WO2023211229A1 - 항―wars1 항체 및 이의 용도 - Google Patents

항―wars1 항체 및 이의 용도 Download PDF

Info

Publication number
WO2023211229A1
WO2023211229A1 PCT/KR2023/005828 KR2023005828W WO2023211229A1 WO 2023211229 A1 WO2023211229 A1 WO 2023211229A1 KR 2023005828 W KR2023005828 W KR 2023005828W WO 2023211229 A1 WO2023211229 A1 WO 2023211229A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
wars1
fragment
amino acid
Prior art date
Application number
PCT/KR2023/005828
Other languages
English (en)
French (fr)
Inventor
진미림
강병철
최윤희
장진아
윤희경
조이슬
서리라
투이 트램 응우옌투이
Original Assignee
주식회사 미림진
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 미림진 filed Critical 주식회사 미림진
Publication of WO2023211229A1 publication Critical patent/WO2023211229A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present invention relates to antibodies that specifically bind to WARS1 protein and uses thereof.
  • Aminoacyl-tRNA synthetase is an enzyme that mediates the reaction of specifically binding amino acids to tRNA, and plays a central role in protein production. Recently, the ARS is known to be involved in various life phenomena such as apoptosis, angiogenesis, and inflammatory response in addition to protein production.
  • human tryptophanyl-tRNA synthetase 1 WARS1 is an aminoacyl-tRNA synthetase that links tryptophan with the tRNA that recognizes tryptophan, and has recently been used as a host defense mechanism against infection.
  • WARS1 functions as an endogenous ligand for TLR4 and TLR2, activating macrophages and inducing activation of innate immunity. Additionally, WARS1 initiates the production of proinflammatory cytokines and chemokines, including TNF- ⁇ , IL-6, MIP-1 ⁇ , and IL-8, and triggers infiltration of neutrophils. Afterwards, expression of the WARS1 gene is induced by IFN- ⁇ to maintain continuous secretion of WARS1. Consistent with these findings, WARS1 was observed at high levels in the blood of sepsis patients.
  • ARSs including WARS1
  • WARS1 have many similarities in protein structure, so antibodies obtained through immune reactions often show cross-reactivity with other ARSs and do not produce highly sensitive antibodies.
  • the present inventors attempted to discover antibodies or fragments thereof that specifically bind to WARS1, the expression level of which is significantly increased in patients with infectious diseases such as sepsis.
  • the present invention was completed by producing a novel anti-WARS1 antibody that specifically binds to WARS1 and inhibits the inflammatory response in immune cells, and confirming its pharmacological activity.
  • one aspect of the present invention is H-CDR1 comprising the amino acid sequence of SEQ ID NO: 3, H-CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and H-CDR2 comprising the amino acid sequence of SEQ ID NO: 7. Heavy chain variable region including CDR3; And L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, L-CDR2 comprising the amino acid sequence represented by SEQ ID NO: 95, and L-CDR3 comprising the amino acid sequence represented by SEQ ID NO: 96 below. It provides an anti-WARS1 antibody or fragment thereof comprising a light chain variable region:
  • Xaa1 is Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly or Pro,
  • Xaa2 is Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly or Pro;
  • Xaa1 is Ser, then Xaa2 is not His;
  • Xaa3 is Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly or Pro.
  • Another aspect of the present invention provides a polynucleotide encoding the antibody or fragment thereof, an expression vector containing the polynucleotide, and a transformed cell into which the expression vector has been introduced.
  • Another aspect of the present invention provides a method for producing an antibody or fragment thereof, comprising culturing the transformed cell and obtaining the antibody or fragment thereof.
  • Another aspect of the present invention provides a pharmaceutical composition for preventing or treating inflammatory diseases comprising the antibody or fragment thereof as an active ingredient.
  • Another aspect of the present invention provides the use of the antibody or fragment thereof for preventing or treating inflammatory diseases.
  • Another aspect of the present invention provides a method for preventing or treating inflammatory diseases, comprising administering the antibody or fragment thereof to a subject.
  • the anti-WARS1 antibody according to the present invention specifically bound to WARS1 and inhibited the secretion of TNF- ⁇ induced by WARS1 in immune cells. Additionally, when the anti-WARS1 antibody of the present invention was administered to a severe sepsis mouse model, chronic obstructive pulmonary disease mouse model, inflammatory bowel disease mouse model, rheumatoid arthritis mouse model, atopic dermatitis mouse model, and macrophage activation syndrome model, the results showed that the All mouse models showed disease improvement effects. Therefore, the anti-WARS1 antibody according to the present invention can be effectively used for the treatment of inflammatory diseases.
  • Figure 1 is a schematic diagram of a vector for expressing the heavy chain of an anti-WARS1 antibody.
  • Figure 2 is a schematic diagram of a vector for expressing the light chain of an anti-WARS1 antibody.
  • Figures 3a and 3b are diagrams showing the results of confirming anti-WARS1 antibodies by SDS-PAGE.
  • Figures 4a and 4b are graphs showing the results of confirming the binding affinity of anti-WARS1 antibody and WARS1 (derived from human, marmoset (NHP), mouse, rat or pig) through direct ELISA.
  • WARS1 derived from human, marmoset (NHP), mouse, rat or pig
  • Figure 5 is a graph showing the binding affinity between anti-WARS1 antibody and WARS1 (derived from human, marmoset (NHP), mouse, rat, or pig) using direct ELISA measurement, showing the results in Kd (dissociation constant).
  • Figures 6a to 6c are graphs showing the results of confirming the binding affinity of anti-WARS1 antibody and WARS1 (derived from human, marmoset (NHP), mouse, rat, or pig) through sandwich ELISA measurement.
  • WARS1 derived from human, marmoset (NHP), mouse, rat, or pig
  • Figure 7 is a diagram showing the results of confirming the binding specificity of the anti-WARS1 antibody to recombinant WARS1 protein and secreted WARS1 through Western blot.
  • hu human, Mar: marmoset (NHP), P: pig, R: rat, M: mouse
  • Figure 8 shows the results of epitope mapping using peptide production and antibody binding specificity of the human WARS1 sequence.
  • Figures 9A to 9C are diagrams showing the production and results of alanine (Ala) mutants of human WARS1 recombinant protein for epitope mapping.
  • Figure 10 is a graph showing the results of measuring the concentration of TNF- ⁇ in the medium after treating a mouse macrophage cell line (J774.1A) with recombinant WARS1 protein and IgG or anti-WARS1 antibody.
  • Figure 11 is a diagram showing an experimental schedule for confirming the anti-inflammatory effect of anti-WARS1 antibody using a sepsis mouse model.
  • Figure 12 is a graph showing the results of confirming the survival rate of mice after administering IgG1 or anti-WARS1 antibody to a severe sepsis mouse model.
  • Figure 13 is a diagram showing the base sequence of the pOptiVec Topo vector.
  • Figure 14 is a graph showing the results of confirming the anti-inflammatory activity of anti-WARS1 antibodies (GKB101, H54K) in human lung fibroblasts (HLF). *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001 vs PBS
  • Figure 15 is a diagram showing an experimental schedule for verifying the efficacy of anti-WARS1 antibody (H54K) in suppressing respiratory damage using a COPD mouse model.
  • Figures 16a and 16b show After administering Normal, Isotype IgG1 or anti-WARS1 antibody (H54K) to a COPD mouse model, infiltrated immune cells in the lung tissue, collagen deposition, and mucus secretion in the airways were examined by H&E staining, Massone Trichrome staining, and Periodic acid-Schiff staining, respectively. -This is a diagram showing the results confirmed through Alcian Blue (PAS-AB) staining.
  • PES-AB Alcian Blue
  • Figures 17a and 17b show the expression of inflammatory cytokines and chemokines in alveolar lavage fluid (17a) and lung tissue (17b) after administration of PBS (CON), Isotype IgG1, or anti-WARS1 antibody (H54K) to a COPD mouse model. This is a graph showing the confirmed results. *p ⁇ 0.05, **p ⁇ 0.001
  • Figure 17c is a graph showing the results of confirming the expression of cough-inducing genes in lung tissue through q-PCR after administering PBS (CON), Isotype IgG1, or anti-WARS1 antibody (H54K) to a COPD mouse model.
  • Figures 18a and 18b show the results of analyzing immune cells in lung tissue (18b) and alveolar lavage fluid (18a) after administering PBS (CON), Isotype IgG1, or anti-WARS1 antibody (H54K) to a COPD mouse model. It's a graph.
  • Figure 19 is a graph showing the results of analyzing immune cells in mediastinal lymph nodes through flow cytometry after administering PBS (CON), Isotype IgG1, or anti-WARS1 antibody (H54K) to a COPD mouse model.
  • Figure 20 is a graph showing the results of analyzing immune cells in the blood through flow cytometry after administering PBS (CON), Isotype IgG1, or anti-WARS1 antibody (H54K) to a COPD mouse model.
  • Figure 21 is a diagram showing an experiment schedule to confirm the effect of anti-WARS1 antibody on improving inflammatory bowel disease using a DSS (dextran sulfate sodium-induced colitis) mouse model.
  • Figure 22a is a diagram showing the criteria for determining a clinical index for assigning a clinical activity index (DAI) to evaluate the effect of anti-WARS1 antibody (GKB101, H54K) on improving inflammatory bowel disease using a DSS mouse model.
  • DAI clinical activity index
  • Figure 22b is a graph showing the results of evaluating the clinical activity index of each administration group after administration of saline, Isotype IgG1 (IgG1), or anti-WARS1 antibody (GKB101, H54K) in a DSS mouse model. At this time, control is the untreated group.
  • IgG1 Isotype IgG1
  • anti-WARS1 antibody GKB101, H54K
  • Figure 23 is a graph showing the results of evaluating the intestinal bleeding score of each administration group after administration of saline, Isotype IgG1 (IgG1), or anti-WARS1 antibody (GKB101, H54K) in a DSS mouse model. At this time, control is the untreated group.
  • IgG1 Isotype IgG1
  • anti-WARS1 antibody GKB101, H54K
  • Figure 24 is a graph showing the results of evaluating the stool consistency score of each administration group after administration of saline, Isotype IgG1 (IgG1), or anti-WARS1 antibody (GKB101, H54K) in a DSS mouse model. . At this time, control is the untreated group.
  • IgG1 Isotype IgG1
  • anti-WARS1 antibody GKB101, H54K
  • Figure 25 is a graph showing the results of measuring the intestinal length of each administration group after administration of saline, Isotype IgG1 (IgG1), or anti-WARS1 antibody (GKB101, H54K) in a DSS mouse model. At this time, control is the untreated group.
  • IgG1 Isotype IgG1
  • anti-WARS1 antibody GKB101, H54K
  • Figure 26 is a graph showing the results of measuring the spleen weight of each administration group after administration of saline, Isotype IgG1 (IgG), or anti-WARS1 antibody (GKB101, H54K) in a DSS mouse model. At this time, control is the untreated group.
  • IgG Isotype IgG1
  • GKB101, H54K anti-WARS1 antibody
  • Figure 27 is a graph showing the results of measuring immune factors in each region of intestinal tissue after administration of saline, Isotype IgG1 (IgG), or anti-WARS1 antibody (GKB101, H54K) in a DSS mouse model. *p ⁇ 0.05, ***p ⁇ 0.001, ****p ⁇ 0.0001 vs saline administration group
  • Figure 28 shows the results of confirming the gene expression of immune factors in each part of the intestinal tissue through qPCR after administration of saline, Isotype IgG1 (IgG), or anti-WARS1 antibodies (GKB101, H54K) in the DSS mouse model. It's a graph. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001 vs saline administration group
  • Figure 29 is a diagram showing the results of confirming the degree of crypt damage in colon tissue of each administration group through H&E staining after administration of saline, isotype IgG1 (IgG), or anti-WARS1 antibody (GKB101, H54K) in a DSS mouse model. am.
  • Figure 30 is a graph showing the results of confirming the anti-inflammatory activity of anti-WARS1 antibody (H54K) in osteoclasts differentiated from J774A.1 cells, human fiblroblast like synoviocytes (FLS), and RAW264.7 cells. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001
  • Figure 31 is a diagram showing an experimental schedule for verifying the effect of anti-WARS1 antibody on improving rheumatoid arthritis in a CIA (collagen-induced arthritis) mouse model.
  • Figure 32a is a diagram showing the clinical index standards for evaluating the clinical arthritis index by observing the feet of each administration group after administering Isotype IgG1 or anti-WARS1 antibody (GKB101, H54K) to a CIA mouse model.
  • Figure 32b is a graph showing the clinical arthritis index and clinical arthritis index analysis results and AUC for the clinical arthritis index and clinical arthritis index analysis results by observing the feet of each administration group after administering Isotype IgG1 or anti-WARS1 antibody (GKB101, H54K) to a CIA mouse model. *p ⁇ 0.05, **p ⁇ 0.01, vs H54K antibody administration group
  • Figures 33a to 33d are graphs showing the results of confirming the expression of inflammatory factors in serum and foot joints of each administration group after administering Isotype IgG1 or anti-WARS1 antibody (GKB101, H54K) to a CIA mouse model. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001, ****p ⁇ 0.0001 vs anti-WARS1 antibody administration group
  • Figures 34a to 34c show the anti-inflammatory activity and cell migration of anti-WARS1 antibody (GKB101, H54K) in adult human dermal fibroblasts (HDFa) or human keratinocytes treated with Staphylococcus aureus. and graphs and drawings showing the results of confirming the proliferation inhibition effect. *p ⁇ 0.05, ***p ⁇ 0.001, ****p ⁇ 0.0001 vs PBS
  • Figure 35 is a diagram showing an experiment schedule to confirm the atopic dermatitis improvement effect of anti-WARS1 antibody in an atopic mouse model.
  • Figure 36 is a diagram showing the results of evaluating clinical indices of each administration group after administering Isotype IgG1, dexamethasone, or anti-WARS1 antibody (GKB101, H54K) to an atopic mouse model.
  • Figure 37 is a graph showing the results confirming the improvement of tight junction by anti-WARS1 antibody (GKB101, H54K) in human colon cancer cell line (Caco-2). *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001 vs PBS
  • Figure 38 is a diagram showing an experimental schedule to confirm the anti-inflammatory effect in tissues of anti-WARS1 antibodies (GKB101, H54K) in a macrophage activation syndrome model using CpG.
  • Figure 39 is a diagram showing the results of evaluating Ferritin, one of the clinical indicators, after administration of anti-WARS1 antibody (GKB101, H54K) in a macrophage activation syndrome model using CpG.
  • Figures 40a and 40b are graphs showing the results of measuring the expression of WARS1 and inflammatory cytokines in liver tissue of mice after administration of anti-WARS1 antibodies (GKB101, H54K) in a macrophage activation syndrome model using CpG. .
  • Figures 41a and 41b are graphs showing the results of analyzing the distribution and infiltration of immune cells in the spleen and liver tissues of mice after administration of anti-WARS1 antibodies (GKB101, H54K) in the macrophage activation syndrome model using CpG. am.
  • the present invention provides an antibody or fragment thereof that specifically binds to WARS1.
  • the antibody or fragment thereof that specifically binds to WARS1 may be an antibody or fragment thereof that specifically binds to R20, R24, K27, I36, I43, and K47.
  • the WARS1 may be human WARS1 containing the amino acid sequence of SEQ ID NO: 94.
  • the term “antibody” refers to an immunoglobulin molecule that reacts immunologically with a specific antigen, and refers to a protein molecule that specifically recognizes the antigen.
  • the heavy and light chains of immunoglobulins may each include a constant region (C) and a variable region (V).
  • the light and heavy chain variable regions of immunoglobulins contain three variable regions called complementarity determining regions (CDRs) and four framework regions (FRs).
  • CDR complementarity determining regions
  • FRs framework regions
  • WARS refers to tryptophanyl-tRNA synthetase, and is also known as tryptophan-tRNA ligase, TrpRS, WRS, etc. .
  • WARS is an enzyme that mediates the aminoacylation reaction between the amino acid tryptophan and tRNA.
  • WARS is encoded by the WARS gene in humans, and the amino acid sequence and mRNA base sequence of the protein are known as Genbank accession number NP_004175.2 (protein), GenBank accession number NM_004184.3 (mRNA base sequence), etc.
  • WARS has two isoforms: cytoplasmic form (WARS1 or tryptophanyl-tRNA synthetase 1, cytoplasmic) and mitochondrial form (WARS2 or tryptophanyl-tRNA synthetase 2, mitochondrial).
  • WARS may be WARS1.
  • the WARS1 is not limited, but is preferably human WARS1 containing the amino acid sequence of SEQ ID NO: 94.
  • the anti-WARS1 antibody of the present invention may be an antibody or fragment thereof that specifically binds to WARS1.
  • the fragment of the antibody of the present invention may be Fab, F(ab') 2 , Fd, sdFv, Fv, dAb, scFv, sdAb, tetramer, etc., and can specifically bind to WARS1. It may have any form as long as it contains an antigen binding site.
  • One aspect of the present invention is a heavy chain variable region comprising H-CDR1 containing the amino acid sequence of SEQ ID NO: 3, H-CDR2 containing the amino acid sequence of SEQ ID NO: 5, and H-CDR3 containing the amino acid sequence of SEQ ID NO: 7. ; And L-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, L-CDR2 comprising the amino acid sequence represented by SEQ ID NO: 95, and L-CDR3 comprising the amino acid sequence represented by SEQ ID NO: 96 below. It provides an anti-WARS1 antibody or fragment thereof comprising a light chain variable region:
  • Xaa1 is Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly or Pro,
  • Xaa2 is Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly or Pro;
  • Xaa1 is Ser, then Xaa2 is not His;
  • Xaa3 may be Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly or Pro.
  • Xaa1 may be any one selected from the group consisting of Ile, Leu, Thr, Val, and Gln, and in this case, Xaa2 may be His or Leu.
  • Xaa1 is Ser
  • Xaa2 may be any one selected from the group consisting of Ile, Leu, Lys, Glu, and Phe.
  • Xaa3 may be Leu or Asn.
  • L-CDR1 of the light chain variable region includes the amino acid sequence of SEQ ID NO: 12
  • L-CDR2 includes SEQ ID NO: 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40 , 42, and 44
  • L-CDR3 may include the amino acid sequence of SEQ ID NO: 16 or SEQ ID NO: 46.
  • the heavy chain variable region may include the amino acid sequence of SEQ ID NO: 9.
  • the light chain variable region is any one amino acid selected from the group consisting of SEQ ID NOs: 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 48 and 49 May contain sequences.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 21.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 23.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 25.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 27.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 29.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 31.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 33.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 35.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 37.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 39.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 41.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 43.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 45.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 47.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 48.
  • the antibody or fragment thereof may include a heavy chain variable region including the amino acid sequence of SEQ ID NO: 9 and a light chain variable region including SEQ ID NO: 49.
  • the antibody or fragment thereof may include an immunoglobulin Fc region.
  • the Fc region of the immunoglobulin includes the heavy chain constant region 2 (CH2) and the heavy chain constant region 3 (CH3) of the immunoglobulin, but does not include the variable regions of the heavy and light chains and the light chain constant region (CL) of the immunoglobulin. refers to proteins that do not The immunoglobulin Fc region may be derived from IgG, IgA, IgE, IgD or IgM.
  • the Fc region of the immunoglobulin may be not only a wild-type Fc region, but also an Fc region variant.
  • the term "Fc region variant" used herein refers to a variant that has a glycosylation pattern different from that of the wild-type Fc region, has an increased sugar chain compared to the wild-type Fc region, has a decreased sugar chain compared to the wild-type Fc region, or has a sugar chain removed ( It may be in a deglycosylated form. Additionally, an aglycosylated Fc region is also included.
  • the Fc region or variant may have an adjusted number of sialic acids, fucosylation, and glycosylation through culture conditions or genetic manipulation of the host.
  • the sugar chain of the Fc region of immunoglobulin can be modified by conventional methods such as chemical methods, enzymatic methods, and genetic engineering methods using microorganisms.
  • the Fc region variant may be a mixture of the Fc regions of immunoglobulins IgG, IgA, IgE, IgD, or IgM.
  • the Fc region variant may be a form in which some amino acids in the Fc region are replaced with other amino acids.
  • the Fc region may include the amino acid sequence of SEQ ID NO: 51.
  • the antibody of the present invention is a fusion protein comprising the light chain variable region (VL) and light chain constant region (CL) of an anti-WARS1 antibody, and the heavy chain variable region (VH), heavy chain constant region 1 (CH1), and Fc of an anti-WARS1 antibody. It may contain a fusion protein containing a region.
  • the anti-WARS1 antibody may include (I) and (II).
  • the N' is the N terminus
  • the X is the antigen binding site of the anti-WARS1 antibody or fragment thereof and consists of X' and
  • the X' is an antigen binding site of the heavy chain of an anti-WARS1 antibody or fragment thereof and includes a variable region (VH) and a CH1 region,
  • the X'' is a light chain antigen binding site of an anti-WARS1 antibody or fragment thereof and includes a variable region (VL) and a constant region (CL),
  • the linker is a peptide linker
  • the o is O or 1.
  • anti-WARS1 antibody or fragment thereof, antigen binding site, variable region, and constant region are the same as described above.
  • the peptide linker may be composed of 1 to 50 consecutive amino acids or 3 to 30 consecutive amino acids. In one embodiment, the peptide linker may consist of 23 amino acids. Additionally, the peptide linker may contain at least one cysteine. Specifically, it may contain one, two or three cysteines. Additionally, the peptide linker may be derived from the hinge of immunoglobulin. For example, the hinge can be selected from the hinge regions of various IgG subtype antibodies. Additionally, the hinge may be a form in which some amino acids in the hinge region derived from immunoglobulin are replaced with other amino acids, or may be a sequence in which some amino acid sequences are added. In one embodiment, the peptide linker may be a peptide linker consisting of the amino acid sequence of SEQ ID NO: 50.
  • Another aspect of the invention provides polynucleotides encoding anti-WARS1 antibodies or fragments thereof.
  • the anti-WARS1 antibody or fragment thereof is the same as described above.
  • the polynucleotide may include the base sequence of SEQ ID NO: 52, which encodes the heavy chain region of an anti-WARS1 antibody or fragment thereof.
  • the polynucleotide may include any one base sequence selected from the group consisting of SEQ ID NO: 54 to SEQ ID NO: 69, which encodes the light chain region of an anti-WARS1 antibody or fragment thereof.
  • one or more bases may be mutated by substitution, deletion, insertion, or a combination thereof.
  • synthesis methods well known in the art, for example, methods described in the literature (Engels and Uhlmann, Angew Chem IntEd Engl., 37:73-127, 1988), can be used. and triester, phosphite, phosphoramidite and H-phosphate methods, PCR and other autoprimer methods, and oligonucleotide synthesis methods on solid supports.
  • the polypeptide is at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, It may include base sequences having an identity of at least about 97%, at least about 98%, at least about 99%, or at least about 100%.
  • the polynucleotide may additionally include a signal sequence or leader sequence.
  • signal sequence used herein refers to a nucleic acid encoding a signal peptide that directs secretion of a protein of interest.
  • the signal peptide is cleaved after translation in the host cell.
  • the signal sequence of the present invention is a nucleotide encoding an amino acid sequence that initiates the movement of a protein across the ER (endoplasmic reticulum) membrane.
  • Signal sequences are well characterized in the art and typically contain 16 to 30 amino acid residues, but may contain more or fewer amino acid residues.
  • a typical signal peptide consists of three regions: a basic N-terminal region, a central hydrophobic region, and a more polar C-terminal region.
  • the central hydrophobic region contains 4 to 12 hydrophobic residues that anchor the signal sequence throughout the membrane lipid bilayer while the immature polypeptide moves.
  • the signal sequence is cleaved within the lumen of the ER by cellular enzymes commonly known as signal peptidases.
  • the signal sequence may be tPa (tissue Plasminogen Activation), HSV gDs (signal sequence of Herpes simplex virus glycoprotein D), IgG signal sequence, or growth hormone secretion signal sequence.
  • a secretion signal sequence used in higher eukaryotic cells, including mammals can be used.
  • Signal sequences useful in the present invention include antibody light chain signal sequences, such as antibody 14.18 (Gillies et al., J. Immunol. Meth 1989. 125:191-202), and antibody heavy chain signal sequences, such as MOPC141 antibody heavy chain signal.
  • the signal sequence may include the amino acid sequence of SEQ ID NO: 1.
  • Another aspect of the present invention provides a vector loaded with a polynucleotide encoding the anti-WARS1 antibody or fragment thereof.
  • the polynucleotide may include a heavy chain region including the base sequence of SEQ ID NO: 52 and a light chain region including any one base sequence selected from the group consisting of SEQ ID NO: 54 to SEQ ID NO: 69.
  • the term “vector” can be introduced into a host cell and recombined and inserted into the host cell genome.
  • the vector is understood as a nucleic acid vehicle containing a nucleotide sequence capable of spontaneous replication as an episome.
  • the vectors include linear nucleic acids, plasmids, phagemids, cosmids, RNA vectors, viral vectors, mini-chromosomes and analogs thereof.
  • viral vectors include, but are not limited to, retroviruses, adenoviruses, and adeno-associated viruses.
  • the vector may be plasmid DNA, phage DNA, etc., commercially developed plasmids (pUC18, pBAD, pIDTSAMRT-AMP, etc.), E. coli-derived plasmids (pYG601BR322, pBR325, pUC118, pUC119, etc.), Bacillus subtilis.
  • plasmids pUB110, pTP5, etc.
  • yeast-derived plasmids yeast-derived plasmids
  • phage DNA Charon4A, Charon21A, EMBL3, EMBL4, ⁇ gt10, ⁇ gt11, ⁇ ZAP, etc.
  • animal virus vectors retroviruses
  • adenovirus vaccinia virus
  • insect virus vectors baculovirus, etc.
  • the plasmid may contain a selection marker, such as an antibiotic resistance gene, and host cells maintaining the plasmid may be cultured under selective conditions.
  • a selection marker such as an antibiotic resistance gene
  • the term “gene expression” or “expression” of a protein of interest is understood to mean transcription of a DNA sequence, translation of an mRNA transcript, and secretion of an antibody product or fragment thereof.
  • a useful expression vector may be RcCMV (Invitrogen, Carlsbad) or variants thereof.
  • the expression vector may include a human CMV (cytomegalovirus) promoter to promote continuous transcription of the target gene in mammalian cells and a bovine growth hormone polyadenylation signal sequence to increase the steady-state level of RNA after transcription. You can.
  • Another aspect of the present invention provides a transformed cell into which an expression vector loaded with a polynucleotide encoding the anti-WARS1 antibody or fragment thereof has been introduced. At this time, the anti-WARS1 antibody or fragment thereof is the same as described above.
  • transformed cell refers to prokaryotic cells and eukaryotic cells into which a recombinant expression vector can be introduced.
  • the transformed cells can be produced by introducing a vector into a host cell and transforming it. Additionally, the antibody or fragment thereof of the present invention can be produced by expressing the polynucleotide contained in the vector.
  • the transformation can be performed by various methods. There is no particular limitation thereto as long as the antibody of the present invention can be produced.
  • the transformation method is a CaCl 2 precipitation method, a Hanahan method that increases efficiency by using a reducing substance called DMSO (dimethyl sulfoxide) in the CaCl 2 precipitation method.
  • electroporation, calcium phosphate precipitation, protoplast fusion method, stirring method using silicon carbide fiber, agrobacteria-mediated transformation method, transformation method using PEG, dextran sulfate, lipofectamine and drying/ Suppression-mediated transformation methods, etc. may be used.
  • the target can be delivered into cells using virus particles through infection. Additionally, vectors can be introduced into host cells by gene bombardment or the like.
  • the host cell used to produce the transformed cell is not particularly limited as long as it is capable of producing the antibody of the present invention.
  • the host cells may include, but are not limited to, cells of prokaryotic, eukaryotic, mammalian, plant, insect, fungal or cellular origin.
  • An example of the prokaryotic cell may be Escherichia coli.
  • yeast can be used as an example of a eukaryotic cell.
  • the mammalian cells include CHO cells, F2N cells, COS cells, BHK cells, Bowes melanoma cells, HeLa cells, 911 cells, AT1080 cells, A549 cells, SP2/0 cells, and human lymphoblastoids.
  • NSO cells HT-1080 cells, PERC.6 cells, HEK 293 cells, or HEK293T cells can be used, but are not limited thereto, and any cell that can be used as a mammalian host cell known to those skilled in the art can be used.
  • the glycosylation-related genes of the host cell are manipulated through methods known to those skilled in the art to manipulate the antibody's sugar chain pattern (e.g., sialic acid, fucose). misfire, saccharification) can be adjusted.
  • the antibody's sugar chain pattern e.g., sialic acid, fucose. misfire, saccharification
  • Another aspect of the present invention provides a method for producing the anti-WARS1 antibody or fragment thereof.
  • the manufacturing method includes i) culturing the transformed cells; and ii) obtaining an anti-WARS1 antibody or fragment thereof.
  • culture refers to a method of growing microorganisms under appropriately artificially controlled environmental conditions.
  • the method of culturing the transformed cells can be performed using methods widely known in the art.
  • the culture is not particularly limited as long as it can be produced by expressing the antibody of the present invention.
  • the culture may be continuously cultured in a batch process or fed batch or repeated fed batch process.
  • the step of obtaining the antibody from the culture may be performed by methods known in the art.
  • the obtaining method is not particularly limited as long as the produced antibody of the present invention or fragment thereof can be obtained.
  • the obtaining method includes centrifugation, filtration, extraction, spraying, drying, evaporation, precipitation, crystallization, electrophoresis, fractional dissolution (e.g. ammonium sulfate precipitation), chromatography (e.g. ion exchange, affinity , hydrophobicity and size exclusion), etc.
  • composition comprising anti-WARS1 antibody or fragment thereof
  • Another aspect of the present invention provides a pharmaceutical composition for preventing or treating inflammatory diseases comprising an anti-WARS1 antibody or fragment thereof as an active ingredient.
  • an anti-WARS1 antibody or fragment thereof is the same as described above.
  • inflammation is a response to protect the living body against harmful factors, and involves immune cells, blood vessels, and inflammatory mediators to suppress cell damage, remove damaged tissue and necrotic cells, and It includes a series of processes to reproduce.
  • Inflammatory disease is a general term for diseases whose main lesion is inflammation.
  • the inflammatory diseases include peritonitis, osteomyelitis, cellulitis, meningitis, encephalitis, pancreatitis, trauma-induced shock, cystic fibrosis, stroke, Lyme disease, polyarteritis nodosa, hypersensitivity angiitis, Lou Gehrig's granulomatosis, articular cell arteritis, bursitis, tenosynovitis, and epicondylitis.
  • the preferred dosage of the pharmaceutical composition varies depending on the patient's condition and weight, degree of disease, drug form, administration route and period, but can be appropriately selected by a person skilled in the art.
  • the antibody or fragment thereof may be used in any amount depending on the use, formulation, purpose of formulation, etc., as long as it exhibits anti-inflammatory activity or, in particular, can exhibit a therapeutic effect for inflammatory diseases. effective amount), and a typical effective amount will be determined within the range of 0.001% by weight to 20.0% by weight based on the total weight of the composition.
  • effective amount refers to the amount of an active ingredient that can improve the condition of a disease or induce a treatment effect, especially an improvement in the condition of an inflammatory disease. Such effective amounts can be determined experimentally within the scope of the ordinary ability of those skilled in the art.
  • treatment can be used to include both therapeutic treatment and preventive treatment, and includes both application and any form of medication to treat diseases in mammals, including humans.
  • the term also includes inhibiting or slowing the progression of a disease; Restoring or repairing damaged or missing function, thereby partially or completely relieving a disease; or stimulating inefficient processes; It includes the meaning of alleviating serious diseases.
  • prevention may be used to mean alleviating or reducing the pathological condition or disease of an individual.
  • “enhanced efficacy” e.g., improvement in efficacy
  • improved efficacy measured by comparing parameters such as clearance rate and treatment or improvement of inflammatory diseases in test animals or human subjects. It can be.
  • the pharmaceutical composition of the present invention is administered in a “therapeutically effective amount.”
  • administration means introducing a predetermined substance into an individual by an appropriate method, and the composition may be administered through any general route as long as it can reach the target tissue. It may be administered intraperitoneally, intravenously, intramuscularly, subcutaneously, intradermally, orally, topically, intranasally, intrapulmonaryly, or rectally, but is not limited thereto.
  • the term "therapeutically effective amount” or “pharmaceutically effective amount” refers to the amount of a compound or composition effective in preventing or treating a target disease, which means treating the disease at a reasonable benefit/risk ratio applicable to medical treatment. It refers to an amount that is sufficient for treatment and does not cause side effects.
  • the level of the effective amount is determined by factors including the patient's health status, type and severity of the disease, activity of the drug, sensitivity to the drug, administration method, administration time, administration route and excretion rate, treatment period, combination or concurrent use of drugs, and It may be determined based on factors well known in the medical field.
  • a therapeutically effective amount refers to an amount of drug that is effective in treating an inflammatory disease.
  • the pharmaceutical composition may further include a pharmaceutically acceptable carrier.
  • the pharmaceutically acceptable carrier may be any carrier that is a non-toxic material suitable for delivery to a patient. Distilled water, alcohol, fats, waxes and inert solids may be included as carriers. Pharmacologically acceptable adjuvants (buffers, dispersants) may also be included in the pharmaceutical composition.
  • the pharmaceutical composition may be prepared into a parenteral formulation according to the route of administration by a conventional method known in the art, including a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable means that it does not inhibit the activity of the active ingredient and does not have toxicity beyond what is acceptable for the subject of application (prescription).
  • the pharmaceutical composition When the pharmaceutical composition is prepared as a parenteral formulation, it can be formulated in the form of injections, transdermal administration, nasal inhalation, and suppositories along with a suitable carrier according to methods known in the art.
  • suitable carriers include sterile water, ethanol, polyols such as glycerol or propylene glycol, or mixtures thereof, preferably Ringer's solution, phosphate buffered saline (PBS) containing triethanol amine, or sterile for injection. Isotonic solutions such as water or 5% dextrose can be used.
  • PBS phosphate buffered saline
  • Isotonic solutions such as water or 5% dextrose can be used.
  • the preferred dosage of the pharmaceutical composition is in the range of 0.01 ⁇ g/kg to 10 g/kg, or 0.01 mg/kg to 1 g/kg per day, depending on the patient's condition, weight, gender, age, patient's severity, and route of administration. It can be. Administration can be done once to several times a day or once a month to once every two weeks. These dosages should not be construed as limiting the scope of the invention in any respect.
  • the subjects to which the pharmaceutical composition can be applied are mammals and humans, and humans are particularly preferred.
  • the pharmaceutical composition of the present invention may further include any compounds or natural extracts known to have a therapeutic effect on inflammatory diseases.
  • Another aspect of the present invention provides the use of the anti-WARS1 antibody or fragment thereof for preparing a medicament for preventing or treating inflammatory diseases.
  • the inflammatory disease, prevention, treatment, anti-WARS1 antibody or fragment thereof are the same as described above.
  • Another aspect of the present invention provides use of the anti-WARS1 antibody or fragment thereof for preventing or treating inflammatory diseases.
  • the inflammatory disease, prevention, treatment, anti-WARS1 antibody or fragment thereof are the same as described above.
  • Another aspect of the present invention provides a method for preventing or treating an inflammatory disease comprising administering the anti-WARS1 antibody or fragment thereof to a subject.
  • the inflammatory disease, treatment, anti-WARS1 antibody or fragment thereof, and administration are the same as described above.
  • the subject may be a mammal, preferably a human.
  • the individual may be a patient suffering from an inflammatory disease or an individual who is likely to suffer from an inflammatory disease.
  • the administration route, dosage, and frequency of administration of the antibody or fragment thereof may be administered to the subject in various methods and amounts depending on the patient's condition and the presence or absence of side effects, and the optimal administration method, dosage, and frequency of administration can be determined by a person skilled in the art. You can select an appropriate range.
  • the preferred dosage of the anti-WARS1 antibody or fragment thereof is in the range of 0.01 ⁇ g/kg to 10 g/kg, or 0.01 mg/kg to 1 day, depending on the patient's condition, weight, gender, age, severity of the patient, and route of administration. It may be in the range of 1 g/kg. Administration can be done once to several times a day or once a month to once every two weeks. These dosages should not be construed as limiting the scope of the invention in any respect.
  • the antibody or fragment thereof may be administered in combination with any compound or natural extract known to have a therapeutic effect on inflammatory diseases, or may be formulated in the form of a combination preparation with other drugs.
  • the vector was introduced into Expi293 cells using Expifectamine 293 reagent (Thermo fisher) at a ratio of 1:1, and heavy and light chains were expressed together in the same cell. After introducing the vector, the culture was shaken for about 5 days, the cell culture was centrifuged, the supernatant was recovered, and the antibody was separated and purified.
  • the recovered supernatant was loaded on a Hitrap MabselectSure column (GE Healthcare Life Sciences) and washed with PBS to remove non-specific binding. Proteins that specifically bind to the column were separated using 100mM Citrate buffer (pH 3.0) + 300mM NaCl. The eluate obtained by fast protein liquid chromatography (FPLC) was loaded onto size exclusion chromatography (GE Healthcare Life Sciences) to obtain high purity antibodies.
  • the purified anti-WARS1 antibody was named “GKB101” (Table 1, Figures 3a and 3b).
  • the light chain variant of GKB101 was amplified through PCR, and the light chain variable region
  • the primer base sequences used to amplify genes including the mutation sites of CDR2 and CDR3 are shown in Table 4.
  • L-CDR2 and L-CDR3 variants containing each mutation were incubated at 98°C/1 min using the vector template (pcDNA3.3-GKB101) and the above primers (10 pmol each); 98°C/10 sec, 55°C/15 sec, 72°C/5 min, 28 cycles; PCR was performed under conditions of 72°C/5 min to amplify the gene containing the mutation site. Afterwards, 0.5 ⁇ l of DpnI restriction enzyme was added to the PCR product and reacted with the enzyme at 37°C for 30 minutes. After the enzyme reaction, the purified PCR product was mixed with NEBuilder Master mix (NEB, Cat# E2621) and reacted at 50°C for 60 minutes, and then transformed into DH5 ⁇ competent cells to select positive clones.
  • NEBuilder Master mix NEB, Cat# E2621
  • nucleic acid sequence encoding ANSHRPS is GCTAATAGTCATCGGCCAAGC (SEQ ID NO: 70)
  • nucleic acid sequence encoding GAWDDSLSAYV is GGTGCTTGGGATGATAGCCTGAGTGCTTATGTC (SEQ ID NO: 71).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named “S53I” (Table 5, Figures 3a and 3b).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named "S53L” (Table 6, Figures 3a and 3b).
  • Heavy chain region signal sequence MGWSYIILFLVATAADVHS One Heavy chain variable region EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9 Heavy chain constant region (CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10 linker EPPKSCDKTHTCPPCPAPELLGGP 50 Fc region (CH2+CH3) SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named "S53T" (Table 7, Figures 3a and 3b).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named "S53V” (Table 8, Figures 3a and 3b).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named “S53Q” (Table 9, Figures 3a and 3b).
  • Heavy chain region signal sequence MGWSYIILFLVATAADVHS One Heavy chain variable region EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9 Heavy chain constant region (CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10 linker EPPKSCDKTHTCPPCPAPELLGGP 50 Fc region (CH2+CH3) SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named “S53I” (Table 10, Figures 3a and 3b).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named “H54L” (Table 11, Figures 3a and 3b).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named “H54K” (Table 12, Figures 3a and 3b).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named “H54Q” (Table 13, Figures 3a and 3b).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named “H54F” (Table 14, Figures 3a and 3b).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named “SH/IL” (Table 15, Figures 3a and 3b).
  • SEQ ID NO: 52 A polynucleotide encoding a polypeptide comprising (SEQ ID NO: 50) and an Fc region (SEQ ID NO: 51); and a signal peptide (SEQ ID NO: 1), a polynucleotide (SEQ ID NO: 65) encoding a polypeptide comprising the variable region (SEQ ID NO: 43) and constant region (SEQ ID NO: 19) of the anti-WARS1 antibody light chain, respectively, pOptiVEC (Thermo fisher, Figure 1) and pcDNA 3.3 vector (Thermo fisher, Figure 2).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named “SH/LL” (Table 16, Figures 3a and 3b).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named “SH/QL” (Table 17, Figures 3a and 3b).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named "SHL/ILN" (Table 18, Figures 3a and 3b).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named “SHL/LLN” (Table 19, Figures 3a and 3b).
  • SEQ ID NO: 52 A polynucleotide (SEQ ID NO: 52) encoding a polypeptide comprising (SEQ ID NO: 50) and an Fc region (SEQ ID NO: 51); and a signal peptide (SEQ ID NO: 1), a polynucleotide (SEQ ID NO: 69) encoding a polypeptide comprising the variable region (SEQ ID NO: 49) and constant region (SEQ ID NO: 19) of the anti-WARS1 antibody light chain, respectively, pOptiVEC (Thermo fisher, Figure 1) and pcDNA 3.3 vector (Thermo fisher, Figure 2).
  • the antibody was isolated and purified by introducing the vector into Expi293 cells in the same manner as in Example 1, and was named "SHL/QLN" (Table 20, Figures 3a and 3b).
  • the binding ability of the anti-WARS1 antibody of the present invention, produced in the same manner as Example 1 and Example 2, to WARS1 protein was confirmed using direct ELISA and sandwich ELISA methods.
  • WARS1 a recombinant protein derived from humans, marmosets (NHP), mice, rats, and pigs
  • a concentration of 1 ⁇ g/ml was coated on a 96-well plate (Maxisorp, Thermo fisher), and then 1% BSA was added. Blocking was performed with the included PBS at room temperature for 1 hour.
  • GKB101 antibody or its variant antibody was diluted in a concentration-dependent manner and added to each coated well, reacted at room temperature for 1 hour, and then washed four times with PBST (PBS+Tween20).
  • Sandwich ELISA was performed by coating a 96-well plate (Maxisorp, Thermo Fisher) with GKB101 antibody or its variant antibody at a concentration of 1 ⁇ g/ml, and then blocking with PBS containing 1% BSA for 1 hour at room temperature.
  • WARS1 recombinant protein from human, marmoset (NHP), mouse, rat, or pig was diluted in a concentration-dependent manner and added to each antibody-coated well, reacted at room temperature for 1 hour, and then washed four times with PBST (PBS+Tween20). did. Each well was reacted with anti-his tag antibody (Santa Cruz) for 1 hour.
  • the binding affinity of the anti-WARS1 antibody to the recombinant WARS1 protein of the GKB101 antibody and its variant antibodies was measured and compared.
  • the GKB101 antibody was tested against the WARS1 recombinant protein derived from human, marmoset (NHP), mouse, rat, and pig. A strong bonding force equal to or greater than that of was confirmed.
  • the S53Q, H54K, SH/QL, SHL/ILN, SHL/LLN, and SHL/QLN antibodies have lower K d values. It is about 10 -12 M, and in recombinant proteins from marmoset (NHP), the K d value of SHL/ILN, SHL/LLN and SHL/QLN antibodies is It is about 10 -12 M level.
  • the K d value of S53V, S53Q, H54K, H54Q, SH/QL, SHL/ILN, SHL/LLN and SHL/QLN antibodies is approximately 10 -12 M.
  • the K d value of S53V, S53Q, H54L, H54K, H54Q, SH/QL, SHL/ILN, SHL/LLN, and SHL/QLN antibodies is about 10 -12 M.
  • the K d value of S53L, S53V, S53Q, H54K, and H54Q antibodies is about 10 -9 M.
  • the K d value of S53V, S53Q, H54L, H54K, H54Q, SH/QL, SHL/ILN, SHL/LLN and SHL/QLN antibodies against WARS1 recombinant protein showed high binding affinity of about 10 -12 M. .
  • WARS1 recombinant protein derived from human, mouse, pig, marmoset (NHP) or rat
  • cell culture medium derived from human, mouse, pig, marmoset (NHP) or rat
  • human or mouse serum were used as WARS1 protein samples.
  • the cell culture medium was used by treating the human monocyte cell line THP-1 or the mouse macrophage cell line J774.1A with LPS (lipopolysaccharide, 100 ng/ml) for 24 hours to induce an inflammatory response, and then obtain the cell culture supernatant.
  • LPS lipopolysaccharide, 100 ng/ml
  • WARS1 recombinant protein from human, mouse, pig, marmoset (NHP) or rat
  • cell supernatant obtained by the above method
  • 30 ⁇ g each of mouse or human serum were loaded on 8% SDS-PAGE, and then PVDF It was transferred to a membrane (Millipore). Afterwards, the membrane was reacted with 1 ⁇ g/ml of GKB101 or its variant antibody for 1 hour each, and then washed three times with TBST (TBS+Tween20).
  • both the GKB101 antibody and its variant antibodies of the present invention specifically detect WARS1 in recombinant protein, culture supernatant of THP-1 cells or J774A.1 cells, and human or mouse serum.
  • the S53I, S53L, S53V, S53Q, H54I, H54K, H54Q, H54F and SH/LL antibodies were able to detect pig-derived recombinant proteins at an equal or higher level compared to the GKB101 antibody.
  • a peptide corresponding to the human WARS1 protein WHEP domain sequence of the anti-WARS1 antibody of the present invention and an alanine mutant human WARS1 protein were prepared, and the binding ability of the anti-WARS1 antibody thereto was confirmed through ELISA.
  • anti-WARS1 antibody was coated on a 96-well plate (Maxisorp, Thermo fisher) at a concentration of 1 ⁇ g/ml, and then incubated at room temperature for 1 hour with PBS containing 1% BSA. Blocked. Each biotin-labeled peptide was diluted in a concentration-dependent manner and added to each coated well, reacted at room temperature for 1 hour, and then washed four times with PBST (PBS+Tween20). Each well was treated with streptavidin (R&D systems) with HRP attached, reacted for 1 hour, and then washed with PBST. Finally, after color development with TMB substrate (BD), absorbance was measured at 490 nm (NIVO) ( Figure 8).
  • anti-WARS1 antibody was coated at a concentration of 1 ⁇ g/ml on a 96-well plate (Maxisorp, Thermo fisher), followed by 1% BSA. was blocked for 1 hour at room temperature with PBS containing .
  • Each WARS1 protein was diluted to 50 ng/ml and added to each coated well, reacted at room temperature for 1 hour, and then washed four times with PBST (PBS+Tween20). Each well was reacted with anti-his tag antibody (Santa Cruz) for 1 hour.
  • GKB101, S53I, S53Q, S53I, H54K, and H54Q antibodies all commonly have epitopes in the sequence R20, R24, K27, I36, I43, and K47 in the human WARS1 WHEP domain.
  • mouse macrophage cell line J774A.1 cells were inoculated into a 96-well cell culture plate (Nunc) at 4 ⁇ 10 4 cells/well and cultured for 24 hours. At this time, cells were cultured using high glucose DMEM (Gibco) containing 10% FBS and 1% penicillin-streptomycin.
  • the antigen-antibody mixture was prepared by mixing human-derived WARS1 recombinant protein (5 ⁇ g) and the anti-WARS1 antibody (5 ⁇ g) of the present invention and reacting for 2 hours in an incubator at 37°C.
  • the cell medium was replaced with a new one, and then the cells were treated with the antigen-antibody mixture prepared in the above manner in each well. After about 15 hours, the culture medium of each cell was centrifuged, the supernatant was collected, and the concentration of TNF- ⁇ in the supernatant was measured (ELISA MAXTM Standard Set Mouse TNF- ⁇ , BioLegend). At this time, IgG was used as a control for anti-WARS1 antibody.
  • mice in which severe sepsis was induced by injection of CS were used.
  • mice 21 mg of CS (cecal slurry) was injected into mice (C57BL/6, Daehan Biolink, 8 weeks old), and 4, 8, and 12 hours later, Isotype IgG1, GKB101 antibody, S53I antibody, S53Q, or S53K antibody. It was administered intraperitoneally a total of three times at concentrations of 2.5 mg/kg, 5 mg/kg, or 10 mg/kg, respectively (FIG. 11). Afterwards, the survival of the mice was observed for up to 72 hours.
  • S53I did not show a tendency to increase survival in a dose-dependent manner
  • S53Q and H54K antibodies were administered at concentrations of 2.5 mg/kg and 10 mp. It was confirmed that the survival rate significantly increased at /kg.
  • anti-WARS1 antibodies H54K, a variant of anti-WARS1 antibody. Therefore, in the examples below, anti-WARS1 antibodies, H54K, and M105A can be used interchangeably.
  • Example 7 Confirmation of anti-inflammatory activity of anti-WARS1 antibody in cell lines related to chronic obstructive pulmonary disease
  • anti-WARS1 antibody H54K
  • the anti-inflammatory activity of anti-WARS1 antibody was confirmed using the cells involved.
  • the cells used were human lung fibroblast cell lines (HLF, ATCC, PCS-201-013) and were cultured in DMEM containing 10% FBS and 1% antibiotic/antifungal agent.
  • the cell lines were inoculated into 96-well plates at 2 ⁇ 10 4 cells/well and cultured in DMEM containing 0.1% FBS for 24 hours.
  • WARS1 (10 ⁇ g/ml) and anti-WARS1 antibodies (3C6, GKB101, H54K, 5 ⁇ g/ml) or PBS were mixed and reacted at 37°C for 1 hour.
  • the prepared cells were treated with the WARS1/anti-WARS1 antibody mixture and cultured for an additional 16 hours. After 16 hours, the culture medium was taken, and the concentrations of IL-8 (BioLegend, 430515) and IL-6 (BioLegend, #431304) in the culture medium were measured using ELISA. At this time, WARS1 treated with PBS was used as a control group.
  • the secretion of IL-8 and IL-6 increased in the WARS1-treated group (control group) in human lung fibroblasts.
  • the secretion of IL-8 and IL-6 decreased in a concentration-dependent manner compared to the control group. In particular, the greatest decrease was confirmed in the H54K antibody treatment group.
  • Example 8.1 Capture of standard cigarette smoke
  • the weight of the cigarette holder containing the Cambridge filter was measured before combustion in accordance with ISO4387 regulations, and the cigarette smoke condensate burned by the method of Example 8.1 was obtained by measuring the weight of the cigarette holder in which cigarette smoke was collected by the Cambridge filter after combustion.
  • the weight of the holder was measured and the cigarette smoke condensate (TPM, total particulate matter) content was calculated (ISO4387, 2000).
  • TPM total particulate matter
  • the Cambridge filters in which cigarette smoke condensate was collected by the method of Example 8.1 were separated from the cigarette holders and placed in 100 ml Erlenmeyer flasks, and 50 ml of isopropanol as an extraction solvent was added and mixed. The mixture was left at room temperature for more than 8 hours to extract cigarette smoke condensate.
  • the extract was filtered after extraction and concentrated using a vacuum filtration concentrator, and the concentrates in three Erlenmeyer flasks were collected in a scintillation vial and completely concentrated using nitrogen gas.
  • TPM total particulate matter
  • TPM(mg/cig) (W FHA - W FBH )/N
  • TPM Total particulate matter
  • WFHA Weight of Filter Holder after smoking
  • WFHB Weight of Filer Holder before smoking
  • N Number of cigarettes smoked per trap (cig.)
  • Example 9 Verification of respiratory damage inhibition effect of anti-WARS1 antibody using chronic obstructive pulmonary disease mouse model
  • Example 9.1 Production of chronic obstructive pulmonary disease mouse model
  • mice Male 7-week-old specific pathogen-free (SPF) BALB/c mice (18 g to 20 g) were supplied by Orient Bio. Animals were provided with sufficient solid feed (no antibiotics, Samyang Feed Co.) and water until the day of the experiment, and were acclimatized for one week in an environment with a temperature of 22 ⁇ 2°C, humidity of 55 ⁇ 15%, and 12 hours (light-dark cycle). It was used in the experiment. In addition, approval was obtained from Daejeon University's Institutional Animal Care and Use Committee (IACUC) to review the ethical and scientific validity and efficient management of animal experiments.
  • IACUC Institutional Animal Care and Use Committee
  • the LPS/CS mixture for establishing a mouse model of chronic obstructive pulmonary disease is 100 ⁇ g/ml of lipopolysaccharide (LPS) and 4 mg of standard cigarette smoking extract (CSE) in 1:1 ratio. Prepared by mixing 1. After 7-week-old BALB/c male mice were pseudoanesthetized with ketamine and rumph, the LPS/CS mixture was injected into the nose and mouth of the mouse at a total of 100 ⁇ l (50 ⁇ l each) once a week for 3 weeks.
  • a COPD mouse model is created by inhalation using an intra-nazal-trachea injection method.
  • the experimental group was i) untreated normal group (Normal), ii) PBS (control group, CON), iii) group administered Isotype IgG1 antibody (3 mg/kg, i.p), and iv) group administered anti-WARS1 antibody (H54K). It was carried out separately. At this time, each sample was administered 1 hour before administration of LPS and CS (FIG. 15).
  • the H54K antibody which is the anti-WARS1 antibody, may be described interchangeably with the M105A antibody.
  • mice After completion of the experiment, blood, bronchoalveolar lavage fluid, and lung tissue were separated from the mice to evaluate the effect of anti-WARS1 antibody (H54K) on suppressing respiratory damage. At this time, the results of each experimental group were expressed as mean ⁇ standard deviation (SEM), and the numerical data between experimental groups were verified for significance with Duncan's multiple comparison tests after one-way analysis of variance (ANOVA). did.
  • the airway and lung tissues obtained from the experimental mice in Example 9.1 were stained using H&E staining, Masson Trichrome staining (M-T staining), or Periodic acid-Schiff (PAS)-Alcian Blue (AB) staining, respectively, and then subjected to light microscopy. Tissue morphology was analyzed through observation.
  • Example 9.2.1 Observation of inflammatory immune cell infiltration in airway and lung tissue through H&E staining
  • the extracted airway and lung tissues were fixed by reacting in 4% paraformaldehyde (PFA) for one day, and paraffin tissue section slides were produced.
  • the paraffin tissue section slides were each washed three times with xylene solution and 100% ethanol to remove paraffin.
  • the tissue slide from which paraffin was removed through the above process was reacted in a hematoxylin solution for 5 minutes and then sequentially washed in running water and 1% hydrochloric acid. Then, the slide was washed with running water, neutralized with 1% ammonia solution (diluted in 70% ethanol), washed again with running water, and reacted in Eosin solution for 2 minutes. After the reaction was completed, the slide was sequentially reacted in a 70% to 100% ethanol solution and then in a xylene solution for 3 minutes. At this time, the reaction process in the xylene solution was performed a total of three times. Finally, after encapsulating the tissue slide with a cover slide, the shape of the tissue was observed using an optical microscope.
  • Masson Trichrome (M-T) staining was performed on lung tissue slides prepared in the same manner as in Example 9.2.1.
  • the paraffin-removed slide was reacted in Bouin's solution at 60°C, taken out, cooled, and sequentially reacted in Weigert's Hematoxylin solution, Briebrich Scarlet solution, Phosphotungstic phosphomolybdic acid, and Aniline blue solution. Finally, after reacting in a 1% acetic acid solution, the lung tissue section slide was encapsulated with a cover slide and the degree of collagen deposition in the tissue was confirmed under an optical microscope.
  • Example 9.2.3 Observation of mucus secretion in airway tissue through Periodic acid-Schiff-Alcian Blue staining
  • Example 9.1 The airway tissue extracted from the experimental mouse in Example 9.1 was treated with tissue slides prepared in the same manner as in Example 9.2.1 and treated with Periodic acid-Schiff-Alcian Blue (PAS-AB) using Periodic Acid Schiff (Sigma Aldrich, 395B). It was dyed using a dyeing method.
  • PAS-AB Periodic acid-Schiff-Alcian Blue
  • Sigma Aldrich, 395B Periodic Acid Schiff
  • tissue slides from which paraffin was removed were sequentially reacted in Alcian blue solution, 0.5% Periocid acid solution, and Schiff's solution. After reaction with each solution, the slide was thoroughly washed with running water. The slides stained through the above process were reacted in a hematoxylin solution, washed with water, and dehydrated by sequentially reacting in an ethanol solution with a concentration of 70% to 100%. Finally, the tissue slide was encapsulated in a cover glass and observed under an optical microscope.
  • Example 9.3 Analysis of inflammatory cytokine concentrations in airway, alveolar lavage fluid, lung tissue and serum
  • the concentrations of inflammatory cytokines and chemokines were measured in lung tissues obtained from the experimental mice in Example 9.1.
  • alveolar lavage fluid was collected after washing the bronchial tubes and lung tissue with 1 ml of PBS through mouse airway intubation.
  • the lavage fluid was used as bronchoalveolar lavage (BAL) fluid (BALF).
  • a portion of lung tissue was removed, protein lysis buffer was added to a concentration of 100 ⁇ g/ml, and the tissue was dissolved. The lysate was centrifuged at 13,000 rpm, and only the supernatant was collected and used as a lung tissue sample.
  • Serum samples were obtained by collecting blood through heart blood collection, transferring it to a heparin tube, and centrifuging it at 2,000 rpm for 20 minutes at room temperature.
  • the concentrations of mCXCL2/MIP-2, mIL-6, and mMIP1 ⁇ were measured using mouse CXCL2/MIP-2 ELISA (R&D systems), mouse IL-6 ELISA (BioLegend), and mouse MIP1- ⁇ ELISA. (R&D R&D systems)
  • the concentration of each cytokine or chemokine was measured using a kit.
  • anti-WARS1 antibody H54K
  • H54K anti-WARS1 antibody
  • Immune cells in serum, alveolar lavage fluid, and lung tissue obtained from the experimental mice in Example 9.1 were analyzed through flow cytometry.
  • alveolar lavage fluid was obtained in the same manner as in Example 9.3.
  • Lung tissue samples were prepared by the following method. First, a portion of the lung tissue was mixed with a collagenase solution at a concentration of 1 mg/ml, pulverized using a GentleMacs C-tube, and incubated with shaking at 37°C for 30 minutes. The shaking culture solution was passed through a 70 ⁇ m cell strainer to collect single cells.
  • Immunofluorescence staining was performed on the lung tissue samples prepared as above and the cells obtained from the alveolar lavage fluid.
  • the antibodies used at this time were PE-anti-CD3e antibody (553064, BD Pharmingen), FITC-anti-CD8 antibody (553031, BD Pharmingen), PE-anti-CD4 antibody (553047, BD Pharmingen), and PE-anti-Gr-1. antibodies (553128, BD Pharmingen), FITC-anti-CD69 antibody (55732, BD Pharmingen), FITC-anti-CD11b antibody (553310, BD Pharmingen) and PE-anti-B220 antibody (561878, BD Pharmingen).
  • Each immune cell was classified into CD11b+Gr-1+ (granulocyte), Gr-1-SiglecF+ (eosinophil), and Gr-1+highSiglecF+ (eosinophil_high), and the distribution (%) of each cell was analyzed.
  • Example 9.5 Analysis of immune cells in mediastinal lymph nodes
  • Mediastinal lymph node samples were prepared as follows. First, the chest was opened, and the mediastinal lymph nodes located in the superior vena cava near the thymus were removed using scissors and forceps, and then passed through a 70 ⁇ m cell strainer to collect single cells.
  • Immunofluorescence staining was performed on the mediastinal lymph node cells prepared as above using the same antibody and method as in Example 9.4.
  • the flow cytometry values were classified into CD3+, CD4+, CD8+, CD4+CD69+, CD8+CD69+, and CD11c+B220- using the FlowJo program (FlowJoTM v7 Software, BD Biosciences), and the distribution of each cell ( %) was analyzed.
  • PBMC peripheral blood mononuclear cells
  • Immunofluorescence staining was performed on the immune cells in PBMC prepared as above.
  • the antibodies were PE-anti-CD3e antibody (553064, BD Pharmingen), FITC-anti-CD8 antibody (553031, BD Pharmingen), PE-anti-CD4 antibody (553047, BD Pharmingen), and PE-anti-Gr-1 antibody.
  • FITC-anti-CD19 antibody 553785, BD Pharmingen
  • PerCP Cy5-anti-SiglecF antibody 565526, BD Pharmingen
  • reaction was washed with FACS buffer (0.5% FBS, 0.02% NaN 3 in PBS) and analyzed using a flow cytometer.
  • FACS buffer (0.5% FBS, 0.02% NaN 3 in PBS
  • the analysis value was calculated by classifying each immune cell into CD3+, CD19+, CD4+, CD8+, and Gr-1+SiglecF- (neutrophils) using the FlowJo program (FlowJoTM v7 Software, BD Biosciences) and calculating the distribution (%) of each cell. was analyzed.
  • the distribution of lymphocytes in the blood increased in the Isotype IgG1 administered group or the PBS administered group compared to the normal group.
  • the anti-WARS1 antibody (H54K) administered group a decrease of approximately 30% was observed compared to the PBS or Isotype IgG1 administered group. All data were expressed as standard deviation (SEM) and analyzed using the ANOVA statistical program.
  • Example 10 Verification of the effect of improving intestinal permeability by anti-WARS1 antibody treatment in colon cancer cell lines
  • human intestinal epidermal cell lines (Caco-2, ATCC, HTB-37) were used.
  • the cells were cultured in DMEM medium containing 10% FBS and 1% antibiotic/antifungal agent.
  • the cell lines were inoculated into 6-well plates at 3 ⁇ 10 5 cells/well and cultured in DMEM medium containing 0.1% FBS for 24 hours.
  • WARS1 (10 ⁇ g/ml) and anti-WARS1 antibodies (3C6, GKB101, H54K, 5 ⁇ g/ml) or PBS were mixed and reacted at 37°C for 1 hour.
  • the prepared cells were treated with the WARS1/anti-WARS1 antibody mixture and cultured for an additional 16 hours. After 16 hours, the culture medium was removed and fixed with 4% formaldehyde for 5 minutes at room temperature. The fixed cells were treated with 0.1% TritonX-100 and reacted for 5 minutes to increase cell permeability of the antibody.
  • the cells were treated with anti-human ZO-1 (Invitrogen, 1A12) antibody diluted 1:500 in 1% BSA and incubated at 4°C overnight. Afterwards, FITC-conjugated secondary antibody (Jackson ImmunoResearch, 200-002-037) was diluted 1:1000 in 1% BSA, treated with cells, and reacted at room temperature for 1 hour. Intracellular nuclei were stained with DAPI (4',6-diamidino-2-phenylindole, Sigma-Aldrich, D8417) (1 ⁇ l). The fluorescently stained cells were confirmed using a confocal microscope (LSM700 confocal laser scanning microscope, Carl Zeiss). Additionally, the cell images were analyzed using Zen 3.0 software (blue edition).
  • intestinal permeability can be improved by anti-WARS1 antibody in inflammatory bowel disease.
  • Example 11 Verification of the effect of anti-WARS1 antibody on improving inflammatory bowel disease using an inflammatory bowel disease mouse model
  • the DSS mouse model (dextran sulfate sodium-induced colitis model) was used as a mouse model for inflammatory bowel disease.
  • Mice were 6-10 week old female B57BL/6 mice (Orient Bio), and were raised in an SPF laboratory animal room maintained at a constant temperature and humidity of 21-23°C and relative humidity of 40-45%. In addition, the number of experimental animals per cage was less than 4, and cages were exchanged and fed three times a week.
  • DSS (MP biomedical, reagent-grade, MW 36-50 kDa, 160110) was dissolved in sterile water at a concentration of 2.5%, and then 100 ml of 2.5% DSS solution was supplied to each mouse cage, replaced once every two days. Clinical examinations were performed regularly until the end of the experiment to check the degree of inflammation and measure body weight. At this time, if the body weight decreased by more than 25% from the test start date, euthanasia was performed for ethical reasons. The experiment was terminated 7 to 8 days from the start of the experiment when the clinical index of the control group was judged to have reached its maximum.
  • test group was divided into a total of 4 groups (Figure 21).
  • DSS was administered from day 0, and from days 1, 3, and 5, negative control material (vehicle, saline), Isotype IgG1 (5 mg/kg, Bio , H54K, 5 mpk each) were administered intraperitoneally. At this time, saline, the vehicle, was administered orally.
  • DAI clinical activity index
  • the clinical activity index (DAI) was significantly decreased in the anti-WARS1 antibody (GKB101, H54K) administered group compared to the control group (saline), especially in the H54K administered group. A significant decrease was confirmed (*p ⁇ 0.05, ****p ⁇ 0.0001).
  • anti-WARS1 antibodies especially H54K, have an improvement effect on inflammatory bowel disease.
  • the body weight loss score which is one of the DAI evaluation items
  • the weight loss was evident compared to the normal group (con), but when compared with the Isotype IgG1 administered group, the anti-WARS1 antibody administered group showed significant weight loss. No significant difference could be observed.
  • the stool consistency score was decreased in the anti-WARS1 antibody (GKB101, H54K) administered group compared to the control group (saline), and it was confirmed that there was a significant decrease in particular in the H54K administered group (*p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001, ****p ⁇ 0.0001).
  • the results of analyzing the AUC of the stool consistency score also showed a similar pattern to the results during the administration period.
  • Colon tissue was removed from the experimental mouse of Example 11.1, and intestinal length was measured.
  • Example 11.2.5 Weight measurement of the spleen
  • the spleen was removed from the experimental mouse of Example 11.1, and the weight of the spleen was measured.
  • Intestinal tissues were extracted from the experimental mice of Example 11.1 for each region, protein and mRNA were separated, and the expression of immune factors was confirmed in each sample.
  • Protein samples were prepared as follows.
  • the entire intestine or the distal part was removed, and then protein lysis buffer was added to dissolve the tissue.
  • the lysate was centrifuged at 13,000 rpm, and only the supernatant was obtained, quantified, and used as an intestinal tissue sample.
  • the proteins isolated as above include IL-1 ⁇ (R&D systems, DY401), TNF- ⁇ (BioLegend, 430915), MCP-1 (R&D systems, DY479), IFN- ⁇ (R&D systems, DY485), and CXCL2/MIP2 ( R&D systems, DY425), IL-6 (BioLegend, 431315), IL-17A (R&D Systems, DY421), and MIP1 ⁇ (R&D systems, DY450) were used to measure the concentrations.
  • WARS1 was measured as follows.
  • WARS1 monoclonal antibody was coated on a 96-well plate (Maxisorp, Thermo Fisher) at a concentration of 1 ⁇ g/ml, and then blocked with PBS containing 1% BSA for 1 hour at room temperature. Samples or recombinant WARS1 were added to each coated well, reacted at room temperature for 1 hour, and then washed four times with PBST (PBS+Tween20). Anti-WARS1 antibody (MirimGENE Co., Ltd) was added to each well, reacted at room temperature for 1 hour, and then washed four times with PBST.
  • PBST PBS+Tween20
  • the protein expression of WARS1, TNF- ⁇ , IL-6, MIP1 ⁇ , and MCP-1 was significantly higher in the anti-WARS1 antibody (GKB101, H54K) administered group compared to the control group (saline).
  • a decrease could be confirmed.
  • a greater decrease was observed in the H54K antibody administered group.
  • the mRNA expression of immune factors such as TNF- ⁇ , IFN- ⁇ , MCP-1, IL-6, and iNOS was also significantly decreased in the anti-WARS1 antibody administered group compared to the control group, especially in the H54K antibody administered group.
  • a decrease was confirmed (Figure 28). At this time, it was confirmed that WARS1 expression in intestinal tissue was also significantly reduced.
  • anti-WARS1 antibody (GKB101, H54K) can inhibit the expression of inflammatory immune factors in intestinal tissue in an inflammatory bowel disease model, and in particular, the H54K variant antibody has better inhibitory activity compared to the GKB101 antibody. I was able to confirm.
  • Intestinal tissue was removed from the experimental mouse of Example 11.1, and H&E staining was performed in the same manner as Example 9.2.1 to observe the shape of the intestinal tissue.
  • Example 12 Confirmation of anti-inflammatory activity of anti-WARS1 antibody in rheumatoid arthritis-related cell lines
  • anti-WARS1 antibody H54K
  • the anti-inflammatory activity of anti-WARS1 antibody was confirmed using cells involved in rheumatoid arthritis.
  • the cells are osteoclasts differentiated from the human synovial cell-like fibroblast cell line (FLS, fibroblast like synoviocyte cell line, cell applications, 408K-05a), J774A.1 cells, a mouse macrophage cell line, and RAW264.7 cells, a mouse macrophage cell line. was used.
  • FLS human synovial cell-like fibroblast cell line
  • J774A.1 cells J774A.1 cells
  • a mouse macrophage cell line a mouse macrophage cell line
  • RAW264.7 cells a mouse macrophage cell line. was used.
  • the cell lines were inoculated into 96-well plates at 2 ⁇ 10 4 cells/well and cultured in DMEM containing 0.1% FBS for 24 hours.
  • WARS1 (10 ⁇ g/ml) and anti-WARS1 antibody (H54K, 10 ⁇ g/ml) were mixed and reacted at 37°C for 1 hour.
  • the prepared cells were treated with the WARS1/anti-WARS1 antibody mixture and cultured for an additional 16 hours.
  • the culture medium was taken and the concentrations of CXCL2 (R&D systems, DY452), MMP3 (R&D systems, DY548), IL-6 (BioLegend, #431304), and TNF- ⁇ (BioLegend, #430904) in the culture medium were measured using ELISA. Measured.
  • IgG was used as a control for anti-WARS1 antibody.
  • RAW264.7 cells were cultured for 5 days in 10% FBS/DMEM medium containing 50 ng/ml of the recombinant protein mouse RANKL (peprotech, 315-11) to induce differentiation into osteoclasts.
  • Example 13 Verification of the effect of anti-WARS1 antibody on improving rheumatoid arthritis using a rheumatoid arthritis mouse model
  • H54K anti-WARS1 antibody
  • mice used were 7-week-old male DBA/1J mice, and were raised in an SPF laboratory animal room where constant temperature and humidity was maintained at a temperature of 21-23°C and a relative humidity of 40-45% (IACUC No. 2021-0133).
  • the number of experimental animals in each cage was less than 6, and cages were changed and feed was supplied twice a week.
  • the stimulant for inducing arthritis was dissolved in 10 mM acetic acid to a concentration of 2 mg/ml, bovine type II collagen, and then dissolved in CFA (Complete). It was prepared by mixing 1:1 (v/v) with Freund's adjuvant, 2 mg/ml). Primary immunization was performed by intradermally injecting 100 ⁇ l of collagen prepared using the above method into the tail of 7-week-old mice.
  • IFA Incomplete Freund's adjuvant
  • type 2 fetal bovine collagen were mixed at a ratio of 1:1 (v/v), emulsified, and then intradermally injected into the tail of each mouse at 100 ⁇ l.
  • Primary immunization was performed. Mice that underwent secondary immunization were randomly divided and used as experimental groups. The experimental group was divided into an isotype IgG1 administration group (5 mg/kg) and an anti-WARS1 antibody (H54K, 5 mg/kg) administration group. Administration was administered intraperitoneally once every 2 days, for a total of 10 times, starting from the day of the second immunization (day 21).
  • the severity of arthritis was reduced in the anti-WARS1 antibody (KB101, H54K) administered group compared to the Isotype IgG1 administered group, and in particular, it was confirmed that there was a significant decrease in the H54K antibody administered group (IgG1 administered group vs. anti-WARS1 antibody) -WARS1 antibody administered group (H54K), 7.85 ⁇ 0.319 vs 4.59 ⁇ 0.182, *p ⁇ 0.05).
  • the results of analyzing the AUC of clinical arthritis index (CAI) also showed similar patterns to the results during the administration period.
  • Arthritis incidence was also decreased in the anti-WARS1 antibody (GKB101, H54K) administration group compared to the Isotype IgG1 administration group, and in particular, a significant decrease was confirmed in the H54K antibody administration group (Isotype IgG1 vs anti-WARS1 antibody (H54K), 46.42 ⁇ 7.945 vs 12.5 ⁇ 3.689, **p ⁇ 0.01).
  • the AUC analysis results of arthritis incidence also confirmed a significant decrease in the anti-WARS1 antibody (H54K) administration group compared to the Isotype IgG1 administration group (Isotype IgG1 vs anti-WARS1 antibody (H54K), 99.99 ⁇ 9.817 vs 35 ⁇ 3.931, *p ⁇ 0.05).
  • the anti-WARS1 antibody has a therapeutic effect in the rheumatoid arthritis model, and in particular, the H54K antibody is more effective than the GKB101 antibody.
  • Example 13.3 Analysis of inflammatory and osteoclast factor concentrations in serum and foot joints
  • Serum and foot joints were obtained from the experimental mice of Example 13.1, and the concentrations of inflammatory cytokines and chemokines were measured.
  • the protein in the foot joint was dissolved by removing the skin tissue from the joint tissue of the mouse and adding protein lysis buffer.
  • the lysate was centrifuged at 13,000 rpm to obtain the supernatant, which was quantified and used as joint tissue protein.
  • WARS1, inflammatory cytokines, and chemokines in serum and foot joints were tested using mouse CXCL2/MIP-2 ELISA (R&D systems) kit, mouse IL-6 ELISA (BioLegend) kit, and mouse MIP1- ⁇ ELISA (R&D systems). using the kit, MMP3 (R&D systems, DY548), IL-6 (BioLegend, #431304), TNF- ⁇ (BioLegend, #430904), IL-17A, IL-17F, MMP9, RANKL, and IL-1 ⁇ kit. It was measured using ELISA, and the method was carried out according to the manufacturer's method.
  • the anti-WARS1 antibody (GKB101, H54K) not only suppressed the expression of inflammatory cytokines and chemokines in the rheumatoid arthritis model, but also suppressed the expression of chondrocyte destructive factor/osteoclast differentiation factor.
  • H54K anti-WARS1 antibody
  • human dermal fibroblast adult
  • HDFa human dermal fibroblast adult
  • HaCat human keratinocytes
  • HDFa and HaCat cells were seeded in a 96-well plate at 2 ⁇ 10 4 cells/well and cultured in DMEM containing 0.1% FBS for 24 hours.
  • Staphylococcus aureus Antibiotic Resistant Strain Bank, CCARM2307
  • MOI multiplicity of infection
  • PBS vehicle
  • H54K 1.25 ⁇ g/ml of anti-WARS1 antibody
  • each cell culture was collected and the concentrations of IL-8 (BioLegend, #431504), MCD1 (R&D systems, DY336), TARC (R&D systems, DY364), and WARS1 in the culture were measured using ELISA. did. At this time, the concentration of WARS1 in the cell culture was measured using the same method as Example 11.3.
  • HDFa and HaCat cells were seeded in a 24-well plate at 1 ⁇ 10 5 cells/well and cultured in DMEM containing 0.1% FBS for 24 hours. Afterwards, the culture bottom of the well was scraped using a micro-tip to form a certain space without cells. WARS1 (20 ⁇ g/ml) and anti-WARS1 antibody (H54K, 20 ⁇ g/ml) were mixed and reacted at 37°C for 1 hour. The mixed solution was applied to the corresponding well and cultured for an additional 16 hours. After 16 hours, each well was observed under a light microscope, and the migration and proliferation of cells were recorded through photographs.
  • Example 15 Verification of atopic dermatitis improvement effect of anti-WARS1 antibody in atopic mouse model
  • mice used were 8-week-old female NC/Nga mice, and were raised in an SPF laboratory animal room maintained at a constant temperature and humidity at a temperature of 21-23°C and a relative humidity of 40-45%.
  • the number of experimental animals in each cage was less than 3, and cages were exchanged and fed once a week.
  • SpA Staphylococcus protein A, Sigma Aldrich
  • Anti-WARS1 antibody (H54K) 10 mg/kg or Isotype IgG1 (10 mg/kg) was administered intraperitoneally 3 times a week for a total of 6 times.
  • Isotype IgG1 was used as a control group
  • dexamethasone was used as a positive control group.
  • Dexamethasone was administered intraperitoneally at a concentration of 10 mg/kg, three times a week, for a total of six times (Figure 35).
  • isotype IgG1, dexamethasone, or anti-WARS1 antibody (H54K) was administered to an atopic mouse model, and skin erythema/bleeding, wounds/dryness, swelling, and exfoliation were administered. was observed to clinically evaluate the occurrence of atopic dermatitis.
  • the dermatitis score for the four indicators in the Isotype IgG1 administration group significantly increased compared to the normal group (naive, group that did not cause dermatitis).
  • the dermatitis index was significantly reduced compared to the Isotype IgG1 administered group.
  • the CpG (CpG oligodeoxynucleotides (ODN)-induced macrophage activation syndrome model) mouse model was used as a macrophage activation syndrome mouse model.
  • the mice used were female B57BL/6J mice aged 8-10 weeks, and were raised in the SPF Laboratory Animal Center where constant temperature and humidity is maintained at a temperature of 21-23°C and a relative humidity of 40-45%. In addition, the number of animals per cage was 5, and cages were exchanged and food was supplied once a week.
  • CpG ODN (InvivoGen, Class B, tlrl-1826) was diluted in PBS to a concentration of 45 ⁇ g/200 ⁇ l, stored at -80°C, and administered once a day for each mouse, a total of 5 times (0, 2, 4). , 6, 8 days) 200 ⁇ l each was administered intraperitoneally. One day after the last administration (day 9), blood was collected from the heart of an anesthetized mouse, and then the liver and spleen were collected to check the level of inflammatory indicators and cell activity. The condition of the mouse was checked once a day until the end of the experiment.
  • test group was divided into a total of 6 groups, and on each CpG administration day, 2 hours after CpG administration, negative control group PBS, Isotype IgG (10 mg/kg, Bio , 15 mg/kg) or GKB101 (10 mg/kg)] was administered intraperitoneally at each concentration. All data were expressed as standard deviation (SEM) and were subjected to multiple comparison analysis using the ANOVA statistical method (FIG. 38).
  • the expression of WARS1, inflammatory cytokines, and chemokines was decreased in the anti-WARS1 antibody (GKB101, H54K) administered group compared to the PBS administered group or the Isotype IgG administered group.
  • the expression of WARS1, inflammatory cytokines, and chemokines was decreased in a concentration-dependent manner.
  • T cells and natural killer cells were removed and passed through a 70 ⁇ m cell strainer. A single cell was secured. Immunofluorescence staining was performed on the cells. The antibodies used at this time are shown in Table 24 below.
  • the above antibodies excluding the anti-mouse IFN- ⁇ antibody, were applied to each corresponding cell sample tube, reacted for 20 minutes, and then washed with FACS buffer.
  • the tube sample to confirm the distribution of activated Th1 cells was fixed/permeabilized using fix/perm buffer (invitrogen, 00-5523-00).
  • the sample tube was reacted with a PE anti-mouse IFN- ⁇ antibody, washed with FACS buffer, and flow cytometry was performed.
  • the above analysis values were divided into CD45+CD11b+CD27-NK1.1+ (activated NK cells), CD45+CD3+CD8+IFN ⁇ + (activated Th1 cells) using the FlowJo program (FlowJoTM v7 Software, BD Biosciences).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Rheumatology (AREA)
  • Genetics & Genomics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Pain & Pain Management (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

항-WARS1 항체 및 이를 유효성분으로 포함하는 약학 조성물에 관한 것이다. 본 발명에 의한 항-WARS1 항체는 WARS1에 특이적으로 결합하였으며, WARS1에 의해 유도되는 TNF-α의 분비를 억제할 수 있다. 또한 본 발명에 의한 항-WARS1 항체는 패혈증, 만성 폐쇄성 폐질환, 염증성 장질환, 류마티스 관절염, 아토피 피부염, 대식세포 활성화 증후군 등을 포함하는 염증성 질환의 예방 또는 치료 용도로 효과적으로 사용될 수 있다.

Description

항―WARS1 항체 및 이의 용도
본 발명은 WARS1 단백질에 특이적으로 결합하는 항체 및 이의 용도에 관한 것이다.
아미노아실 티알엔에이 합성효소(aminoacyl-tRNA synthetase, ARS)는 아미노산을 특이적으로 tRNA에 결합시키는 반응을 매개하는 효소로서, 단백질 생성에 중추적인 역할을 담당한다. 최근, 상기 ARS가 단백질 생성 외에도 세포사멸(apoptosis), 혈관형성(angiogenesis), 염증반응 등 다양한 생명현상에 관여하는 것으로 알려져 있다. ARS 중 인간 트립토파닐 티알엔에이 합성효소 1(tryptophanyl-tRNA synthetase 1, WARS1)은 트립토판을 인지하는 tRNA와 트립토판을 연결하는 아미노아실 티알엔에이 합성효소로서, 최근에는 감염에 대한 숙주 방어 기전에 있어서의 WARS1의 역할에 대해 관심이 높아지고 있다. 본 발명자들은 이전에, 단핵구가 세균 감염 후 수분 이내에 신규(de novo) 합성 없이 세포 내 존재하는 WARS1을 세포 밖으로 분비한다는 것을 보고하였다(Young Ha Ahn. et al. Nature Microbiology (2016) 2:16191).
분비된 WARS1은 TLR4와 TLR2의 내생 리간드로 기능함으로써, 대식세포를 활성화하여 선천적인 면역의 활성화를 유도한다. 또한, WARS1은 TNF-α, IL-6, MIP-1α, IL-8을 포함하는 전염증성 사이토카인 및 케모카인 생산을 개시하고 호중구의 침윤을 유발한다. 이후 WARS1 유전자의 발현이 IFN-γ에 의해 유도되어 WARS1의 지속적인 분비를 유지한다. 이러한 발견과 일치하게도, WARS1은 패혈증 환자의 혈액에서 높은 수준으로 관찰되었다.
이를 반영하여 세균, 바이러스 및/또는 곰팡이에 의한 감염성 및/또는 염증성 질환의 치료를 위해 항-WARS1 항체를 개발하는 전략을 생각해 볼 수 있다. 그러나, WARS1을 포함하는 ARS들은 단백질 구조상 유사한 점이 많아, 면역반응으로 얻어지는 항체는 다른 ARS에도 교차 반응을 보이는 등 고감도의 항체가 생성되지 않는 경우가 많다.
따라서, 다른 ARS에 대한 교차 반응 없이 WARS1에만 특이적으로 결합하여 WARS1을 효과적으로 중화할 수 있는 항체의 개발이 절실한 상황이다.
본 발명자들은 패혈증과 같은 감염질환 환자에서 그 발현량이 현저히 증가하는 WARS1에 특이적으로 결합하는 항체 또는 이의 단편을 발굴하고자 노력하였다. 그 결과, WARS1에 특이적으로 결합하면서 면역세포에서 염증 반응을 억제하는 신규한 항-WARS1 항체를 제조하고, 그의 약리 활성을 확인함으로써 본 발명을 완성하였다.
상기 목적을 달성하기 위하여, 본 발명의 일 측면은 서열번호 3의 아미노산 서열을 포함하는 H-CDR1, 서열번호 5의 아미노산 서열을 포함하는 H-CDR2 및 서열변호 7의 아미노산 서열을 포함하는 H-CDR3을 포함하는 중쇄 가변 영역; 및 서열번호 12의 아미노산 서열을 포함하는 L-CDR1, 하기의 서열번호 95로 표현되는 아미노산 서열을 포함하는 L-CDR2 및 하기의 서열번호 96으로 표현되는 아미노산 서열을 포함하는 L-CDR3을 포함하는 경쇄 가변 영역;을 포함하는 항-WARS1 항체 또는 이의 단편을 제공한다:
N 말단-Ala Asn Xaa1 Xaa2 His Arg Pro Ser-C 말단(서열번호 95),
여기서, Xaa1은 Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly 또는 Pro이며,
Xaa2는 Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly 또는 Pro이고,
Xaa1이 Ser인 경우, Xaa2는 His가 아니며,
N 말단-Gly Ala Trp Asp Asp Ser Xaa3 Ser Ala Tyr Val-C 말단(서열번호 96),
여기서, Xaa3은 Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly 또는 Pro이다.
본 발명의 다른 측면은 상기 항체 또는 이의 단편을 암호화하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현 벡터 및 상기 발현 벡터가 도입된 형질전환 세포를 제공한다.
본 발명의 또 다른 측면은 상기 형질전환 세포를 배양하는 단계 및 항체 또는 이의 단편을 수득하는 단계를 포함하는 항체 또는 이의 단편의 제조 방법을 제공한다.
본 발명의 또 다른 측면은 상기 항체 또는 이의 단편을 유효성분으로 포함하는 염증성 질환의 예방 또는 치료용 약학 조성물을 제공한다.
본 발명의 또 다른 측면은 상기 항체 또는 이의 단편의 염증성 질환 예방 또는 치료용 용도를 제공한다.
본 발명의 또 다른 측면은 상기 항체 또는 이의 단편을 개체에 투여하는 단계를 포함하는 염증성 질환의 예방 또는 치료 방법을 제공한다.
본 발명에 의한 항-WARS1 항체는 WARS1에 특이적으로 결합하였으며, 면역세포에서 WARS1에 의해 유도되는 TNF-α의 분비를 억제하였다. 또한 본 발명의 항-WARS1 항체를 중증 패혈증 마우스 모델, 만성 폐쇄성 폐질환 마우스 모델, 염증성 장질환 마우스 모델, 류마티스 관절염 마우스 모델, 아토피 피부염 마우스 모델 및 대식세포 활성화 증후군 모델에 투여한 결과, 각 질환의 마우스 모델에서 모두 질환의 개선 효과를 나타내었다. 따라서, 본 발명에 의한 항-WARS1 항체는 염증성 질환의 치료 용도로 효과적으로 사용될 수 있다.
도 1은 항-WARS1 항체의 중쇄를 발현시키기 위한 벡터의 모식도이다.
도 2는 항-WARS1 항체의 경쇄를 발현시키기 위한 벡터의 모식도이다.
도 3a 및 도 3b는 항-WARS1 항체를 SDS-PAGE로 확인한 결과를 나타낸 도면이다.
도 4a 및 도 4b는 항-WARS1 항체 및 WARS1(인간, 마모셋(NHP), 마우스, 래트 또는 돼지 유래)의 결합력을 direct ELISA를 통해 확인한 결과를 나타낸 그래프이다.
도 5는 항-WARS1 항체와 WARS1(인간, 마모셋(NHP), 마우스, 래트 또는 돼지 유래)의 결합력을 direct ELISA 측정법을 통해 확인한 결과를 Kd(dissociation constant)로 나타낸 그래프이다.
도 6a 내지 도 6c는 항-WARS1 항체 및 WARS1(인간, 마모셋(NHP), 마우스, 래트 또는 돼지 유래)의 결합력을 샌드위치 ELISA 측정법을 통해 확인한 결과를 나타낸 그래프이다.
도 7은 항-WARS1 항체의 재조합 WARS1 단백질 및 분비된 WARS1에 대한 결합 특이도를 웨스턴 블롯을 통해 확인한 결과를 나타낸 도면이다. hu: 인간, Mar: 마모셋(NHP), P: 돼지, R: 래트, M: 마우스
도 8은 인간 WARS1 서열의 펩타이드 제작 및 항체 결합 특이도를 이용한 에피토프 매핑 결과를 나타낸 것이다.
도 9a 내지 도 9c는 에피토프 맵핑을 위한 인간 WARS1 재조합 단백질의 알라닌(Ala) 돌연변이체 제작 및 결과를 나타낸 도면이다.
도 10은 마우스 대식세포주(J774.1A)에 재조합 WARS1 단백질과 IgG 또는 항-WARS1 항체를 처리한 후, 배지 내 TNF-α의 농도를 측정한 결과를 나타낸 그래프이다.
도 11은 패혈증 마우스 모델을 이용하여 항-WARS1 항체의 항염 효과를 확인하기 위한 실험 스케줄을 나타낸 도면이다.
도 12는 중증 패혈증 마우스 모델에 IgG1 또는 항-WARS1 항체를 투여한 뒤, 마우스의 생존율을 확인한 결과를 나타낸 그래프이다.
도 13은 pOptiVec Topo 벡터의 염기서열을 나타낸 도면이다.
도 14는 인간 폐섬유아세포(HLF)에서 항-WARS1 항체(GKB101, H54K)의 항염 활성을 확인한 결과를 나타낸 그래프이다. *p<0.05, **p<0.01, ***p<0.001 vs PBS
도 15는 COPD 마우스 모델을 이용하여 항-WARS1 항체(H54K)의 호흡기 손상 억제 효능을 검증하기 위한 실험 스케쥴을 나타낸 도면이다.
도 16a 및 도 16b는 COPD 마우스 모델에 Normal, Isotype IgG1 또는 항-WARS1 항체(H54K)를 투여한 뒤, 폐 조직 내 침윤된 면역세포, 콜라겐 침착, 및 기도 내 점액분비를 각각 H&E 염색, Massone Trichrome 염색, Periodic acid-Schiff-Alcian Blue(PAS-AB) 염색을 통해 확인한 결과를 나타낸 도면이다.
도 17a 및 도 17b는 COPD 마우스 모델에 PBS(CON), Isotype IgG1 또는 항-WARS1 항체(H54K)를 투여한 뒤, 폐포 세척액(17a) 및 폐 조직(17b) 내의 염증성 사이토카인 및 케모카인의 발현을 확인한 결과를 나타낸 그래프이다. *p<0.05, **p<0.001
도 17c는 COPD 마우스 모델에 PBS(CON), Isotype IgG1 또는 항-WARS1 항체(H54K)를 투여한 뒤, 폐 조직 내 기침 유발 유전자의 발현을 q-PCR을 통해 확인한 결과를 나타낸 그래프이다.
도 18a 및 도 18b는 COPD 마우스 모델에 PBS(CON), Isotype IgG1 또는 항-WARS1 항체(H54K)를 투여한 뒤, 폐 조직(18b) 및 폐포 세척액(18a) 내의 면역세포를 분석한 결과를 나타낸 그래프이다.
도 19는 COPD 마우스 모델에 PBS(CON), Isotype IgG1 또는 항-WARS1 항체(H54K)를 투여한 뒤, 종격동 림프절(mediastinal lymph node) 내의 면역세포를 유세포 분석을 통해 분석한 결과를 나타낸 그래프이다.
도 20은 COPD 마우스 모델에 PBS(CON), Isotype IgG1 또는 항-WARS1 항체(H54K)를 투여한 뒤, 혈액 내 면역세포를 유세포 분석을 통해 분석한 결과를 나타낸 그래프이다.
도 21은 DSS(dextran sulfate sodium-induced colitis) 마우스 모델을 이용하여 항-WARS1 항체의 염증성 장질환 개선 효과를 확인하기 위한 실험 스케쥴을 나타낸 도면이다.
도 22a는 DSS 마우스 모델을 이용한 항-WARS1 항체(GKB101, H54K)의 염증성 장질환 개선 효과를 평가하기 위한 임상활성지수(disease activity index: DAI)를 부여하는 임상지표 결정 기준을 나타낸 도면이다.
도 22b는 DSS 마우스 모델에서 생리식염수(saline), Isotype IgG1(IgG1) 또는 항-WARS1 항체(GKB101, H54K) 투여 후, 각 투여군의 임상활성지수를 평가한 결과를 나타낸 그래프이다. 이때, control은 무처리군이다.
도 23은 DSS 마우스 모델에서 생리식염수(saline), Isotype IgG1(IgG1) 또는 항-WARS1 항체(GKB101, H54K) 투여 후, 각 투여군의 장 출혈 스코어를 평가한 결과를 나타낸 그래프이다. 이때, control은 무처리군이다.
도 24는 DSS 마우스 모델에서 생리식염수(saline), Isotype IgG1(IgG1) 또는 항-WARS1 항체(GKB101, H54K) 투여 후, 각 투여군의 대장의 일관성(stool consistency) 스코어를 평가한 결과를 나타낸 그래프이다. 이때, control은 무처리군이다.
도 25는 DSS 마우스 모델에서 생리식염수(saline), Isotype IgG1(IgG1) 또는 항-WARS1 항체(GKB101, H54K) 투여 후, 각 투여군의 장 길이를 측정 결과를 나타낸 그래프이다. 이때, control은 무처리군이다.
도 26은 DSS 마우스 모델에서 생리식염수(saline), Isotype IgG1(IgG) 또는 항-WARS1 항체(GKB101, H54K) 투여 후, 각 투여군의 비장 무게를 측정한 결과를 나타낸 그래프이다. 이때, control은 무처리군이다.
도 27은 DSS 마우스 모델에서 생리식염수(saline), Isotype IgG1(IgG) 또는 항-WARS1 항체(GKB101, H54K) 투여 후, 장 조직의 각 부위에서 면역인자를 측정한 결과를 나타낸 그래프이다. *p<0.05, ***p<0.001, ****p<0.0001 vs 생리식염수 투여군
도 28은 DSS 마우스 모델에서 생리식염수(saline), Isotype IgG1(IgG) 또는 항-WARS1 항체(GKB101, H54K) 투여 후, 장 조직의 각 부위에서 면역인자의 유전자 발현을 qPCR을 통해 확인한 결과를 나타낸 그래프이다. *p<0.05, **p<0.01, ***p<0.001 vs 생리식염수 투여군
도 29는 DSS 마우스 모델에서 생리식염수(saline), isotype IgG1(IgG) 또는 항-WARS1 항체(GKB101, H54K) 투여 후, 각 투여군의 대장 조직의 Crypt 손상 정도를 H&E 염색법을 통해 확인한 결과를 나타낸 도면이다.
도 30은 J774A.1 세포, 인간 윤활막세포 유사 섬유아세포(FLS, fiblroblast like synoviocyte) 및 RAW264.7 세포에서 분화된 파골세포에서 항-WARS1 항체(H54K)의 항염 활성을 확인한 결과를 나타낸 그래프이다. *p<0.05, **p<0.01, ***p<0.001
도 31은 CIA(collagen-induced arthritis) 마우스 모델에서 항-WARS1 항체의 류마티스 관절염 개선 효과 검증하기 위한 실험 스케쥴을 나타낸 도면이다.
도 32a는 CIA 마우스 모델에 Isotype IgG1 또는 항-WARS1 항체(GKB101, H54K)를 투여한 후, 각 투여군의 족부를 관찰하여 임상 관절염 지수를 평가하기 위한 임상지표 기준을 나타낸 도면이다.
도 32b는 CIA 마우스 모델에 Isotype IgG1 또는 항-WARS1 항체(GKB101, H54K)를 투여한 후, 각 투여군의 족부를 관찰하여 임상 관절염 지수 및 임상 관절염 지수 분석 결과 및 이에 대한 AUC를 나타낸 그래프이다. *p<0.05, **p<0.01, vs H54K 항체 투여군
도 33a 내지 도 33d는 CIA 마우스 모델에 Isotype IgG1 또는 항-WARS1 항체(GKB101, H54K)를 투여한 후, 각 투여군의 혈청 및 족부 관절 내 염증인자의 발현을 확인한 결과를 나타낸 그래프이다. *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001 vs 항-WARS1 항체 투여군
도 34a 내지 도 34c는 Staphylococcus aureus을 처리한 성인 인간 유래 진피 섬유아세포(HDFa, human dermal fibroblast) 또는 인간 각질 형성 세포(human keratinocyte)에서 항-WARS1 항체(GKB101, H54K)의 항염 활성, 세포의 이동 및 증식 억제 효과를 확인한 결과를 나타낸 그래프 및 도면이다. *p<0.05, ***p<0.001, ****p<0.0001 vs PBS
도 35는 아토피 마우스 모델에 항-WARS1 항체의 아토피 피부염 개선 효과를 확인하기 위한 실험 스케쥴을 나타낸 도면이다.
도 36은 아토피 마우스 모델에 Isotype IgG1, 덱사메타손(dexamethasone) 또는 항-WARS1 항체(GKB101, H54K)를 투여한 후, 각 투여군의 임상지표를 평가한 결과를 나타낸 도면이다.
도 37은 인간 대장암 세포주(Caco-2)에서 항-WARS1 항체(GKB101, H54K)에 의한 tight junction 개선을 확인한 결과를 나타낸 그래프이다. *p<0.05, **p<0.01, ***p<0.001 vs PBS
도 38은 CpG를 이용한 대식세포 활성화 증후군 모델에서 항-WARS1 항체(GKB101, H54K)의 조직 내 항염증 효과를 확인하기 위한 실험 스케쥴을 나타낸 도면이다.
도 39는 CpG를 이용한 대식세포 활성화 증후군 모델에서 항-WARS1 항체(GKB101, H54K)를 투여한 후, 임상지표 중 하나인 Ferritin을 평가한 결과를 나타낸 도면이다.
도 40a 및 도 40b는 CpG를 이용한 대식세포 활성화 증후군 모델에서 항-WARS1 항체(GKB101, H54K)를 투여한 후, 마우스의 간 조직에서의 WARS1 및 염증성 사이토카인의 발현을 측정한 결과를 나타낸 그래프이다.
도 41a 및 도 41b는 CpG를 이용한 대식세포 활성화 증후군 모델에서 항-WARS1 항체(GKB101, H54K)를 투여한 후, 마우스의 비장 및 간 조직에서의 면역세포의 분포 및 침투를 분석한 결과를 나타낸 그래프이다.
항-WARS1 항체
본 발명은 WARS1에 특이적으로 결합하는 항체 또는 이의 단편을 제공한다.
이때, 상기 WARS1에 특이적으로 결합하는 항체 또는 이의 단편은 R20, R24, K27, I36, I43, K47에 특이적으로 결합하는 항체 또는 이의 단편일 수 있다. 상기 WARS1은 서열번호 94의 아미노산 서열을 포함하는 인간 WARS1일 수 있다.
본 명세서에서 사용하는 용어, "항체"는 특정 항원과 면역학적으로 반응하는 면역글로불린 분자로, 항원을 특이적으로 인식하는 단백질 분자를 의미한다. 면역글로불린의 중쇄 및 경쇄는 각각 불변 영역(constant region, C) 및 가변 영역(variable region, V)을 포함할 수 있다. 면역글로불린의 경쇄 및 중쇄 가변 영역은, 상보성 결정 영역(complementarity determining region, CDR)이라 불리는 3개의 다변가능한 영역 및 4개의 구조 영역(framework region, FR)을 포함한다. 상기 CDR은 주로 항원의 에피토프에 결합하는 항원 결합 부위이다.
본 명세서에서 사용하는 용어, "WARS"는 트립토파닐 티알엔에이 합성효소(tryptophanyl-tRNA synthetase)를 의미하며, 트립토판티알엔에이 연결효소(tryptophan-tRNA ligase), TrpRS, WRS 등으로도 알려져 있다. WARS는 아미노산 트립토판과 tRNA의 아미노아실레이션(aminoacylation) 반응을 매개하는 효소이다. WARS는 인간에서는 WARS 유전자에 의해 암호화되며, 단백질의 아미노산 서열과 mRNA 염기 서열은 Genbank accession number NP_004175.2(단백질), GenBank accession number NM_004184.3(mRNA 염기서열) 등으로 공지되어 있다. WARS는 cytoplasmic form(WARS1 또는 tryptophanyl-tRNA synthetase 1, cytoplasmic)과 mitochondrial form(WARS2 또는 tryptophanyl-tRNA synthetase 2, mitochondrial)의 두 가지 아형(isoform)이 있다. 본 발명에서 WARS는 WARS1일 수 있다. 상기 WARS1은 제한되지는 않으나, 바람직하게는 서열번호 94의 아미노산 서열을 포함하는 인간 WARS1인 것일 수 있다.
본 발명의 항-WARS1 항체는 상기 WARS1에 특이적으로 결합하는 항체 또는 이의 단편일 수 있다. 또한, 상기 항체의 단편은 본 발명의 항체의 단편은 Fab, F(ab')2, Fd, sdFv, Fv, dAb, scFv, sdAb, 테트라머 등일 수 있으며, WARS1에 특이적으로 결합할 수 있는 항원 결합 부위를 포함하는 것이면 어떠한 형태도 포함할 수 있다.
본 발명의 일 측면은 서열번호 3의 아미노산 서열을 포함하는 H-CDR1, 서열번호 5의 아미노산 서열을 포함하는 H-CDR2 및 서열변호 7의 아미노산 서열을 포함하는 H-CDR3을 포함하는 중쇄 가변 영역; 및 서열번호 12의 아미노산 서열을 포함하는 L-CDR1, 하기의 서열번호 95로 표현되는 아미노산 서열을 포함하는 L-CDR2 및 하기의 서열번호 96으로 표현되는 아미노산 서열을 포함하는 L-CDR3을 포함하는 경쇄 가변 영역;을 포함하는 항-WARS1 항체 또는 이의 단편을 제공한다:
N 말단-Ala Asn Xaa1 Xaa2 His Arg Pro Ser-C 말단(서열번호 95),
여기서, Xaa1은 Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly 또는 Pro이며,
Xaa2는 Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly 또는 Pro이고,
Xaa1이 Ser인 경우, Xaa2는 His가 아니며,
N 말단-Gly Ala Trp Asp Asp Ser Xaa3 Ser Ala Tyr Val-C 말단(서열번호 96),
여기서, Xaa3은 Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly 또는 Pro일 수 있다.
구체적으로, 상기 경쇄 가변 영역의 L-CDR2에서 Xaa1은 Ile, Leu, Thr, Val 및 Gln로 이루어진 군에서 선택되는 어느 하나일 수 있으며, 이때 Xaa2는 His 또는 Leu일 수 있다. 또한, Xaa1이 Ser인 경우 Xaa2는 Ile, Leu, Lys, Glu 및 Phe으로 이루어진 군에서 선택되는 어느 하나일 수 있다.
구체적으로, 상기 경쇄 가변 영역의 L-CDR3에서 Xaa3은 Leu 또는 Asn일 수 있다.
더 구체적으로, 상기 경쇄 가변 영역의 L-CDR1은 서열번호 12의 아미노산 서열을 포함하고, L-CDR2는 서열번호 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42 및 44로 이루어진 군에서 선택되는 어느 하나의 아미노산 서열을 포함하고, L-CDR3은 서열번호 16 또는 서열번호 46의 아미노산 서열을 포함할 수 있다.
바람직하게, 상기 중쇄 가변 영역은 서열번호 9의 아미노산 서열을 포함하는 것일 수 있다. 또한, 상기 경쇄 가변 영역은 서열번호 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 48 및 49로 이루어진 군에서 선택되는 어느 하나의 아미노산 서열을 포함할 수 있다.
본 발명의 일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 21을 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 23을 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 25를 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 27을 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 29를 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 31을 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 33을 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 35를 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 37을 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 39를 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 41을 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 43을 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 45를 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 47을 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 48을 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
일 구체예로 상기 항체 또는 이의 단편은 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 49를 포함하는 경쇄 가변 영역을 포함하는 것일 수 있다.
본 발명에서 상기 항체 또는 이의 단편은 면역글로불린 Fc 영역을 포함할 수 있다. 이때, 상기 면역글로불린의 Fc 영역은 면역글로불린의 중쇄 불변 영역 2(CH2) 및 중쇄 불변 영역 3(CH3)을 포함하며, 면역글로불린의 중쇄 및 경쇄의 가변 영역 및 경쇄 불변 영역(CL)은 포함하지 않는 단백질을 의미한다. 상기 면역글로불린 Fc 영역은 IgG, IgA, IgE, IgD 또는 IgM 유래 일 수 있다.
또한, 상기 면역글로불린의 Fc 영역은 야생형 Fc 영역 뿐만 아니라, Fc 영역 변이체일 수 있다. 또한, 본 명세서에서 사용하는 용어 "Fc 영역 변이체"는 야생형 Fc 영역의 당쇄 형태(glycosylation pattern)와 다르거나, 야생형 Fc 영역에 비해 증가된 당쇄, 야생형 Fc 영역에 비해 감소한 당쇄, 또는 당쇄가 제거(deglycosylated)된 형태일 수 있다. 또한, 무당쇄(aglycosylated) Fc 영역도 포함된다. Fc 영역 혹은 변이체는 배양조건 혹은 호스트의 유전자 조작을 통해 조정된 숫자의 시알산(sialic acid), 퓨코실화(fucosylation), 당화(glycosylation)를 갖도록 한 것일 수 있다.
또한, 화학적 방법, 효소적 방법 및 미생물을 사용한 유전공학적 엔지니어링 방법 등과 같이 통상적인 방법으로 면역글로불린의 Fc 영역의 당쇄를 변형시킬 수 있다. 또한, 상기 Fc 영역 변이체는 면역글로불린 IgG, IgA, IgE, IgD 또는 IgM의 Fc 영역이 혼합된 형태일 수 있다. 또한, 상기 Fc 영역 변이체는 상기 Fc 영역의 일부 아미노산이 다른 아미노산으로 치환된 형태일 수 있다.
본 발명의 일 구체예에서 상기 Fc 영역은 서열번호 51의 아미노산 서열을 포함할 수 있다.
본 발명의 항체는 항-WARS1 항체의 경쇄 가변 영역(VL) 및 경쇄 불변 영역(CL)을 포함하는 융합단백질과 항-WARS1 항체의 중쇄 가변 영역(VH), 중쇄 불변 영역 1(CH1) 및 Fc 영역을 포함하는 융합단백질을 포함할 수 있다.
구체적으로, 상기 항-WARS1 항체는 (I) 및 (II)를 포함하는 것일 수 있다.
N'-X'-[링커]o-Fc 영역 단편 또는 이의 변이체-C' (I); 및
N'-X''-C' (II)
이때, 상기 구조식 (I) 및 (II)에 있어서,
상기 N'은 N 말단이고,
상기 C'는 C 말단이며,
상기 X는 항-WARS1 항체 또는 이의 단편의 항원 결합 부위로, X' 및 X''으로 이루어져 있으며,
상기 X'는 항-WARS1 항체 또는 이의 단편의 중쇄의 항원 결합 부위로 가변 영역(VH) 및 CH1 영역을 포함하며,
상기 X''는 항-WARS1 항체 또는 이의 단편의 경쇄 항원 결합 부위로 가변 영역(VL) 및 불변 영역(CL)을 포함하고,
상기 링커는 펩타이드 링커이며,
상기 o는 O 또는 1이다.
이때, 항-WARS1 항체 또는 이의 단편, 항원 결합 부위, 가변 영역 및 불변 영역은 상술한 바와 동일하다.
상기 펩타이드 링커는 1 내지 50개의 연속된 아미노산 또는 3 내지 30개의 연속된 아미노산으로 이루어질 수 있다. 일 구체예로 상기 펩타이드 링커는 23개의 아미노산으로 이루어질 수 있다. 또한, 펩타이드 링커는 적어도 하나의 시스테인을 포함할 수 있다. 구체적으로, 하나, 두 개 또는 세 개의 시스테인을 포함할 수 있다. 또한, 상기 펩타이드 링커는 면역글로불린의 힌지에서 유래된 것일 수 있다. 예를 들어, 상기 힌지는 다양한 IgG 하위 유형 항체의 힌지 영역으로부터 선택될 수 있다. 또한, 상기 힌지는 면역글로불린 유래의 힌지 영역의 일부 아미노산이 다른 아미노산으로 치환된 형태이거나, 일부 아미노산 서열이 추가된 서열일 수 있다. 일 구체예에서는, 상기 펩타이드 링커는 서열번호 50의 아미노산 서열로 이루어진 펩타이드 링커일 수 있다.
항-WARS1 항체를 암호화하는 폴리뉴클레오티드
본 발명의 다른 측면은 항-WARS1 항체 또는 이의 단편을 암호화하는 폴리뉴클레오티드를 제공한다. 상기 항-WARS1 항체 또는 이의 단편은 상술한 바와 동일하다.
상기 폴리뉴클레오티드는 항-WARS1 항체 또는 이의 단편의 중쇄 영역을 암호화하는 서열번호 52의 염기서열을 포함할 수 있다. 상기 폴리뉴클레오티드는 항-WARS1 항체 또는 이의 단편의 경쇄 영역을 암호화하는 서열번호 54 내지 서열번호 69로 이루어진 군에서 선택되는 어느 하나의 염기서열을 포함할 수 있다.
또한, 상기 폴리뉴클레오티드는 동일한 폴리펩타이드를 암호화한다면, 하나 이상의 염기가 치환, 결실, 삽입 또는 이들의 조합에 의해 변이될 수 있다. 폴리뉴클레오티드 서열을 화학적으로 합성하여 제조하는 경우, 당업계에 널리 공지된 합성법, 예를 들어 문헌(Engels and Uhlmann, Angew Chem IntEd Engl., 37:73-127, 1988)에 기술된 방법을 이용할 수 있으며, 트리에스테르, 포스파이트, 포스포르아미다이트 및 H-포스페이트 방법, PCR 및 기타 오토프라이머 방법, 고체 지지체상의 올리고뉴클레오티드 합성법 등을 들 수 있다.
일 구체예에 따르면, 상기 폴리펩타이드는 서열번호 52, 서열번호 54 내지 서열번호 69의 염기서열과 적어도 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99%, 또는 적어도 약 100%의 동일성을 가지는 염기서열을 포함할 수 있다.
상기 폴리뉴클레오티드는 신호 서열(signal sequence) 또는 리더 서열(leader sequence)을 추가적으로 포함할 수 있다. 여기에서 사용하는 용어 "신호 서열"은 목적 단백질의 분비를 지시하는 신호 펩타이드를 암호화하는 핵산을 의미한다. 상기 신호 펩타이드는 숙주 세포에서 번역된 후에 절단된다. 구체적으로, 본원 발명의 신호서열은 ER(endoplasmic reticulum) 막을 관통하는 단백질의 이동을 개시하는 아미노산 서열을 암호화하는 뉴클레오티드이다.
신호 서열은 당업계에 그 특징이 잘 알려져 있으며, 통상 16 내지 30개의 아미노산 잔기를 포함하나, 그보다 더 많거나 적은 아미노산 잔기를 포함할 수 있다. 통상적인 신호 펩타이드는 기본 N 말단 영역, 중심의 소수성 영역 및 보다 극성인(polar) C 말단 영역의 세 영역으로 구성된다. 중심 소수성 영역은 미성숙 폴리펩타이드가 이동하는 동안 막지질 이중층을 통하여 신호서열을 고정시키는 4 내지 12개의 소수성 잔기를 포함한다.
개시 이후에, 신호서열은 흔히 신호 펩티다아제(signal peptidases)로 알려진 세포 효소에 의하여 ER의 루멘(lumen) 내에서 절단된다. 이때, 상기 신호서열은 tPa(tissue Plasminogen Activation), HSV gDs(signal sequence of Herpes simplex virus glycoprotein D), IgG 신호서열 또는 성장 호르몬(growth hormone)의 분비신호서열일 수 있다. 바람직하게, 포유동물 등을 포함하는 고등 진핵세포에서 사용되는 분비 신호서열을 사용할 수 있다. 본 발명에서 유용한 신호서열은 항체 경쇄 신호서열, 예를 들면 항체 14.18(Gillies et al., J. Immunol. Meth 1989. 125:191-202), 항체 중쇄 신호서열, 예를 들면, MOPC141 항체 중쇄 신호서열(Sakano et al., Nature, 1980. 286: 676-683) 및 당업계에 알려진 다른 신호서열(예, Watson et al., Nucleic Acid Research, 1984. 12:5145-5164를 참조)을 포함한다. 일 구체예로 상기 신호 서열은 서열번호 1의 아미노산 서열을 포함할 수 있다.
폴리뉴클레오티드가 적재된 벡터
본 발명의 또 다른 측면은, 상기 항-WARS1 항체 또는 이의 단편을 암호화하는 폴리뉴클레오티드가 적재된 벡터를 제공한다. 이때, 상기 폴리뉴클레오티드는 서열번호 52의 염기서열을 포함하는 중쇄 영역 및 서열번호 54 내지 서열번호 69로 이루어진 군에서 선택되는 어느 하나의 염기서열을 포함하는 경쇄 영역을 포함할 수 있다.
본 명세서에서 사용하는 용어, "벡터"는 숙주 세포에 도입되어 숙주 세포 유전체 내로 재조합 및 삽입될 수 있다. 또는 상기 벡터는 에피좀으로서 자발적으로 복제될 수 있는 뉴클레오티드 서열을 포함하는 핵산 수단으로 이해된다. 상기 벡터는 선형 핵산, 플라스미드, 파지미드, 코스미드, RNA 벡터, 바이러스 벡터, 미니-염색체 및 이의 유사체들을 포함한다. 바이러스 벡터의 예로는 레트로바이러스, 아데노바이러스 및 아데노-관련 바이러스를 포함하나 이에 제한되지 않는다.
구체적으로, 상기 벡터는 플라스미드 DNA, 파아지 DNA 등이 될 수 있고, 상업적으로 개발된 플라스미드(pUC18, pBAD, pIDTSAMRT-AMP 등), 대장균 유래 플라스미드(pYG601BR322, pBR325, pUC118, pUC119 등), 바실러스 서브틸리스 유래 플라스미드(pUB110, pTP5 등), 효모-유래 플라스미드(YEp13, YEp24, YCp50 등), 파아지 DNA(Charon4A, Charon21A, EMBL3, EMBL4, λgt10, λgt11, λZAP 등), 동물 바이러스 벡터(레트로바이러스(retrovirus), 아데노바이러스(adenovirus), 백시니아 바이러스(vaccinia virus) 등), 곤충 바이러스 벡터(배큘로바이러스(baculovirus) 등) 등이 될 수 있다. 상기 벡터는 숙주 세포에 따라서 단백질의 발현량과 수식 등이 다르게 나타나므로, 목적에 가장 적합한 숙주 세포를 선택하여 사용함이 바람직하다.
또한, 상기 플라스미드는 항생제 내성 유전자와 같은 선별 마커를 포함할 수 있고, 플라스미드를 유지하는 숙주 세포는 선택적인 조건하에서 배양될 수 있다.
본 명세서에서 사용하는 용어, 목적 단백질의 "유전자 발현" 또는 "발현"은 DNA 서열의 전사, mRNA 전사체의 번역 및 항체 생산물 또는 이의 단편의 분비를 의미하는 것으로 이해된다. 유용한 발현 벡터는 RcCMV(Invitrogen, Carlsbad) 또는 이의 변이체일 수 있다. 상기 발현 벡터는 포유류 세포에서 목적 유전자의 연속적인 전사를 촉진하기 위한 인간 CMV(cytomegalovirus) 프로모터 및 전사 후 RNA의 안정상태 수준을 높이기 위한 우태 성장 인자(bovine growth hormone) 폴리아데닐레이션 신호서열을 포함할 수 있다.
형질전환 세포
본 발명의 또 다른 측면은, 상기 항-WARS1 항체 또는 이의 단편을 암호화하는 폴리뉴클레오티드가 적재된 발현 벡터가 도입된 형질전환 세포를 제공한다. 이때, 항-WARS1 항체 또는 이의 단편은 상술한 바와 동일하다.
본 명세서에서 사용하는 용어, "형질전환 세포"는 재조합 발현 벡터가 도입될 수 있는 원핵 세포 및 진핵 세포를 나타낸다. 상기 형질전환 세포는 벡터를 숙주 세포에 도입하여 형질전환 시켜서 제작될 수 있다. 또한, 상기 벡터에 포함된 폴리뉴클레오티드를 발현시켜 본 발명의 항체 또는 이의 단편을 생산할 수 있다.
상기 형질전환은 다양한 방법에 의하여 수행될 수 있다. 본 발명의 항체를 생산할 수 있는 한, 특별히 이에 제한되지 않는다, 구체적으로, 상기 형질전환 방법은 CaCl2 침전법, CaCl2 침전법에 DMSO(dimethyl sulfoxide)라는 환원물질을 사용함으로써 효율을 높인 Hanahan 방법, 전기천공법(electroporation), 인산칼슘 침전법, 원형질 융합법, 실리콘 카바이드 섬유를 이용한 교반법, 아그로박테리아 매개된 형질전환법, PEG를 이용한 형질전환법, 덱스트란 설페이트, 리포펙타민 및 건조/억제 매개된 형질전환 방법 등이 사용될 수 있다. 또한, 감염(infection)을 수단으로 하여 바이러스 입자를 사용하여 목적물을 세포 내로 전달시킬 수 있다. 또한, 유전자 밤바드먼트 등에 의해 벡터를 숙주 세포 내로 도입할 수 있다.
또한, 상기 형질전환 세포의 제작에 사용되는 숙주 세포 역시 본 발명의 항체를 생산할 수 있는 한, 특별히 이에 제한되지 않는다. 구체적으로 상기 숙주 세포는 원핵세포, 진핵세포, 포유동물, 식물, 곤충, 균류 또는 세포성 기원의 세포를 포함할 수 있지만 이에 한정되지 않는다. 상기 원핵세포의 일 예로는 대장균을 사용할 수 있다. 또한, 진핵세포의 일 예로는 효모를 사용할 수 있다. 또한, 상기 포유동물 세포로 CHO 세포, F2N 세포, COS 세포, BHK 세포, 바우스(Bowes) 흑색종 세포, HeLa 세포, 911 세포, AT1080 세포, A549 세포, SP2/0 세포, 인간 림프아구(human lymphoblastoid), NSO 세포, HT-1080 세포, PERC.6 세포, HEK 293 세포 또는 HEK293T 세포 등을 사용할 수 있으나, 이에 한정되지 않으며, 당업자에게 알려진 포유동물 숙주 세포로 사용 가능한 세포는 모두 이용 가능하다.
또한, 항체의 치료제로서의 특성을 최적화하거나 기타 다른 목적을 위해, 호스트 세포가 갖고 있는 당화(glycosylation) 관련 유전자를 당업자에게 알려져 있는 방법을 통해 조작하여 항체의 당쇄 패턴(예를 들어, 시알산, 퓨코실화, 당화)을 조정할 수 있다.
항-WARS1 항체 또는 이의 단편의 생산방법
본 발명의 또 다른 측면은 상기 항-WARS1 항체 또는 이의 단편의 제조 방법을 제공한다.
상기 제조 방법은 i) 상기 형질전환 세포를 배양하는 단계; 및 ii) 항-WARS1 항체 또는 이의 단편을 수득하는 단계를 포함할 수 있다.
본 명세서에서 사용하는 용어, "배양"이란, 미생물을 적당히 인공적으로 조절한 환경조건에서 생육시키는 방법을 의미한다.
상기 형질전환 세포를 배양하는 방법은 당업계에 널리 알려져 있는 방법을 이용하여 수행할 수 있다. 구체적으로, 상기 배양은 본 발명의 항체를 발현시켜서 생산할 수 있는 한 특별히 이에 제한되지 않는다. 구체적으로, 상기 배양은 배치 공정 또는 주입 배치 또는 반복 주입 배치 공정(fed batch or repeated fed batch process)에서 연속식으로 배양할 수 있다.
또한, 배양물로부터 상기 항체를 수득하는 단계는 당업계에 공지된 방법에 의해 수행될 수 있다. 구체적으로, 상기 수득 방법은 생산된 본 발명의 항체 또는 이의 단편을 수득할 수 있는 한, 특별히 이에 제한되지 않는다. 바람직하게는, 상기 수득 방법은 원심분리, 여과, 추출, 분무, 건조, 증발, 침전, 결정화, 전기영동, 분별용해(예를 들면 암모늄설페이트 침전), 크로마토그래피(예를 들면 이온 교환, 친화성, 소수성 및 크기배제) 등의 방법일 수 있다.
항-WARS1 항체 또는 이의 단편을 포함하는 약학 조성물
본 발명의 또 다른 측면은 항-WARS1 항체 또는 이의 단편을 유효성분으로 포함하는 염증성 질환의 예방 또는 치료용 약학 조성물을 제공한다. 여기서, 항-WARS1 항체 또는 이의 단편은 상술한 바와 동일하다.
본 명세서에서 사용된 용어, "염증"은 유해인자에 대해 생체를 보호하기 위한 반응으로, 면역세포, 혈관 및 염증 매개체들이 관여하여 세포의 손상을 억제하고, 손상된 조직 및 괴사 세포를 제거하며, 조직을 재생하는 일련의 과정을 포함한다. "염증성 질환"은 염증을 주 병변으로 하는 질병을 총칭하는 것이다.
상기 염증성 질환은 복막염, 골수염, 봉소염, 뇌막염, 뇌염, 췌장염, 외상 유발 쇼크, 낭포성 섬유증, 뇌졸중, 라임병, 결절성 다발동맥염, 과민성 혈관염, 루게릭 육아종증, 관절 세포 동맥염, 점액낭염, 건초염, 상과염(테니스 엘보), 헤노흐-쉔라인 자반병, 다중심성 세망조직구종, 수르코일로시스(surcoilosis), 혈색소증, 겸상 적혈구증 및 기타 혈색소병증, 고지단백혈증, 저감마글로불린혈증, 가족성 지중해열, 재귀열, 패혈증, 패혈성 쇼크, 다장기 기능장애 증후군, 기관지 폐 형성장애(broncho-pulmonary dysplasia), 염증성 장질환, 만성 폐쇄성 폐질환(COPD), 대식세포 활성화 증후군(MAS), 만성전신성 홍반성 루푸스, 경피증, 아토피성 피부염, 건선, 아나필랙시스, 피부염, 당뇨병성 망막증, 망막염, 황반 변성, 포도막염, 결막염, 관절염, 류마티스성 관절염, 강직성 척추염, 골관절염, 골다공증, 알레르기, 당뇨, 당뇨성 신장병, 신우염, 신장염, 쇼그렌 증후군, 자가 면역 췌장염, 치주질환, 천식, 이식편 대 숙주 질환, 만성 골반 염증 질환, 자궁내막염, 비염, 이식 거부 및 만성 전립선염으로 구성되는 군으로부터 선택되는 어느 하나일 수 있다.
상기 약학 조성물의 바람직한 투여량은 환자의 상태 및 체중, 질병의 정도, 약물형태, 투여경로 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있다. 본 발명의 염증성 질환의 예방 또는 치료용 약학 조성물에서 상기 항체 또는 이의 단편은 항염 활성을 나타내거나, 특히, 염증성 질환의 치료 효과를 나타낼 수 있는 한, 용도, 제형, 배합 목적 등에 따라 임의의 양(유효량)으로 포함될 수 있는데, 통상적인 유효량은 조성물 전체 중량을 기준으로 할 때 0.001 중량% 내지 20.0 중량% 범위 내에서 결정될 것이다. 여기서 "유효량"이란 질환의 상태 개선 또는 치료(treatment) 효과, 특히 염증성 질환의 상태 개선 또는 치료 효과를 유도할 수 있는 유효성분의 양을 말한다. 이러한 유효량은 당업자의 통상의 능력 범위 내에서 실험적으로 결정될 수 있다.
본 명세서에서 사용하는 용어, "치료"는 치료학적 처리 및 예방적 처리를 모두 포함하는 의미로 사용될 수 있으며, 인간을 포함한 포유류에서 질환을 치료하기 위한 적용이나 어떠한 형태의 투약을 모두 포함한다. 또한, 상기 용어는 질환의 진행을 억제하거나 늦추는 것을 포함하며; 손상되거나, 결손된 기능을 회복시키거나, 수리하여, 질환을 부분적이거나 완전하게 완화시키거나; 또는 비효율적인 프로세스를 자극하거나; 심각한 질환을 완화하는 의미를 포함한다. 이때, "예방"은 개체의 병리학적 상태 또는 질환을 완화시키거나 감소시키는 의미로 사용될 수 있다.
생체이용률과 같은 약동학적 파라미터(Pharmacokinetic parameters) 및 클리어런스율(clearance rate)과 같은 기본적인 파라미터(underlying parameters)도 효능에 영향을 줄 수 있다. 따라서, "향상된 효능"(예를 들어, 효능의 개선)은 향상된 약동학적 파라미터 및 향상된 효능에 기인할 수 있으며, 시험 동물 또는 인간 대상체에서 클리어런스율 및 염증성 질환 치료 또는 개선과 같은 파라미터를 비교하여 측정될 수 있다.
한편, 본 발명의 약학적 조성물은 "치료학적으로 유효한 양"으로 투여한다.
본 명세서에서 사용하는 용어 "투여"란, 적절한 방법으로 개체에게 소정의 물질을 도입하는 것을 의미하며, 상기 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 어떠한 일반적인 경로를 통하여 투여될 수 있다. 복강내 투여, 정맥내 투여, 근육내 투여, 피하 투여, 피내 투여, 경구 투여, 국소 투여, 비내 투여, 폐내 투여, 직장내 투여될 수 있으나, 이에 한정되지는 않는다.
본 명세서에서 사용하는 용어 "치료학적으로 유효한 양" 또는 "약학적으로 유효한 양"이란 대상 질환을 예방 또는 치료하는데 유효한 화합물 또는 조성물의 양으로서, 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분하며 부작용을 일으키지 않을 정도의 양을 의미한다. 상기 유효량의 수준은 환자의 건강상태, 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 방법, 투여 시간, 투여 경로 및 배출 비율, 치료 기간, 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 일 구현예에서 치료학적으로 유효한 양은 염증성 질환을 치료하는데 효과적인 약물의 양을 의미한다.
이때, 상기 약학 조성물은 약학적으로 허용 가능한 담체를 더 포함할 수 있다. 상기 약학적으로 허용 가능한 담체는 환자에게 전달하기에 적절한 비-독성 물질이면 어떠한 담체라도 가능하다. 증류수, 알코올, 지방, 왁스 및 비활성 고체가 담체로 포함될 수 있다. 약물학적으로 허용되는 애쥬번트(완충제, 분산제) 또한 약학 조성물에 포함될 수 있다.
구체적으로, 상기 약학 조성물은 약제학적으로 허용되는 담체를 포함하여 당업계에 공지된 통상의 방법으로 투여 경로에 따라 비경구용 제형으로 제조될 수 있다. 여기서 "약제학적으로 허용되는" 의미는 유효성분의 활성을 억제하지 않으면서 적용(처방) 대상이 적응 가능한 이상의 독성을 지니지 않는다는 의미이다.
상기 약학 조성물이 비경구용 제형으로 제조될 경우, 적합한 담체와 함께 당업계에 공지된 방법에 따라 주사제, 경피 투여제, 비강 흡입제 및 좌제의 형태로 제제화될 수 있다. 주사제로 제제화할 경우 적합한 담체로서는 멸균수, 에탄올, 글리세롤이나 프로필렌 글리콜 등의 폴리올 또는 이들의 혼합물을 사용할 수 있으며, 바람직하게는 링거 용액, 트리에탄올 아민이 함유된 PBS(phosphate buffered saline)나 주사용 멸균수, 5% 덱스트로스 같은 등장 용액 등을 사용할 수 있다. 약제학적 조성물의 제제화와 관련하여서는 당업계에 공지되어 있으며, 구체적으로 문헌[Remington's Pharmaceutical Sciences(19th ed., 1995)] 등을 참조할 수 있다. 상기 문헌은 본 명세서의 일부로서 간주된다.
상기 약학 조성물의 바람직한 투여량은 환자의 상태, 체중, 성별, 연령, 환자의 중증도, 투여 경로에 따라 1일 0.01 ㎍/㎏ 내지 10 g/㎏ 범위, 또는 0.01 ㎎/㎏ 내지 1 g/㎏ 범위일 수 있다. 투여는 1일 1회 내지 수회 또는 1달 1회 ~ 2주 1회 나누어 이루어질 수 있다. 이러한 투여량은 어떠한 측면으로든 본 발명의 범위를 제한하는 것으로 해석되어서는 아니 된다.
상기 약학 조성물이 적용(처방)될 수 있는 대상은 포유동물 및 사람이며, 특히 사람인 경우가 바람직하다. 본 발명의 약학 조성물은 염증성 질환의 치료 효과를 갖는 것으로 공지된 임의의 화합물이나 천연 추출물을 추가로 포함할 수 있다.
본 발명의 또 다른 측면은, 염증성 질환의 예방 또는 치료용 약제를 제조하기 위한 상기 항-WARS1 항체 또는 이의 단편의 용도를 제공한다. 여기서, 염증성 질환, 예방, 치료, 항-WARS1 항체 또는 이의 단편은 상술한 바와 동일하다.
본 발명의 또 다른 측면은, 상기 항-WARS1 항체 또는 이의 단편의 염증성 질환의 예방 또는 치료용 용도를 제공한다. 여기서, 염증성 질환, 예방, 치료, 항-WARS1 항체 또는 이의 단편은 상술한 바와 동일하다.
본 발명의 또 다른 측면은, 상기 항-WARS1 항체 또는 이의 단편을 개체에 투여하는 단계를 포함하는 염증성 질환을 예방 또는 치료하는 방법을 제공한다. 여기서, 염증성 질환, 치료, 항-WARS1 항체 또는 이의 단편 및 투여는 상술한 바와 동일하다. 상기 개체는 포유동물일 수 있으며, 바람직하게는 인간일 수 있다. 또한, 상기 개체는 염증성 질환을 앓는 환자이거나 염증성 질환을 앓을 가능성이 큰 개체일 수 있다.
상기 항체 또는 이의 단편의 투여경로, 투여량 및 투여횟수는 환자의 상태 및 부작용의 유무에 따라 다양한 방법 및 양으로 대상에게 투여될 수 있고, 최적의 투여방법, 투여량 및 투여횟수는 통상의 기술자가 적절한 범위로 선택할 수 있다. 상기 항-WARS1 항체 또는 이의 단편의 바람직한 투여량은 환자의 상태, 체중, 성별, 연령, 환자의 중증도, 투여 경로에 따라 1일 0.01 ㎍/㎏ 내지 10 g/㎏ 범위, 또는 0.01 ㎎/㎏ 내지 1 g/㎏ 범위일 수 있다. 투여는 1일 1회 내지 수회 또는 1달 1회 ~ 2주 1회 나누어 이루어질 수 있다. 이러한 투여량은 어떠한 측면으로든 본 발명의 범위를 제한하는 것으로 해석되어서는 아니 된다.
또한, 상기 항체 또는 이의 단편은 염증성 질환의 치료 효과를 갖는 것으로 공지된 임의의 화합물이나 천연 추출물과 병용하여 투여되거나, 다른 약물과의 조합 제제 형태로 제형화될 수 있다.
이하 본 발명을 실시예를 통하여 보다 상세하게 설명한다. 그러나, 이들 실시예는 하나 이상의 구체예를 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
실시예 1. GKB101 제조
WARS1(서열번호 94)에 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 18)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 53)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 클로닝 하였다. 이때 사용된 항체 정보는 하기 표 2 및 표 3과 같다.
상기 벡터를 1:1의 비율로 Expifectamine 293 reagent(Thermo fisher)를 이용하여 Expi293 세포에 도입하여 동일 세포 내에서 중쇄 및 경쇄를 함께 발현시켰다. 벡터를 도입 후, 약 5일 동안 진탕 배양한 후, 세포배양액을 원심 분리하고, 상층액을 회수하여 항체를 분리 및 정제하였다.
구체적으로, 회수한 상층액은 Hitrap MabselectSure column(GE Healthcare Life Sciences)에 로딩(loading)하고, PBS로 세척하여 비특이적 결합을 제거하였다. 100 mM Citrate buffer(pH 3.0) + 300 mM NaCl을 이용하여 컬럼에 특이적으로 결합하는 단백질을 분리하였다. FPLC(Fast protein liquid chromatography)로 얻은 용출액은 크기 배제 크로마토그래피(GE Healthcare Life Sciences)에 로딩하여 고순도의 항체를 수득하였다. 상기 정제한 항-WARS1 항체를 "GKB101"로 명명하였다(표 1, 도 3a 및 도 3b).
GKB101 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFS SYDMS WVRQAPGKGLEWVS AISSGGSSIYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR DVAWDMLGDFDY WGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역(CH2+CH3)
 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISC TGSSSNIGSNYVY WYQQLPGTAPKLLIY ANSHRPS GVPDRFSGSKSGTSASLAISGLRSEDEADYYC GAWDDSLSAYV FGGGTKLTVL 18
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2. GKB101의 변이체 제조
WARS1에 특이적을 결합하는 항체를 제조하기 위하여, 상기 실시예 1의 GKB101를 바탕으로 경쇄 가변 영역의 CDR2 및/또는 CDR3의 서열을 변화시켜 여러 변이체를 제작하였다. 이때, 사용된 항체 정보는 하기 표 2 및 표 3에 나타내었다.
상기 GKB101의 경쇄 변이체는 PCR을 통해 증폭시켰고, 경쇄 가변 영역의 CDR2 및 CDR3의 돌연변이부위를 포함한 유전자를 증폭하는데 사용한 프라이머 염기서열은 표 4에 나타내었다.
각각의 돌연변이를 포함하는 L-CDR2 및 L-CDR3 변이체는 Vector template(pcDNA3.3-GKB101)와 상기 프라이머(각각 10 pmol)를 이용하여 98℃/1 min; 98℃/10 sec, 55℃/15 sec, 72℃/5 min, 28 cycles; 72℃/5 min의 조건으로 PCR을 수행하여 돌연변이 부위를 포함한 유전자를 증폭하였고, 이후 PCR 산물은 DpnI 제한효소 0.5 ㎕을 첨가 후 37℃에서 30분 동안 효소와 반응시켰다. 효소 반응 후, 정제된 PCR 산물은 NEBuilder Master mix(NEB, Cat# E2621)와 혼합하여 50℃에서 60분 동안 반응시킨 뒤, DH5α competent cell에 형질전환(transformation)하여 positive clone을 선별하였다.
H-CDR1 H-CDR2 H-CDR3 L-CDR1 L-CDR2 L-CDR3
GKB101 SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANSHRPS
(서열번호 14)		 GAWDDSLSAYV
(서열번호 16)
S53I SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANIHRPS
(서열번호 20)		 GAWDDSLSAYV
(서열번호 16)
S53L SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANLHRPS
(서열번호 22)		 GAWDDSLSAYV
(서열번호 16)
S53T SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANTHRPS
(서열번호 24)		 GAWDDSLSAYV
(서열번호 16)
S53V SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANVHRPS
(서열번호 26)		 GAWDDSLSAYV
(서열번호 16)
S53Q SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANQHRPS
(서열번호 28)		 GAWDDSLSAYV
(서열번호 16)
H54I SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANSIRPS
(서열번호 30)		 GAWDDSLSAYV
(서열번호 16)
H54L SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANSLRPS
(서열번호 32)		 GAWDDSLSAYV
(서열번호 16)
H54K SYDMS
(서열번호 3)		 AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANSKRPS
(서열번호 34)		 GAWDDSLSAYV
(서열번호 16)
H54Q SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANSQRPS
(서열번호 36)		 GAWDDSLSAYV
(서열번호 16)
H54F SYDMS(서열번호 3) AISSGGSSIYYADSVKG(서열번호 5) DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANSFRPS
(서열번호 38)		 GAWDDSLSAYV
(서열번호 16)
SH/IL SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANILRPS
(서열번호 40)		 GAWDDSLSAYV
(서열번호 16)
SH/LL SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANLLRPS
(서열번호 42)		 GAWDDSLSAYV
(서열번호 16)
SH/QL SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANQLRPS
(서열번호 44)		 GAWDDSLSAYV
(서열번호 16)
SHL/ILN SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANILRPS
(서열번호 40)		 GAWDDSNSAYV
(서열번호 46)
SHL/LLN SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANLLRPS
(서열번호 42)		 GAWDDSNSAYV
(서열번호 46)
SHL/QLN SYDMS(서열번호 3) AISSGGSSIYYADSVKG
(서열번호 5)		 DVAWDMLGDFDY
(서열번호 7)		 TGSSSNIGSNYVY
(서열번호 12)		 ANQLRPS
(서열번호 44)		 GAWDDSNSAYV
(서열번호 46)
영역 FR1 FR2 FR3 FR4
VH-FR EVQLLESGGGLVQPGGSLRLSCAASGFTFS
(서열번호 2)		 WVRQAPGKGLEWVS
(서열번호 4)		 RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR(서열번호 6) WGQGTLVTVSS
(서열번호 8)
LH-FR QSVLTQPPSASGTPGQRVTISC(서열번호 11) WYQQLPGTAPKLLIY
(서열번호 13)		 GVPDRFSGSKSGTSASLAISGLRSEDEADYYC(서열번호 15) FGGGTKLTVL
(서열번호 17)
항체 영역 정방향 프라이머 역방향 프라이머
S53I L-CDR2 CTAATATTCATCGGCCAAGCGGGGTC
(서열번호 72)		 GCCGATGAATATTAGCATAGATGAGGAGTTTGGG
(서열번호 73)
S53L L-CDR2 CTAATCTGCATCGGCCAAGCGGGGTC(서열번호 74) GCCGATGCAGATTAGCATAGATGAGGAGTTTGGG
(서열번호 75)
S53T L-CDR2 CTAATACTCATCGGCCAAGCGGGGTC(서열번호 76) GCCGATGAGTATTAGCATAGATGAGGAGTTTGGG
(서열번호 77)
S53V L-CDR2 CTAATGTGCATCGGCCAAGCGGGGTC(서열번호 78) GCCGATGCACATTAGCATAGATGAGGAGTTTGGG
(서열번호 79)
S53Q L-CDR2 CTAATCAGCATCGGCCAAGCGGGGTC(서열번호 80) GCCGATGCTGATTAGCATAGATGAGGAGTTTGGG
(서열번호 81)
H54I L-CDR2 GCTAATAGTATTCGGCCAAGCGGGGTCC(서열번호 82) CCGAATACTATTAGCATAGATGAGGAGTTTGGG
(서열번호 83)
H54L L-CDR2 GCTAATAGTCTTCGGCCAAGCGGGGTCC(서열번호 84) CCGAAGACTATTAGCATAGATGAGGAGTTTGGG (서열번호 85)
H54K L-CDR2 GCTAATAGTAAGCGGCCAAGCGGGGTCC(서열번호 86) CCGCTTACTATTAGCATAGATGAGGAGTTTGGG(서열번호 87)
H54Q L-CDR2 GCTAATAGTCAACGGCCAAGCGGGGTCC(서열번호 88) CCGTTGACTATTAGCATAGATGAGGAGTTTGGG (서열번호 89)
H54F L-CDR2 GCTAATAGTTTTCGGCCAAGCGGGGTCC(서열번호 90) CCGAAAACTATTAGCATAGATGAGGAGTTTGGG
(서열번호 91)
L96N L-CDR3 GATAGCAATAGTGCTTATGTCTTCGGGGGA(서열번호 92) AAGCACTATTGCTATCATCCCAAGCACCA
(서열번호 93)
이때, ANSHRPS을 암호화하는 핵산 서열은 GCTAATAGTCATCGGCCAAGC(서열번호 70)이며, GAWDDSLSAYV을 암호화하는 핵산 서열은 GGTGCTTGGGATGATAGCCTGAGTGCTTATGTC(서열번호 71)이다.
실시예 2.1. S53I 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 21)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 54)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "S53I"로 명명하였다(표 5, 도 3a 및 도 3b).
S53I 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)		 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANIHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 21
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.2. S53L 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 23)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 55)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "S53L"로 명명하였다(표 6, 도 3a 및 도 3b).
S53L 아미노산 서열 서열번호
중쇄영역
 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)		 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa)
 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANLHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 23
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.3. S53T 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 25)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 56)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "S53T"로 명명하였다(표 7, 도 3a 및 도 3b).
S53T 아미노산 서열 서열번호
중쇄영역
 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)		 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANTHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 25
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.4. S53V 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 27)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 57)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "S53V"로 명명하였다(표 8, 도 3a 및 도 3b).
S53V 아미노산 서열 서열번호
중쇄영역
 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)
 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANVHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 27
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.5. S53Q 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 29)과 불변 영역(서열번호 19)을 포함하는 폴리뉴클레오티드(서열번호 58)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "S53Q"로 명명하였다(표 9, 도 3a 및 도 3b).
S53Q 아미노산 서열 서열번호
중쇄영역
 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)		 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANQHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 29
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.6. H54I 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 31)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 59)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "S53I"로 명명하였다(표 10, 도 3a 및 도 3b).
H54I 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)		 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANSIRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 31
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.7. H54L 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 33)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 60)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "H54L"로 명명하였다(표 11, 도 3a 및 도 3b).
H54L 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)		 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANSLRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 33
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.8. H54K 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 35)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 61)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "H54K"로 명명하였다(표 12, 도 3a 및 도 3b).
H54K 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)		 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANSKRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 35
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.9. H54Q 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 37)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 62)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "H54Q"로 명명하였다(표 13, 도 3a 및 도 3b).
H54Q 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)		 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANSQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 37
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.10. H54F 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 39)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 63)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "H54F"로 명명하였다(표 14, 도 3a 및 도 3b).
H54F 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)		 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANSFRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 39
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.11. SH/IL 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 41)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 64)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "SH/IL"로 명명하였다(표 15, 도 3a 및 도 3b).
SH/IL 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)
 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANILRPSSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 41
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.12. SH/LL 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 43)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 65)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "SH/LL"로 명명하였다(표 16, 도 3a 및 도 3b).
SH/LL 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)

 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANLLRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 43
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.13. SH/QL 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 45)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 66)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "SH/QL"로 명명하였다(표 17, 도 3a 및 도 3b).
SH/QL 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)
 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANQLRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSLSAYVFGGGTKLTVL 45
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.14. SHL/ILN 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 47)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 67)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "SHL/ILN"으로 명명하였다(표 18, 도 3a 및 도 3b).
SHL/ILN 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)

 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANILRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSNSAYVFGGGTKLTVL 47
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.15. SHL/LLN 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 48)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 68)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "SHL/LLN"으로 명명하였다(표 19, 도 3a 및 도 3b).
SHL/LLN 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)

 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANLLRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSNSAYVFGGGTKLTVL 48
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 2.16. SHL/QLN 제조
WARS1(서열번호 94)에 대한 특이적 결합을 하는 항체를 생산하기 위하여, 시그널 펩타이드(서열번호 1), 항-WARS1 항체 중쇄의 가변 영역(서열번호 9)과 불변 영역(서열번호 10), 링커(서열번호 50) 및 Fc 영역(서열번호 51)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 52); 및 시그널 펩타이드(서열번호 1), 항-WARS1 항체 경쇄의 가변 영역(서열번호 49)과 불변 영역(서열번호 19)을 포함하는 폴리펩타이드를 코딩하는 폴리뉴클레오티드(서열번호 69)를 각각 pOptiVEC(Thermo fisher, 도 1) 및 pcDNA 3.3 벡터(Thermo fisher, 도 2)에 적재하였다.
상기 실시예 1과 동일한 방법으로 상기 벡터를 Expi293 세포에 도입하여 항체를 분리 정제하였고, "SHL/QLN"로 명명하였다(표 20, 도 3a 및 도 3b).
SHL/QLN 아미노산 서열 서열번호
중쇄영역 신호서열 MGWSYIILFLVATAADVHS 1
중쇄가변영역 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSAISSGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVAWDMLGDFDYWGQGTLVTVSS 9
중쇄불변영역(CH1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKV 10
링커 EPPKSCDKTHTCPPCPAPELLGGP 50
Fc 영역
(CH2+CH3)

 SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLPGK 51
경쇄영역(kappa) 신호서열 MGWSYIILFLVATAADVHS 1
경쇄가변영역 QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVYWYQQLPGTAPKLLIYANQLRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDDSNSAYVFGGGTKLTVL 49
경쇄불변영역 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 19
실시예 3. 항-WARS1 항체의 WARS1에 대한 결합력 확인
실시예 3.1. In vitro 수준에서 항-WARS1 항체의 WARS1에 대한 결합력 확인
상기 실시예 1 및 실시예 2와 동일한 방법으로 제작된 본 발명의 항-WARS1 항체의 WARS1 단백질에 대한 결합능을 Direct ELISA 및 sandwich ELISA 방법을 이용하여 확인하였다.
구체적으로, Direct ELISA를 위하여 인간, 마모셋(NHP), 마우스, 래트, 돼지 유래의 재조합 단백질 1 ㎍/㎖ 농도의 WARS1을 96웰 플레이트(Maxisorp, Thermo fisher)에 코팅한 뒤, 1% BSA가 포함되어 있는 PBS로 상온에서 1시간 동안 블로킹하였다. GKB101 항체 또는 이의 변이체 항체를 농도 의존적으로 희석하여 코팅된 각 웰에 첨가하고 상온에서 1시간 동안 반응시킨 뒤, PBST(PBS+ Tween20)로 4번 세척하였다. 각 웰에 HRP가 붙어있는 항체(anti-Human IgG, cell signaling)를 처리하여 1시간 동안 반응시킨 뒤, PBST로 세척하였다. 마지막으로 TMB substrate(BD)로 발색 후 490 nm에서 흡광도를 측정하였다(NIVO)(도 4a 내지 도 5).
Sandwich ELISA는 1 ㎍/㎖ 농도의 GKB101 항체 또는 이의 변이체 항체를 를 96웰 플레이트(Maxisorp, Thermo fisher)에 코팅한 뒤, 1% BSA가 포함되어 있는 PBS로 상온에서 1시간 동안 블로킹하였다. 인간, 마모셋(NHP), 마우스, 래트 또는 돼지의 WARS1 재조합 단백질을 농도 의존적으로 희석하여 항체가 코팅된 각 웰에 첨가하여 상온에서 1시간 동안 반응시킨 뒤, PBST(PBS+ Tween20)로 4번 세척하였다. 각 웰에 항-his tag 항체(Santa cruz)를 1시간 동안 반응시켰다. PBST(PBS+ Tween20)로 4번 세척 후 HRP가 붙어있는 항체로(항-마우스 IgG, Santa cruz) 1시간 동안 반응시킨 뒤, TMB substrate(BD)로 발색 후 490 nm에서 흡광도를 측정하였다(NIVO)(도 6a 내지 도 6c).
그 결과, GKB101 항체 및 이의 변이체 항체의 재조합 WARS1 단백질에 대한 항-WARS1 항체의 결합력을 측정 비교한 결과에서 모두 인간, 마모셋(NHP), 마우스, 래트, 돼지 유래의 WARS1 재조합 단백질에 대해 GKB101 항체와 동등 또는 동등 이상의 강한 결합력을 확인할 수 있었다.
또한, 인간 유래의 재조합 단백질에 대해서는 S53Q, H54K, SH/QL, SHL/ILN, SHL/LLN 및 SHL/QLN 항체가 Kd값이 약 10-12 M이고, 마모셋(NHP) 유래의 재조합 단백질에서는 SHL/ILN, SHL/LLN 및 SHL/QLN 항체의 Kd값은 약 10-12 M 수준이다.
또한, 마우스 유래의 재조합 단백질에 대해서는 S53V, S53Q, H54K, H54Q, SH/QL, SHL/ILN, SHL/LLN 및 SHL/QLN 항체의 Kd값은 약 10-12 M이다. 또한, 래트 유래 재조합 단백질에 대해서는 S53V, S53Q, H54L, H54K, H54Q, SH/QL, SHL/ILN, SHL/LLN 및 SHL/QLN 항체의 Kd값은 약 10-12 M이다. 또한, 돼지 유래 재조합 단백질에 대해서는 S53L, S53V, S53Q, H54K 및 H54Q 항체의 Kd값이 약 10-9 M이다. 그 결과, WARS1 재조합 단백질에 대해서 S53V, S53Q, H54L, H54K, H54Q, SH/QL, SHL/ILN, SHL/LLN 및 SHL/QLN 항체의 Kd값이 약 10-12 M 수준의 높은 결합력을 보였다.
실시예 3.2. 웨스턴 블롯을 이용한 항-WARS1 항체의 WARS1에 대한 결합능 확인
상기 실시예 1 및 실시예 2와 동일한 방법으로 제작된 본 발명의 항-WARS1 항체의 WARS1 단백질에 대한 결합능을 웨스턴 블롯을 통해 확인하였다.
이때, WARS1 단백질 샘플로 WARS1 재조합 단백질(인간, 마우스, 돼지, 마모셋(NHP) 또는 래트 유래), 세포 배양액 및 인간 또는 마우스의 혈청을 사용하였다. 특히 세포 배양액은 인간 단핵구 세포주 THP-1 또는 마우스 대식세포주 J774.1A에 LPS(lipopolysaccharide, 100 ng/㎖)를 24시간 처리하여 염증 반응을 유도한 뒤, 세포 배양 상층액을 수득하여 사용하였다.
WARS1 재조합 단백질(인간, 마우스, 돼지, 마모셋(NHP) 또는 래트 유래), 상기 방법으로 수득한 세포 상층액 및 마우스 또는 인간의 혈청을 각각 30 ㎍씩 8% SDS-PAGE에 로딩한 뒤, PVDF 멤브레인(Millipore)에 트랜스퍼(transfer)하였다. 그 뒤, membrane은 1 ㎍/㎖의 GKB101 또는 이의 변이체 항체로 각각 1시간 동안 반응시킨 뒤, TBST(TBS+Tween20)로 세번 세척하였다. 그 뒤, 2차 항체(항-인간 IgG HRP, Millipore)로 1시간 동안 반응시킨 뒤, TBST로 3번 세척하여 ECL(West® bright ECL, Advanta)을 처리하여 단백질 발현을 확인하였다(LAS-4000, Fujifilm).
그 결과, 도 7에 나타낸 바와 같이, 본 발명의 GKB101 항체 및 이의 변이체 항체는 모두 재조합 단백질, THP-1 세포 또는 J774A.1 세포의 배양 상층액, 및 인간 또는 마우스 혈청 내의 WARS1을 특이적으로 검출할 수 있었다. 특히, S53I, S53L, S53V, S53Q, H54I, H54K, H54Q, H54F 및 SH/LL 항체는 GKB101 항체와 비교하여 돼지 유래의 재조합 단백질을 동등 이상으로 검출할 수 있었다.
실시예 4. 에피토프 매핑
제작된 본 발명의 항-WARS1 항체의 인간 WARS1 단백질 WHEP 도메인 서열에 해당하는 펩타이드 및 알라닌 돌연변이 인간 WARS1 단백질을 제작하여 이에 대한 항-WARS1 항체의 결합능을 ELISA 방법을 통해 확인하였다.
구체적으로, 펩타이드를 이용한 에피토프 매핑을 위해서, 항-WARS1 항체를 1 ㎍/㎖ 농도로 96웰 플레이트(Maxisorp, Thermo fisher)에 코팅한 뒤, 1% BSA가 포함되어 있는 PBS로 상온에서 1시간 동안 블로킹하였다. 각각의 비오틴(biotin)으로 표지되어 있는 펩타이드들을 농도 의존적으로 희석하여 코팅된 각 웰에 첨가하고 상온에서 1시간 동안 반응시킨 뒤, PBST(PBS+Tween20)로 4번 세척하였다. 각 웰에 HRP가 붙어 있는 streptavidin(R&D systems)을 처리하여 1시간 동안 반응시킨 뒤, PBST로 세척하였다. 마지막으로 TMB substrate(BD)로 발색 후 490 nm에서 흡광도를 측정하였다(NIVO)(도 8).
그 결과, GKB101 항체 및 이의 변이체 항체 중 S53L, H54K, SH/IL, SH/LL, SHL/ILN, SHL/LLN이 펩타이드 다섯개의 펩타이드에서 모두 강한 결합력을 보였으며, 이들 중 인간 WARS1의 WHEP 도메인 서열 펩타이드에 대해 H54K, SH/QL, SHL/ILN과 SHL/QLN은 GKB101과 비교 시 동등 이상의 결합력을 보였다.
WHEP 도메인 부위의 특정 아미노산이 알라닌으로 치환된 인간 재조합 WARS1 단백질을 이용한 에피토프 매핑을 위해서, 항-WARS1 항체를 1 ㎍/㎖ 농도로 96웰 플레이트(Maxisorp, Thermo fisher)에 코팅한 뒤, 1% BSA가 포함되어 있는 PBS로 상온에서 1시간 동안 블로킹하였다. 각각의 WARS1 단백질을 50 ng/㎖로 희석하여 코팅된 각 웰에 첨가하고 상온에서 1시간 동안 반응시킨 뒤, PBST(PBS+ Tween20)로 4번 세척하였다. 각 웰에 항-his tag 항체(Santa cruz)을 1시간 동안 반응시켰다. PBST(PBS+Tween20)로 4번 세척 후 HRP가 붙어있는 항체로(항-마우스 IgG, Santa cruz) 1시간 동안 반응시킨 뒤, TMB substrate(BD)로 발색 후 490 nm에서 흡광도를 측정하였다(NIVO)(도 9a 내지 도 9c).
그 결과, GKB101, S53I, S53Q, S53I, H54K, H54Q 항체 모두 공통적으로 인간 WARS1 WHEP 도메인에 서열 R20, R24, K27, I36, I43, K47 부위가 에피토프임을 알 수 있었다.
실시예 5. In vitro 에서 WARS1에 대한 항-WARS1 항체의 특이적 항체의 중화능 확인
실시예 1 및 실시예 2와 동일한 방법으로 제조된 본 발명의 항-WARS1 항체의 WARS1에 대한 중화능을 in vitro에서 확인하였다.
구체적으로, 마우스 대식세포주 J774A.1 세포를 96웰 세포 배양 플레이트(Nunc)에 웰당 4×104 세포/웰로 접종하여 24시간 배양하였다. 이때, 세포는 10% FBS 및 1% 페니실린-스트렙토마이신이 포함된 high glucose DMEM(Gibco)을 사용하여 배양하였다. 항원-항체 혼합물은 인간 유래 WARS1 재조합 단백질(5 ㎍) 및 본 발명의 항-WARS1 항체(5 ㎍)를 혼합하여 37℃ 인큐베이터에서 2시간 동안 반응시켜 준비하였다.
항원-항체 혼합물을 세포에 처리하기 2시간 전, 세포의 배지를 새롭게 교체한 뒤, 각각의 웰에 상기 방법으로 준비된 항원-항체 혼합물을 세포에 처리하였다. 약 15시간 후, 각 세포의 배양액을 원심분리 하여 상층액을 수거한 뒤, 상층액 내의 TNF-α 농도를 측정하였다(ELISA MAX™ Standard Set Mouse TNF-α, BioLegend). 이때, IgG는 항-WARS1 항체에 대한 대조군으로 사용하였다.
그 결과, 마우스 대식세포에서 본 발명에 의한 17종의 항-WARS1 항체 중 7종의 항체(GKB101, S53I, S53L, S53Q, H54K, SHL/LLN 및 SHL/QLN 항체)가 WARS1에 의한 증가된 TNF-α의 분비를 40%이상 억제하였다. 또한, S53I, S53L, S53Q 및 SHL/LLN 항체는 GKB101 항체와 비교하여 동등이상의 WARS1 중화능을 나타내었다(도 10).
실시예 6. In vivo 에서 항-WARS1 항체의 활성 확인
In vivo 수준에서 본 발명의 항-WARS1 항체의 활성을 확인하기 위하여, CS(cecal slurry)를 주입하여 중증 패혈증을 유발한 마우스를 사용하였다.
구체적으로, 마우스(C57BL/6, 대한바이오링크, 8주령)에 CS(cecal slurry)를 21 mg 주입하고 4시간, 8시간 및 12시간 후에 Isotype IgG1, GKB101 항체, S53I 항체, S53Q 또는 S53K 항체를 각각 2.5 mg/kg, 5 mg/kg 또는 10 mg/kg의 농도로 총 3회 복강투여 하였다(도 11). 그 뒤, 72시간까지 마우스의 생존을 관찰하였다.
S53I, S53Q, H54K를 중증 패혈증 마우스 모델을 이용한 효능평가를 실시한 결과, S53I의 경우, 투여 농도 의존적으로 생존도가 증가하는 경향이 보이지 않은 반면, S53Q, H54K 항체는 농도 2.5 mg/kg 와 10 mp/kg에서 유의적으로 생존율이 증가함을 확인하였다.
이하, 실시예를 통한 항-WARS1 항체의 염증성 질환 개선 효과는 항-WARS1 항체의 변이체인 H54K를 이용하여 확인하였다. 따라서, 이하의 실시예에서 항-WARS1 항체, H54K 및 M105A는 혼용되어 기재할 수 있다.
II. 만성 폐쇄성 폐질환 마우스 모델을 이용한 항-WATRS1 항체의 호흡기 손상 억제 효능 평가
실시예 7. 만성 폐쇄성 폐질환 관련 세포주에서 항 WARS1 항체의 항염활성 확인
항-WARS1 항체(H54K)의 만성 폐쇄성 폐질환에 대한 치료효과를 확인하기 위하여, 이에 관여하는 세포를 이용하여 항-WARS1 항체의 항염 활성을 확인하였다.
이때, 세포는 인간 폐 섬유아세포주(HLF, ATCC, PCS-201-013)를 사용하였고 10% FBS 와 1% 항생제/항진균제가 포함된 DMEM에서 배양하였다.
구체적으로, 상기 세포주를 96웰 플레이트에 2Х104 세포/웰로 각각 접종하여, 0.1% FBS가 포함된 DMEM에서 24시간 동안 배양하였다. 이때, WARS1(10 ㎍/㎖) 및 항-WARS1 항체(3C6, GKB101, H54K, 5㎍/㎖) 또는 PBS를 혼합하여 37℃에서 1시간 동안 반응시켜 준비하였다. 상기 WARS1/항-WARS1 항체 혼합액을 준비된 세포에 처리하고 16시간 추가배양 하였다. 16시간 후, 배양액을 취하여 배양액 내 IL-8(Biolegend, 430515) 및 IL-6(BioLegend, #431304)의 농도를 ELISA를 통해 측정하였다. 이때, 대조군으로 PBS를 처리한 WARS1을 사용하였다.
그 결과, 도 14에 나타낸 바와 같이, 인간 폐섬유아세포에서 WARS1 단독 처리군(대조군)에서는 IL-8 및 IL-6의 분비가 증가하였다. 반면, WARS1 및 항-WARS1 항체 처리군에서는 대조군과 비교하여 IL-8 및 IL-6의 분비가 농도 의존적으로 감소하였다. 특히 H54K 항체 처리군에서 가장 크게 감소한 것을 확인할 수 있었다.
실시예 8. 표준 담배 추출물 조제
실험재료로 표준 담배 CM7(coresta monitoring cigarette 7) 60개피 및 이소프로파놀(isopropanol, Merck), 에탄올(ethanol, Merck), n-heptadecane(Sigma-Aldrich)를 준비하였고, 실험장비는 자동흡연장치(automatic smoking machine, ISO3308 규격품, 모델: RM20, Heinr Borgwaldt)를 사용하였다.
실시예 8.1. 표준 담배연기의 포집
표준 담배 CM7 연기 응축물 포집은 ISO3402 규정에 의거하여 흡연실(온도 22±2℃, 상대습도 60±5%)에서 실시하였다. ISO3308 규정에 의거하여 RM20 자동흡연장치를 이용하여 흡연부피 35.0±0.3 ㎖, 흡연주기 60±0.5초, 흡연시간 2.00±0.02초 및 꽁초길이 tip paper 길이+3 mm(overwrap+3 mm) ISO 표준 흡연 방법으로 궐련담배를 연소시키고, 92 mm 캠브리지 필터(cambridge filter, ISO3308 규격품)로 담배연기 응축물을 포집하였다.
실시예 8.2. 담배연기 응축물 무게 측정
흡연 전 ISO4387 규정에 의하여 연소 전 캠브리지 필터가 들어있는 담배 홀더(cigarette holder)의 무게를 측정하고, 실시예 8.1의 방법으로 연소시킨 담배연기 응축물은 연소 후 캠브리지 필터에 의해 담배연기가 포집된 담배 홀더의 무게를 측정하여 담배연기 응축물(TPM, total particulate matter) 함량을 계산하였다(ISO4387, 2000). 표준 담배를 3번 연소시킨 경우, TPM 무게는 19개피에 16.0621 mg, 20개피에 15.9135 mg 및 20개피에 15.5380 mg이었다. 따라서, 총 표준 담배 시료 수는 59개피이고 TPM 무게는 47.5136 mg이었다.
실시예 8.3. 표준 담배연기 응축물 추출
실시예 8.1의 방법으로 담배연기 응축물이 포집된 캠브리지 필터를 담배 홀더에서 분리하여 각각 100 ㎖ 삼각플라스크에 넣고 추출용매 이소프로판올을 50 ㎖씩 첨가하여 혼합하였다. 상기 혼합물을 실온에서 8시간 이상 방치하여 담배연기 응축물을 추출하였다. 상기 추출물은 추출 후 여과하고 감압여과 농축기로 농축하였고, 3개의 삼각플라스크에 들어있는 농축액을 scintillation vial에 모아 질소 가스를 이용하여 완전 농축하였다.
상기 방법으로 농축된 담배연기 응축물에서 하기의 수학식 1을 이용하여 총 입자상물질(TPM) 함량의 계산하였다.
<수학식 1>
TPM(mg/cig) = (WFHA - WFBH)/N
여기서 TPM : 총 입자상 분진 물질
WFHA : 흡연 후 Filter Holder의 무게
WFHB : 흡연 전 Filer Holder의 무게
N : 한 Trap 당 흡연한 개피 수(cig.)
실시예 9. 만성 폐쇄성 폐질환 마우스 모델을 이용한 항-WARS1 항체의 호흡기 손상 억제 효과 검증
실시예 9.1. 만성 폐쇄성 폐질환 마우스 모델 제작
숫컷 7주령의 SPF(specific pathogen-free) BALB/c 마우스(18 g 내지 20 g)는 오리엔트바이오사에서 공급받았다. 동물은 실험 당일까지 고형사료(항생제 무첨가, 삼양사료 Co.)와 물을 충분히 공급하고 온도 22±2℃, 습도 55±15%, 12시간(light-dark cycle)의 환경에서 1주간 적응시킨 후 실험에 사용하였다. 그리고 동물실험의 윤리적, 과학적 타당성 검토 및 효율적인 관리를 위하여 대전대학교 동물실험윤리위원회(Institutional animal care and use committee, IACUC)의 승인을 받았다.
만성 폐쇄성 폐질환(COPD, chronic obstructive pulmonary disease) 마우스 모델을 확립하기 위한 LPS/CS 혼합물은 100 ㎍/㎖의 LPS(lipopolysaccharide) 및 4 ㎎의 표준 담배 추출물(CSE, cigarette smoking extract)을 각각 1:1로 혼합하여 준비하였다. 7주령 BALB/c 수컷 마우스를 케타민(ketamine) 및 럼프(rumph)로 가마취한 후, 상기 LPS/CS 혼합물을 마우스의 코 및 입에 마리당 총 100 ㎕(각각 50 ㎕)로 주 1회씩 3주간 INT(intra-nazal-trachea) 주사(injection) 방법으로 흡입시켜 COPD 마우스 모델을 제작한다.
이때, 실험군은 i) 무처리한 정상군(Normal), ii) PBS(대조군, CON), iii) Isotype IgG1 항체(3 ㎎/㎏, i.p) 투여군 및 iv) 항-WARS1 항체(H54K) 투여군으로 나누어 실시하였다. 이때, 각 샘플은 LPS 및 CS를 투여하기 1시간 전에 투여하였다(도 15). 이하, 본 발명에서 상기 항-WARS1 항체인 H54K 항체는 M105A 항체와 혼용되어 기재될 수 있다.
실험 종료 후 마우스에서 혈액, 기관지 폐포세척액 및 폐 조직을 분리하여 항-WARS1 항체(H54K)의 호흡기 손상 억제 효과를 평가하였다. 이때, 각 실험군 결과값은 평균(mean)±표준 편차(SEM)으로 나타내었으며, 실험 집단간 수치 데이터는 일원배치 분산분석(one-way analysis of variance; ANOVA) 후에 Duncan's multiple comparison tests로 유의성을 검증하였다.
실시예 9.2. 폐 조직의 병리학적 분석
실시예 9.1의 실험 마우스에서 수득한 기도 및 폐 조직을 H&E 염색, Masson Trichrome 염색(M-T 염색) 또는 Periodic acid-Schiff(PAS)-Alcian Blue(AB)염색 방법을 이용하여 각각 염색한 뒤, 광학 현미경 관찰을 통해 조직 형태를 분석하였다.
실시예 9.2.1. H&E 염색을 통한 기도 및 폐 조직 내 염증성 면역세포 침윤 관찰
구체적으로, 투여 종료 후 적출된 기도 및 폐 조직을 4% 파라포름알데하이드(PFA)에서 하루 동안 반응시켜 고정한 뒤, 파라핀 조직 절편 슬라이드을 제작하였다. 상기 파라핀 조직 절편 슬라이드를 각각 자일렌(xylene) 용액 및 100% 에탄올로 3번 세척하여 파라핀을 제거하였다.
상기의 과정을 통해 파라핀이 제거된 조직 슬라이드를 헤마톡실린(hemaxoylin) 용액에서 5분간 반응시킨 뒤, 흐르는 물 및 1% 염산에 순차적으로 세척하였다. 그리고, 상기 슬라이드를 흐르는 물로 세척한 뒤 1% 암모니아 용액(70% ethanol에 희석함)으로 중화시킨 뒤, 흐르는 물에 다시 세척하고 에오신(Eosin) 용액에서 2분간 반응시켰다. 반응이 끝난 뒤, 슬라이드를 순차적으로 70% 내지 100% 에탄올 용액에서 반응시키고 자일렌 용액에서 3분간 반응시켰다. 이때, 자일렌 용액에서 반응시키는 과정은 총 3번 실시하였다. 마지막으로 커버 슬라이드로 조직 슬라이드를 봉입한 후 광학 현미경으로 조직의 형태를 관찰하였다.
그 결과, 도 16a에 나타낸 바와 같이, 정상군과 비교하여 IgG1 투여군에서는 기도 주변에 염증성 면역세포의 침윤이 관찰되었다. 또한 염증심화로 인한 폐포 세포의 파괴도 진행되는 것이 관찰되었다. 반면, 항-WARS1 항체(H54K) 투여군에서는 염증성 면역세포의 침윤이 감소하고 폐포 세포가 유지되어 있는 것을 확인할 수 있었다.
실시예 9.2.2. Masson Trichrome 염색을 통한 폐 조직 내 콜라겐 침착 관찰
실시예 9.2.1과 동일한 방법으로 제작된 폐 조직 슬라이드에 대하여 Masson Trichrome(M-T) 염색을 수행하였다.
구체적으로, 파라핀이 제거된 슬라이드를 60℃의 Bouin's 용액에서 반응시킨 뒤, 꺼내어 식힌 다음 Weigert's Hematoxylin 용액, Briebrich Scarlet 용액, Phosphotungstic phosphomolybdic acid 및 Aniline blue 용액에서 순차적으로 반응시켰다. 마지막으로 1% 아세트산 용액에서 반응시킨 뒤, 커버 슬라이드로 폐 조직 절편 슬라이드를 봉입하여 광학 현미경으로 조직 내 콜라겐 침착 정도를 확인하였다.
그 결과, 도 16a에 나타난 바와 같이, IgG1 투여군에서 기관(tracheole) 및 폐포(alveolar) 세포 주변으로 콜라겐 침착이 높게 관찰되었다. 반면, 항-WARS1 항체(H54K) 투여군은 상기와 같은 콜라겐 침착이 감소된 것을 확인할 수 있었다.
실시예 9.2.3. Periodic acid-Schiff-Alcian Blue 염색을 통한 기도 조직 내 점액질 분비 관찰
실시예 9.1의 실험 마우스에서 적출한 기도 조직을 실시예 9.2.1과 동일한 방법으로 제작된 조직 슬라이드를 Periodic Acid Schiff(Sigma Aldrich, 395B)을 사용하여 Periodic acid-Schiff-Alcian Blue(PAS-AB) 염색 방법으로 염색하였다.
구체적으로, 파라핀이 제거된 조직 슬라이드를 순차적으로 Alcian blue 용액, 0.5% Periocid acid 용액 및 Schiff's 용액에서 반응시켰다. 각 용액과의 반응 후에는 슬라이드를 흐르는 물로 충분히 세척하였다. 상기 과정을 통해 염색된 슬라이드를 헤마톡실린 용액에서 반응시킨 뒤 물로 세척하고 70% 내지 100% 농도의 에탄올 용액에서 순차적으로 반응시켜 탈수시켰다. 마지막으로 상기 조직 슬라이드를 커버 글라스로 봉입한 뒤 광학 현미경으로 관찰하였다.
그 결과, 도 16b에 나타낸 바와 같이, IgG1 투여군과 비교하여 항-WARS1 항체(H54K) 투여군에서 기도 주변에 존재하는 배상세포(goblet cell) 내 점액의 양이 감소하는 것이 관찰할 수 있었다.
실시예 9.3. 기도, 폐포세척액, 폐 조직 및 혈청 내의 염증성 사이토카인 농도 분석
실시예 9.1의 실험 마우스에서 수득한 폐 조직에서 염증성 사이토카인 및 케모카인의 농도를 측정하였다.
이때, 각 샘플의 채취는 하기와 같이 수행하였다.
먼저, 폐포세척액은 마우스 기도 삽관을 통해 1 ㎖의 PBS로 기관지 및 폐 조직을 세척한 뒤 수거하였다. 상기 세척액을 폐포세척액(BALF, bronchoalveolar lavage(BAL) fluid)으로 사용하였다.
또한, 폐 조직의 일부를 적출하여 100 ㎍/㎖의 농도가 되도록 단백질 용해 버퍼(protein lysis buffer)를 첨가하고 조직을 용해하였다. 상기 용해물을 13,000 rpm으로 원심분리 하여 상층액만 수거하여 폐 조직 샘플로 사용하였다.
혈청 샘플은 심장 채혈을 통해 혈액을 수득한 뒤, 헤파린 튜브에 옮겨 상온에서 2,000 rpm으로 20분 동안 원심분리 하여 수득하였다.
상기 과정을 통해 수득된 각 샘플에 대하여 mCXCL2/MIP-2, mIL-6, mMIP1α의 농도는 mouse CXCL2/MIP-2 ELISA(R&D systems), mouse IL-6 ELISA(BioLegend), mouse MIP1-α ELISA(R&D R&D systems) 키트를 이용하여 각각의 사이토카인 또는 케모카인의 농도를 측정하였다.
그 결과, 도 17a(폐포세척액) 및 도 17b(폐 조직)에 나타낸 바와 같이, 정상군과 비교하여 Isotype IgG1 투여군 또는 PBS 투여군에서 CXCL1 및 CXCL2, IL-6, TNFα 및 TARC가 증가하였다. 반면, 항-WARS1 항체(H54K) 투여군에서는 Isotype IgG1 투여군 또는 PBS 투여군 대비 약 1/4 내지 약 1/2 가량 감소하는 것을 관찰할 수 있었다. 모든 데이터는 표준편차(SEM)으로 표기되었고 ANOVA 통계 프로그램을 사용하여 분석하였다.
또한, 유전자 발현을 확인하기 위하여 폐 조직의 일부를 적출하여 Trizol(invitrogen, 15596026)을 첨가한 뒤, 제조사의 프로토콜에 따라 mRNA를 추출하였다. 상기 mRNA를 주형으로 하여 cDNA EcoDry Premix(Random Hexamers) 키트(Takara, 639546)을 이용하여 cDNA를 합성하고 SYBR Green real time PCR master mix(Applied biosystems, 4309155)를 이용하여 각각의 유전자의 발현을 q-PCR을 통해 확인하였다. 이때, 사용된 프라이머는 하기 표 21에 나타내었다.
유전자명 정방향 프라이머(5'에서 3') 역방향 프라이머(5'에서 3')
MUC5AC AGAATATCTTTCAGGACCCCTGCT(서열번호 146) ACACCAGTGCTGAGCATACTTTT(서열번호 147)
TARC TCCAGGGCAAGCTCATCTGT(서열번호 148) AATGCCTCAGCGGGAAGGTC(서열번호 149)
TRPA1 TGAGATCGACCGGAGT(서열번호 150) TGCTGAAGGCATCTT(서열번호 151)
Eotaxin TGCTGAAGGCATCTTG(서열번호 152) AATATCAGCACCAGTCGCCC(서열번호 153)
그 결과 도 17c에 나타낸 바와 같이, 정상군과 비교하여 PBS 투여군에서 기침 유발 유전자(MUC5AC, TRPA1, TRPV1) 및 호산구 염증 유전자인 eotaxin의 발현이 크게 증가한 것을 확인하였다. 반면, 항-WARS1 항체(H54K) 투여군에서는 PBS 투여군 또는 Isotype IgG1 투여군과 비교하여 상기 유전자의 발현이 감소한 것을 확인할 수 있었다.
상기 결과를 통해, 항-WARS1 항체(H54K)는 COPD 모델 마우스에서 염증성 사이토카인, 케모카인, 기침 유발 유전자 및 호산구 염증 유전자의 발현을 억제할 수 있음을 확인할 수 있었다.
실시예 9.4. 기도, 폐포 세척액, 폐 조직 및 혈청 내의 면역세포 분석
실시예 9.1의 실험 마우스에서 수득한 혈청, 폐포세척액 및 폐 조직 내의 면역세포를 유세포 분석을 통해 분석하였다.
이때, 폐포세척액은 실시예 9.3과 동일한 방법으로 수득하였다.
폐 조직 샘플은 하기의 방법으로 준비하였다. 먼저 폐 조직의 일부를 1 mg/㎖ 농도의 콜라겐 분해효소 용액과 혼합하여 GentleMacs의 C-tube를 이용하여 분쇄한 뒤, 37℃에서 30분 진탕 배양하였다. 상기 진탕 배양 용액을 70 μm 세포 스트레이너에 통과시켜 단일 세포를 수거하였다.
상기와 같이 준비한 폐 조직 샘플 및 폐포세척액에서 수득한 세포에 대하여 면역 형광염색(immunofluorescence staining)을 실시하였다. 이때 사용한 항체는 PE-항-CD3e 항체(553064, BD Pharmingen), FITC-항-CD8 항체(553031, BD Pharmingen), PE-항-CD4 항체(553047, BD Pharmingen), PE-항-Gr-1 항체(553128, BD Pharmingen), FITC-항-CD69 항체(55732, BD Pharmingen), FITC-항-CD11b 항체(553310, BD Pharmingen) 및 PE-항-B220 항체(561878, BD Pharmingen)이다. 상기 항체를 각각의 세포에 처리하고 30분간 4℃에서 암반응시켰다. 반응 후 3회 이상 FACS 버퍼(0.5% FBS, 0.02% NaN3 in PBS)로 수세한 후, 유세포 분석기로 분석하였다. 상기 분석값은 FlowJo 프로그램(FlowJo™ v7 Software, BD Biosciences)을 이용하여 CD3+, CD4+, CD8+, CD4+CD69+, CD8+CD69+, CD4+CD62L-CD44+high, Gr-1+SiglecF-(호중구), CD11b+Gr-1+(과립구), Gr-1-SiglecF+(호산구) 및 Gr-1+highSiglecF+(호산구_high)으로 각각의 면역세포를 분류하고 각 세포들의 분포(%)를 분석하였다.
그 결과, 도 18a, 도 18b 및 도 20에 나타낸 바와 같이, 정상군과 비교하여 Isotype IgG1 투여군 또는 PBS 투여군에서 침투한 전체 세포 수 및 림프구(특히 B 림프구, 활성 T 림프구), 호중구, 대식세포 및 과립구의 수가 약 3~100배 증가하였다. 반면, 항-WARS1 항체(H54K) 투여군에서는 Isotype IgG1 투여군 또는 PBS 투여군 대비 최대 약 1/2 수준으로 감소하는 것을 관찰할 수 있었다. 모든 데이터는 표준편차(SEM)으로 표기되었고 ANOVA 통계 프로그램을 사용하여 분석하였다.
실시예 9.5. 종격동 림프절 내의 면역세포 분석
실시예 9.1의 마우스 실험에서 수득한 종격동 림프절(mediastinal lymph node) 내의 면역세포를 실시예 9.4과 동일한 방법으로 분석하였다.
종격동 림프절 샘플은 하기와 같이 준비하였다. 먼저 흉부를 개복한 후 흉선근처의 상대정맥에 위치한 내측 양쪽, 외측 양쪽 종격동 림프절을 가위와 집게를 이용하여 적출한 후 70 μm 세포 스트레이너를 통과시켜 단일 세포를 수거하였다.
상기와 같이 준비한 종격동 림프절 세포에 대하여 상기 실시예 9.4와 동일한 항체 및 방법을 통해 면역 형광염색을 실시하였다. 상기 유세포 분석값은 FlowJo 프로그램(FlowJo™ v7 Software, BD Biosciences)을 이용하여 CD3+, CD4+, CD8+, CD4+CD69+, CD8+CD69+ 및 CD11c+B220-으로 각각의 면역세포를 분류하고 각 세포들의 분포(%)를 분석하였다.
그 결과, 도 19에 나타낸 바와 같이, 정상군과 비교하여 Isotype IgG1 투여군 또는 PBS 투여군에서 침투한 전체 세포 수가 증가한 것을 확인할 수 있었다. 특히, IgG1 투여군에서 CD4+T 림프구 및 CD8+ T 림프구가 5배 이상 증가 및 활성화되었다. 반면, 항-WARS1 항체(H54K) 투여군에서는 Isotype IgG1 투여군 또는 PBS 투여군 대비 최대 약 1/2 수준으로 감소하는 것을 관찰할 수 있었다. 모든 데이터는 표준편차(SEM)으로 표기되었고 ANOVA 통계 프로그램을 사용하여 분석하였다.
실시예 9.6. 혈액 내 면역세포 분석
실시예 9.1의 마우스 실험에서 수득한 말초혈액 단핵세포(PBMC, peripheral blood mononuclear cell) 내의 면역세포를 실시예 9.4와 동일한 방법으로 분석하였다. 이때, PBMC 샘플은 흉부를 개복한 후 심실에서 헤파린(20~30 ㎕) 주사기로 혈액을 수득한 뒤, 상기 혈액을 ACK 용액(Thermos Fisher, A1049201)과 혼합하여 적혈구를 제거하여 준비하였다.
상기와 같이 준비된 PBMC 내 면역세포에 대하여 면역 형광염색을 실시하였다. 이때 항체는 PE-항-CD3e 항체(553064, BD Pharmingen), FITC-항-CD8 항체(553031, BD Pharmingen), PE-항-CD4 항체(553047, BD Pharmingen), PE-항-Gr-1 항체(553128, BD Pharmingen), FITC-항-CD19 항체(553785, BD Pharmingen) 및 PerCP Cy5-항-SiglecF 항체(565526, BD Pharmingen)를 사용하였다. 상기 항체를 각각의 세포에 처리하고 30분간 4℃에서 암반응시켰다. 반응 후 FACS 버퍼(0.5% FBS, 0.02% NaN3 in PBS)로 수세한 후, 유세포 분석기로 분석하였다. 상기 분석값은 FlowJo 프로그램(FlowJo™ v7 Software, BD Biosciences)을 이용하여 CD3+, CD19+, CD4+, CD8+ 및 Gr-1+SiglecF-(호중구)으로 각각의 면역세포를 분류하고 각 세포들의 분포(%)를 분석하였다.
그 결과, 도 20에 나타낸 바와 같이, 정상군과 비교하여 Isotype IgG1 투여군 또는 PBS 투여군에서 림프구의 혈액 내 분포가 분포가 증가하였다. 반면, 항-WARS1 항체(H54K) 투여군에서는 PBS 또는 Isotype IgG1 투여군과 비교하여 약 30% 가량 감소하는 것을 관찰할 수 있었다. 모든 데이터는 표준편차(SEM)으로 표기되었고 ANOVA 통계 프로그램을 사용하여 분석하였다.
III. 항-WARS1 항체의 염증성 장질환 개선 효과 검증
실시예 10. 대장암 세포주에서 항-WARS1 항체 처리에 의한 장 투과능 개선 효과 검증
항-WARS1 항체(H54K)의 염증성 장질환에 대한 치료효과를 확인하기 위하여, 장 표피세포를 이용하여 항-WARS1 항체의 처리에 의한 장 투과능 개선 효과를 확인하였다.
이때, 세포는 인간 장 표피세포주(Caco-2, ATCC, HTB-37)를 사용하였다. 상기 세포는 10% FBS 및 1% 항생제/항진균제가 포함된 DMEM 배지에서 배양하였다.
구체적으로, 상기 세포주를 6웰 플레이트에 3×105 세포/웰로 각각 접종하여, 0.1% FBS가 포함된 DMEM 배지에서 24시간 동안 배양하였다. 이때, WARS1(10 ㎍/㎖) 및 항-WARS1 항체(3C6, GKB101, H54K, 5㎍/㎖) 또는 PBS를 혼합하여 37℃에서 1시간 동안 반응시켜 준비하였다. 상기 WARS1/항-WARS1 항체 혼합액을 준비된 세포에 처리하고 16시간 추가배양 하였다. 16시간 후, 배양액을 제거하고 4% 포름알데하이드로 5분 동안 상온에서 고정하였다. 고정된 세포에 0.1% TritonX-100을 처리하고 5분 동안 반응시켜 항체의 세포 투과도를 높혔다. 2% BSA로 1시간 동안 블로킹한 뒤, 항-인간 ZO-1(Invitrogen, 1A12) 항체를 1% BSA에 1:500로 희석하여 세포에 처리하고 4℃에서 밤새도록 반응시켰다. 이후 FITC가 접합된 2차 항체(Jackson ImmunoResearch, 200-002-037)를 1% BSA에 1:1000으로 희석하여 세포에 처리한 뒤 1시간 동안 상온에서 반응시켰다. 세포 내 핵은 DAPI(4',6-diamidino-2-phenylindole, Sigma-Aldrich, D8417)(1 ㎕)를 처리하여 염색하였다. 상기 형광 염색된 세포를 컨포컬 현미경(LSM700 confocal laser scanning microscope, Carl Zeiss)를 사용하여 확인하였다. 또한 상기 세포 이미지는 Zen 3.0 소프트웨어(blue edition)를 이용하여 분석하였다.
그 결과, 도 37에 나타낸 바와 같이, 장 표피세포(Caco-2 세포)에 WARS1를 처리한 경우, ZO-1의 발현(밀착 연접, tight junction)이 감소되었으나, 항-WARS1 항체 처리에 의해 다시 회복되는 것을 확인할 수 있었다. 특히, H54K 항체 처리군에서 가장 큰 회복 효과가 관찰되었다.
상기 결과를 통하여, 염증성 장질환에서 항-WARS1 항체에 의해 장 내 투과도가 개선될 수 있음을 확인할 수 있었다.
실시예 11. 염증성 장질환 마우스 모델을 이용한 항-WARS1 항체의 염증성 장질환 개선 효과 검증
실시예 11.1. 염증성 장질환 마우스 모델 제작
염증성 장질환의 마우스 모델로 DSS 마우스 모델(dextran sulfate sodium-induced colitis model)을 사용하였다. 마우스는 6-10주령의 암컷 B57BL/6 마우스(오리엔트바이오)를 사용하였고, 온도 21~23℃, 상대습도 40~45%로 항온 항습이 유지되는 SPF 실험동물실에서 사육되었다. 또한, 케이지 별 실험동물 개체수는 4마리 이하로 수용하며 주 3회 케이지 교환 및 사료를 공급하였다.
DSS(MP biomedical, reagent-grade, MW 36-50 kDa, 160110)를 멸균수에 2.5%의 농도로 녹인 뒤, 마우스 케이지당 100 ㎖의 2.5% DSS 용액을 2일에 1회 교체하여 공급하였다. 실험 종료일까지 정기적으로 임상적 검사를 수행하여 염증진행 정도를 확인하고 체중을 측정하였다. 이때, 시험 시작일 체중으로부터 25% 이상 감소하는 경우 윤리적 차원에서 안락사를 시행하였다. 실험은 실험 시작일로부터 7 내지 8일에 대조군의 임상지수가 최대에 도달하였다고 판단될 때 종료하였다.
시험군은 총 4군으로 나누어 진행하였다(도 21). DSS는 0일부터 투여를 시작하였으며, 1일, 3일, 5일째부터 음성대조물질(vehicle, saline), Isotype IgG1(5 mg/kg, Bio X cell, BP0297), 및 항-WARS1 항체(GKB101, H54K, 각각 5 mpk)를 각각 복강투여 하였다. 이때, vehicle인 saline은 경구투여 하였다.
실험 시작일부터 실험 종료일까지 매일 1회 염증 발생 및 염증 정도를 관찰하여 0-4점의 점수를 부여하여 그 합계를 임상활성지수(disease activity index: DAI)로 사용하였다. 또한, 체중을 매일 1회 측정하여 0-4점의 점수를 부여하여 DAI 측정에 사용하였다.
모든 데이터는 표준편차(SEM)으로 표기되었고 ANOVA 통계 프로그램을 사용하여 분석하였다.
실시예 11.2. 임상지표 평가
실시예 11.2.1. 임상 활성지수 평가
DSS 마우스 모델에서 항-WARS1 항체의 염증성 장질환의 개선 효과를 확인하기 위하여, 실시예 11.1의 실험 마우스의 염증 증상 발생 및 체중 변화를 기반으로 임상활성지수(disease activity index: DAI)를 정량적으로 평가하였다(도 22a).
그 결과, 도 22b에 나타낸 바와 같이, 대조군(saline)과 비교하여 항-WARS1 항체(GKB101, H54K) 투여군에서 유의적으로 임상활성지수(disease activity index: DAI)가 감소하였고, 특히 H54K 투여군에서 유의적으로 감소한 것을 확인할 수 있었다(*p<0.05, ****p<0.0001).
임상지표의 AUC(area under the curve)를 분석한 결과에서도 임상지표의 투여기간 동안의 결과와 유사한 양상을 보였다.
상기 결과를 통해, 항-WARS1 항체, 특히 H54K는 염증성 장질환의 개선 효과가 있음을 확인할 수 있었다.
실시예 11.2.2. 체중 평가
또한, DAI를 평가 항목 중 하나인 체중감소 스코어(body weight loss score)를 평가한 결과, 정상군(con)에 비하여 체중감소가 뚜렷하였지만 Isotype IgG1 투여군과 비교하였을 시, 항-WARS1 항체 투여군에서는 통계적으로 유의한 차이를 관찰할 수 없었다.
실시예 11.2.3. 장 출혈 평가
실시예 11.1의 실험 마우스에서 장 출혈(rectal bleeding) 스코어를 평가하였다.
그 결과, 도 23에 나타낸 바와 같이, 대조군(saline)에 비해 항-WARS1 항체(GKB101, H54K) 투여군에서 장 출혈이 유의적으로 감소한 것을 확인할 수 있었다(****p<0.0001). 장 출혈 스코어의 AUC를 분석한 결과에서도 투여 기간 동안의 결과와 유사한 양상을 나타내었다.
실시예 11.2.4. 대변의 일관성 스코어 평가
실시예 11.1의 실험 마우스에서 대변의 일관성(stool consistency) 스코어를 평가하였다.
그 결과, 도 24에 나타낸 바와 같이, 대조군(saline)에 비해 항-WARS1 항체(GKB101, H54K) 투여군에서 대변의 일관성 스코어가 감소하였고, 특히 H54K 투여군에서 유의적으로 감소한 것을 확인할 수 있었다(*p<0.05, **p<0.01, ***p<0.001, ****p<0.0001). 대변의 일관성 스코어의 AUC를 분석한 결과에서도 투여 기간 동안의 결과와 유사한 양상을 나타내었다.
실시예 11.2.5. 장 길이 측정
실시예 11.1의 실험 마우스에서 대장 조직을 적출하고, 장 길이를 측정하였다.
그 결과, 도 25에 나타낸 바와 같이, 대조군(saline)에서는 대장의 길이가 감소되었다. 반면, 항-WARS1 항체(GKB101, H54K) 투여군에서는 대조군에 비해 대장의 손상이 유의적으로 감소하였고, 특히 H54K 투여군에서 유의적으로 감소한 것을 확인할 수 있었다(*p<0.05).
실시예 11.2.5. 비장의 중량 측정
실시예 11.1의 실험 마우스에서 비장을 적출하고, 비장의 중량을 측정하였다.
그 결과, 도 26에 나타낸 바와 같이, 대조군(PBS)에서는 비장 중량이 무처리군과 비교하여 증가하였다. 반면, 항-WARS1 항체(H54K) 투여군에서는 비장의 중량이 유의적으로 감소된 것을 확인할 수 있었다(**p<0.01).
실시예 11.3. 장 조직 내 면역인자 발현 확인
실시예 11.1의 실험 마우스에서 장조직을 부위별로 적출하여 단백질 및 mRNA을 분리하고 각각의 샘플에서 면역인자의 발현을 확인하였다.
단백질 샘플은 하기와 같은 방법으로 준비하였다.
먼저, 장 전체 또는 말단(distal) 부위를 적출한 뒤 단백질 용해 버퍼(protein lysis buffer)를 첨가하여 조직을 용해시켰다. 상기 용해물을 13,000 rpm으로 원심분리한 뒤, 상층액만을 수득하여 정량하고 장 조직 샘플로 사용하였다.
상기와 같이 분리된 단백질은 IL-1β(R&D systems, DY401), TNF-α(BioLegend, 430915), MCP-1(R&D systems, DY479), IFN-γ(R&D systems, DY485), CXCL2/MIP2(R&D systems, DY425), IL-6(BioLegend, 431315), IL-17A(R&D Systems, DY421) 및 MIP1α(R&D systems, DY450)의 농도를 측정하는데 사용하였다.
또한 WARS1의 발현은 하기와 같이 측정하였다.
WARS1 단일클론 항체를 1 ㎍/㎖의 농도로 96웰 플레이트(Maxisorp, Thermo fisher)에 코팅한 뒤, 1% BSA가 포함되어 있는 PBS로 상온에서 1시간 동안 블로킹하였다. 샘플 또는 재조합 WARS1을 코팅된 웰에 각각 첨가하고 상온에서 1시간 동안 반응시킨 뒤, PBST(PBS+ Tween20)로 4번 세척하였다. 각 웰에 항-WARS1 항체(MirimGENE Co., Ltd)를 첨가하여 상온에서 1시간 동안 반응시킨 뒤, PBST로 4번 세척하였다. HRP가 붙어있는 2차 항체로(항-래빗 IgG, HRP-접합된 항체) 1시간 동안 반응시킨 뒤, PBST로 세척하고 TMB 기질(BD)로 발색시켜 490 nm에서 OD값을 측정하였다(VersaMax Microplate reader).
mRNA는 단백질 샘플과 동일한 장 부위에 Trizol(invitrogen, 15596026)을 첨가한 뒤, 제조사의 프로토콜에 따라 RNeasy RNA isolation 키트(QIAGEN)를 이용하여 RNA 추출하였다. 상기 RNA를 주형으로 하여 cDNA EcoDry Premix(Random Hexamers) 키트(Takara, 639546)을 이용하여 cDNA를 합성하고 면역인자의 발현을 q-PCR을 통해 확인하였다. 이때, 사용한 프라이머는 표 22에 나타내었다.
유전자명 정방향 프라이머(5'에서 3') 역방향 프라이머(5'에서 3')
FOXP3 CCTGCCTTGGTACATTCGTG(서열목록 118) TGTTGTGGGTGAGTGCTTTG(서열목록 119)
IFN-γ ACAGCTCTCCGTCCTCGTAT(서열목록 120) CCTTAGAGTAGAAAGACCG(서열목록 121)
IL-6 CCTCTGGTCTTCTGGAGTAC(서열목록 122) GGAAATTGGGGTAGGAAGG(서열목록 123)
IL-10 AGCCACATGCTCCTAGAGC(서열목록 124) GCCTGGGGCATCACTTCTAC(서열목록 125)
iNOS GGAGCCTTTAGACCTCAACAGA(서열목록 126) TGAACGAGGAGGGTGGTG(서열목록 127)
MCP-1 GGGACGTTTGCTATGATGCC(서열목록 128) CCTACTCATTGGGATACTCTTGCT(서열목록 129)
TGF-β1 ACCATGCCAACTTCTGTCTG(서열목록 130) CGGGTTGTGTTGGTTGTAGA(서열목록 131)
TNF-α GCCTCTTCTCATTCCTGCTT(서열목록 132) TGGGAACTTCTCATCCCTTTG(서열목록 133)
WARS1 CAGGATGTGTTCAATGTGCC(서열목록 134) TTGAAGGTGACGTGCTTCTG(서열목록 135)
GAPDH TCAACAGCAACTCCCACTCTTCCA(서열목록 136) ACCCTGTTGCTGTAGCCGTATTCA(서열목록 137)
그 결과, 도 27에 나타낸 바와 같이, 대조군(saline)과 비교하여 항-WARS1 항체(GKB101, H54K) 투여군에서 WARS1, TNF-α, IL-6, MIP1α 및 MCP-1의 단백질 발현이 유의적으로 감소한 것을 확인할 수 있었다. 특히, H54K 항체 투여군에서 더 많이 감소하는 것이 관찰되었다. 또한, TNF-α, IFN-γ, MCP-1, IL-6 및 iNOS와 같은 면역인자들의 mRNA 발현도 대조군과 비교하여 항-WARS1 항체 투여군에서 유의적으로 감소하였고, 특히 H54K 항체 투여군에서 가장 많이 감소한 것을 확인할 수 있었다(도 28). 이때, 장 조직 내의 WARS1 발현도 유의적으로 감소한 것을 확인하였다.
상기 결과를 통하여, 항-WARS1 항체(GKB101, H54K)는 염증성 장질환 모델에서 장 조직 내 염증성 면역인자의 발현을 억제할 수 있으며, 특히 GKB101 항체와 비교하여 H54K 변이체 항체가 억제 활성이 더욱 우수함을 확인할 수 있었다.
실시예 11.4. 장 조직의 형태학적 평가
실시예 11.1의 실험 마우스에서 장 조직을 적출하고, 실시예 9.2.1과 동일한 방법으로 H&E 염색을 수행하여 장 조직의 형태를 관찰하였다.
그 결과, 도 29에 나타낸 바와 같이, 대조군(saline)과 비교하여 항-WARS1 항체 투여군에서 장 조직의 손상 및 면역세포의 침투가 감소한 것을 확인할 수 있었다. 특히, 상기 효과는 H54K 항체 투여군이 GKB101 항체 투여군보다 우수하였다.
IV. 항-WARS1 항체의 류마티스 관절염 개선 효과 검증
실시예 12. 류마티스 관절염 관련 세포주에서 항-WARS1 항체의 항염 활성 확인
항-WARS1 항체(H54K)의 류마티스 관절염에 대한 치료효과를 확인하기 위하여, 류마티스 관절염에 관여하는 세포를 이용하여 항-WARS1 항체의 항염 활성을 확인하였다.
이때, 세포는 인간 윤활막세포 유사 섬유아세포 세포주(FLS, fibroblast like synoviocyte cell line, cell applications, 408K-05a), 마우스 대식세포주인 J774A.1 세포 및 마우스 대식세포주인 RAW264.7 세포에서 분화된 파골세포를 사용하였다.
구체적으로, 상기 세포주를 96웰 플레이트에 2×104 세포/웰로 각각 접종하여, 0.1% FBS가 포함된 DMEM에서 24시간 동안 배양하였다. 이때, WARS1(10 ㎍/㎖) 및 항-WARS1 항체(H54K, 10 ㎍/㎖)를 혼합하여 37℃에서 1시간 동안 반응시켜 준비하였다. 상기 WARS1/항-WARS1 항체 혼합액을 준비된 세포에 처리하고 16시간 추가배양 하였다. 16시간 후, 배양액을 취하여 배양액 내 CXCL2(R&D systems, DY452), MMP3(R&D systems, DY548), IL-6(BioLegend, #431304) 및 TNF-α(BioLegend, #430904)의 농도를 ELISA를 통해 측정하였다. J774A.1 세포 실험의 경우, IgG를 항-WARS1 항체에 대한 대조군으로 사용하였다. RAW264.7 세포는 50 ng/㎖의 재조합 단백질 마우스 RANKL(peprotech, 315-11)이 포함된 10% FBS/DMEM 배지에서 RAW264.7 세포를 5일간 배양하여 파골세포로 분화를 유도하였다. 이후 분화된 파골세포만 수거하여 상기 WARS1(10 ㎍/㎖) 및 항-WARS1 항체(H54K, 10, 12.5, 25 ㎍/㎖)의 중화방법과 동일한 조건으로 항-WARS1 항체에 의한 파골세포의 활성억제능을 확인하였다.
그 결과, 도 30에 나타낸 바와 같이, J774A.1 세포, FLS 세포 및 RAW264.7 세포 유래 파골세포에서 모두 WARS1의 처리에 의한 세포 활성을 통한 염증 염증 반응이 항-WARS1 항체(H54K) 처리에 의해 감소한 것을 확인할 수 있었다.
실시예 13. 류마티스 관절염 마우스 모델을 이용한 항-WARS1 항체의 류마티스 관절염 개선 효과 검증
실시예 13.1. 류마티스 관절염 마우스 모델 제작
류마티스 관절염 모델인 CIA(Collagen-Induced Arthritis) 마우스 모델을 이용하여 항-WARS1 항체(H54K)의 염증성 관절염에 대한 개선 효과를 확인하였다.
마우스는 7주령의 수컷 DBA/1J 마우스를 사용하였고, 온도 21~23℃상대습도 40~45%로 항온 항습이 유지되는 SPF 실험동물실에서 사육되었다(IACUC No. 2021-0133).
또한, 케이지별 실험동물 개체수는 6마리 이하로 수용하며, 주 2회 케이지 교환 및 사료를 공급하였다. 먼저, CIA 마우스 모델을 제작하기 위하여, 관절염 유도를 위한 자극제는 10 mM 아세트산(acetic acid)에 2 mg/㎖의 농도가 되도록 2형 우태아 콜라겐(bovine type II collagen)을 녹인 뒤, CFA(Complete Freund's adjuvant, 2 mg/㎖)과 1:1(v/v)로 혼합하여 준비하였다. 상기 방법으로 준비한 콜라겐을 7주령 마우스의 꼬리에 마리당 100 ㎕씩 피내주사 하여 1차 면역화를 진행하였다. 1차 면역화를 진행하고 21일 후, IFA(Incomplete Freund's adjuvant) 및 2형 우태아 콜라겐을 1:1(v/v)로 혼합하여 에멀전화한 후, 마우스 꼬리에 마리당 100 ㎕씩 피내주사 하여 2차 면역화를 진행하였다. 2차 면역화를 진행한 마우스는 무작위로 나누어 실험군으로 사용하였다. 실험군은 Isotype IgG1 투여군(5 mg/kg) 및 항-WARS1 항체(H54K, 5 mg/kg) 투여군으로 나누어 진행하였다. 투여는 2차 면역화 수행일(21일)부터 2일에 1회씩 총 10회 복강투여 하였다.
실시예 13.2. 관절염 임상 지수 평가
실시예 13.1의 실험 마우스에서 실험 물질을 투여하기 시작한 후부터 족부의 관절염 발생 및 중증도의 임상적 평가를 임상지표 기준(도 32a)에 따라 평가하였다.
그 결과, 도 32b에 나타낸 바와 같이, Isotype IgG1 투여군에 비해 항-WARS1 항체(KB101, H54K) 투여군에서 관절염 중증도가 감소하였고, 특히 H54K 항체 투여군에서 유의적으로 감소한 것을 확인할 수 있었다(IgG1 투여군 vs 항-WARS1 항체 투여군(H54K), 7.85±0.319 vs 4.59±0.182, *p<0.05). 임상적 관절염 중증도(CAI, clinical arthritis index)의 AUC를 분석한 결과에서도 투여 기간 동안의 결과와 유사한 양상을 나타냈다.
관절염 발병률(arthritis incidence)도 Isotype IgG1 투여군에 비해 항-WARS1 항체(GKB101, H54K) 투여군에서 감소하였고, 특히 H54K 항체 투여군에서 유의적으로 감소한 것을 확인하였다(Isotype IgG1 vs 항-WARS1 항체(H54K), 46.42±7.945 vs 12.5±3.689, **p<0.01). 관절염 발병률의 AUC 분석 결과에서도 Isotype IgG1 투여군에 비하여 항-WARS1 항체(H54K) 투여군에서 유의적으로 감소한 것을 확인하였다(Isotype IgG1 vs 항-WARS1 항체(H54K), 99.99±9.817 vs 35±3.931, *p<0.05).
상기 결과를 통해, 항-WARS1 항체는 류마티스 관절염 모델에서 치료 효과가 있으며, 특히 H54K 항체가 GKB101 항체보다 효과가 우수함을 확인할 수 있었다.
실시예 13.3. 혈청 및 족부 관절 내 염증인자 및 파골인자 농도 분석
실시예 13.1의 실험 마우스에서 혈청 및 족부 관절을 수득하여 염증성 사이토카인 및 케모타인의 농도를 측정하였다.
구체적으로, 족부 관절 내의 단백질은 마우스의 관절 조직에서 피부 조직을 제거한 뒤, 단백질 용해 버퍼를 첨가하여 조직을 용해시켰다. 상기 용해물을 13,000 rpm에서 원심분리 하여 상층액을 수득하고 정량하여 관절 조직 단백질로 사용하였다.
상기 단백질을 이용하여 혈청 및 족부 관절 내 WARS1, 염증성 사이토카인 및 케모카인은 mouse CXCL2/MIP-2 ELISA(R&D systems) 키트, mouse IL-6 ELISA(BioLegend) 키트, mouse MIP1-α ELISA(R&D systems) 키트, MMP3(R&D systems, DY548), IL-6(BioLegend, #431304), TNF-α(BioLegend, #430904), IL-17A, IL-17F, MMP9, RANKL 및 IL-1β 키트를 사용하여 ELISA를 통해 측정하였고, 방법은 제조사의 방법 따라 진행하였다.
그 결과, 도 33a 내지 도 33d에 나타낸 바와 같이, Isotype IgG1 투여군과 비교하여 항-WARS1 항체(H54K) 투여군에서 WARS1, IL-17A, IL-17F, TNF-α, IL-6, MIP1α, CXCL2/MIP2(IL-8 homologue), IL-1β 및 MMP3의 농도가 유의적으로 감소하는 것을 관찰할 수 있었다(도 33a 내지 도 33d). 이때, 모든 데이터는 표준편차(SEM)로 표기되었고, ANOVA 통계 프로그램을 사용하여 분석하였다.
상기 결과를 통해, 항-WARS1 항체(GKB101, H54K)는 류마티스성 관절염 모델에서 염증성 사이토카인 및 케모카인 발현 억제 뿐 아니라 연골세포 파쇄인자/파골세포 분화인자 발현도 억제하는 것을 확인할 수 있었다.
V. 항-WARS1 항체의 피부염 개선 효과 검증
실시예 14. 인간 피부 세포주에서 항-WARS1 항체의 항염 활성 확인
아토피 피부염에서 항-WARS1 항체(H54K)의 항염 활성, 세포 이동 및 증식 억제에 대한 표적 기전을 확인하기 위하여 인간 진피 섬유아세포(성인)(HDFa, human dermal fibroblast adult, ATCC, PCS-201-012) 및 인간 각질 세포(HaCat, human keratinocyte)를 사용하였다. 상기 세포는 10% FBS 및 1% 항생제/항진균제가 포함된 DMEM에서 배양하였다.
구체적으로, 항염 활성을 확인하기 위하여, HDFa 및 HaCat 세포를 96웰 플레이트에 웰 당 2×104 세포/웰로 접종하여 0.1% FBS가 포함된 DMEM에서 24시간 배양하였다. WARS1을 분비시키기 위해 Staphylococcus aureus(항생제내성균주은행, CCARM2307)를 10의 감염다중도(MOI)로 처리하고 PBS(vehicle) 또는 1.25 ㎍/㎖의 항-WARS1 항체(H54K)를 각각 처리하였다. 16시간 추가 배양 후, 각각의 세포 배양액을 수거하여 배양액 내의 IL-8(BioLegend, #431504), MCD1(R&D systems, DY336), TARC(R&D systems, DY364) 및 WARS1의 농도를 ELISA를 이용하여 측정하였다. 이때, 세포 배양액 내 WARS1의 농도는 실시예 11.3과 동일한 방법을 통해 측정하였다.
또한 세포의 이동 및 증식 억제 효과를 확인하기 위해 HDFa 및 HaCat 세포를 24웰 플레이트에 웰 당 1×105 세포/웰로 접종하여 0.1% FBS가 포함된 DMEM에서 24시간 배양하였다. 이후 micro-tip을 이용하여 웰의 배양바닥을 긁어 세포가 없는 일정 공간을 형성시켰다. 그리고 WARS1(20 ㎍/㎖) 및 항-WARS1 항체(H54K, 20 ㎍/㎖)를 혼합하여 37℃에서 1시간 동안 반응시켰다. 상기 혼합액을 해당 웰에 처리하고 16시간 추가배양 하였다. 16시간 후 각 웰을 광학 현미경으로 관찰하고 세포들의 이동 및 증식을 사진으로 기록하였다.
그 결과, 도 34a 내지 도 34c에 나타낸 바와 같이, HDFa 세포 및 HaCat 세포 Staphylococcus aureus 처리에 의한 WARS1의 분비가 증가한 반면, 항-WARS1 항체(H54K)의 처리에 의하여 WARS1 및 IL-8의 분비가 유의적으로 감소한 것을 확인하였다. 또한, 상기 세포의 이동 및 증식도 항-WARS1 항체 처리에 의하여 감소한 것을 확인할 수 있었다.
실시예 15. 아토피 마우스 모델에서 항-WARS1 항체의 아토피 피부염 개선 효과 검증
실시예 15.1. 아토피 마우스 모델 제작
마우스는 8주령의 암컷 NC/Nga 마우스를 사용하였고, 온도 21~23℃상대습도 40~45%로 항온 항습이 유지되는 SPF 실험동물실에서 사육되었다. 또한, 케이지별 실험동물 개체수는 3마리 이하로 수용하였고, 주 1회 케이지 교환 및 사료를 공급하였다.
먼저, 아토피 마우스 모델을 제작하기 위하여, 실험 시작 1일 전 NC/Nga 마우스의 등 부위의 윗쪽 부분까지 제모하고, 4％ SDS 수용액을 이용하여 도포 예정인 피부 부위의 지방 성분을 제거하였다. 약 1시간 동안 완전히 건조시킨 후, 편편한 스틱을 이용하여 Biostir AD(아토피 피부염 유발 시약, 집먼지진드기) 연고 100 mg을 제모된 부위에 균일하게 도포하였다. Biostir AD 연고 도포는 주 3회의 간격으로 4주 동안(총 12회) 실시하였다. SpA(Staphylococcus protein A, Sigma Aldrich)는 14일째부터 마리당 200 ㎍씩(200 ㎍/마우스) 5일 간격으로 총 3회 등 부위에 도포하였다. 항-WARS1 항체(H54K)(10 mg/kg) 또는 Isotype IgG1(10 mg/kg)은 1주에 3회씩 총 6회 복강투여 하였다. 이때, 대조군으로 Isotype IgG1을 사용하였고, 양성대조군으로는 덱사메타손을 사용하였다. 덱사메타손은 10 mg/kg의 농도로 1주에 3회씩 총 6회 복강 투여하였다(도 35).
실시예 15.2. 임상지표 평가
항-WARS1 항체(H54K)의 아토피 피부염 개선 효과를 확인하기 위하여, 아토피 마우스 모델에서 Isotype IgG1, 덱사메타손 또는 항-WARS1 항체(H54K)를 투여하고, 피부 홍반/출혈, 상처/건조, 부종 및 탈락 등을 관찰하여 아토피 피부염으로의 발현을 임상적으로 평가하였다.
그 결과, 도 36에 나타낸 바와 같이, Isotype IgG1 투여군은 정상군(naive, 피부염을 유발하지 않은 군)과 비교하여 4종의 지표에 대하여 피부염 점수가 크게 증가하였다. 반면, 항-WARS1 항체 투여군의 경우, Isotype IgG1 투여군과 비교하여 피부염 지수가 유의적으로 감소하였다.
VI. 항-WARS1 항체의 대식세포 활성화 증후군 개선 효과 검증
실시예 16. CpG 이용한 대식세포 활성화 증후군 모델에서 항-WARS1 항체의 항염 활성 확인
실시예 16.1. CpG 이용한 대식세포 활성 증후군 모델 제작
대식세포 활성화 증후군 마우스 모델로 CpG(CpG oligodeoxynucleotides (ODN)-induced macrophage activation syndrome model) 마우스 모델을 이용하였다. 마우스는 8-10 주령의 암컷 B57BL/6J 마우스를 사용하였고, 온도 21~23℃ 상대습도 40~45%로 항온 항습이 유지되는 SPF 실험동물센터에서 사육되었다. 또한, 케이지 별로 개체 수는 5마리로 수용하며 주 1회 케이지 교환 및 사료를 공급하였다.
CpG ODN(InvivoGen, Class B, tlrl-1826)을 PBS에 45 ㎍/200 ㎕의 농도로 희석하여 -80℃에 저장한 뒤, 마우스 별로 2일마다 하루 1회씩 총 5회(0, 2, 4, 6, 8일) 200 ㎕씩 복강 투여하였다. 마지막 투여 1일 후(9일차)에 호흡 마취된 마우스의 심장으로부터 혈액을 채혈한 후, 염증성 지표 및 세포 활성 정도를 확인하기 위하여 간 및 비장을 채취하였다. 실험 종료일까지 하루 1회 마우스의 상태를 확인하였다.
시험군은 총 6군으로 나누어 진행하였으며, CpG 투여일마다 CpG 투여 2시간 후 음성대조군 PBS, Isotype IgG(10 mg/kg, Bio X cell, BP0297), 항-WARS1 항체[(H54K, 5, 10, 15 mg/kg) 또는 GKB101(10 mg/kg)]을 각 농도에 맞게 복강 투여하였다. 모든 데이터는 표준편차(SEM)로 표기되었고, ANOVA 통계 방법을 이용하여 다중 비교 분석하였다(도 38).
실시예 16.2. 간 조직 내 WARS1 및 염증성 사이토카인 발현 분석
실시예 16.1의 마우스 간 조직의 일부를 채취하여 gentleMACSTM Octo Dissociator(Miltenyi Biotec) 및 Trizol(Takara, 9109, 1 ㎖)을 사용하여 간 조직을 용해하였다. 상기 용해된 간 조직에서 상기 실시예 11.3과 동일한 방법으로 RNA 분리하고 cDNA를 합성한 뒤, 표 22 및 표 23의 프라이머를 이용하여 q-PCR을 통해 유전자 발현을 확인하였다.
유전자명 정방향 프라이머(5'에서 3') 역방향 프라이머(5'에서 3')
IFN-γ GAACTGGCAAAAGGATGGTGA(서열목록138) TGTGGGTTGTTGACCTCAAAC(서열목록 139)
IL-6 TACCACTTCACAAGTCGGAGGC(서열목록 140) CTGCAAGTGCATCGTTGTTC(서열목록 141)
TNF-α GGTGCCTATGTCTCAGCCTCTT(서열목록 142) GCCATAGAACTGATGAGAGGGAG(서열목록 143)
CXCL9 ATGAAGTCCGCTGTTCTTTTCC(서열목록 144) GTCTCTTATGTAGTCTTCCTTG(서열목록 145)
그 결과, 도 40b에 나타낸 바와 같이, PBS 투여군 또는 Isotype IgG 투여군과 비교하여 항-WARS1 항체(GKB101, H54K) 투여군에서 WARS1 및 염증성 사이토카인, 케모카인의 발현이 감소하였다. 특히 H54K 항체 투여군에서는 농도 의존적으로 WARS1, 염증성 사이토카인 및 케모카인의 발현이 감소되었다. CpG 마우스 모델에서 항-WARS1 항체(GKB101, H54K)에 의한 간 조직 내 WARS1 감소 효과를 확인하기 위하여 마우스의 간 조직 일부를 채취하여 단백질 용해 버퍼를 첨가한 후 M tube(Miltenyi Biotec, 130-093-236)에 간 조직을 넣고 gentleMACSTM Octo Dissociator(Miltenyi Biotec)를 이용하여 균질화 하였다. 이후 과정은 실시예 11.3과 동일한 방법으로 WARS1을 측정하였다.
그 결과, 도 40a에 나타낸 바와 같이, PBS 투여군 또는 Isotype IgG1 투여군과 비교하여 항-WARS1 항체(GKB101, H54K) 투여군의 간 조직 내 WARS1의 발현이 감소한 것을 확인할 수 있었다. 특히 H54K 항체 투여군에서는 농도 의존적으로 WARS1의 발현이 감소하였다.
실시예 16.3. 혈액 내 Ferritin 분석
CpG 마우스 모델에서 항-WARS1 항체(GKB101, H54K)에 의한 혈장 내 ferritin 감소 효과를 확인하기 위하여 마우스의 심장 채혈을 통해 혈액을 수득한 뒤, 헤파린 튜브에 옮겨 상온에서 2,000 rpm으로 20분 동안 원심분리하여 혈장을 준비하였다. Ferritin은 ELISA 키트(ferritin kit, Abcam, ab157713)를 이용하여 제조사의 프로토콜에 따라 측정하였다.
그 결과, 도 39에 나타낸 바와 같이, PBS 투여군 또는 Isotype IgG1 투여군과 비교하여 H54K 항체 투여군(15 mg/kg)에서 유의적으로 혈청 내 ferritin 수준이 감소하였음을 확인할 수 있었다
실시예 16.4. 비장 내 면역세포 분포 분석
CpG 마우스 모델에서 항-WARS1 항체에 의한 T 세포의 분포(%) 및 자연살해세포(NK 세포)의 분포(%)의 변화를 확인하기 위하여 마우스의 비장을 적출한 후 70 μm 세포 스트레이너를 통과시켜 단일세포를 확보였다. 상기 세포에 대하여 면역 형광염색을 수행하였다. 이때 사용한 항체는 하기 표 24와 같다.
항체 제조사 Cat no
BD Pharmingen™ APC Rat Anti-Mouse CD45 BD Pharmingen 559864
BD Pharmingen™ FITC Mouse Anti-Mouse NK-1.1 BD Pharmingen 553164
BD Horizon™ V450 Rat anti-CD11b BD Pharmingen 560455
BD Pharmingen™ PE Hamster Anti-Mouse CD27 BD Pharmingen 558754
BD Pharmingen™ PE Hamster Anti-Mouse CD3e BD Pharmingen 553064
BD Pharmingen™ FITC Rat Anti-Mouse CD8 BD Pharmingen 561966
BD Pharmingen™PE anti-mouse IFN gamma BD Pharmingen 554412
항-마우스 IFN-γ 항체를 제외한 상기 항체를 각각의 해당 세포 샘플튜브에 처리하고 20분간 반응 후 FACS 버퍼로 세척하였다. 활성화된 Th1 세포의 분포를 확인하기 위한 해당 튜브샘플은 fix/perm buffer(invitrogen, 00-5523-00)을 사용하여 샘플을 고정/투과시켰다. 상기 샘플튜브에 PE 항-마우스 IFN-γ 항체를 처리하여 반응시킨 뒤 FACS 버퍼로 세척하고 유세포 분석을 수행하였다. 상기 분석값은 FlowJo 프로그램(FlowJo™ v7 Software, BD Biosciences)을 이용하여 CD45+CD11b+CD27-NK1.1+(활성 NK 세포), CD45+CD3+CD8+IFNγ+(활성 Th1 세포)로 각각의 면역세포를 분류하고 각 세포들의 분포(%)를 분석하였다. 그 결과, 도 41a에 나타낸 바와 같이, 정상군과 비교하여 PBS 투여군 및 Isotype IgG1 투여군에서는 NK 세포의 분포(%)가 증가하였다. 반면, 항-WARS1 항체(GKB101, H54K) 투여군에서 PBS 투여 및 Isotype IgG1 투여군과 비교하여 NK 세포의 분포가 감소한 것을 확인할 수 있었다. 특히, H54K 항체 투여군의 경우 농도 의존적으로 NK 세포의 분포(%)가 감소하였다.
실시예 17. 간 조직 내 면역세포 침투 분석
CpG 마우스 모델에서 항-WARS1 항체(GKB101, H54K)에 의한 간 조직 내 면역세포의 침투에 대한 영향을 확인하기 위해 적출한 마우스 간의 한 엽을 채취하여 10% 포르말린 용액(Sigma, HT501128)으로 약 1일 동안 고정하였다. 상기 고정된 조직은 실시예 11.1과 동일한 방법으로 H&E 염색을 실시하여 관찰하였다.
그 결과, 도 41b에 나타낸 바와 같이, PBS 투여군 및 Isotype IgG1 투여군과 비교하여 항-WARS1 항체(H54K, GKB101) 투여군의 간 조직에서 면역세포 침윤이 감소한 것을 확인할 수 있었다.

Claims (16)

  1. 서열번호 3의 아미노산 서열을 포함하는 H-CDR1, 서열번호 5의 아미노산 서열을 포함하는 H-CDR2 및 서열변호 7의 아미노산 서열을 포함하는 H-CDR3을 포함하는 중쇄가변영역; 및
    서열번호 12의 아미노산 서열을 포함하는 L-CDR1, 하기의 서열번호 95의 아미노산 서열을 포함하는 L-CDR2 및 하기의 서열번호 96의 아미노산 서열을 포함하는 L-CDR3을 포함하는 경쇄 가변 영역;을 포함하는 항-WARS1 항체 또는 이의 단편:
    N 말단-Ala Asn Xaa1 Xaa2 His Arg Pro Ser-C 말단(서열번호 95),
    여기서, Xaa1은 Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly 또는 Pro이며,
    Xaa2는 Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly 또는 Pro이고,
    이때, Xaa1이 Ser인 경우, Xaa2는 His가 아니며,
    N 말단-Gly Ala Trp Asp Asp Ser Xaa3 Ser Ala Tyr Val-C 말단(서열번호 96),
    여기서, Xaa3은 Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, Lys, Arg, His, Asp, Ser, Thr, Glu, Asn, Gln, Cys, Gly 또는 Pro이다.
  2. 제1항에 있어서,
    상기 항체 또는 이의 단편은 WARS1에 특이적으로 결합하는 것인, 항-WARS1 항체 또는 이의 단편.
  3. 제1항에 있어서,
    상기 항체 또는 이의 단편은 WARS1에 특이적으로 결합하는 것인, 항-WARS1 항체 또는 이의 단편.
  4. 제1항에 있어서,
    상기 Xaa3은 Leu 또는 Asn인 것인, 항-WARS1 항체 또는 이의 단편.
  5. 제1항에 있어서,
    상기 경쇄 가변 영역은
    서열번호 12의 아미노산 서열을 포함하는 L-CDR1;
    서열번호 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42 및 44로 이루어진 군에서 선택되는 어느 하나의 아미노산 서열을 포함하는 L-CDR2;
    서열번호 16 또는 서열번호 46의 아미노산 서열을 포함하는 L-CDR3;을 포함하는 것인, 항-WARS1 항체 또는 이의 단편.
  6. 제1항에 있어서,
    상기 중쇄 가변 영역은 서열번호 9의 아미노산 서열을 포함하는 것인, 항-WARS1 항체 또는 이의 단편.
  7. 제1항에 있어서,
    상기 경쇄 가변 영역은 서열번호 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 48 및 49로 이루어진 군에서 선택되는 어느 하나의 아미노산 서열을 포함하는 것인, 항-WARS1 항체 또는 이의 단편.
  8. 제1항에 있어서,
    상기 항체는 Fc 영역을 포함하는 것인, 항-WARS1 항체 또는 이의 단편.
  9. 제1항 내지 제8항 중 어느 한 항의 항-WARS1 항체 또는 이의 단편을 암호화하는 폴리뉴클레오티드.
  10. 제9항의 폴리뉴클레오티드를 포함하는 발현 벡터.
  11. 제10항의 발현 벡터가 도입된 형질전환 세포.
  12. 제11항의 형질전환 세포를 배양하는 단계; 및
    항-WARS1 항체 또는 이의 단편을 수득하는 단계;를 포함하는 항-WARS1 항체 또는 이의 단편의 제조 방법.
  13. 제1항 내지 제8항 중 어느 한 항의 항-WARS1 항체 또는 이의 단편을 유효성분으로 포함하는 염증성 질환의 예방 또는 치료용 약학 조성물.
  14. 제13항에 있어서,
    상기 염증성 질환은 복막염, 골수염, 봉소염, 뇌막염, 뇌염, 췌장염, 외상 유발 쇼크, 낭포성 섬유증, 뇌졸중, 라임병, 결절성 다발동맥염, 과민성 혈관염, 루게릭 육아종증, 관절 세포 동맥염, 점액낭염, 건초염, 상과염(테니스 엘보), 헤노흐-쉔라인 자반병, 다중심성 세망조직구종, 수르코일로시스(surcoilosis), 혈색소증, 겸상 적혈구증 및 기타 혈색소병증, 고지단백혈증, 저감마글로불린혈증, 가족성 지중해열, 재귀열, 패혈증, 패혈성 쇼크, 다장기 기능장애 증후군, 기관지 폐 형성장애(broncho-pulmonary dysplasia), 염증성 장질환, 만성 폐쇄성 폐질환(COPD), 대식세포 활성화 증후군(MAS), 만성전신성 홍반성 루푸스, 경피증, 아토피성 피부염, 건선, 아나필랙시스, 피부염, 당뇨병성 망막증, 망막염, 황반 변성, 포도막염, 결막염, 관절염, 류마티스성 관절염, 강직성 척추염, 골관절염, 골다공증, 알레르기, 당뇨, 당뇨성 신장병, 신우염, 신장염, 쇼그렌 증후군, 자가 면역 췌장염, 치주질환, 천식, 이식편 대 숙주 질환, 만성 골반 염증 질환, 자궁내막염, 비염, 이식 거부 및 만성 전립선염으로 구성되는 군으로부터 선택되는 어느 하나인 것인, 염증성 질환의 예방 또는 치료용 약학 조성물.
  15. 제1항의 항체 또는 이의 단편의 염증성 질환 예방 또는 치료용 용도.
  16. 제1항의 항체 또는 이의 단편을 개체에 투여하는 단계를 포함하는 염증성 질환의 예방 또는 치료 방법.
PCT/KR2023/005828 2022-04-27 2023-04-27 항―wars1 항체 및 이의 용도 WO2023211229A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2022-0052421 2022-04-27
KR20220052421 2022-04-27

Publications (1)

Publication Number Publication Date
WO2023211229A1 true WO2023211229A1 (ko) 2023-11-02

Family

ID=88519264

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/005828 WO2023211229A1 (ko) 2022-04-27 2023-04-27 항―wars1 항체 및 이의 용도

Country Status (2)

Country Link
KR (1) KR20230154482A (ko)
WO (1) WO2023211229A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101729547B1 (ko) * 2016-07-05 2017-04-25 충남대학교 산학협력단 트립토파닐-tRNA 합성효소 단백질을 함유하는 조성물의 백신 보조제로서의 활용
KR101899591B1 (ko) * 2015-02-26 2018-09-17 재단법인 의약바이오컨버젼스연구단 트립토파닐 티알엔에이 합성효소를 유효성분으로 포함하는 감염성 염증 질환의 치료 또는 예방용 조성물 및 면역증강용 조성물
KR20210010236A (ko) * 2019-07-19 2021-01-27 재단법인 의약바이오컨버젼스연구단 트립토파닐-티알엔에이 합성효소 단백질에 특이적으로 결합하는 항체 및 이의 용도

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101899591B1 (ko) * 2015-02-26 2018-09-17 재단법인 의약바이오컨버젼스연구단 트립토파닐 티알엔에이 합성효소를 유효성분으로 포함하는 감염성 염증 질환의 치료 또는 예방용 조성물 및 면역증강용 조성물
KR101729547B1 (ko) * 2016-07-05 2017-04-25 충남대학교 산학협력단 트립토파닐-tRNA 합성효소 단백질을 함유하는 조성물의 백신 보조제로서의 활용
KR20210010236A (ko) * 2019-07-19 2021-01-27 재단법인 의약바이오컨버젼스연구단 트립토파닐-티알엔에이 합성효소 단백질에 특이적으로 결합하는 항체 및 이의 용도

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
JIN MIRIM, JIN MIRIM: "Unique roles of tryptophanyl-tRNA synthetase in immune control and its therapeutic implications", EXPERIMENTAL AND MOLECULAR MEDICINE, SEOUL, KR, vol. 51, no. 1, 1 January 2019 (2019-01-01), KR , pages 1 - 10, XP055924828, ISSN: 1226-3613, DOI: 10.1038/s12276-018-0196-9 *
YU YA CHUN; HAN JUNG MIN; KIM SUNGHOON: "Aminoacyl-tRNA synthetases and amino acid signaling", BIOCHIMICA ET BIOPHYSICA ACTA, ELSEVIER SCIENCE PUBLISHERS, AMSTERDAM., NL, vol. 1868, no. 1, 20 October 2020 (2020-10-20), NL , XP086349114, ISSN: 0167-4889, DOI: 10.1016/j.bbamcr.2020.118889 *

Also Published As

Publication number Publication date
KR20230154482A (ko) 2023-11-08

Similar Documents

Publication Publication Date Title
WO2017116205A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체의 지속형 결합체
WO2018030806A1 (ko) 항체 중쇄불변부위 이종이중체에 융합된 사이토카인 및 이를 포함하는 약제학적 조성물
WO2019066586A1 (ko) 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체
WO2020130749A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 및 인슐린을 포함하는 약학 조성물
WO2022085905A1 (ko) SARS-CoV-2 스파이크 단백질에 특이적으로 결합하는 항체 및 이의 용도
WO2016199964A1 (ko) 분리된 비멘틴 유래 펩타이드에 특이적으로 결합하는 항체 또는 상기 펩타이드의 결합 단편
WO2019045477A1 (ko) 비멘틴 유래 펩타이드에 특이적으로 결합하는 물질을 포함하는 피부질환 예방 및 치료용 조성물
WO2023211229A1 (ko) 항―wars1 항체 및 이의 용도
WO2020071865A1 (ko) 글루카곤 및 이를 포함하는 조합물의 치료학적 용도
WO2022139493A1 (ko) TGF-β 신호전달을 억제할 수 있는 신규한 펩타이드 및 이의 용도
WO2022015115A1 (ko) 3중 작용성 지속형 결합체 또는 3중 작용제를 포함하는 조합물의 치료학적 용도
WO2022035200A1 (ko) Il-12 및 항-cd20 항체를 포함하는 융합단백질 및 이의 용도
WO2022119380A1 (ko) 신규한 ace2 변이체 및 그의 이용
WO2021215801A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체를 포함하는 고지혈증 예방 또는 치료용 약학적 조성물 및 예방 또는 치료 방법
WO2020263063A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 간 질환에 대한 치료적 용도
WO2020138868A1 (ko) 타입 1 인터페론 중화 fc-융합 단백질 및 이의 용도
WO2020214013A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 고지혈증에 대한 치료적 용도
WO2023132698A1 (ko) 글루카곤-유사 펩타이드-1 및 인터루킨-1 수용체 길항제를 포함하는 퇴행성 뇌질환 예방 또는 치료용 약학 조성물
WO2016200220A1 (ko) 분리된 비멘틴 유래 펩타이드에 특이적으로 결합하는 항체 또는 상기 펩타이드의 결합 단편
WO2023211228A1 (ko) 항―wars1 항체를 포함하는 염증성 질환의 예방 또는 치료용 약학 조성물
WO2022015039A1 (ko) 글루카곤-유사 펩타이드-1 및 글루카곤-유사 펩타이드-2를 포함하는 융합 단백질 및 이의 용도
WO2023204556A1 (ko) 장질환의 예방 또는 치료를 위한 GLP-2와, 인슐린 분비 펩타이드, TNFα 억제제, 또는 이 둘 모두의 병용 요법
WO2023277620A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체를 포함하는 조합물의 치료학적 용도
WO2022080991A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체의 호흡기 감염 질환의 후유증의 치료 용도
WO2024112133A1 (en) Cassette for expression of fusion protein from which methionine at the n-terminus has been removed, and use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23796871

Country of ref document: EP

Kind code of ref document: A1