.
생체이용률과 같은 약동학적 파라미터(pharmacokinetic parameters) 및 클리어런스율(clearance rate)과 같은 기본적인 파라미터(underlying parameters)도 효능에 영향을 줄 수 있다. 따라서, "향상된 효능"(예를 들어, 효능의 개선)은 향상된 약동학적 파라미터 및 향상된 효능에 기인할 수 있으며, 시험 동물 또는 인간 대상체에서 클리어런스율 및 질환 치료 또는 개선과 같은 파라미터를 비교하여 측정될 수 있다.
한편, 본 발명의 약학적 조성물은 "치료학적으로 유효한 양"으로 투여한다.
본 명세서에서 사용하는 용어 "투여"란, 적절한 방법으로 개체에게 소정의 물질을 도입하는 것을 의미하며, 상기 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 어떠한 일반적인 경로를 통하여 투여될 수 있다. 복강내 투여, 정맥내 투여, 근육내 투여, 피하 투여, 피내 투여, 경구 투여, 국소 투여, 비내 투여, 폐내 투여, 직장내 투여될 수 있으나, 이에 한정되지는 않는다.
본 명세서에서 사용하는 용어 "치료학적으로 유효한 양" 또는 "약학적으로 유효한 양"이란 대상 질환을 예방 또는 치료하는데 유효한 화합물 또는 조성물의 양으로서, 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분하며 부작용을 일으키지 않을 정도의 양을 의미한다. 상기 유효량의 수준은 환자의 건강상태, 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 방법, 투여 시간, 투여 경로 및 배출 비율, 치료 기간, 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 일 구현예에서 치료학적으로 유효한 양은 질환을 치료하는데 효과적인 약물의 양을 의미한다.
이때, 상기 약학 조성물은 약학적으로 허용 가능한 담체를 더 포함할 수 있다. 상기 약학적으로 허용 가능한 담체는 환자에게 전달하기에 적절한 비-독성 물질이면 어떠한 담체라도 가능하다. 증류수, 알코올, 지방, 왁스 및 비활성 고체가 담체로 포함될 수 있다. 약물학적으로 허용되는 애쥬번트(완충제, 분산제) 또한 약학 조성물에 포함될 수 있다.
구체적으로, 상기 약학 조성물은 약제학적으로 허용되는 담체를 포함하여 당업계에 공지된 통상의 방법으로 투여 경로에 따라 비경구용 제형으로 제조될 수 있다. 여기서 "약제학적으로 허용되는" 의미는 유효성분의 활성을 억제하지 않으면서 적용(처방) 대상이 적응 가능한 이상의 독성을 지니지 않는다는 의미이다.
상기 약학 조성물이 비경구용 제형으로 제조될 경우, 적합한 담체와 함께 당업계에 공지된 방법에 따라 주사제, 경피 투여제, 비강 흡입제 및 좌제의 형태로 제제화될 수 있다. 주사제로 제제화할 경우 적합한 담체로서는 멸균수, 에탄올, 글리세롤이나 프로필렌 글리콜 등의 폴리올 또는 이들의 혼합물을 사용할 수 있으며, 바람직하게는 링거 용액, 트리에탄올 아민이 함유된 IgG1(phosphate buffered saline)나 주사용 멸균수, 5% 덱스트로스 같은 등장 용액 등을 사용할 수 있다. 약제학적 조성물의 제제화와 관련하여서는 당업계에 공지되어 있으며, 구체적으로 문헌[Remington's Pharmaceutical Sciences(19th ed., 1995)] 등을 참조할 수 있다. 상기 문헌은 본 명세서의 일부로서 간주된다.
상기 약학 조성물의 바람직한 투여량은 환자의 상태, 체중, 성별, 연령, 환자의 중증도, 투여 경로에 따라 1일 0.01 ㎍/㎏ 내지 10 g/㎏ 범위, 또는 0.01 ㎎/㎏ 내지 1 g/㎏ 범위일 수 있다. 투여는 1일 1회 또는 수회로 나누어 이루어질 수 있다. 이러한 투여량은 어떠한 측면으로든 본 발명의 범위를 제한하는 것으로 해석되어서는 아니 된다.
상기 약학 조성물이 적용(처방)될 수 있는 대상은 포유동물 및 사람이며, 특히 사람인 경우가 바람직하다. 본 발명의 약학 조성물은 질환의 치료 효과를 갖는 것으로 공지된 임의의 화합물이나 천연 추출물을 추가로 포함할 수 있다.
본 발명의 또 다른 측면은, 질환의 예방 또는 치료용 약제를 제조하기 위한 상기 항-WARS1 항체 또는 이의 항원 결합 단편의 용도를 제공한다. 여기서, 질환, 예방, 치료, 항-WARS1 항체 또는 이의 단편은 상술한 바와 동일하다.
본 발명의 또 다른 측면은, 상기 항-WARS1 항체 또는 이의 항원 결합 단편의 질환의 예방 또는 치료용 용도를 제공한다. 여기서, 질환, 예방, 치료, 항-WARS1 항체 또는 이의 단편은 상술한 바와 동일하다.
본 발명의 또 다른 측면은, 상기 항-WARS1 항체 또는 이의 항원 결합 단편을 개체에 투여하는 단계를 포함하는 질환을 예방 또는 치료하는 방법을 제공한다. 여기서, 질환, 예방, 치료, 항-WARS1 항체 또는 이의 단편 및 투여는 상술한 바와 동일하다. 상기 개체는 포유동물일 수 있으며, 바람직하게는 인간일 수 있다. 또한, 상기 개체는 질환을 앓는 환자이거나 질환을 앓을 가능성이 큰 개체일 수 있다.
상기 항체 또는 이의 단편의 투여경로, 투여량 및 투여횟수는 환자의 상태 및 부작용의 유무에 따라 다양한 방법 및 양으로 대상에게 투여될 수 있고, 최적의 투여방법, 투여량 및 투여횟수는 통상의 기술자가 적절한 범위로 선택할 수 있다. 상기 항-WARS1 항체 또는 이의 항원 결합 단편의 바람직한 투여량은 환자의 상태, 체중, 성별, 연령, 환자의 중증도, 투여 경로에 따라 1일 0.01 ㎍/㎏ 내지 10 g/㎏ 범위, 또는 0.01 ㎎/㎏ 내지 1 g/㎏ 범위일 수 있다. 투여는 1일 1회 또는 수회로 나누어 이루어질 수 있다. 이러한 투여량은 어떠한 측면으로든 본 발명의 범위를 제한하는 것으로 해석되어서는 아니 된다.
또한, 상기 항체 또는 이의 항원 결합 단편은 질환의 치료 효과를 갖는 것으로 공지된 임의의 화합물이나 천연 추출물과 병용하여 투여되거나, 다른 약물과의 조합 제제 형태로 제형화 될 수 있다.
이하 본 발명을 실시예를 통하여 보다 상세하게 설명한다. 그러나, 이들 실시예는 하나 이상의 구체예를 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
I. GKB101 항체 제조
실시예 1. GKB101 항체 제조
WARS1(서열번호 24)에 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변영역(서열번호 9)과 불변영역(서열번호 10), 링커(서열번호 20) 및 Fc 영역(서열번호 21)을 포함하는 폴리펩티드를 코딩하는 폴리뉴클레오티드(서열번호 25); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변영역(서열번호 18)과 불변영역(서열번호 19)을 포함하는 폴리펩티드를 코딩하는 폴리뉴클레오티드(서열번호 26)를 각각 pOptiVEC(Thermo Fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo Fisher, 도 2)에 클로닝하였다. 이때 사용된 항체 정보는 하기 표 1 내지 3과 같다.
상기 벡터를 1:1의 비율로 Expifectamine 293 reagent(Thermo Fisher)를 이용하여 ExpiHEK293 세포에 도입하여 동일 세포 내에서 중쇄 및 경쇄를 함께 발현시켰다. 벡터를 도입 후, 약 5일 동안 진탕 배양한 후, 세포배양액을 원심 분리하고, 상층액을 회수하여 항체를 분리 및 정제하였다.
구체적으로, 회수한 상층액은 Hitrap MabselectSure column(GE Healthcare Life Sciences)에 로딩(loading)하고, IgG1로 세척하여 비특이적 결합을 제거하였다. 100 mM Citrate buffer(pH 3.0) + 300 mM NaCl을 이용하여 컬럼에 특이적으로 결합하는 단백질을 분리하였다. FPLC(fast protein liquid chromatography)로 얻은 용출액은크기 배제 크로마토그래피(GE Healthcare Life Sciences)에 로딩하여 고순도의 항체를 수득하였다. 상기 정제한 항-WARS1 항체를 "GKB101"로 명명하였다(표 4).
H-CDR1 H-CDR2 H-CDR3 L-CDR1 L-CDR2 L-CDR3
GKB101 SYDMS(서열번호 3) AISSGGSSIYYADSVKG(서열번호 5) DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANSHRPS
(서열번호 14)		 GAWDDSLSAYV
(서열번호 16)
중쇄 가변 영역 경쇄 가변 영역
GKB101 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS(서열번호 9) QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANSHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL(서열번호 18)
영역 FR1 FR2 FR3 FR4
VH-FR EVQLLESGGGLVQPGGSLRLSCAASGFTFS(서열번호 2) WVRQAPGKGLEWVS(서열번호 4) RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR(서열번호 6) WGQGTLVTVSS
(서열번호 8)
LH-FR QSVLTQPPSASGTPGQRVTISC(서열번호 11) WYQQLPGTAPKLLIY(서열번호 13) GVPDRFSGSKSGTSASLAISGLRSEDEADYYC(서열번호 15) FGGGTKLTVL(서열번호 17)
GKB101 아미노산 서열 서열
번호
중쇄영역
 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFS SYDMS WVRQAPGKGLEWVS AISSGGSSIYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR DVAWDMLGDFDY WGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 20
Fc 영역
(CH2+CH3)
 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 21
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISC TGSSSNIGSNYVY WYQQLPGTAPKLLIY ANSHRPS GVPDRFSGSKSGTSASLAISGLRSEDEADYYC GAWDDSLSAYV FGGGTKLTVL 18
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
II. GKB101 항체의 호흡기 손상 억제 효능 평가
실시예 2. 표준 담배 추출물 조제
실험재료로 표준 담배 CM7(coresta monitoring cigarette 7) 60개피 및 이소프로파놀(isopropanol, Merck), 에탄올(ethanol, Merck), n-heptadecane(Sigma-Aldrich)를 준비하였고, 실험장비는 자동흡연장치(automatic smoking machine, ISO3308 규격품, 모델: RM20, Heinr Borgwaldt)를 사용하였다.
실시예 2.1. 표준 담배연기의 포집
표준 담배 CM7 연기 응축물 포집은 ISO3402 규정에 의거하여 흡연실(온도 22±2℃, 상대습도 60±5%)에서 실시하였다. ISO3308 규정에 의거하여 RM20(Heinr Borgwaldt) 자동흡연장치를 이용하여 흡연부피 35.0±0.3 ㎖, 흡연주기 60±0.5초, 흡연시간 2.00±0.02초 및 꽁초길이 tip paper 길이+3 mm(overwrap+3 mm) ISO 표준 흡연 방법으로 궐련담배를 연소시키고, 92 mm 캠브리지 필터(cambridge filter, ISO3308 규격품)로 담배연기 응축물을 포집하였다.
실시예 2.2. 담배연기 응축물 무게 측정
흡연 전 ISO4387 규정에 의하여 연소 전 캠브리지 필터가 들어있는 담배 홀더의 무게를 측정하고, 실시예 2.1의 방법으로 연소시킨 담배연기 응축물은 연소 후 캠브리지 필터에 의해 담배연기가 포집된 담배 홀더의 무게를 측정하여 TPM(total particulate matter) 함량을 계산하였다(ISO4387, 2000). 표준 담배를 3번 연소시킨 경우, TPM 무게는 19개피에 16.0621 mg, 20개피에 15.9135 mg 및 20개피에 15.5380 mg/cig이었다. 따라서, 총 표준 담배 시료 수는 59개피이고 TPM 무게는 47.5136 mg이었다.
실시예 2.3. 표준 담배연기 응축물 추출
실시예 2.1의 방법으로 담배연기 응축물이 포집된 캠브리지 필터를 담배 홀더에서 분리하여 각각 100 ㎖ 삼각 플라스크에 넣고 추출용매 이소프로판올을 50 ㎖씩 첨가하여 혼합하였다. 상기 혼합물을 실온에서 8시간 이상 방치하여 담배연기 응축물을 추출하였다. 상기 추출물은 추출 후 여과하고 감압여과 농축기로 농축하였고, 3개의 삼각 플라스크에 들어있는 농축액을 scintillation vial에 모아 질소 가스를 이용하여 완전 농축하였다.
상기 방법으로 농축된 담배연기 응축물에서 하기의 수학식 1을 이용하여 총 입자상물질(TPM) 함량의 계산하였다.
<수학식 1>
TPM(mg/cig) = (WFHA - WFBH)/N
여기서 TPM : 총 입자상 분진 물질
WFHA : 흡연 후 Filter Holder의 무게
WFHB : 흡연 전 Filer Holder의 무게
N : 한 Trap 당 흡연한 개피 수(cig.)
실시예 3. 만성 폐쇄성 폐질환 마우스 모델을 이용한 GKB101 항체의 호흡기 손상 억제 효과 검증
숫컷 7주령의 SPF(specific pathogen-free) BALB/c 마우스(18 g 내지 20 g)는 오리엔트바이오사에서 공급받았다. 동물은 실험 당일까지 고형사료(항생제 무첨가, 삼양사료 Co.)와 물을 충분히 공급하고 온도 22±2℃, 습도 55±15%, 12시간(light-dark cycle)의 환경에서 1주간 적응시킨 후 실험에 사용하였다. 그리고 동물실험의 윤리적, 과학적 타당성 검토 및 효율적인 관리를 위하여 대전대학교 동물실험윤리위원회(Institutional animal care and use committee: IACUC)의 승인을 받았다.
만성 폐쇄성 폐질환(COPD, chronic obstructive pulmonary disease) 마우스 모델을 확립하기 위한 LPS/CS 혼합물은 100 ㎍/㎖의 LPS(lipopolysaccharide) 및 4 ㎎의 표준 담배 추출물(CSE, cigarette smoking extract)을 각각 1:1로 섞어 준비하였다.
7주령 BALB/c 수컷 마우스를 케타민(ketamine)/럼프(rumph)로 가마취한 후, 상기 LPS/CS 혼합물을 마우스의 코 및 입에 마리 당 총 100 ㎕(각각 50 ㎕)로 주 1회씩 3주간 INT(intra-nazal-trachea) 주사(injection) 방법으로 흡입시켜 COPD 마우스 모델을 제작한다.
이때, 실험군은 (i) 무처리한 정상군(normal, Nr), (ii) LPS/CS 및 생리식염수를 투여한 대조군(COPD-CTRL), (ⅲ)LPS/CS 및 덱사메타손(Dexamethasone, 5 ㎎/㎏, p.o)을 투여한 실험군(COPD-DEXA.), (ⅳ) LPS/CS 및 GKB101 항체(1 ㎎/㎏, i.p)를 투여한 실험군(COPD-GKB101(1 ㎎/㎏, i.p), (ⅴ) LPS/CS 및 GKB101 항체(3 ㎎/㎏, i.p)를 투여한 실험군(COPD-GKB101(3 ㎎/㎏, i.p), (ⅵ) LPS/CS 및 GKB101 항체(9 ㎎/㎏, i.p)를 투여한 실험군(COPD-GKB101, 9 ㎎/㎏, i.p) 및 (ⅶ) LPS/CS 및 Roflumilast(30 ㎎/㎏, p.o)을 투여한 실험군(COPD-Roflumilast)으로 나누어 실시하였다. 실험 종료 후 각 군 생쥐의 혈액, 기관지 폐포세척액 및 폐조직을 분리하여 GKB101 항체의 호흡기 손상 억제 효과를 평가하였다. 각각의 시험물질(생리식염수 포함)은 LPS/CS 처리 1시간 전에 전처리 되었다.
실험 집단간 수치 데이터는 각 실험군 결과값은 평균(mean)±표준 편차(SD)로 나타내었으며, 동물실험에서는 SPSS 11.0 소프트웨어(IBM-SPSS Inc.)를 이용하여 일원배치 분산분석(ANOVA) 후에 Duncan's multiple comparison tests로 유의성을 검증하였다. p 값이 0.05, 0.01 혹은 0.001 보다 작은 경우를 구분하여 분석하였으며(#p<0.05, ##p<0.01, ###p<0.001 vs. COPD_CTL 또는 Nr; **p<0.01, ***p<0.001 vs. COPD-CTL), 각 경우에 해당 시 통계적으로 유의적 차이가 있는 것으로 판정하였다.
실시예 3.1. 기관지 폐포세척액, 폐세포 분리 및 총 세포수 측정
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 실험 마우스에서 수득한 기관지 폐포세척액(BALF, bronchoalveolar lavage(BAL) fluid) 내 존재하는 BAL 세포 및 총 폐세포를 측정하였다.
이때, 각 샘플의 채취는 하기와 같이 수행하였다.
먼저, 폐포세척액은 마우스 기도 삽관을 통해 1 ㎖의 PBS로 기관지 및 폐 조직을 세척한 뒤 수거하였다. 상기 세척액을 폐포세척액(BALF, bronchoalveolar lavage(BAL) fluid)으로 사용하였다.
또한, 폐 조직의 일부를 적출하여 100 ㎍/㎖의 농도가 되도록 단백질 용해 버퍼(protein lysis buffer)를 첨가하고 조직을 용해하였다. 상기 용해물을 13,000 rpm으로 원심분리하여 상층액만 수거하여 폐 조직 샘플로 사용하였다. 폐세포는 Cytospin을 시행하여 Diff-Quick staining을 통하여 계수하였다.
그 결과, 도 3 및 도 4에 나타낸 바와 같이, COPD 마우스 모델에서 총 BAL 세포의 수가 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군에서 유의성 있게 감소하였다. 총 Peyer's patch세포수의 경우 정상군(Balb/c_normal)에 비하여 대조군(COPD-CTL)에서 감소하였고, GKB101 항체 투여군은 대조군(COPD-CTL)과 유사한 결과를 나타내었다. 또한, 기관지 폐포세척에서 Cytospin을 통한 호중구(neutrophil)를 계수한 결과, 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군에서 농도 의존적으로 유의성 있게 호중구의 수가 감소한 것을 확인할 수 있었다.
실시예 3.2. 혈액에서 혈구세포 분석
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 실험 마우스에서 수득한 혈액에서 전혈구 검사(complete blood count:CBC)를 실시하였다.
그 결과, 도 5에 나타낸 바와 같이, 총 백혈구(WBCs) 수는 대조군(COPD-CTL)과 GKB101 항체 투여군이 모두 유사하게 관찰되었다. 또한, Roflumilast 투여군에서도 유의적인 변화가 관찰되지 않았다. 호중구(neutrophil) 빈도수(%)는 대조군(COPD-CTL)과 비교하여 GKB101 항체 투여군이 감소한 것을 확인할 수 있었다. 반면, 림프구(lymphocyte) 빈도수(%)의 경우, 대조군(COPD-CTL)과 비교하여GKB101 항체 투여군(1 mg/kg 및 3 mg/kg)에서 유의성 있게 증가하였다. 또한, 단핵구(monocyte) 빈도수(%)는 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군이 농도 의존적으로 유의성 있게 감소하였다.
실시예 3.3. 기관지 폐포세척액에서 염증성 사이토카인 농도 분석
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 실험 마우스에서 수득한 기관지 폐포세척액에서 염증성 사이토카인의 농도를 ELISA를 이용하여 측정하였다.
그 결과, 도 6에 나타낸 바와 같이, 기관지 폐포세척액 내 CXCL-1, MIP2, IL-17 및 TNF-α의 농도는 모두 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군(9 mg/kg) 및 양성대조군인 Dexa 투여군에서 유의적으로 감소하였다. 특히, MIP2 및 IL-17의 농도는 대조군에 비하여 모든 농도의 GKB101 항체 처리군에서 유의적으로 감소하였다.
실시예 3.4. 혈청에서 기관지 폐기능 지표 분석
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 마우스 실험에서 수득한 혈청에서 SDMA(symmetric dinethylarginine)을 ELISA로 측정하였다.
그 결과, 도 7에 나타낸 바와 같이, 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군(3 mg/kg(p<0.05) 및 9 mg/kg(p<0.05)에서 혈청 내 SDMA 농도가 유의적으로 감소하였다. 이때, 양성대조군인 Dexa 투여군(p<0.05) 및 Roflumilast 투여군(p<0.01)도 대조군(COPD-CTL)에 비하여 혈청 내 SDMA 농도가 유의적으로 감소하였다.
실시예 3.5. 폐조직 내의 염증 및 기침 관련 유전자 발현 분석
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 실험 마우스에서 수득한 폐조직에서 염증 및 기침(cough)에 관련된 유전자의 발현을 q-PCR을 통해 확인하였다. 이때 사용된 프라이머는 표 5에 나타낸 바와 같다.
그 결과, 도 8a 및 도 8b에 나타낸 바와 같이, 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군(9 mg/kg)의 폐조직에서 기침 관련 유전자인 MUC5AC 및 TARC, 및 염증 관련 유전자인 CXCL-1 및 Cox-2의 유전자 발현이 유의적으로 감소한 것을 확인할 수 있었다. 반면, 기침 관련 유전자 중 TRPA1 및 TRPV1, 및 염증 관련 유전자 중 TNF-α 및 NOS-II의 발현은 대조군(COPD-CTL)에 비하여 감소하였으나 통계학적 유의성은 없었다.
상기 결과를 통해 GKB101 항체 투여에 의하여 MUC5AC, TARC, CXCL-1 및 Cox-2 등과 같이 면역세포 및 호중구와 관련된 호흡기 염증 활성이 억제되었음을 확인할 수 있었다.
유전자명 프라이머 서열
TGF-β1 정방향 5'-TGGAGCAACATGTGGAACTC-3'(서열번호 27)
역방향 5'-CTGCCGTACAACTCCAGTGA-3'(서열번호 28)
MUC5AC 정방향 5'-AGAATATCTTTCAGGACCCCTGCT-3'(서열번호 29)
역방향 5'-ACACCAGTGCTGAGCATACTTTT-3'(서열번호 30)
mTRPV1 정방향 5'-CATCTTCACCACGGCTGCTTAC-3'(서열번호 31)
역방향 5'-CAGACAGGATCTCTCCAGTGAC-3'(서열번호 32)
mTRPA1 정방향 5'-TGAGATCGACCGGAGT-3'(서열번호 33)
역방향 5'-TGCTGAAGGCATCTTG-3'(서열번호 34)
CXCL-1 정방향 5’-CCGAAGTCATAGCCACAC-3'(서열번호 35)
역방향 5'-GTGCCATCAGAGCAGTCT-3'(서열번호 36)
Cox-2 정방향 5'-GGGTGTCCCTTCACTTCTTTCA-3'(서열번호 37)
역방향 5'-TGGGAGGCACTTGCATTGA-3'(서열번호 38)
TARC 정방향 5'-CCCATGAAGACCTTCACCTC-3'(서열번호 39)
역방향 5'-ACTCTCGGCCTACATTGGTG-3'(서열번호 40)
NOS II 정방향 5'-CGAAACGCTTCACTTCCAA-3'(서열번호 41)
역방향 5'-TGAGCCTATATTGCTGTGGCT-3'(서열번호 42)
실시예 3.6. 폐조직의 병리학적 분석
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 실험 마우스에서 수득한 폐조직을 H&E 염색하여 광학 현미경을 통해 관찰하였다.
구체적으로, 투여 종료 후 적출된 기도 조직과 폐조직을 4% 파라포름알데하이드(paraformaldehyde)에서 하루 동안 반응시켜 고정한 뒤, 파라핀 조직 절편 슬라이드를 제작하였다. 상기 파라핀 조직 절편 슬라이드를 각각 자일렌(xylene) 용액 및 100% 에탄올로 3번 세척하여 파라핀을 제거하였다.
상기 파라핀이 제거된 슬라이드는 하기의 방법으로 수행하여 관찰하였다. 헤마톡실린(hematoxylin) 용액에서 슬라이드를 5분간 반응시킨 뒤, 상기 슬라이드를 흐르는 물 및 1% 염산에 순차적으로 세척하였다. 그 다음으로 흐르는 물에서 상기 슬라이드를 세척한 뒤 1% 암모니아 용액(70% ethanol에 희석함)으로 중화시켰다. 상기 슬라이드를 흐르는 물에 세척하고 에오신(eosin) 용액에서 2분간 반응시켰다. 반응이 끝난 뒤, 슬라이드를 순차적으로 70% 내지 100% 에탄올 용액으로 세척하고, 자일렌 용액에서 3분간 반응시켰다. 이때, 자일렌 용액에서 반응시키는 과정은 총 3번 실시하였다. 마지막으로 커버 슬라이드로 조직 절편 슬라이드를 봉입한 후 광학 현미경으로 조직의 형태를 관찰하였다.
Masson Trichrome 염색 및 관찰은 하기의 방법으로 수행하였다. 파라핀이 제거된 슬라이드를 60℃의 Bouin's 용액에서 반응시킨 뒤, 꺼내어 식힌 다음 Weigert's Hematoxylin 용액, Briebrich Scarlet 용액, Phosphotungstic phosphomolybdic acid 및 Aniline blue 용액에서 순차적으로 반응시켰다. 마지막으로 1% 아세트산 용액에서 반응시킨 뒤, 커버 슬라이드로 폐 조직 절편 슬라이드를 봉입하여 광학 현미경으로 조직 내 콜라겐 침착 정도를 확인하였다.
Periodic acid-Schiff-Alcian Blue 염색은 상기 파라핀이 제거된 슬라이드를 순차적으로 Alcian blue 용액, 0.5% Periocid acid 용액 및 Schiff's 용액에서 반응시켰다. 각 용액과의 반응 후에는 슬라이드를 흐르는 물로 충분히 세척하였다. 상기 과정을 통해 염색된 슬라이드를 헤마톡실린 용액에서 반응시킨 뒤 물로 세척하고 70% 내지 100% 농도의 에탄올 용액에서 순차적으로 반응시켜 탈수시켰다. 상기 조직 절편을 커버 글라스로 봉입한 뒤 광학 현미경으로 관찰하였다.
그 결과, 도 9에 나타낸 바와 같이, 정상군(normal)에 비하여 대조군(COPD-CTL)에서 기도의 두께가 크게 증가하는 것을 관찰할 수 있었다. 또한, 기관지(airway) 주변에 염증성 면역세포의 침윤, 및 과립구(호중구, 호산구(eosinophils) 및 활성화된 대식세포로 인하여 염증이 심화되어 폐포의 파괴가 진행된 것이 관찰되었다.
또한, Masson Trichrome(M-T) 염색을 통해 폐포 파괴 정도를 콜라겐 침착(collagen deposition)으로 확인한 결과, 정상군(normal)에 비하여 대조군(COPD-CTL)에서 폐조직 내의 기도(tracheal), 폐포(alveolar) 및 세포의 염증 부위가 증가하였고, 혈액 세포의 침윤이 증가한 것을 확인할 수 있었다. 더불어, 대조군(COPD-CTL)에서는 기관지 주변에 점액질을 분비하는 배상세포(goblet cell)가 많이 분포하고 있음을 PAS 염색을 통해 확인할 수 있었다.
반면, GKB101 항체 투여군(3 mg/kg 및 9 mg/kg) 및 양성대조군인 Dexa. 3 ㎎/㎏ 투여군 및 Roflumilast 투여군은 대조군(COPD-CTL)과 비교하여 기도의 두께가 정상군(normal)에 가깝게 감소하였으며, 기관지 주변의 염증성 면역세포의 침윤, 및 과립구세포(호중구, 호산구) 및 활성화된 대식세포의 수가 크게 감소한 것을 확인할 수 있었다. 또한, Masson Trichrome(M-T) 염색 결과, 기도, 폐포 및 기관지 주변의 배상세포 및 세포의 염증 부위가 감소하였고, 혈액세포의 침윤정도도 정상군(normal)과 유사한 정도로 감소한 것으로 관찰되었다.
실시예 3.7. 기도 조직의 병리학적 분석
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 마우스 실험에서 수득한 기도 상피세포층을 periodic acid-Schiff(PAS)-Alcian Blue(AB) 염색 방법을 이용하여 염색하고, 기도 조직의 형태를 광학 현미경으로 관찰하였다. PAS-AB 염색은 실시예 3.6과 동일한 방법으로 실시하였다.
그 결과, 도 10에 나타낸 바와 같이, 정상군(normal), 대조군(COPD-CTL)에서 배상세포 내 짙은 보라색으로 염색된 점액(mucin)의 양이 관찰 증가한 것을 확인할 수 있었다. 반면, GKB101 항체 투여군(3 mg/kg, 9 mg/kg)에서는 배상세포 내 점액의 양이 감소하는 것이 관찰되었다. 상기 결과를 통해, GKB101 항체가 COPD 유도에 의해 배상세포 내 점액 함유량 증가를 억제하는 것을 확인할 수 있었다.
실시예 3.8. 폐조직 내의 CXCL-1 및 TNF-α 발현 확인
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 실험 마우스에서 수득한 폐조직으로 실시예 3.6과 동일한 방법으로 조직 슬라이드를 제작한 뒤, CXCL-1 및 TNF-α의 발현을 면역조직화학염색법(immunohistochemistry, IHC)을 통해 확인하였다. 이때, 핵은 Hoechst를 이용하여 염색하였다.
그 결과, 도 11 내지 도 14에 나타낸 바와 같이, 정상군(Nr, normal)에 비하여 대조군(COPD-CTL)에서 CXCL-1 및 TNF-α 단백질 발현이 증가한 것을 확인할 수 있었다. 반면, GKB101 항체 투여군의 경우 대조군(COPD-CTL)과 비교하여 농도 의존적으로 TNF-α(p<0.001) 및 CXCL-1(p<0.001) 단백질 발현이 유의적으로 감소한 것을 확인할 수 있었다. 이때, 양성대조군인 Dexa. 투여군(p<0.05) 및 Roflumilast 투여군(p<0.01)도 대조군(COPD-CTL)에 비하여 CXCL-1 및 TNF-α의 단백질 발현이 유의적으로 감소하였다.
실시예 3.9. 폐조직 내의 IRAK-1 단백질 발현 확인
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 마우스 실험에서 수득한 폐조직에서 MyD88 관련 기전으로 염증 신호전달 단백질인 IRAK-1 단백질의 발현을 면역조직화학염색법을 통해 확인하였다. 이때, 핵은 hoechst를 이용하여 염색하였다. 이때, IHC는 실시예 3.8과 동일한 방법으로 수행하였다.
그 결과, 도 15 및 도 16에 나타낸 바와 같이, 정상군(Balb/c_Nr)에 비하여 대조군(COPD-CTL)에서 IRAK-1 단백질 발현이 폐기도 주변에서 증가하였고, GKB101 항체 투여군(1 mg/kg, 3 mg/kg, 9 mg/kg)에서는 대조군(COPD_CTL)에 비하여 농도 의존적으로 IRAK-1 단백질 발현이 유의적으로 감소하였다. 이때, 양성대조군인 Dexa. 투여군(p<0.05) 및 Roflumilast 투여군(p<0.01)도 대조군(COPD-CTL)에 비하여 폐조직 내의 IRAK-1 단백질 발현이 유의성 있게 감소하였다.
실시예 3.10. 기관지 폐포세척액 및 폐조직 내의 면역세포 분석
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 실험 마우스에서 수득한 기관지 폐포세척액 및 폐조직 내의 면역세포를 유세포 분석을 통해 분석하였다.
구체적으로, 분리한 PBMCs, BAL 세포, 폐 세포 및 Peyer's patch 세포를 5×105 세포의 농도로 희석하여 4℃에서 면역 형광염색(immunofluorescence staining)을 실시하였다. 이때 사용한 항체는 PE-항-CD3e 항체(553064, BD Pharmingen), FITC-항-CD8 항체(553031, BD Pharmingen), PE-항-CD4 항체(553047, BD Pharmingen), PE-항-Gr-1 항체(553128, BD Pharmingen), FITC-항-CD69 항체(55732, BD Pharmingen), FITC-항-CD11b 항체(553310, BD Pharmingen) 및 PE-항-B220 항체(561878, BD Pharmingen)이다. 상기 항체를 각각의 세포에 처리하고 30 분간 얼음에서 반응시켰다. 반응 후 3회 이상 인산 완충 생리식염수로 수세한 후, 유세포 분석기로 분석하였다. 상기 분석값은 FlowJo 프로그램(FlowJo™ v7 Software, BD Biosciences)을 이용하여 CD62L-CD44+high&CD21/CD35+B220+ 및 SiglecF-Gr-1+호중구 세포빈도를 백분율(%)로 분석한 후, 총 세포수(total cells)를 적용하여 각 조직에서의 절대 총 세포수(absolute number)를 산출하였다.
실시예 3.10.1. 기관지 폐포세척액 내의 염증세포 분석
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 실험 마우스에서 수득한 기관지 폐포세척액 내의 염증세포를 실시예 3.10과 동일한 방법으로 유세포 분석하였다.
그 결과, 도 17a 내지 도 17d에 나타낸 바와 같이, 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군의 BAL에 침윤된 염증활성 CD4+ 및 CD8+ 절대세포수가 농도 의존적으로 유의성 있게 감소하였다. 또한, 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군의 BAL에 침윤된 호중구(Gr-1+SiglecF-호중구) 절대세포 수가 농도 의존적으로 유의성 있게 감소하였다.
실시예 3.10.2. 폐조직 내의 염증세포 분석
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 마우스 실험에서 수득한 기관지 폐조직 내의 염증세포를 실시예 3.10과 동일한 방법으로 유세포 분석하였다.
그 결과, 도 18a 내지 도 18d에 나타낸 바와 같이, 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군의 폐에 침윤된 염증성 림프구(inflammation lymphocytes)(CD4+CD44high+CD62L-, B220+CD21+/CD35+: iBALT 형성 림프구)의 절대세포 수가 농도 의존적으로 유의성 있게 감소하였다. 특히 도 18의 L은 폐에 침윤된 호중구(Gr-1+SiglecF-호중구)의 절대세포 수를 나타낸 것으로 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군이 감소하고 고농도군에서 통계학적 유의성이 나타났다. 이때, 양성대조군 Dexa. 투여군(p<0.05) 및 Roflumilast 투여군(p<0.01)은 대조군(COPD-CTL)에 비하여 염증성 림프구(CD4+CD44high+CD62L-, B220+CD21+/CD35+: iBALT 형성 림프구)의 절대세포수가 통계학적으로 유의성 있게 감소하였다.
실시예 3.10.3. Peyer's patch에서 면역세포 분석
COPD 마우스 모델에서 GKB101 항체의 호흡기 손상 억제 효과를 확인하기 위하여 실시예 3의 마우스 실험에서 수득한 Peyer's patch에서의 면역세포를 실시예 3.10과 동일한 방법으로 유세포 분석을 통해 분석하였다. 이때, Peyer's patch는 소장 점막 면역조직으로 장관강에서 침입한 항원에 대한 국소면역을 담당하고 있다. 또한, 장내 유산균의 활성, T 세포, B 세포, 수지상세포, 그리고 M2 대식세포 활성 및 IgA 생산 전구세포의 분화 성숙에 관여하는 면역기관으로 알려져 있다.
그 결과, 도 19a 내지 도 20에 나타낸 바와 같이, COPD에 의한 염증반응으로 증가된 대조군(COPD-CTL)에 비하여 CD4+, CD4+CD69+ 및 B220+CD69+의 빈도수(%)는 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군이 농도 의존적으로 유의성 있게 감소하였다. 이때, 양성대조군인 Roflumilast 투여군도 대조군(COPD-CTL)에 비하여 CD4+, CD4+CD69+ 및 B220+CD69+의 빈도수(%)가 통계학적으로 유의성 있게 감소하였다. 또한, B220-CD11c+는 수지상세포 빈도수(%)를 나타낸 것으로 대조군(COPD-CTL)에 비하여 GKB101 항체 투여군에서 농도 의존적으로 증가하였다.
III. GKB101 항체의 염증성 장질환 개선 효과 검증
실시예 4. 염증성 장질환 마우스 모델을 이용한 GKB101 항체의 염증성 장질환 개선 효과 검증
염증성 장질환의 마우스 모델로 DSS 마우스 모델(dextran sulfate sodium-induced colitis model)을 사용하였다. 마우스는 6~10주령의 암컷 B57BL/6 마우스(오리엔트바이오)를 사용하였고, 온도 21~23℃, 상대습도 40~45%로 항온 항습이 유지되는 SPF(specific pathogen free) 실험동물실에서 사육되었다. 또한, 케이지 별 실험동물 개체수는 4마리 이하로 수용하며 주 3회 케이지 교환 및 사료를 공급하였다.
DSS(MP biomedical, reagent-grade, MW 36-50 KDa, cat no. 160110)를 멸균수에 2.5%의 농도로 녹인 뒤, 마우스 케이지당 100 ㎖의 2.5% DSS 용액을 2일에 1회 교체하여 공급하였다. 실험 종료일까지 정기적으로 임상적 검사를 수행하여 염증진행 정도를 확인하고 체중을 측정하였다. 이때, 시험 시작일 체중으로부터 25% 이상 감소하는 경우 윤리적 차원에서 안락사를 시행하였다. 실험은 실험 시작일로부터 7 내지 8일에 대조군의 임상지수가 최대에 도달하였다고 판단될 때 종료하였다.
시험군은 총 7군으로 나누어 진행하였다(도 21). DSS는 0일부터 투여를 시작하였으며, 1일, 3일, 5일째부터 PBS(대조군), Isotype IgG1(5 mg/kg, Bio X cell, BP0297), 양성대조군 항-TNF-α항체(5 mg/kg, Bio X cell, BP0058) 및 GKB101 항체를 각각 복강투여 하였다. 이때, vehicle인 PBS는 경구투여 하였다.
실험 시작일부터 실험 종료일까지 매일 1회 염증 발생 및 염증 정도를 관찰하여 도 22의 기준에 따라 0~4점의 점수를 부여하여 그 합계를 임상활성지수(disease activity index: DAI)로 사용하였다. 또한, 체중을 매일 1회 측정하여 도 22의 기준에 따라 0-4점의 점수를 부여하여 DAI 측정에 사용하였다.
각각의 평가 지표에 대한 암맹평가 자료를 기반으로 대조군과 시험군 또는 두 시험군 간의 통계분석을 SPSS(IBM Corporation)를 통해 수행하였다. 양 군 간의 비교를 위해 Student's t-test 또는 Mann Whitney U test를 사용하였다. 수준은 p값이 0.05 이하이면 유의성이 있는 것으로 하였다.
실시예 4.1. 임상지표 평가
실시예 4.1.1. 임상활성지수 평가
DSS 마우스 모델에서 GKB101 항체의 염증성 장질환의 개선 효과를 확인하기 위하여, 실시예 4의 실험 마우스에서 염증 증상 발생 및 체중 변화를 기반으로 임상활성지수(disease activity index: DAI)를 정량적으로 평가하였다(도 22).
그 결과, 도 23에 나타낸 바와 같이, 양성대조군인 항-TNF-α 항체 투여군 및 GKB101 항체 투여군(2.5 mg/kg, 10 mg/kg, 15 mg/kg)에서 모두 대조군(PBS)과 비교하여 유의적으로 임상활성지수가 감소하였다. 특히, GKB101 항체 투여군에서는 투여 농도 의존적으로 장질환 개선 효과를 나타내었다. Isotype IgG1과 비교하였을 때, 양성대조군(항-TNF-α 항체)에서는 통계적 유의성이 없었으나, GKB101 항체 투여군(10 mg/kg 및 15 mg/kg)에서는 유의성 있는 감소 효과를 나타내었다.
임상지표의 AUC(area under the curve)를 분석한 결과에서도 임상지표의 time course 결과와 유사한 양상을 보였다. 양성대조군(항-TNF-α 항체) 및 GKB101 항체 투여군(2.5 mg/kg, 10 mg/kg, 15 mg/kg)에서 모두 PBS 투여군과 비교하여 유의적으로 감소하였다. 특히, GKB101 항체 투여군(10 mg/kg, 15 mg/kg)에서는 양성대조군보다 더 뚜렷한 감소 효과를 관찰할 수 있었다(도 24).
상기 결과를 통해, GKB101 항체는 10 mg/kg 이상의 농도에서 임상에서 표준치료제로 널리 사용되고 있는 항-TNF-α 항체보다 더 좋은 임상지표의 감소효과를 나타내었음을 확인할 수 있었다.
실시예 4.1.2. 체중감소 스코어 평가
또한, DAI를 평가 항목 중 하나인 체중감소 스코어(body weight loss score)를 평가한 결과, 도 25에 나타낸 바와 같이, 정상군에 비하여 체중감소가 뚜렷하였지만 대조군과 비교하였을 시, GKB101 항체 투여군 및 양성대조군(항-TNF-α 항체) 모두에서 통계적으로 유의한 차이를 관찰할 수 없었다. 상기 결과에 대해 체중감소 스코어의 AUC를 분석한 결과에서도 상기와 동일한 결과를 나타내었다(도 26).
실시예 4.1.3. 대변의 일관성 스코어 평가
DSS 마우스 모델에서 GKB101 항체의 염증성 장질환의 개선 효과를 확인하기 위하여, 실시예 4의 실험 마우스에서 대변의 일관성(stool consistency) 스코어를 평가하였다.
그 결과, 도 27에 나타낸 바와 같이, 대조군에 비해 양성대조군(항-TNF-α 항체)에서 통계적으로 유의한 감소를 나타내었다. GKB101 항체 투여군의 경우, 2.5 mg/kg, 10 mg/kg, 및 15 mg/kg 투여군에서 모두 유의성 있는 감소 효과가 관찰되었고, 특히 GKB101 항체 10 mg/kg 및 15 mg/kg 투여군에서는 훨씬 더 뚜렷한 감소 효과가 관찰되었다. 대변의 일관성 스코어의 AUC를 분석한 결과에서도 GKB101 항체 투여군에서 모두 대조군에 비해 통계적으로 유의한 감소 효과를 나타내었다(도 28).
실시예 4.1.4. 장 출혈 스코어 평가
DSS 마우스 모델에서 GKB101 항체의 염증성 장질환의 개선 효과를 확인하기 위하여, 실시예 4의 실험 마우스에서 장 출혈(intestinal bleeding) 스코어를 평가하였다.
그 결과, 도 29에 나타낸 바와 같이, 대조군에 비해 양성대조군(항-TNF-α 항체) 및 GKB101 투여군에서 모두 유의적인 감소 효과가 관찰되었다. 장 출혈 스코어의 AUC를 분석한 결과에서도, 양성대조군(항-TNF-α 항체) 및 GKB101 항체 투여군에서 모두 대조군에 비해 통계적으로 유의한 감소 효과를 나타내었다(도 30).
실시예 4.1.5. 장 길이 측정
DSS 마우스 모델에서 GKB101 항체의 염증성 장질환의 개선 효과를 확인하기 위하여, 실시예 4의 실험 마우스에서 대장 조직을 적출하여 장 길이 및 중량을 측정하였다.
그 결과, 도 31 내지 도 33에 나타낸 바와 같이, 대조군에서는 정상군에 비해 대장 길이가 약 44.5% 감소되었으나, 양성대조군(항-TNF-α 항체) 및 GKB101 항체 투여군(10 mg/kg, 15 mg/kg)에서는 대조군과 비교하여 유의적으로 대장 길이의 손상이 감소된 것을 확인할 수 있었다. 특히, GKB101 투여군(10 mg/kg, 15 mg/kg)의 대장 길이는 양성대조군(항-TNF-α 항체)에 비해 더 길게 유지된 것을 확인할 수 있었다. 대장의 무게는 GKB101 항체 투여군(15 mg/kg)에서만 대조군에 비해 통계적으로 유의한 증가가 관찰되었다.
상기 결과를 통해, GKB101 항체는 농도 의존적으로 대장의 손상을 억제하는 것을 확인할 수 있었으며, 특히 10 mg/kg 이상의 농도로 투여할 시 월등한 억제 효과를 나타낼 수 있음을 확인하였다.
실시예 4.2. 대장염 조직의 조직병리 분석을 통한 조직 형태학적 평가
DSS 마우스 모델에서 GKB101 항체의 염증성 장질환의 개선 효과를 확인하기 위하여, 실시예 4의 실험 마우스에서 대장 조직을 적출하여 H&E로 염색하여 대장조직의 형태를 관찰하였다(200X 배율). 관찰된 결과는 도 34의 항목 및 지표 기준에 따라 점수를 부여하고 평가항목에 대한 점수를 합산하여 최종적으로 조직의 형태를 평가하였다(도 34). 이때, H&E 염색은 실시예 3.6과 동일한 방법으로 수행하였다.
그 결과, 도 35 내지 도 38에 나타낸 바와 같이, 대장 조직의 염증활성도 및 조직손상평가에서 GKB101 항체 투여군은 대조군(PBS) 또는 항체 음성대조군(Isotype IgG1)에 비해 농도 의존적으로 유의성 있는 치료효과를 나타내었다. 또한, 임상적으로 광범위하게 사용 중인 궤양성 대장염 치료제인 항-TNF-α 항체와 비교하여 통계적으로 유의성 있는 우수한 치료효과를 나타내었다. DSS 마우스 모델에서 처리군별 및 개별 마우스별로 임상활성지수(DAI, clinical disease activity index) 및 총 형태학적 스코어(total histological score)간의 상관관계를 확인한 결과를 통해 GKB101 항체 투여군 및 양성대조군(항-TNF-α 항체)의 DAI는 조직형태학적 정량평가지표에 의해 잘 반영되는 것을 확인할 수 있었다.
실시예 4.3. 비장 무게 평가
DSS 마우스 모델에서 GKB101 항체의 염증성 장질환의 개선 효과를 확인하기 위하여, 실시예 4의 실험 마우스에서 비장조직을 적출하여 무게를 측정하였다.
그 결과, 도 39에 나타낸 바와 같이, Isotype IgG1에 비하여 양성대조군(항-TNF-α 항체) 및 GKB101 항체 투여군에서 모두 통계적으로 유의한 차이를 보이지는 않았다.
실시예 4.4. GKB101 항체의 반복 투여에 따른 in vivo 안전성 평가
DSS 마우스 모델에서 GKB101 항체의 안전성 평가를 위하여, 투여 시작일(0일)부터 투여 종료 직전(7일)까지 매일 마우스 체중을 측정하였다.
그 결과, 도 40에 나타낸 바와 같이, 투여기간 동안 정상군을 제외하고 모든 대장염 유도군에서 유사한 정도의 체중감소가 일어났음을 확인하였다.
IV. GKB101 항체의 류마티스 관절염 개선 효과 검증
실시예 5. 류마티스 관절염에 대한 WARS1의 임상적 상관성 확인
류마티스 관절염(RA)과 WARS1과의 상관성을 확인하기 위하여, 류마티스 관절염 환자의 활강액 내 WARS1 단백질의 농도 및 류마티스 관절염 질환의 심각도와의 상관성을 확인하였다. 이때, 활강액 내의 WARS1의 농도는 ELISA를 이용하여 측정하였다.
구체적으로, WARS1 측정은 GKB101 항체를 1 ㎍/㎖ 농도로 96웰 플레이트(Maxisorp, Thermo fisher)에 코팅한 뒤, 1% BSA가 포함되어 있는 PBS로 상온에서 1시간 동안 블로킹하였다. 활강액은 1/2로 희석하여 코팅된 웰에 각각 첨가하고 상온에서 1시간 동안 반응시킨 뒤, PBST(PBS+ Tween20)로 4번 세척하였다. 이때, 재조합 WARS1 단백질은 0.1 내지 50 ng/㎖의 농도 내에서 1/2씩 단계적으로 희석하여(serial dilution) 표준 농도 물질로 사용하였다. 각 웰에 항-WARS1 항체(항-WARS 항체, abFrontier)를 첨가하여 상온에서 1시간 동안 반응시킨 뒤, PBST로 4번 세척하였다. HRP가 붙어있는 2차 항체로(항-인간 IgG1 항체, cell signaling) 1시간 동안 반응시킨 뒤, PBST로 세척하고 TMB 기질(BD)로 발색시켜 490 nm에서 OD값을 측정하였다(VersaMax Microplate reader).
도 41a 및 도 41b에 나타낸 바와 같이, 먼저 퇴행성 관절염(OA) 환자 및 류마티스 관절염(RA) 환자의 활강내 WARS1의 농도를 비교한 결과, 퇴행성 관절염 환자 대비 류마티스 관절염 환자에서 통계 유의적으로 WARS1의 농도가 증가한 것을 확인할 수 있었다. 또한, 류마티스 관절염 환자의 활막 내 형성된 섬유조직(pannus) 또는 신생혈관생성 형성 정도를 GSUS(greyscale ultrasound)를 통해 측정하여 상기 WARS1의 농도와 비교한 결과, WARS1의 농도가 높을수록 섬유조직 및 신생혈관의 형성이 유의적으로 증가한 것을 확인할 수 있었다. 뿐만 아니라, 상기 WARS1의 농도는 활강액 내 침윤된 백혈구 및 각종 면역세포(호중구, 림프구), 염증인자(ESR, CRP) 및 염증성 사이토카인(IL-6) 및 케모카인(IL-8)의 농도와 양의 상관관계(positive correlation)를 나타내었다.
실시예 6. 류마티스 관절염 마우스 모델을 이용한 GKB101 항체의 류마티스 관절염 개선 효과 검증
류마티스 관절염 모델인 CIA(collagen-induced arthritis) 마우스 모델을 이용하여 GKB101 항체의 류마티스 관절염(RA)에 대한 개선 효과를 확인하였다.
마우스는 6~10주령의 수컷 DBA/1J 마우스를 사용하였고, 온도 21~23℃, 상대습도 40~45%로 항온 항습이 유지되는 SPF실험동물실에서 사육되었다. 또한, 케이지 별 실험동물 개체수는 6마리 이하로 수용하며 주 2회 케이지 교환 및 사료를 공급하였다.
먼저, CIA 마우스 모델을 제작하기 위하여, 관절염 유도를 위한 자극제는 10 mM 아세트산(acetic acid)에 2 mg/㎖이 되도록 2형 콜라겐(bovine type II collagen)을 녹인 뒤, Complete Freund's adjuvant(CFA, 2 mg/㎖)과 1:1(v/v)로 혼합하여 준비하였다. 상기 방법으로 준비한 콜라겐을 마우스의 꼬리에 마리 당 100 ㎕씩 피내주사 하여 1차 면역화를 수행하였다. 1차 면역화를 진행한 21일 후, IFA(incomplete Freund's adjuvant) 및 2형 콜라겐을 1:1(v/v)로 섞어 에멀전화한 후, 마우스 꼬리에 마리 당 100 ㎕씩 피내주사 하여 2차 면역화를 진행하였다. 2차 면역화를 수행한 마우스는 무작위로 실험군을 나누어 실험을 수행하였다.
실험은 총 2회 실시하였고, 1회 실험에서는 실험군당 총 4마리의 마우스를 사용하였다. 상기 실험군은 대조군(Vehicle, PBS), 항체 음성대조군(Isotype IgG1, 15 mg/kg) 및 GKB101 항체(15 mg/kg) 투여군으로 나누어 진행하였다(도 42). 2회 실험에서는 군당 5마리의 마우스를 사용하였으며, 대조군(Vehicle, PBS), 항체 음성대조군(Isotype IgG1, 15 mg/kg), 양성대조군으로 항-TNF-α 항체(15 mg/kg), TLR4 억제제(TAK242, 5 mg/kg) 및 MTX(2 mg/kg), 및 GKB101 항체(15 mg/kg) 투여군으로 나누어 진행하였다. 투여는 2차 면역화 수행일(21일)부터 3일에 1회(총 4회) 실시하였고, 투여경로는 복강투여로 진행하였다(도 47).
실시예 6.1. 관절염 임상 지수 평가
CIA 마우스 모델을 이용하여 GKB101 항체의 류마티스 관절염(RA)에 대한 개선 효과를 확인하기 위하여, 실시예 6(1차 실험)과 동일한 방법으로 마우스 실험을 수행하였다. 마우스에 실험 물질을 투여하기 시작한 후부터 네 발에서의 관절염 발생 및 중증도의 임상적 평가를 도 53에 나타낸 바와 같이 임상지표 기준에 따라 평가하였다.
그 결과, 도 43에 나타낸 바와 같이, Isotype IgG1 투여군에서 대조군(Vehicle)과 비슷한 수준의 염증활성도를 확인하였다(대조군 vs Isotype IgG1 투여군, 10.30±1.20 vs 11.25±2.21). GKB101 항체 투여군의 경우, 대조군 또는 Isotype IgG1 투여군에 비해 유의적으로 감소하였다(Isotype IgG1 투여군 vs GKB101 항체 투여군, 11.15±2.21 vs 6.95±2.09, p<0.001, 대조군 vs GKB101 항체 투여군, 10.30±1.20 vs 6.95±2.09, p<0.001). CAI의 AUC를 분석한 결과에서도 투여 기간 동안의 결과와 유사한 양상을 나타냈다. 대조군 및 Isotype IgG1 투여군은 유사한 수준의 염증 활성도를 나타내었으며 GKB101 항체 투여군에서 대조군 또는 Isotype IgG1 투여군에 비해 유의적으로 감소하였다(대조군 vs GKB101 항체 투여군, 98.7±6.5 vs 59.4±16.9, p<0.001; Isotype IgG1 투여군 vs GKB101 항체 투여군, 90.2±13.3 vs 59.4±16.9, p<0.001).
상기 결과 중, CAI가 2점 이상인 관절염이 발생한 발의 빈도(%)를 확인한 결과 CAI 증가와 유사한 패턴을 보였으며, Isotype IgG1 투여군의 경우, 관절염 발생빈도가 대조군과 비슷한 수준으로 진행된 것을 확인할 수 있었다. GKB101 항체 투여군에서는 대조군 또는 Isotype IgG1 투여군과 비교하였을 때 통계적으로 유의하게 감소한 것을 확인할 수 있었다(Isotype IgG1 투여군 vs GKB101 투여군, 67.50±16.87 vs 27.50±18.45, p<0.05, 대조군 vs GKB101 항체 투여군, 75.00±17.8 vs 27.50±18.45, p<0.01). 관절염 발생률(arthritis incidence)의 AUC 분석결과에서도 대조군 및 Isotype IgG1 투여군에 비하여 GKB101 항체 투여군에서 유의적으로 감소한 것을 확인하였다(대조군 vs GKB101 항체 투여군, 542.5±112.0 vs 208.8±182.8, p<0.01; Isotype IgG1 투여군 vs GKB101 항체 투여군, 423.8±148.9 vs 208.8±182.8, p<0.01)(도 54).
상기 결과를 통해, GKB101 항체 투여 시, 염증성 관절염 모델에서 치료 효과가 있음을 확인할 수 있었다.
실시예 6.2. 족부 관절 조직의 조직학적 분석
CIA 마우스 모델을 이용하여 GKB101 항체의 류마티스 관절염(RA)에 대한 개선 효과를 확인하기 위하여, 실시예 6(1차 실험, 도 42)의 실험 마우스의 족부 관절을 H&E 염색하여 관찰하였다. 총 4가지 항목(synovial hyperplasia, pannus formation, cartilage destruction 및 bone erosion)의 조직학적 평가 기준을 바탕으로 조직학적 스코어(histological score)를 측정하였다. 이때, H&E 염색은 실시예 3.6과 동일한 방법으로 수행하였다.
그 결과, 도 44에 나타낸 바와 같이, 대조군 및 Isotype IgG1 투여군에서는 활막세포의 과증식과 함께 판누스 조직의 증가로 연골파괴 및 뼈 미란이 관찰되었다. 반면, GKB101 항체 투여군에서는 대조군 또는 Isotype IgG1 투여군과 비교하여 활막세포의 증식량이 뚜렷하게 감소된 양상을 나타냈다. 또한, 연골 및 뼈의 파괴정도도 감소하였다. 각 파라미터(parameter)의 스코어링 결과를 살펴보면 GKB101 항체 투여군에서 Isotype IgG1 투여군 대비 hyperplasia가 60% 이상 감소하였음을 확인할 수 있었고, 연골파괴(cartilage destruction)는 78.5%, 섬유조직(판누스 형성, pannus formation) 및 골 파괴(bone erosion)은 90% 이상의 뚜렷한 억제 효과를 나타내었다.
실시예 6.3. GKB101 항체의 안정성 평가
CIA 마우스 모델을 이용하여 GKB101 항체의 안정성을 확인하기 위하여, 실시예 6(1차 실험, 도 42)의 실험 마우스의 체중을 측정하였다.
그 결과, 관절염을 유도하기 않은 정상군(normal)에 비하여 관절염 발생군에서 전반적으로 체중이 다소 감소한 경향을 보였다. 하지만, Isotype IgG1 투여군 및 GKB101 항체 투여군 간에는 유의적인 차이가 나타나지 않았다(도 45).
실시예 6.4. 혈청 및 족부 관절 내의 염증성 사이토카인 및 케모카인 농도 분석
CIA 마우스 모델을 이용하여 GKB101 항체의 류마티스 관절염(RA)에 대한 개선 효과를 확인하기 위하여, 실시예 6(1차 실험, 도 42)의 실험 마우스의 혈청 및 족부 관절을 수득하여 염증성 사이토카인 및 케모카인의 농도를 측정하였다.
구체적으로, 관절조직에서 피부조직을 제거한 뒤, 측정하고 단백질 용해 버퍼(protein lysis buffer)를 첨가하여 용해하였다. 상기 용해물을 13,000 rpm으로 원심분리하여 상층액만을 수득한 뒤, 정량하여 족부 관절 단백질로 사용하였다. 혈청 및 족부 관절 내 WARS1, 염증성 사이토카인 및 케모카인은 ELISA를 통해 측정하였다. 이때, WARS1은 실시예 5의 방법으로 측정하였다. mCXCL2/MIP-2, mIL-6, mMIP1α의 농도는 mouse CXCL2/MIP-2 ELISA(R&D systems), mouse IL-6 ELISA(BioLegend), mouse MIP1-α ELISA(R&D systems) 키트를 이용하여 측정하였고, 방법은 제조사의 방법 따라 진행하였다.
그 결과, 도 46에 나타낸 바와 같이, 대조군, Isotype IgG1 투여군 및 GKB101 항체 투여군의 혈청 내에서는 WARS1, 염증성 사이토카인 및 케모카인의 농도가 유사하게 관찰되었다. 족부 관절의 경우 대조군 및 Isotype IgG1 투여군에서 WARS1, mCXCL2/MIP-2(IL-8 homologue), IL-6 및 MIP1α의 농도가 증가된 반면, GKR101 항체 투여군에서는 유의적으로 감소하는 것을 관찰할 수 있었다. 상기 결과는 ANOVA 통계 프로그램을 사용하여 분석하였으며, #p<0.05, ##p<0.01, ###p<0.001이다.
실시예 6.5. 관절염 임상 지수 평가
CIA 마우스 모델을 이용하여 GKB101 항체의 류마티스 관절염(RA)에 대한 개선 효과를 확인하기 위하여, 실시예 6(2차 실험, 도 47)과 동일한 방법으로 마우스 실험을 수행하였다. 마우스에 실험 물질을 투여하기 시작한 후부터 네 발에서의 관절염 발생 및 중증도의 임상적 평가를 도 53에 나타낸 바와 같이 임상지표 기준에 따라 평가하였다.
그 결과, Isotype IgG1 투여군에서 대조군과 비슷한 수준의 염증 활성도를 확인하였다. GKB101 항체 투여군의 경우, 양성대조군인 TLR4i 또는 MTX 투여군과 유사한 수준으로 CAI가 감소하는 것을 확인할 수 있었다(도 48 및 도 49).
실시예 6.6. 족부 관절 내 침윤된 면역세포 분석
CIA 마우스 모델을 이용하여 GKB101 항체의 관절염 치료 효과를 확인하기 위하여, 실시예 6(2차 실험, 도 47)의 실험 마우스의 족부 관절을 수득하여 관절 내 침윤된 면역세포를 유세포 분석을 통해 확인하였다.
구체적으로, 유세포 측정을 위하여 마우스의 족부 관절을 자른 뒤 1 mg/㎖의 콜라겐 분해효소 용액(in 2% FBS+RPMI1640 배지)을 첨가하여 37℃ 진탕 배양기(180 rpm, 20 분)에서 반응시켰다.
반응 후에는 상층액만 회수하였다. 상기 과정을 4회 반복하여 족부 관절 내 세포를 수득하였다. 상기 방법으로 수득된 세포를 유세포 분석기에서 분석하여 백분율(%)로 분석한 후, 총 세포수를 적용하여 각 조직에서의 절대세포수(absolute number)를 산출하였다. 상기 수득된 세포에 APC-항-CD45 항체(Invitrogen, 47-0451-82), PE-cy5-항 CD11b 항체(Invitrogen, 15-0112-82), APC-항-F4/80 항체(Invitrogen, 17-4801-82), APC-항-CD4 항체(Invitrogen, 17-0042-82) 및 eFluorscence450-항 CD3e 항체(Invitrogen, 48-0031-82)를 각각 샘플 튜브에 처리하여 반응시킨 뒤, FACS 버퍼로 세척하였다. 이후 fix/perm buffer(Invitrogen, 00-5523-00)을 사용하여 샘플을 고정/투과시키고, 다시 해당 샘플튜브에 Alexa488-항-iNos 항체(Invitrogen, 53-5920-82), PE-Cy7-항-CD206 항체(Invitrogen, 25-2061-82), PE-Cy7-항-IL-17a 항체(Invitrogen, 25-7177-82) 및 FITC-항-IFNγ 항체(Invitrogen, 11-7311-82)를 각각 처리하여 반응시켰다. 반응이 끝난 뒤, FACS 버퍼로 세척하고 유세포 분석을 수행하여 백분율(%)로 분석하였다. 상기 분석 결과에 총 세포를 적용하여, Paw joint에서의 절대세포수(absolute number)를 산출하였다.
그 결과, 총 면역세포의 수 및 M1/M2 대식세포의 분극화는 Isotype IgG1 투여군에서 대조군과 비슷한 수준으로 확인되었으며, GKB101 항체 투여군의 경우 양성대조군인 TLR4i 또는 MTX 투여군과 유사한 수준으로 감소한 것을 확인할 수 있었다. 이때, Th1 및 Th2 세포는 항-TNF-α 항체 또는 MTX 투여군과 유사한 수준으로 감소하였다(도 50). 상기 결과는 모두 표준편차(SEM)으로 표기되었으며, ANOVA 통계 프로그램을 사용하여 분석하였다. #p<0.05, ##p<0.01, ###p<0.001, #: vs 대조군, *: vs IgG1 투여군, §: vs 항-TNF-α 항체 투여군
실시예 6.7. 족부 관절 내 염증성 사이토카인 및 케모카인의 농도 분석
CIA 마우스 모델을 이용하여 GKB101 항체의 류마티스 관절염(RA)에 대한 개선 효과를 확인하기 위하여, 실시예 6(실험 2, 도 47)의 실험 마우스의 족부 관절 내 염증성 사이토카인 및 케모카인의 농도를 ELISA를 이용하여 측정하였다. 이때, 족부 관절 내의 단백질 수득은 실시예 6.7과 동일한 방법으로 수행하였다.
염증성 사이토카인 및 케모카인의 농도는 mouse IL-17 DuoSet ELISA(R&D Systems) 및 mouse IL-17F DuoSet ELISA(R&D Systems) 키트를 사용하여 측정하였다. 또한, TNF-α, IL-6, CCL3/MIP-α 및 CXCL2/MIP-2α의 측정은 Milliplex MAP Mouse Cytokine/Chemokine Magnetic Bead Panel, Milliplex, MCYTOMAG-70K(Millipore)을 이용하여 측정하였다. 모든 측정은 제조사에서 제공하는 측정방법에 따라 진행하였다.
그 결과, GKB101 항체 투여군의 TNF-α, IL-6, IL-17F, CXCL2/MIP-2α 및 CCL3(MIP-1α)의 농도는 양성대조군인 MTX 또는 TLR4i 투여군과 유사한 수준으로 감소하였으며, 항-TNF-α 항체보다 더 유의적으로 염증성 사이토카인 및 케모카인의 농도가 감소하였다(도 51a 및 도 51b). 모든 데이터는 표준편차(SEM)으로 표기되었고 ANOVA 통계 프로그램을 사용하여 분석하였다. #p<0.05, ##p<0.01, ###p<0.001, #: vs 대조군, *: vs IgG1 투여군
실시예 6.8. 족부 관절 내 연골파쇄인자 및 파골세포 분화인자의 농도 분석
CIA 마우스 모델을 이용하여 GKB101 항체의 류마티스 관절염(RA)에 대한 개선 효과를 확인하기 위하여, 실시예 6(실험 2, 도 47)의 실험 마우스의 족부 관절 내 연골파쇄인자 및 파골세포 분화인자의 농도를 ELISA를 이용하여 측정하였다. 이때, 족부 관절 내의 단백질 수득은 IgG1과 동일한 방법으로 수행하였다.
연골파쇄인자 및 파골세포 분화인자의 농도는 mouse total MMP-3 DuoSet ELISA(R&D Systems) 및 mouse TRANCE/RANKL/TNFSF11 DuoSet ELISA(R&D Systems) 키트를 이용하여 측정하였다. 모든 측정은 제조사에서 제공하는 측정방법에 따라 진행하였다.
그 결과, 연골파쇄인자인 MMP3 및 파골세포 분화인자인 RANKL의 농도는 Isotype IgG1 투여군에서 대조군과 비슷한 수준으로 확인되었고, 양성대조군인 MTX 또는 항-TNF-α 항체 투여군의 경우 MMP3의 농도는 감소시켰지만 RANKL의 농도는 감소시키지 못하였다. 반면, GKB101 항체 또는 TLR4i 투여군의 경우, MMP3 및 RANKL의 농도를 모두 유의적으로 감소시켰다(도 52). 모든 데이터는 표준편차(SEM)으로 표기되었고 ANOVA 통계 프로그램을 사용하여 분석하였다. #p<0.05, ##p<0.01, ###p<0.001, #: vs 대조군, *: vs IgG1 투여군, §: vs 항-TNF-α 항체 투여군
V. GKB101 항체의 피부염 개선 효과 검증
실시예 7. 아토피에 대한 WARS1의 임상적 상관성 유의성 확인
아토피 질환 및 WARS1의 상관관계를 확인하기 위하여, 아토피 환자의 혈중 WARS1의 농도, 사이토카인 및 TARC(thymus and activation-regulated chemokine)의 농도를 측정하여 이들의 상관성을 분석하였다.
평가는 아토피 환자군 14명, 정상군 54명을 대상으로 대상군의 혈액 내 WARS1 및 염증성 사이토카인(IL-6, IL-8, TNF-α, IFN-γ, MIP-1α)의 농도를 측정하였다. 이때, WARS1은 실시예 5와 동일한 방법으로 측정하였다.
그 결과, 도 55a 및 도 55b에 나타낸 바와 같이 정상군(HC)에 비하여 아토피 환자(AD)의 혈액 내 WARS1 농도가 유의적으로 증가하였다. 또한, IL-6, IL-8, TNF-α, IFN-γ 및 MIP-1α의 농도도 유의적으로 증가하였다.
상기 결과를 바탕으로, WARS1 및 사이토카인의 상관관계를 분석한 결과, 혈중 WARS1의 농도 및 사이토카인의 농도는 양의 상관관계(positive correlation)을 나타내었다.
다음으로, 혈중 WARS1 및 TARC 농도를 측정하고 이의 상관관계를 분석하였다. 이때 평가는 아토피 환자군 30명 및 정상군 30명을 대상으로 실시하였다.
그 결과, TARC의 혈중 농도는 정상군에 비하여 아토피 환자군에서 증가하였으며, WARS1의 혈중 농도와도 양의 상관관계(r=0.4411, p=0.0147)를 나타내었다(도 56).
먼저, 피부 세포주에 염증 반응을 유도하기 위하여 감염원으로 Staphylococcus aureus를 사용하였다. 상기 Staphylococcus aureus는 사용 3일 전에 BHI 아가 플레이트에서 배양하고, 1차 및 2차 배양하여 준비하였다. 인간 피부 세포주로는 각질세포(keratinocyte) 및 진피 섬유아세포(dermal fibroblast)를 사용하였다. 상기 세포주를 각각 48웰 플레이트에 1×105 세포/웰의 농도로 접종하여 10% FBS가 포함된 배지에서 페니실린-스트렙토마이신 없이 24시간 배양하였다. 감염 당일 상기 세포의 배지를 DMEM 배지로 교체하면서, 0, 0.1, 1 또는 10 moi(multiplicity of infection)의 Staphylococcus aureus로 감염시켰다. 또한, 동시에 각 웰에 GKB101 항체를 0 ㎍, 2.5 ㎍ 또는 5 ㎍의 농도로 처리하였다. 24시간 뒤, 세포 배양액 내의 WARS1 및 CXCL-8/IL-8의 농도를 ELISA 방법으로 측정하였다. WARS1의 농도는 실시예 5와 동일한 방법으로 측정하였고, CXCL-8/IL-8는 CXCL2/MIP-2 ELISA 키트(R&D)를 이용하여 측정하였다. 상기에 따른 측정 결과 모두 ANOVA 통계 프로그램을 사용하여 분석하였다. ***p<0.001, **p<0.01, ***p<0.001.
그 결과, 두 종류의 인간 피부 세포주에서 모두 staphylococcus aureus의 감염에 의해 증가되었던 배양액 내의 WARS1 및 CXCL8/IL-8 농도가 GKB101 항체 처리에 의해 농도 의존적으로 감소하였다(도 57 및 도 58).
실시예 8. 아토피 마우스 모델에서 GKB101 항체의 아토피 개선 효과 검증
GKB101 항체의 피부염 개선 효과를 확인하기 위하여, 아토피 마우스 모델에서 GKB101의 항염 활성을 평가하였다.
마우스는 6~10주령의 수컷 NC/Nga 마우스를 사용하였고, 온도 21~23℃, 상대습도 40~45%로 항온 항습이 유지되는 SPF 실험동물실에서 사육되었다. 또한, 케이지 별 실험동물 개체수는 3마리 이하로 수용하며 주 1회 케이지 교환 및 사료를 공급하였다.
먼저, 아토피 마우스 모델을 제작하기 위하여, 실험 시작 1일 전 NC/Nga 마우스의 등쪽 윗쪽 부분까지 최대한 제모기로 제모하고, 도포할 부위에 4％ SDS 수용액을 분무하여 피부의 지방 성분을 제거하였다. 약 1시간 동안 완전히 건조시킨 후 편편한 스틱을 이용하여 Biostir AD(아토피 피부염 유발 시약, 집먼지진드기) 연고 100 mg을 등쪽에 균일하게 도포하였다. Biostir AD 연고 도포는 주 2회로 6주간 총 13회 실시하였고, Stapylococcus aureus는 21일째부터 마리 당 4×107 CFU/100 ㎕씩 총 7회 등쪽에 도포하였다. GKB101 항체(5 mg/kg) 또는 Isotype IgG1(5 mg/kg)는 1주에 2회로 총 11회 복강투여 하였다(도 59).
실시예 8.1. 등조직의 염증 정도 및 두께 비교
아토피 마우스 모델에서 GKB101 항체의 피부염 개선 효과를 확인하기 위하여, 실시예 8의 실험 마우스 등조직의 염증정도 및 피부의 두께를 관찰하였다. 이때, 등조직의 피부 두께는 염증이 유발된 부위를 칼리퍼(caliper)로 총 3회 측정하여 평균값으로 제시하였다.
아토피 유발 39일 후 피부염이 유발된 부위를 관찰한 결과 Isotype IgG1 투여에 비하여 GKB101 항체 투여군에서 염증 유발 진행 정도가 감소한 경향을 보였다. 또한, 아토피 유발 35일째 등피부 두께 측정의 결과의 경우 정상군(naive)에 비해 Isotype IgG1 투여군에서 2배 이상 두께가 증가하였다(p<0.001). GKB101 항체 투여군에서는 정상군(naive)에 비하여 등조직의 두께가 유의적으로 증가하였지만(p<0.001), Isotype IgG1 투여군에 비하여 표피의 두께가 유의적으로 감소하였음을 확인할 수 있었다(p<0.05)(도 60).
실시예 8.2. 등조직의 병리학적 분석
아토피 마우스 모델에서 GKB101 항체의 피부염 개선 효과를 확인하기 위하여, 실시예 8의 실험 마우스 등조직을 H&E로 염색하고 조직의 병리학적 형태를 관찰하였다.
구체적으로, 적출한 등조직에서 피부조직을 소량 취하여 4% 파라포름알데하이드에 24시간 동안 고정 후, 6시간 동안 흐르는 물에서 수세하고 에탄올(ethanol)에서 자일렌(xylene)에 이르는 탈수 과정을 진행하여 조직 슬라이드을 제작하였다. 상기 과정을 통해 제작된 파라핀 블록을 microtome을 이용하여 10 um의 두께로 박절하였다. 조직 슬라이드는 일반적인 조직처리 과정을 거쳐 H&E로 염색한 후 광학현미경으로 조직의 변화를 관찰하였다. H&E 염색은 실시예 3.6과 동일한 방법으로 수행하였다.
그 결과, 아토피 염증 유발 후 39일째에 표피 두께를 비교한 결과, 정상군(naive)에 비해 Isotype IgG1 투여군(대조군)에서 유의하게 두꺼워져 있는 것을 확인하였다(p<0.01). 특히 아토피 유발 후 GKB101 항체 투여군의 등조직 두께는 정상군에 비하여 유의하게 증가하였으나(p<0.01), Isotype IgG1 투여군(대조군)에 비해서는 유의하게 감소하였다(p<0.001). 또한, 등조직 내의 림프구 및 단핵구의 침윤을 관찰한 결과, 대조군과 비교하여 GKB101 항체 투여군에서는 침윤된 면역세포가 감소하는 것을 확인할 수 있었다(p<0.01)(도 61a 및 도 61b).
실시예 8.3. 등조직 및 혈중 WARS1 및 염증성 사이토카인 발현 분석
아토피 마우스 모델에서 GKB101 항체의 피부염 개선 효과를 확인하기 위하여, 실시예 8의 실험 마우스 등조직 및 혈액을 채취하여 WARS1 및 염증성 사이토카인의 농도를 측정하였다.
등조직 내의 단백질 발현은 먼저 등조직의 피부조직 단백질을 추출한 뒤, 피부 내 상기 단백질 발현을 측정하였다. WARS1의 농도는 실시예 5의 방법과 동일한 방법으로 측정하였고, IgE 및 CXCL2/MIP-2(IL-8 homologue)는 각각 mouse IgE ELISA 키트(BioLegend) 및 mCXCL2/MIP-2 ELISA 키트(R&D systems)를 이용하여 측정하였다.
그 결과, 등조직 내의 WARS1의 발현은 Isotype IgG1 투여군과 정상군(naive)에서는 차이를 보이지 않았고, GKB101 항체 투여군에서는 유의적으로 감소하였다(p<0.01). 염증성 사이토카인인 CXCL-8/IL-8, IL-6 및 IL-17은 정상군에 비하여 Isotype IgG1 투여군에서 유의적으로 증가(p<0.01)하였고, GKB101 항체 투여군에서는 감소하는 경향을 나타냈다. 혈청 내 WARS1의 발현은 정상군(naive)에 비하여 Isotype IgG1 투여군에서 증가한 것이 관찰되었고, GKB101 항체 투여군에서 유의적으로 감소하는 것을 확인할 수 있었다(p<0.01)(도 62).
비만세포의 매개하여 심각한 면역반응과 과민반응을 일으키는 혈청 내 IgE 항체 농도를 측정한 결과, Isotype IgG1 투여군에서 정상군(naive)보다 유의적으로 IgE의 농도가 증가하였고(p<0.001). GKB101 항체 투여군도 Isotype IgG1 투여군과 유사한 수준의 IgE 농도를 나타내었다(도 63).

Claims (8)

  1. 서열번호 3의 아미노산 서열을 포함하는 H-CDR1, 서열번호 5의 아미노산 서열을 포함하는 H-CDR2 및 서열변호 7의 아미노산 서열을 포함하는 H-CDR3을 포함하는 중쇄 가변영역; 및
    서열번호 12의 아미노산 서열을 포함하는 L-CDR1, 서열번호 14 및 서열번호 16의 아미노산 서열을 포함하는 L-CDR3을 포함하는 경쇄 가변영역;
    으로 이루어진 항-WARS1 항체 또는 이의 단편을 유효성분으로 포함하는 질환의 예방 또는 치료용 약학 조성물.
  2. 제1항에 있어서,
    상기 항체 또는 이의 단편의 중쇄 가변영역은 서열번호 9의 아미노산 서열을 포함하고, 경쇄 가변영역은 서열번호 18의 아미노산 서열을 포함하는 것인, 질환의 예방 또는 치료용 약학 조성물.
  3. 제1항에 있어서,
    상기 항체 또는 이의 단편의 중쇄 영역은 서열번호 22의 아미노산 서열을 포함하고, 경쇄 영역은 서열번호 23의 아미노산 서열을 포함하는 것인, 질환의 예방 또는 치료용 약학 조성물.
  4. 제1항에 있어서,
    상기 질환은 만성폐쇄성폐질환, 염증성 장질환, 류마티스 관절염 및 피부염으로 이루어진 군에서 선택되는 어느 하나인 것인, 질환의 예방 또는 치료용 약학 조성물.
  5. 서열번호 3의 아미노산 서열을 포함하는 H-CDR1, 서열번호 5의 아미노산 서열을 포함하는 H-CDR2 및 서열변호 7의 아미노산 서열을 포함하는 H-CDR3을 포함하는 중쇄 가변영역; 및
    서열번호 12의 아미노산 서열을 포함하는 L-CDR1, 서열번호 14 및 서열번호 16의 아미노산 서열을 포함하는 L-CDR3을 포함하는 경쇄 가변영역;
    으로 이루어진 항-WARS1 항체 또는 이의 단편의 질환의 예방 또는 치료 용도.
  6. 제5항에 있어서,
    상기 질환은 만성폐쇄성폐질환, 염증성 장질환, 류마티스 관절염 및 피부염으로 이루어진 군에서 선택되는 어느 하나인 것인, 질환의 예방 또는 치료 용도.
  7. 서열번호 3의 아미노산 서열을 포함하는 H-CDR1, 서열번호 5의 아미노산 서열을 포함하는 H-CDR2 및 서열변호 7의 아미노산 서열을 포함하는 H-CDR3을 포함하는 중쇄 가변영역; 및
    서열번호 12의 아미노산 서열을 포함하는 L-CDR1, 서열번호 14 및 서열번호 16의 아미노산 서열을 포함하는 L-CDR3을 포함하는 경쇄 가변영역;
    으로 이루어진 항-WARS1 항체 또는 이의 단편을 개체에 투여하는 단계를 포함하는 질환의 예방 또는 치료 방법.
  8. 제7항에 있어서,
    상기 질환은 만성폐쇄성폐질환, 염증성 장질환, 류마티스 관절염 및 피부염으로 이루어진 군에서 선택되는 어느 하나인 것인, 질환의 예방 또는 치료 방법.
PCT/KR2023/005824 2022-04-27 2023-04-27 항―wars1 항체를 포함하는 염증성 질환의 예방 또는 치료용 약학 조성물 WO2023211228A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2022-0052430 2022-04-27
KR20220052430 2022-04-27

Publications (1)

Publication Number Publication Date
WO2023211228A1 true WO2023211228A1 (ko) 2023-11-02

Family

ID=88519265

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/005824 WO2023211228A1 (ko) 2022-04-27 2023-04-27 항―wars1 항체를 포함하는 염증성 질환의 예방 또는 치료용 약학 조성물

Country Status (2)

Country Link
KR (1) KR20230153308A (ko)
WO (1) WO2023211228A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20150077891A (ko) * 2013-12-30 2015-07-08 재단법인 의약바이오컨버젼스연구단 항 wrs 모노클로날 항체 및 이의 용도
KR101729547B1 (ko) * 2016-07-05 2017-04-25 충남대학교 산학협력단 트립토파닐-tRNA 합성효소 단백질을 함유하는 조성물의 백신 보조제로서의 활용
KR101886415B1 (ko) * 2017-09-15 2018-08-08 충남대학교산학협력단 트립토파닐-tRNA 합성효소 유전자를 포함하는 재조합 벡터 및 이의 용도
KR20210010236A (ko) * 2019-07-19 2021-01-27 재단법인 의약바이오컨버젼스연구단 트립토파닐-티알엔에이 합성효소 단백질에 특이적으로 결합하는 항체 및 이의 용도
KR20210010411A (ko) * 2019-07-18 2021-01-27 제이더블유바이오사이언스 주식회사 Wrs 단백질에 특이적으로 결합하는 항체 및 이의 용도

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20150077891A (ko) * 2013-12-30 2015-07-08 재단법인 의약바이오컨버젼스연구단 항 wrs 모노클로날 항체 및 이의 용도
KR101729547B1 (ko) * 2016-07-05 2017-04-25 충남대학교 산학협력단 트립토파닐-tRNA 합성효소 단백질을 함유하는 조성물의 백신 보조제로서의 활용
KR101886415B1 (ko) * 2017-09-15 2018-08-08 충남대학교산학협력단 트립토파닐-tRNA 합성효소 유전자를 포함하는 재조합 벡터 및 이의 용도
KR20210010411A (ko) * 2019-07-18 2021-01-27 제이더블유바이오사이언스 주식회사 Wrs 단백질에 특이적으로 결합하는 항체 및 이의 용도
KR20210010236A (ko) * 2019-07-19 2021-01-27 재단법인 의약바이오컨버젼스연구단 트립토파닐-티알엔에이 합성효소 단백질에 특이적으로 결합하는 항체 및 이의 용도

Also Published As

Publication number Publication date
KR20230153308A (ko) 2023-11-06

Similar Documents

Publication Publication Date Title
WO2018034522A1 (ko) 코어와 그의 표면에 결합된 시알산, 시알릴락토스 또는 이들의 유도체를 포함하는 결합체 및 그의 용도
WO2018124642A2 (ko) 치수줄기세포의 상아 모전구세포로의 분화용 조성물 및 상아모전구세포 표면에 특이적으로 결합하는 IgG 또는 IgM 타입 단일 클론 항체
WO2011043538A2 (ko) 실내 공기유래 세포밖 소포체를 포함하는 조성물 및 이의 용도
WO2017022962A1 (ko) Ripk 억제제를 유효성분으로 포함하는 면역질환의 예방 또는 치료용 조성물
WO2015160219A1 (ko) 피스타시아 웨인마니폴리아 추출물, 이의 분획물 또는 이로부터 분리된 화합물을 포함하는 만성폐쇄성 폐질환(copd) 예방 또는 치료용 약학적 조성물
WO2013129739A1 (ko) 봉독-ｐｌａ2를 포함하는 이상 조절 ｔ 세포 활성 저하 관련 질환의 치료 또는 예방용 약학적 조성물
WO2023211228A1 (ko) 항―wars1 항체를 포함하는 염증성 질환의 예방 또는 치료용 약학 조성물
WO2019045477A1 (ko) 비멘틴 유래 펩타이드에 특이적으로 결합하는 물질을 포함하는 피부질환 예방 및 치료용 조성물
WO2021182874A1 (ko) 안정성이 증진된 액상 약제학적 조성물
WO2019231211A1 (ko) 세신, 길경 및 계지 중 2종 이상의 혼합 추출물을 유효성분으로 포함하는 알레르기성 질환의 예방 또는 치료용 조성물
WO2022055334A1 (ko) 폐 섬유화 질환의 예방 또는 치료용 조성물
WO2018199628A1 (ko) 약독화된 폐렴구균 균주를 포함하는 약제학적 조성물 및 이의 용도
WO2023211229A1 (ko) 항―wars1 항체 및 이의 용도
WO2020263011A1 (ko) 미세아교세포 마커로서의 후각수용체 및 그의 용도
WO2021150076A1 (ko) 만성폐쇄성 폐질환의 예방 또는 치료용 약학적 조성물 또는 건강기능식품
WO2011115458A2 (ko) 자가 면역 질환 예방 및 치료용 ＴＮＦ－α와 ＩＬ－２１ 이중 길항제
EP3921341A1 (en) Streptococcus pneumoniae antiserum without cross-reactivity and method for producing the same
AU2018372397B2 (en) Compositions for preventing or treating lupus
WO2022216027A1 (ko) 산화된 면역글로불린을 유효성분으로 포함하는 면역조절 기능 이상 관련 질환 예방 또는 치료용 약학적 조성물
WO2021194281A1 (ko) 아커만시아 뮤시니필라 유래의 tars 또는 이의 단편 및 이의 용도
WO2023214778A1 (ko) 항-cd300c 항체 또는 이의 항원 결합 단편 및 그의 퇴행성 뇌 질환 예방 또는 치료용 용도
WO2020130711A1 (ko) 신규사이토카인 및 이의 용도
WO2021235685A1 (ko) 암 예방 또는 치료용 약학적 조성물
WO2023128550A1 (ko) Asm에 특이적으로 결합하는 항체 및 이의 용도
WO2023132698A1 (ko) 글루카곤-유사 펩타이드-1 및 인터루킨-1 수용체 길항제를 포함하는 퇴행성 뇌질환 예방 또는 치료용 약학 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23796870

Country of ref document: EP

Kind code of ref document: A1