WO2022035200A1 - Il-12 및 항-cd20 항체를 포함하는 융합단백질 및 이의 용도 - Google Patents

Il-12 및 항-cd20 항체를 포함하는 융합단백질 및 이의 용도 Download PDF

Info

Publication number
WO2022035200A1
WO2022035200A1 PCT/KR2021/010611 KR2021010611W WO2022035200A1 WO 2022035200 A1 WO2022035200 A1 WO 2022035200A1 KR 2021010611 W KR2021010611 W KR 2021010611W WO 2022035200 A1 WO2022035200 A1 WO 2022035200A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
variable region
chain variable
heavy chain
fusion protein
Prior art date
Application number
PCT/KR2021/010611
Other languages
English (en)
French (fr)
Inventor
이다혜
유수민
김동건
장지훈
이병철
Original Assignee
주식회사 카나프테라퓨틱스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 카나프테라퓨틱스 filed Critical 주식회사 카나프테라퓨틱스
Priority to CN202180069741.3A priority Critical patent/CN116390937A/zh
Priority to EP21856206.4A priority patent/EP4198050A4/en
Priority to US18/040,632 priority patent/US20230295327A1/en
Publication of WO2022035200A1 publication Critical patent/WO2022035200A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/54—Interleukins [IL]
    • C07K14/5434—IL-12
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/54—Interleukins [IL]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507—Comprising a combination of two or more separate antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/522—CH1 domain
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
    • C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
    • C12N9/6424—Serine endopeptidases (3.4.21)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/21—Serine endopeptidases (3.4.21)
    • C12Y304/21026—Prolyl oligopeptidase (3.4.21.26), i.e. proline-specific endopeptidase

Definitions

  • the present invention relates to IL-12 or a variant thereof; And it relates to a novel fusion protein comprising an anti-CD20 antibody and an anticancer pharmaceutical composition comprising the same.
  • Interleukin-12 is a representative inflammatory cytokine and plays an essential role in effectively inducing a cellular immune response.
  • IL-12 is a heterodimeric protein comprising 40 kDa (p40) and 35 kDa (p35) subunits linked by disulfide bonds, and is produced by activated macrophages, monocytes, dendritic cells and activated B lymphocytes.
  • IL-12 can enhance T-helper 1 cell immunity, increase cytotoxicity of cellular T-lymphocytes, and inhibit angiogenesis.
  • IL-12 activates IFN- ⁇ production in T cells and NK cells.
  • IL-12 local expression of IL-12 renders tumor cells sensitive to T-cell mediated cytotoxicity, resulting in tumor growth inhibition and the establishment of humoral immunity.
  • a disadvantage in the clinical application of IL-12 is that upon administration, cytokine-related toxicity may occur systemically.
  • CD20 is a hydrophobic diaphragm protein located on immature B (pre B) lymphocytes and mature B lymphocytes with a molecular weight of approximately 35 kDa, and is expressed over 90% in B cell non-Hodgkin's lymphoma (NHL).
  • pre B immature B
  • NHL B cell non-Hodgkin's lymphoma
  • Rituximab an antibody to the human CD20 antigen, has been used for the treatment of patients with B cell non-Hodgkin's lymphoma, and is the antibody referred to as "C2B8" in US Pat. No. 5,776,456.
  • C2B8 an antibody to the human CD20 antigen
  • the present inventors completed the present invention by confirming that, as a result of research to develop a novel fusion protein having anticancer effect, the fusion protein including IL-12 and anti-CD20 antibody increases anticancer activity while reducing systemic toxicity. did
  • a first monomer comprising IL-12 or a variant thereof; And it provides a fusion protein comprising a second monomer comprising an antigen-binding site that specifically binds to CD20.
  • Another aspect of the present invention provides a pharmaceutical composition for preventing or treating cancer comprising the fusion protein as an active ingredient.
  • Another aspect of the present invention provides a polynucleotide encoding the first monomer.
  • Another aspect of the present invention provides a polynucleotide encoding the second monomer.
  • Another aspect of the present invention provides a vector comprising the polynucleotide.
  • Another aspect of the present invention provides a transformed cell into which the vector is introduced.
  • Another aspect of the present invention comprises the steps of: i) culturing the transformed cell; and ii) recovering the fusion protein comprising the first monomer and the second monomer.
  • Another aspect of the present invention is a first monomer comprising IL-12 or a variant thereof; And it provides a method for treating or preventing cancer, comprising administering to a subject a fusion protein comprising a second monomer comprising an antigen-binding site that specifically binds to CD20.
  • Another aspect of the present invention is a first monomer comprising IL-12 or a variant thereof for treating cancer; and a second monomer comprising an antigen-binding site that specifically binds to CD20.
  • Another aspect of the present invention is a first monomer comprising IL-12 or a variant thereof for preparing a medicament for treating cancer; and a second monomer comprising an antigen-binding site that specifically binds to CD20.
  • a fusion protein comprising an antigen-binding site that specifically binds to IL-12 and CD20 may exhibit an anticancer effect by IL-12.
  • the anti-CD20 antibody is implemented in one antibody, it reduces systemic toxicity by accumulating IL-12 specifically in the tumor and exhibits a tumor-specific anticancer effect. That is, it is possible to efficiently treat cancer by specifically localizing IL-12 to the tumor site by targeting CD20, which is specifically expressed in the tumor.
  • 3 is an SDS-PAGE result for T2.14, T2.15, T2.16, T2.17 and Rituximab according to an embodiment.
  • T2.08m is an SDS-PAGE result for T2.08m, T2.09m, T2.10m, T2.11m, T2.12m, and T2.13m according to an embodiment.
  • 6 is an SDS-PAGE result for T2.15m, T2.16m, T2.17m and 18B12 according to an embodiment.
  • FIG. 7 is a graph showing the binding affinity of T2.01 and T2.02 to recombinant human CD20 (recombinant human CD20, rhCD20) through surface plasmon resonance analysis.
  • FIG. 9 is a graph showing the binding affinity of 18B12, T2.01m and T2.02m to A20 cells through flow cytometry.
  • 10 is a graph showing the binding capacity of Rituximab, T2.01 and T2.02 to IL-12 receptor beta 1 through enzyme-linked immunoprecipitation assay.
  • FIG. 11 is a diagram showing the antibody-dependent toxicity of Rituximab, T2.01, T2.02 and T2.12 through ADCC reporter analysis.
  • FIG. 13 is a graph showing the IL-12 activity of T2.01, T2.02 and T2.17 through the signaling ability of human T cells.
  • 15 is a graph showing the IFN- ⁇ secretion ability through enzyme-linked immunoprecipitation assay after reacting Rituximab, T2.01 and T2.02 with mixed lymphocytes.
  • 16 is a graph showing the change in the tumor size of each mouse after treatment by concentration of T2.01m, T2.02m and chemotherapy in an allografted mouse model with A20 cells as a spider plot; am.
  • 17 is a graph showing changes in tumor size after treatment with T2.01m, T2.02m, and chemotherapy in a mouse model in which A20 cells are allografted.
  • 18 is a graph showing a mouse model in which A20 cells are allografted after treatment with T2.01m, T2.02m and chemotherapy, and then measuring the weight of the mouse to check side effects.
  • 19 is a graph showing tumor tissue harvested from mice on the 9th day after treatment with T2.01m, T2.02m, and chemotherapy in an allografted mouse model with A20 cells, and measuring the weight thereof.
  • Figure 20 is an A20 cell allograft mouse model treated with T2.01m, T2.02m, and chemotherapy. Immune cells were isolated from the harvested tumor tissue on day 9, and the distribution of immune cells in the tumor was analyzed by flow cytometry. It is a graph shown through
  • FIG. 21 shows that a tumor recurrence model was constructed by allografting A20 cells and 4T1 cells to a mouse in which complete remission occurred by treatment with T2.02m for a mouse model in which A20 cells were allografted. It is a graph showing the change in the size of the A20 tumor thereafter.
  • FIG. 22 shows a tumor recurrence model was constructed by allografting A20 cells and 4T1 cells to a mouse in which complete remission occurred by treatment with T2.02m for a mouse model in which A20 cells were allografted. Thereafter, it is a graph showing the change in the size of the 4T1 tumor.
  • FIG. 23 shows a tumor recurrence model was constructed by allografting A20 cells and 4T1 cells to a mouse in which complete remission occurred by treatment with T2.02m for a mouse model in which A20 cells were allografted. Afterwards, it is a graph showing the weight of the mouse to check the side effects.
  • 24 is a graph showing changes in tumor size after treatment with T2.02m or 18B12 in a mouse model in which A20 cells are allografted.
  • 25 is a graph showing changes in tumor size after treatment with T2.02m or T2.13m in a mouse model in which A20 cells are allografted.
  • 26 is a graph showing changes in tumor size after co-treatment with T2.02m or 18B12 and T2.13m in a mouse model in which A20 cells are allografted.
  • 27 is a graph showing changes in tumor size after treatment with T2.01m, T2.02m or T2.03m in an allografted mouse model of A20 cells.
  • FIG. 28 is a graph showing the A20 cell allografted mouse model after treatment with T2.01m, T2.02m or T2.03m, and then measuring the weight of the mouse to check side effects.
  • 29 is a graph showing the binding affinity of T2.04, T2.05, T2.06 and T2.07 to recombinant human CD20 through surface plasmon resonance analysis.
  • FIG. 30 is a graph showing the binding affinity of T2.08, T2.09, T2.10 and T2.11 to recombinant human CD20 through surface plasmon resonance analysis.
  • 31 is an anti-CD20/IL-12 fusion protein (first from left; in the figure, the left is a monomer of anti-CD20, and the right is a monomer containing IL-12), an anti-CD20/IL having dual variable domains.
  • scFv single chain variable region fragment
  • FcFv single chain variable region fragment
  • scFv CD20-specific Fab/CD20-specific single chain variable region fragment
  • IL-12 fusion protein left
  • CD20-specific Fab and a fusion protein dimer including IL-12 middle
  • scFv single chain variable region fragment
  • scFv fusion protein dimer containing IL-12
  • Fusion protein comprising IL-12 and CD20 antibodies
  • a fusion protein comprising an antigen binding site that specifically binds to IL-12 or a variant thereof and CD20.
  • the fusion protein may include an immunoglobulin Fc region.
  • the IL-12 or a variant thereof may be a variant having a lowered heparin binding ability.
  • a first monomer comprising IL-12 or a variant thereof; And it provides a fusion protein comprising a second monomer comprising an antigen-binding site that specifically binds to CD20.
  • a dimer of a fusion protein comprising an antigen binding site specifically binding to IL-12 or a variant thereof and CD20.
  • IL-12 is a heterodimeric cytokine composed of the p35 and p40 subunits encoded by two separate genes, IL-12A and IL-12B, respectively.
  • IL-12 is produced by antigen-presenting cells such as macrophages and binds to receptors on the cell surface of activated T cells and NK cells.
  • the IL-12 promotes the proliferation of T cells and NK cells, and enhances the cytotoxic effect of T cells, NK cells and macrophages.
  • IL-12 induces the production of IFN- ⁇ , TNF- ⁇ and GM-CSF, and acts to induce activation of Th1 cells.
  • IL-12 binds to the IL-12 receptor, a heterodimeric receptor formed by IL-12R ⁇ 1 and IL-12R ⁇ 2.
  • the term "variant" of IL-12 includes an amino acid sequence having a function similar to or identical to that of a wild-type IL-12 protein. Specifically, the amino acid sequence of the p35 and p40 subunits constituting IL-12 may be substituted, inserted, or deleted as compared to the wild type.
  • the IL-12 or variant thereof may include IL-12A (p35) or a variant thereof and IL-12B (p40) or a variant thereof.
  • the IL-12 or a variant thereof is IL-12A or a variant thereof; and a structure in which IL-12B or a variant thereof is bound with a peptide linker.
  • the IL-12 or a variant thereof may be a fusion protein comprising the following structural formula (I) or structural formula (II).
  • N' is the N-terminus of the fusion protein
  • C' is the C-terminus of the fusion protein
  • Y is IL-12A or a variant thereof
  • Z is IL-12B or a variant thereof
  • the linker (1) is a peptide linker
  • o may be O or 1.
  • One embodiment of the IL-12 or variant thereof may be a structure in which IL-12B or a variant thereof, a peptide linker and IL-12A or a variant thereof are sequentially coupled from the N-terminus.
  • one embodiment of the IL-12 or variant thereof may be a structure in which IL-12A or a variant thereof, a peptide linker and IL-12B or a variant thereof are sequentially coupled from the N-terminus.
  • IL-12A is a 35 kDa subunit of IL-12 (p35), which binds to the 40 kDa subunit (p40) of IL-12 through a disulfide bond to generate an active cytokine. .
  • the amino acid sequence of IL-12A is GenBank accession NO. It may be one described in AAK84425 (see GenBank accession No. AAA39292 for the amino acid sequence of mouse p35).
  • the IL-12A (p35) gene as a sequence encoding the IL-12A subunit is GenBank accession No. Among the sequences described in AF404773, it may be a nucleotide sequence corresponding to a coding sequence (CDS) (see GenBank accession No. M86672 for a mouse sequence).
  • the term “variant” of IL-12A includes an amino acid sequence having a function similar to or identical to that of wild-type IL-12A protein. Specifically, it means that the amino acid sequence of IL-12A has a substitution, insertion or deletion compared to the wild type.
  • the IL-12A variant may be a fragment of IL-12A, and may have an amino acid sequence in which amino acids 1 to 22 of SEQ ID NO: 138 are deleted. More specifically, the variant of IL-12A may have the amino acid sequence of SEQ ID NO: 125.
  • IL-12A used in an embodiment of the present invention may be human IL-12A and the amino acid sequence of SEQ ID NO: 125.
  • mouse IL-12A may have the amino acid sequence of SEQ ID NO: 132.
  • IL-12B refers to a 40 kDa subunit (p40) of IL-12, which binds to the 35 kDa subunit (p35) of IL-12 through a disulfide bond to form IL-12 and , and also binds to the subunit p19 of IL-23 to form IL-23.
  • IL-12B is also called natural killer cell stimulating factor 2 (natural killer cell stimulating factor 2).
  • IL-12B The amino acid sequence of "IL-12B” is GenBank accession No. It may be one described in AAD56386 (see GenBank accession No. AAA39296 for the amino acid sequence of mouse p40).
  • the IL-12B (p40) gene as a sequence encoding the IL-12B subunit is GenBank accession No. It may be a nucleotide sequence corresponding to a coding sequence (CDS) among the sequences described in AF180563 (see GenBank accession No. M86671 for the mouse sequence).
  • IL-12B used in an embodiment of the present invention may be human IL-12B, and IL-12B may specifically be the amino acid sequence of SEQ ID NO: 124.
  • mouse IL-12B may have the amino acid sequence of SEQ ID NO: 131.
  • the term “variant” of IL-12B includes an amino acid sequence having a function similar to or identical to that of wild-type IL-12B protein. Specifically, it refers to having a substitution, insertion or deletion from the wild-type amino acid sequence of IL-12B.
  • the IL-12B variant may be one in which amino acids 1 to 22 of SEQ ID NO: 137 are deleted. More specifically, the IL-12B variant may be one in which 1 to 8 amino acids are substituted in the sequence of SEQ ID NO: 124. In addition, the IL-12B variant may be one in which amino acids 1 to 22 of SEQ ID NO: 139 are deleted. More specifically, the IL-12B variant may be one in which at most 1 to 8 amino acids are substituted in the sequence of SEQ ID NO: 131.
  • the mutant of IL-12B(p40) may be one in which an amino acid involved in heparin binding of IL-12 is substituted.
  • the variant of IL-12B (p40) may be a form in which lysine (K) binding to heparin in IL-12B is substituted with another amino acid.
  • lysines 258, 260, 263 and 264 of SEQ ID NO: 124 may be substituted with other amino acids.
  • the variant of IL-12B (p40) may include an amino acid sequence in which one or more substitutions selected from the group consisting of K258A, K260A, K263A and K264A have occurred in the amino acid sequence of SEQ ID NO: 124.
  • the variant of IL-12B includes an amino acid sequence in which K258A and K263A are substituted in the amino acid sequence of SEQ ID NO: 124, or K260A and / or K264A in the amino acid sequence of SEQ ID NO: 124 Further containing mutations may be doing
  • the IL-12B (p40) variant may be a form in which arginine (R) or lysine (K) binding to heparin in IL-12B is substituted with another amino acid.
  • arginine at 254 and/or lysine at 255, 256 and 260 of SEQ ID NO: 131 may be substituted with other amino acids.
  • the IL-12B (p40) variant may include an amino acid sequence in which one or more substitutions have occurred selected from the group consisting of R254A, K255A, K256A and K260A in the amino acid sequence of SEQ ID NO: 131.
  • the variant of IL-12B includes an amino acid sequence in which R254A and K260A are substituted in the amino acid sequence of SEQ ID NO: 131, or K255A and / or K256A in the amino acid sequence of SEQ ID NO: 131 It further includes a mutation may be doing
  • the variant of IL-12B may include the amino acid sequence of SEQ ID NO: 127, SEQ ID NO: 129, SEQ ID NO: 134 or SEQ ID NO: 136.
  • the human IL-12B mutant may be composed of the following [Structural Formula A].
  • X 1 is the amino acid sequence of SEQ ID NO: 141
  • X 2 is the amino acid sequence of SEQ ID NO: 142,
  • L is an amino acid sequence consisting of VA 1 -A 2 -QA 3 -K * -A 4 -A 5 -A 6 -A 7 -K * -A 8 .
  • a 1 is R or Q
  • a 2 is V
  • a or I is V
  • a 3 is G or R *
  • a 4 is S
  • N or K * is S
  • N or K * is S
  • N or K * is S
  • N or E is S
  • N or E is S
  • N or E is S
  • N or E is S
  • N or K * is S
  • N or E is S
  • N or K * is S
  • a 5 is K *
  • a 6 is R or K
  • a 7 is E
  • M or T is K * or E.
  • the one or more amino acid residues marked with " * " are not limited thereto, but may be substituted with a non-polar amino acid residue selected from the group consisting of A, G, I, L, M, F, P and V.
  • the mutant of IL-12B(p40) may include substitution of amino acids involved in heparin binding to reduce the cytokine-associated toxicity of IL-12 while maintaining the killing effect on cancer cells. .
  • CD20 is a hydrophobic transmembrane protein having a molecular weight of about 35 kDa expressed on the surface of pre-B and mature B lymphocytes lymphocytes. CD20 is highly expressed in 90% of B cell non-Hodgkin's lymphoma (NHL) but not found in hematopoietic stem cells, pro-B cells, normal plasma cells or other normal tissues.
  • NHL B cell non-Hodgkin's lymphoma
  • CD20 may be used interchangeably with 'CD20 antigen' and includes any variant, isoform and species homologue of human CD20 that is expressed either naturally by cells or on cells transfected with the CD20 gene.
  • Antibodies of the invention may bind to CD20 and mediate the death of cells expressing CD20 (eg, tumor cells). Death of cells expressing CD20 may occur by one or more of antibody-dependent cell cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC) mechanisms.
  • ADCC antibody-dependent cell cytotoxicity
  • CDC complement dependent cytotoxicity
  • the term “specifically binds” refers to binding that is measurably different from a non-specific interaction. Specific binding can be determined by competing with a control molecule similar to a target that does not have binding activity.
  • the term “antigen binding site (Epitope)” refers to a determinant that interacts with a specific antigen binding site in the variable region of an antibody.
  • the antigen binding site is a group of molecules, such as amino acids or sugar side chains, which usually have specific structural features as well as specific charge characteristics.
  • the antigen-binding site that specifically binds to CD20 may collectively refer to a molecule capable of antigen-antibody binding specifically to CD20.
  • the antibody or fragment thereof may be used in any form as long as it contains an antigen-binding domain capable of specifically binding to CD20.
  • the antigen-binding site may include other amino acids that are not directly involved in binding, or amino acids whose effects are blocked by amino acid residues of the antigen-binding site.
  • the antigen-binding site may be an antibody or fragment thereof that specifically binds to CD20.
  • antibody refers to a molecule containing an antigen binding site, and an immunologically active fragment of an immunoglobulin molecule containing an antigen binding site.
  • the immunoglobulin molecule may be an immunoglobulin molecule of IgG, IgE, IgM, IgD, IgA, IgY or a subclass thereof.
  • Antibodies include synthetic antibodies, monoclonal antibodies, single domain antibodies, single chain antibodies, recombinantly produced antibodies, multispecific antibodies (including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies ( intrabody), scFv (including e.g. monospecific and bispecific, etc.), Fab fragment, F(ab') fragment, disulfide-linked Fv(sdFv), anti-idiotypic (anti-Id) antibodies, and antigen-binding fragments of such antibodies.
  • antibody fragment may be a portion of an antibody, such as F(ab′) 2 , F(ab) 2 , Fab′, Fab, Fv, scFv. Regardless of structure, antibody fragments bind the same antigen recognized by the intact antibody.
  • the antigen binding site specifically binding to CD20 is a heavy chain variable region comprising HCDR1 of SEQ ID NO: 107, HCDR2 of SEQ ID NO: 108 and HCDR3 of SEQ ID NO: 109 and LCDR1 of SEQ ID NO: 110, SEQ ID NO: It may include a light chain variable region comprising LCDR2 of 111, LCDR3 of SEQ ID NO: 112.
  • the antigen binding site specifically binding to CD20 may have a heavy chain variable region of SEQ ID NO: 113 and a light chain variable region of SEQ ID NO: 114.
  • a heavy chain variable region comprising HCDR1 of SEQ ID NO: 115, HCDR2 of SEQ ID NO: 116 and HCDR3 of SEQ ID NO: 117 and LCDR1 of SEQ ID NO: 118, LCDR2 of SEQ ID NO: 119, LCDR3 of SEQ ID NO: 120 It may include a light chain variable region.
  • the antigen binding site specifically binding to CD20 may have a heavy chain variable region of SEQ ID NO: 121 and a light chain variable region of SEQ ID NO: 122.
  • the antigen binding site specifically binding to CD20 may be an scFv.
  • the scFv may include the heavy chain and light chain CDRs described above.
  • the scFv that specifically binds to CD20 it may have the amino acid sequence of SEQ ID NO: 88 or SEQ ID NO: 89.
  • the antigen binding site that specifically binds to CD20 may include a known anti-CD20 antibody or fragment thereof.
  • the anti-CD20 antibody or fragment thereof may refer to an antibody known to those skilled in the art without limitation.
  • the anti-CD20 antibody or fragment thereof is Ocrelizumab (RG-1594), Obinutuzumab (RG-7159), Ofatumumab (GSK-1841157), 2B8 (Biogen), Tositumomab (Bexxar), Ublituximab (EMAB-603), Epcortitamab (GEN) 7D8 of -3013), Divozilimab (BCD-132), Odronextabmab (REGN-1979), Veltuzumab, MB-CART2019.1, Ocaratuzumab (LY-2469298), 3H7 of ADI-001, Pamotamab (THG-338), DNL- 1 may include one or more variable regions selected from the group consisting of hA20 and mAb-1.5.3.
  • the antibody is disclosed in International Patent Publication No. WO 2004-056312 A2, International Patent Publication WO 2005-044859 A2, U.S. Patent No. 8,529,902 B2, U.S. Patent No. 8,563,269 B2, U.S. Patent No.
  • the anti-CD20 antibody may include a variable region of Ocrelizumab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 143, HCDR2 of SEQ ID NO: 144, HCDR3 of SEQ ID NO: 145 and LCDR1 of SEQ ID NO: 146, LCDR2 of SEQ ID NO: 147, LCDR3 of SEQ ID NO: 148 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 240 and a light chain variable region of SEQ ID NO: 241.
  • the anti-CD20 antibody may include a variable region of Afutuzumab or Obinutuzumab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 149, HCDR2 of SEQ ID NO: 150, HCDR3 of SEQ ID NO: 151 and LCDR1 of SEQ ID NO: 152, LCDR2 of SEQ ID NO: 153, LCDR3 of SEQ ID NO: 154 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 242 and a light chain variable region of SEQ ID NO: 243.
  • the anti-CD20 antibody may include a variable region of Ofatumumab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 155, HCDR2 of SEQ ID NO: 156, HCDR3 of SEQ ID NO: 157 and LCDR1 of SEQ ID NO: 158, LCDR2 of SEQ ID NO: 159, LCDR3 of SEQ ID NO: 160 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 244 and a light chain variable region of SEQ ID NO: 245.
  • the anti-CD20 antibody may include a variable region of 2B8.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 161, HCDR2 of SEQ ID NO: 162, HCDR3 of SEQ ID NO: 163 and LCDR1 of SEQ ID NO: 164, LCDR2 of SEQ ID NO: 165, LCDR3 of SEQ ID NO: 166 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 246 and a light chain variable region of SEQ ID NO: 247.
  • the anti-CD20 antibody may include a variable region of Tositumomab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 167, HCDR2 of SEQ ID NO: 168, HCDR3 of SEQ ID NO: 169 and LCDR1 of SEQ ID NO: 170, LCDR2 of SEQ ID NO: 171, LCDR3 of SEQ ID NO: 172 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 248 and a light chain variable region of SEQ ID NO: 249.
  • the anti-CD20 antibody may include a variable region of Ublituximab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 173, HCDR2 of SEQ ID NO: 174, HCDR3 of SEQ ID NO: 175 and LCDR1 of SEQ ID NO: 176, LCDR2 of SEQ ID NO: 177, LCDR3 of SEQ ID NO: 178 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 250 and a light chain variable region of SEQ ID NO: 251.
  • the anti-CD20 antibody may include a variable region of Epcortitamab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 179, HCDR2 of SEQ ID NO: 180, HCDR3 of SEQ ID NO: 181 and LCDR1 of SEQ ID NO: 182, LCDR2 of SEQ ID NO: 183, LCDR3 of SEQ ID NO: 184 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 252 and a light chain variable region of SEQ ID NO: 253.
  • the anti-CD20 antibody may include a variable region of Divozilimab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 185, HCDR2 of SEQ ID NO: 186, and HCDR3 of SEQ ID NO: 187 and LCDR1 of SEQ ID NO: 188, LCDR2 of SEQ ID NO: 189, LCDR3 of SEQ ID NO: 190 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 254 and a light chain variable region of SEQ ID NO: 255.
  • the anti-CD20 antibody may include a variable region of Odronextabmab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 191, HCDR2 of SEQ ID NO: 192, HCDR3 of SEQ ID NO: 193 and LCDR1 of SEQ ID NO: 194, LCDR2 of SEQ ID NO: 195, LCDR3 of SEQ ID NO: 196 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 256 and a light chain variable region of SEQ ID NO: 257.
  • the anti-CD20 antibody may include a variable region of Veltuzumab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 197, HCDR2 of SEQ ID NO: 198, HCDR3 of SEQ ID NO: 199 or SEQ ID NO: 200 and LCDR1 of SEQ ID NO: 201, LCDR2 of SEQ ID NO: 202, SEQ ID NO: 203 It may include a light chain variable region including LCDR3.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 258 and a light chain variable region of SEQ ID NO: 259.
  • the anti-CD20 antibody may include a variable region of MB-CART2019.1. Specifically, the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 204, HCDR2 of SEQ ID NO: 205, HCDR3 of SEQ ID NO: 206 and LCDR1 of SEQ ID NO: 207, LCDR2 of SEQ ID NO: 208, LCDR3 of SEQ ID NO: 209 It may include a light chain variable region. In addition, the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 260 and a light chain variable region of SEQ ID NO: 261.
  • the anti-CD20 antibody may include a variable region of Ocaratuzumab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 210, HCDR2 of SEQ ID NO: 211, and HCDR3 of SEQ ID NO: 212 and LCDR1 of SEQ ID NO: 213, LCDR2 of SEQ ID NO: 214, LCDR3 of SEQ ID NO: 215 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 262 and a light chain variable region of SEQ ID NO: 263.
  • the anti-CD20 antibody may include the variable region of ADI-001.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 216, HCDR2 of SEQ ID NO: 217, HCDR3 of SEQ ID NO: 218 and LCDR1 of SEQ ID NO: 219, LCDR2 of SEQ ID NO: 220, LCDR3 of SEQ ID NO: 221 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 264 and a light chain variable region of SEQ ID NO: 265.
  • the anti-CD20 antibody may include a variable region of Pamotamab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 222, HCDR2 of SEQ ID NO: 223, HCDR3 of SEQ ID NO: 224 and LCDR1 of SEQ ID NO: 225, LCDR2 of SEQ ID NO: 226, LCDR3 of SEQ ID NO: 227 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 266 and a light chain variable region of SEQ ID NO: 267.
  • the anti-CD20 antibody may include a variable region of DNL-1.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 228, HCDR2 of SEQ ID NO: 229, HCDR3 of SEQ ID NO: 230 and LCDR1 of SEQ ID NO: 231, LCDR2 of SEQ ID NO: 232, LCDR3 of SEQ ID NO: 233 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 268 and a light chain variable region of SEQ ID NO: 269.
  • the anti-CD20 antibody may include a variable region of mAb-1.5.3.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 234, HCDR2 of SEQ ID NO: 235, and HCDR3 of SEQ ID NO: 236 and LCDR1 of SEQ ID NO: 237, LCDR2 of SEQ ID NO: 238, LCDR3 of SEQ ID NO: 239 It may include a light chain variable region.
  • the anti-CD20 antibody may include a heavy chain variable region of SEQ ID NO: 270 and a light chain variable region of SEQ ID NO: 271.
  • any antibody may be used as long as the anti-CD20 antibody can specifically bind to CD20 present on cancer cells and cause the death of cancer cells.
  • the first monomer includes IL-12 or a variant thereof.
  • the first monomer may additionally include an antigen-binding site that specifically binds to CD20.
  • the first monomer is IL-12 or a variant thereof; and Fc region fragments or variants thereof.
  • the first monomer may include an antigen-binding site that specifically binds to IL-12 or a variant thereof, an Fc region fragment or a variant thereof, and CD20.
  • the first monomer may have the following Structural Formula (III) or Structural Formula (IV).
  • N' is the N-terminus of the fusion protein
  • C' is the C-terminus of the fusion protein
  • X is the structural formula (I) or (II),
  • T is an antigen binding site that specifically binds to CD20
  • the linker (2) and the linker (3) are peptide linkers, and p, q and r may each independently be O or 1.
  • the first monomer when r is 0, may be in the form of a fusion protein in which IL-12 or a variant thereof and an Fc region fragment or variant thereof are linked by a peptide linker.
  • the first monomer is SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26 No., SEQ ID NO: 34, SEQ ID NO: 35, or may include the amino acid sequence of SEQ ID NO: 36.
  • the first monomer when r is 1 in Structural Formula (III), the first monomer may be a form in which a monomer of an anti-CD20 antibody is bound to IL-12 or a variant thereof.
  • the first monomer is SEQ ID NO: 272, SEQ ID NO: 273, SEQ ID NO: 276, SEQ ID NO: 277, SEQ ID NO: 278, SEQ ID NO: 279, SEQ ID NO: 282 or SEQ ID NO: 283 It may include an amino acid sequence of
  • the first monomer may include the amino acid sequence of SEQ ID NO: 274, SEQ ID NO: 275, SEQ ID NO: 280, or SEQ ID NO: 281.
  • the structural formula (III) may include the following structural formulas (III') and (III'').
  • T' is a heavy chain region of an antibody that specifically binds to CD20, comprising a variable region and a CH1 region, or is a light chain region of an antibody;
  • T'' is a light chain region of an antibody that specifically binds to CD20, or a heavy chain region of an antibody comprising a variable region and a CH1 region;
  • T' and T'' combine to form a variable region of an antibody, wherein the variable region specifically binds to CD20;
  • the linkers (2) to (3) are peptide linkers, wherein p and q are each independently 0 or 1, and N', X and C' are as defined above.
  • the structural formula (IV) may include the following structural formulas (IV') and (IV'').
  • T' is a heavy chain region of an antibody that specifically binds to CD20, comprising a variable region and a CH1 region, or is a light chain region of an antibody;
  • T'' is a light chain region of an antibody that specifically binds to CD20, or a heavy chain region of an antibody comprising a variable region and a CH1 region;
  • T' and T'' combine to form a variable region of an antibody, wherein the variable region specifically binds to CD20;
  • the linkers (2) to (3) are peptide linkers, wherein p and q are each independently 0 or 1, and N', X and C' are as defined above.
  • the first monomer is SEQ ID NO: 10 and SEQ ID NO: 2; SEQ ID NO: 11 and SEQ ID NO: 2; SEQ ID NO: 31 and SEQ ID NO: 23; or SEQ ID NO: 32 and SEQ ID NO: 23; SEQ ID NO: 274 and SEQ ID NO: 2; SEQ ID NO: 275 and SEQ ID NO: 2; SEQ ID NO: 280 and SEQ ID NO: 23; Or it may include the amino acid sequence of SEQ ID NO: 281 and SEQ ID NO: 23.
  • the second monomer may further include an antigen-binding site that specifically binds to CD20.
  • the second monomer comprises a first CD20 binding site; and a second CD20 binding site.
  • the antigen binding site specifically binding to CD20 may be Fab, scFv, Fv, or a fragment thereof.
  • the first CD20 binding site may be Fab
  • the second CD20 binding site may be Fv or scFv.
  • the second CD20 binding site may bind to the N-terminus or the C-terminus of the second monomer. Specifically, the second CD20 binding site may be additionally bound to the C terminus of the heavy chain, the C terminus of the light chain, and the N terminus of the variable region.
  • the second monomer may have the following structural formula (V).
  • N' is the N-terminus of the fusion protein
  • C' is the C-terminus of the fusion protein
  • R and Q are antigen binding sites that specifically bind to CD20
  • W is an scFv that specifically binds to CD20; or IL-12 of structural formula (I) or (II) or a variant thereof,
  • linker (4), linker (5) and linker (6) are each a peptide linker, and s, t, u, v and a may each independently be O or 1.
  • the structural formula (V) is SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 12, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: One or more amino acid sequences selected from the group consisting of 23, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 33, SEQ ID NO: 42, SEQ ID NO: 274, SEQ ID NO: 275, SEQ ID NO: 280 and SEQ ID NO: 281 may include
  • the structural formula (V) may include the following structural formulas (V') and (V'').
  • R' is a heavy chain region of an antibody that specifically binds to CD20, comprising a variable region and a CH1 region, or is a light chain region of an antibody;
  • R'' is a light chain region of an antibody that specifically binds to CD20, or a heavy chain region of an antibody comprising a variable region and a CH1 region;
  • R' and R'' combine to form a variable region of an antibody, wherein the variable region specifically binds to CD20;
  • Q' is a heavy chain region of an antibody that specifically binds to CD20, comprising a variable region and a CH1 region, or is a light chain region of an antibody;
  • Q'' is a light chain region of an antibody that specifically binds to CD20, or a heavy chain region of an antibody comprising a variable region and a CH1 region;
  • variable region of an antibody, wherein the variable region specifically binds to CD20
  • W is an scFv that specifically binds to CD20; or IL-12 of structural formula (I) or (II) or a variant thereof,
  • linker (4), linker (5), linker (6) and linker (7) are each a peptide linker, and s, t, u, x, a, and b may each independently be O or 1.
  • the structural formula (V ') is SEQ ID NO: 1, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 12, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 33, SEQ ID NO: number 42, SEQ ID NO: 274, SEQ ID NO: 275, SEQ ID NO: 280 or SEQ ID NO: 281.
  • the structural formula (V'') may be SEQ ID NO: 2, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 23, SEQ ID NO: 28 or SEQ ID NO: 30.
  • the second monomer comprises a heavy chain consisting of the amino acid sequence of SEQ ID NO: 113 and a light chain consisting of the amino acid sequence of SEQ ID NO: 114; Alternatively, it may include a heavy chain consisting of the amino acid sequence of SEQ ID NO: 121 and a light chain consisting of the amino acid sequence of SEQ ID NO: 122.
  • W when W is scFv, W may have the amino acid sequence of SEQ ID NO: 88 or SEQ ID NO: 89.
  • peptide linker refers to a peptide used for linking or distances between a domain and a domain in a fusion protein.
  • the linker may comprise a hinge region of an immunoglobulin.
  • the peptide linkers (1) to (7) refer to peptide linkers composed of amino acids.
  • the peptide linker (2) or peptide linker (5) may consist of 5 to 80 consecutive amino acids, 7 to 70 consecutive amino acids, or 10 to 60 consecutive amino acids, or 12 to 50 amino acids. there is.
  • the peptide linker may include (G4S)n (in this case, n is an integer of 1 to 10). In this case, in (G4S)n, n may be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, respectively.
  • the peptide linker (2) or peptide linker (5) may consist of 5 to 80 consecutive amino acids, 7 to 70 consecutive amino acids, or 10 to 60 consecutive amino acids, or 12 to 50 amino acids. In one embodiment, the peptide linker (2) may consist of 30 amino acids. In addition, the peptide linker (2) may include at least one cysteine. Specifically, it may contain one, two or three cysteines. In addition, the peptide linker (2) may be derived from the hinge of an immunoglobulin, and may further include (G4S)n (where n is an integer of 1 to 10).
  • the peptide linker (2) or the peptide linker (5) is SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101 and SEQ ID NO: 102 It may include a hinge region consisting of any one amino acid sequence.
  • the peptide linker (3), the peptide linker (4), the peptide linker (6) and the peptide linker (7) are 1 to 30 consecutive amino acids, 5 to 20 consecutive amino acids, or 10 to 15 consecutive amino acids can be made with
  • the peptide linker may include (G4S)n (in this case, n is an integer of 1 to 10). In this case, in (G4S)n, n may be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, respectively.
  • the peptide linker (1) may be a peptide linker consisting of the amino acid sequence of SEQ ID NO: 91, SEQ ID NO: 92 or SEQ ID NO: 93.
  • the peptide linker (2), the peptide linker (3) or the peptide linker (5) may include SEQ ID NO: 91 or SEQ ID NO: 92.
  • the peptide linker (2) or the peptide linker (5) may be a peptide linker comprising the amino acid sequence of SEQ ID NO: 100 or SEQ ID NO: 102.
  • the aforementioned immunoglobulin fragment may be an Fc region of an immunoglobulin.
  • the Fc region of the immunoglobulin may be a wild-type Fc domain as well as an Fc domain variant.
  • the Fc region may be an Fc region of IgG, IgA, IgE, IgD or IgM, and specifically, it may be derived from IgG1 or IgG2a.
  • Fc domain variant is different from the glycosylation pattern of the wild-type Fc domain, increased sugar chains compared to the wild-type Fc domain, decreased sugar chains compared to the wild-type Fc domain, or deglycosylated (deglycosylated) ) may be in the form It also includes an aglycosylated Fc domain.
  • the Fc domain or variant may have a number of sialic acid, fucosylation, and glycosylation adjusted through culture conditions or host genetic manipulation.
  • the sugar chain of the Fc domain of an immunoglobulin can be modified by a conventional method such as a chemical method, an enzymatic method, and a genetic engineering method using microorganisms.
  • the Fc domain variant may be a mixed form of immunoglobulin IgG, IgA, IgE, IgD or IgM Fc region.
  • the Fc domain variant may be a form in which some amino acids of the Fc domain are substituted with other amino acids.
  • amino acid introduced by the above substitution and/or addition is lysine (K), alanine (A), arginine (R), asparagine (N), aspartic acid (D), cysteine (C), glutamine (Q). ), glutamic acid (E), glycine (G), histidine (H), isoleucine (I), leucine (L), methionine (M), phenylalanine (F), proline (P), serine (S), threonine (T) ), tryptophan (W), tyrosine (Y), and may be any one selected from the group consisting of valine (V).
  • V valine
  • the Fc region may include a knob structure or a hole structure.
  • the term "knob-into-hole” refers to an antibody that specifically binds to different regions, such as a bispecific antibody, a multispecific antibody, or a heterodimeric antibody. It is a design strategy for manufacturing. Generally, this technique involves placing a knob at the interface of a first polypeptide (eg, a first CH3 domain of a first heavy chain of an antibody) and at an interface of a second polypeptide (eg, a second CH3 domain of a heavy chain of an antibody). introducing a corresponding hole, so that the knob can be positioned within the hole to promote heterodimer formation and hinder homodimer formation.
  • a first polypeptide eg, a first CH3 domain of a first heavy chain of an antibody
  • a second polypeptide eg, a second CH3 domain of a heavy chain of an antibody
  • a 'knob' is constructed by replacing small amino acid side chains from the interface of a first polypeptide (eg, the first CH3 domain of a first antibody heavy chain) with larger side chains (eg, arginine, phenylalanine, tyrosine or tryptophan).
  • Complementary 'holes' of the same or similar size in the knob replace large amino acid side chains with smaller side chains (eg alanine, serine, valine, or threonine).
  • Said knobs and holes can be created by altering the nucleic acid encoding the polypeptide, eg, by site-specific mutagenesis, or by peptide synthesis.
  • the knob structure of the IgG1 may be SEQ ID NO: 19 or 103, and the hole structure may be SEQ ID NO: 20 or 104.
  • the knob structure or hole structure may be a form in which amino acids at positions 146, 148, and 187 of the amino acid sequence of SEQ ID NO: 284 are substituted with other amino acids.
  • the knob structure or the hole structure may be a form in which the amino acid sequence of SEQ ID NO: 284 is substituted with T146W, T146S, L148A and Y187A.
  • the knob structure may be substituted with T146W, and the hole structure may be substituted with T146S, L148A, and Y187V.
  • the knob structure of IgG2a may be SEQ ID NO: 40 or 105, and the hole structure may be SEQ ID NO: 41 or 106.
  • the knob structure or hole structure may be a form in which amino acids at positions 152, 154, and 193 of the amino acid sequence of SEQ ID NO: 285 are substituted with other amino acids.
  • the knob structure or the hole structure may be a form in which the amino acid sequence of SEQ ID NO: 285 is substituted with T152W or T152S, M154A and Y193V.
  • the knob structure may be substituted with T152W, and the hole structure may be substituted with T152S, M154A, and Y193V.
  • the Fc domain variant may include a DANG mutation or a NG mutation.
  • DANG mutation refers to the D265A/N297G mutation to eliminate effector function in human IgG1 or mouse IgG2a.
  • the effector functions mediated by the Fc region in an IgG molecule include Clq binding, complement dependent cytotoxicity, Fc receptor binding, antibody dependent cell mediated cytotoxicity (ADCC), phagocytosis, cell surface receptors (eg B cell receptor, BCR). control of the lowering of Such effector functions generally require the binding of the Fc region with a binding domain (eg, an antibody variable domain).
  • a binding domain eg, an antibody variable domain
  • the effector function can be changed, and the effector function is changed in the Fc region, for example, by modifying Clq binding and/or FcR binding, thereby changing CDC activity and/or ADCC activity.
  • the 'DANG mutation' means that the effector function mediated by the Fc region is removed from the IgG molecule so that an unwanted effector action does not occur during antibody production.
  • the DANG mutation may be a form in which the amino acid in human IgG1 of SEQ ID NO: 104 is substituted with D45A/N77G. Also, the amino acid in mouse IgG2a of SEQ ID NO: 106 may be substituted with D51A/N83G.
  • the fusion protein may be an antibody.
  • the antibody may be a heterodimeric antibody including a knob-into-hole structure.
  • the fusion protein has structural formula (III) and structural formula (V); Or it may be one comprising Structural Formulas (IV) and Structural Formulas (V).
  • one embodiment of the fusion protein includes the first monomer of (i) or (ii); and a second monomer of (iii), (iv), (v) or (vi):
  • the fusion protein comprises a first monomer comprising (i); and a second monomer including (iii) above (first from the left in FIG. 31 ).
  • the fusion protein is SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, It may include one or more amino acid sequences selected from the group consisting of SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 33, SEQ ID NO: 34 and SEQ ID NO: 35.
  • the fusion protein is SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3; SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 4; SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 5; SEQ ID NO: 2, SEQ ID NO: 12 and SEQ ID NO: 13; SEQ ID NO: 2, SEQ ID NO: 12 and SEQ ID NO: 14; SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24; SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 25; SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 26; SEQ ID NO:23, SEQ ID NO:33 and SEQ ID NO:34; Or SEQ ID NO: 23, SEQ ID NO: 33 and SEQ ID NO: 35 may be included.
  • the fusion protein comprises a first monomer comprising (i); and a second monomer including (iv) above (second from the left in FIG. 31 ).
  • the fusion protein is to include one or more amino acid sequences selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 24, SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID NO: 28 can Specifically, the fusion protein is SEQ ID NO: 3, SEQ ID NO: 6 and SEQ ID NO: 7; SEQ ID NO: 5, SEQ ID NO: 6 and SEQ ID NO: 7; SEQ ID NO: 24, SEQ ID NO: 27 and SEQ ID NO: 28; Or SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID NO: 28 may be included.
  • the fusion protein comprises a first monomer comprising (i); and a second monomer including (v) (third from the left in FIG. 31 ).
  • the fusion protein is to include one or more amino acid sequences selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 8, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 26 and SEQ ID NO: 29 can Specifically, the fusion protein is SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 8; SEQ ID NO:2, SEQ ID NO:5 and SEQ ID NO:8; SEQ ID NO:23, SEQ ID NO:24 and SEQ ID NO:29; Or SEQ ID NO: 23, SEQ ID NO: 26 and SEQ ID NO: 29 may be included.
  • the fusion protein comprises a first monomer comprising (i); and a second monomer including (vi) (fourth from the left in FIG. 31 ).
  • the fusion protein is to include one or more amino acid sequences selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 9, SEQ ID NO: 22, SEQ ID NO: 24, SEQ ID NO: 26 and SEQ ID NO: 30 can Specifically, the fusion protein is SEQ ID NO: 1, SEQ ID NO: 3 and SEQ ID NO: 9; SEQ ID NO: 1, SEQ ID NO: 5 and SEQ ID NO: 9; SEQ ID NO: 22, SEQ ID NO: 24 and SEQ ID NO: 30; Or SEQ ID NO: 22, SEQ ID NO: 26 and SEQ ID NO: 30 may be included.
  • the fusion protein comprises a first monomer comprising (ii); and a second monomer comprising (iii) above (fifth from the left in FIG. 31 ).
  • the fusion protein is to include one or more amino acid sequences selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 31 and SEQ ID NO: 32 can Specifically, the fusion protein is SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 10; SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 11; SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 31; Or SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 32 may be included.
  • the fusion protein dimer comprising an antigen-binding site specifically binding to IL-12 or a variant thereof and CD20 comprises the monomer of the structural formula (III) and the monomer of the structural formula (V). It may be a fusion protein dimer that is (left side of FIG. 32).
  • r is 1, and in the structural formula (V), s, a, and t are 0.
  • the structural formula (V) may include (V') and (V'').
  • s, a, t, and b are 0.
  • the Fc region of the dimer has a knob-into-hole structure, through which different fusion proteins can be bound.
  • the fusion protein comprises at least one amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 272, SEQ ID NO: 273, SEQ ID NO: 278 and SEQ ID NO: 279 it could be Specifically, the fusion protein is SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 272; SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 273; SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 278; Or SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 279 may be included.
  • the fusion protein dimer comprising the antigen-binding site specifically binding to IL-12 or a variant thereof and CD20 may be a fusion protein dimer comprising the structure of Structural Formula (V) (middle of FIG. 32).
  • the fusion protein dimer may include (V') and (V'').
  • s and t are 0, and a is 1.
  • s, t, and b are 0, and a is 1.
  • the fusion protein dimer may be a fusion protein dimer including the structure of Structural Formula (IV). In this case, in the structural formula (IV), r is 1.
  • the fusion protein may include one or more amino acid sequences selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 23, SEQ ID NO: 274, SEQ ID NO: 275, SEQ ID NO: 280 and SEQ ID NO: 281.
  • the fusion protein is SEQ ID NO: 2 and SEQ ID NO: 274; SEQ ID NO: 2 and SEQ ID NO: 275; It may include SEQ ID NO: 23 and SEQ ID NO: 280 or SEQ ID NO: 23 and SEQ ID NO: 281.
  • the fusion protein dimer comprising an antigen-binding site specifically binding to IL-12 or a variant thereof and CD20 may be a fusion protein dimer comprising the structure of Structural Formula (III) (FIG. 32) to the right).
  • r is 1.
  • the fusion protein may include SEQ ID NO: 276, SEQ ID NO: 277, SEQ ID NO: 282, or SEQ ID NO: 283.
  • the multispecific fusion protein herein may be in a chemically modified form.
  • the fusion protein is chemically modified by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization with known protecting/blocking groups, proteolytic cleavage and/or binding to a cellular ligand or other protein. can be Many of these chemical modifications can be performed by known techniques.
  • Another aspect of the present invention provides a polynucleotide encoding the first monomer or a polynucleotide encoding the second monomer.
  • the polypeptide of the first monomer is SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 24, SEQ ID NO: SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 272, SEQ ID NO: 273, SEQ ID NO: 274, SEQ ID NO: 275, SEQ ID NO: 276, SEQ ID NO: 277 , SEQ ID NO: 278, SEQ ID NO: 279, SEQ ID NO: 280, SEQ ID NO: 281, SEQ ID NO: 282, or SEQ ID NO: 283 at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86% , at least about 87%, at least about 88%, at least about 8
  • the polynucleotide encoding the first monomer is SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78 and at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 100% identity.
  • the polypeptide of the second monomer is SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 12, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: About 70% with SEQ ID NO: 23, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 33, SEQ ID NO: 42, SEQ ID NO: 274, SEQ ID NO: 275, SEQ ID NO: 280 or SEQ ID NO: 281, at least about 75 %, at least about 80%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93 %, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or
  • the polynucleotide encoding the second monomer is SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 54, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 75, SEQ ID NO: 84 and at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 100% identity.
  • the polynucleotide may additionally include a nucleic acid encoding a signal sequence or a leader sequence.
  • signal sequence refers to a signal peptide that directs secretion of a target protein.
  • the signal peptide is cleaved after translation in the host cell.
  • the signal sequence is an amino acid sequence that initiates the movement of the protein through the ER (Endoplasmic reticulum) membrane.
  • the signal sequence is well-known in the art, and typically includes 16 to 30 amino acid residues, but may include more or fewer amino acid residues than that.
  • a typical signal peptide consists of three regions: a basic N-terminal region, a central hydrophobic region, and a more polar C-terminal region.
  • the central hydrophobic region contains 4 to 12 hydrophobic residues that anchor the signal sequence through the membrane lipid bilayer during migration of the immature polypeptide.
  • the signal sequence is cleaved in the lumen of the ER by a cellular enzyme commonly known as signal peptidase.
  • the signal sequence may be a secretion signal sequence of tPa (Tissue Plasminogen Activation), HSV gDs (Signal sequence of Herpes simplex virus glycoprotein D), or growth hormone.
  • tPa tissue Plasminogen Activation
  • HSV gDs Synchromethyl sequence of HSV gDs
  • growth hormone a secretion signal sequence used in higher eukaryotic cells, including mammals, may be used.
  • the signal sequence may be used by using a wild-type signal sequence or by substituting a codon having a high expression frequency in a host cell.
  • Another aspect of the present invention provides a vector comprising the polynucleotide.
  • the vector can be introduced into a host cell, recombination and insertion into the host cell genome. or said vector is understood as a nucleic acid means comprising a polynucleotide sequence capable of spontaneous replication as an episome.
  • Such vectors include linear nucleic acids, plasmids, phagemids, cosmids, RNA vectors, viral vectors and analogs thereof.
  • examples of viral vectors include, but are not limited to, retroviruses, adenoviruses, and adeno-associated viruses.
  • the vector may be plasmid DNA, phage DNA, etc., commercially developed plasmids (pUC18, pBAD, pIDTSAMRT-AMP, etc.), Escherichia coli-derived plasmids (pYG601BR322, pBR325, pUC118, pUC119, etc.), Bacillus subtilis plasmids (pUB110, pTP5, etc.), yeast-derived plasmids (YEp13, YEp24, YCp50, etc.), phage DNA (Charon4A, Charon21A, EMBL3, EMBL4, ⁇ gt10, ⁇ gt11, ⁇ ZAP, etc.), animal virus vectors (retroviruses) ), adenovirus, vaccinia virus, etc.), insect virus vectors (baculovirus, etc.). Since the vector exhibits different protein expression levels and modifications depending on the host cell, it is preferable to select and use a host plasm
  • the term "gene expression” or “expression” of a protein of interest is understood to mean transcription of a DNA sequence, translation of an mRNA transcript, and secretion of a fusion protein product or fragment thereof.
  • a useful expression vector may be RcCMV (Invitrogen, Carlsbad) or a variant thereof.
  • the expression vector includes a human CMV (Cytomegalovirus) promoter to promote continuous transcription of the target gene in mammalian cells, and a bovine growth hormone polyadenylation signal sequence to increase the stable-state level of RNA after transcription. can do.
  • Another aspect of the present invention provides a transformed cell into which the vector is introduced.
  • the host cell of the transformed cell may include, but is not limited to, a cell of prokaryotic, eukaryotic, mammalian, plant, insect, fungal or cellular origin.
  • a cell of prokaryotic, eukaryotic, mammalian, plant, insect, fungal or cellular origin As an example of the prokaryotic cell, E. coli may be used.
  • yeast may be used as an example of eukaryotic cells.
  • CHO cells, F2N cells, CSO cells, BHK cells, Bowes melanoma cells, HeLa cells, 911 cells, AT1080 cells, A549 cells, HEK293 cells or HEK293T cells may be used as the mammalian cells, The present invention is not limited thereto, and any cell that can be used as a mammalian host cell known to those skilled in the art can be used.
  • the CaCl 2 precipitation method when introducing the expression vector into a host cell, the CaCl 2 precipitation method, the CaCl 2 precipitation method using a reducing material called DMSO (dimethyl sulfoxide), which increases the efficiency by using the Hanahan method, the electroporation method, the calcium phosphate precipitation method , protoplast fusion method, agitation method using silicon carbide fiber, agrobacterium mediated transformation method, transformation method using PEG, dextran sulfate, lipofectamine and drying/inhibition mediated transformation method, etc.
  • DMSO dimethyl sulfoxide
  • the glycosylation-related gene possessed by the host cell is manipulated through a method known to those skilled in the art, and the sugar chain pattern of the fusion protein (e.g., sialic acid, fucosylation, glycation) can be adjusted.
  • the sugar chain pattern of the fusion protein e.g., sialic acid, fucosylation, glycation
  • Another aspect of the present invention comprises the steps of: i) culturing the transformed cell; and ii) recovering the fusion protein comprising the first monomer and the second monomer.
  • the method of culturing the transformed cells can be performed using a method well known in the art. Specifically, the culture may be continuously cultured in a batch process or in a fed batch or repeated fed batch process (Fed batch or Repeated fed batch process).
  • Another aspect of the present invention provides a pharmaceutical composition for preventing or treating cancer comprising the fusion protein as an active ingredient.
  • the cancer is stomach cancer, liver cancer, lung cancer, colorectal cancer, breast cancer, prostate cancer, skin cancer, bone cancer, multiple myeloma, glioma, ovarian cancer, pancreatic cancer, cervical cancer, thyroid cancer, laryngeal cancer, acute myeloid leukemia, chronic myelogenous leukemia, acute It may be any one selected from the group consisting of lymphoblastic leukemia, chronic lymphoblastic leukemia, brain tumor, neuroblastoma, retinoblastoma, head and neck cancer, salivary gland cancer and lymphoma.
  • the preferred dosage of the pharmaceutical composition varies depending on the condition and weight of the patient, the degree of disease, the drug form, the route and duration of administration, but may be appropriately selected by those skilled in the art.
  • the active ingredient may be used in an arbitrary amount (effective amount) according to the use, formulation, purpose of formulation, etc., as long as it exhibits tumor therapeutic activity or, in particular, can exhibit a therapeutic effect on cancer. may be included, but a typical effective amount will be determined within the range of 0.001% to 20.0% by weight based on the total weight of the composition.
  • the term "effective amount” refers to an amount of an active ingredient capable of inducing an improvement or treatment effect of a disease, particularly an improvement or treatment effect of cancer. Such an effective amount can be determined empirically within the ordinary ability of one of ordinary skill in the art.
  • treatment may be used to include both therapeutic treatment and prophylactic treatment. In this case, prevention may be used in the sense of alleviating or reducing a pathological condition or disease of an individual.
  • treatment includes any form of administration or application for treating a disease in a mammal, including a human. The term also includes inhibiting or slowing the progression of a disease; restoring or repairing damaged or missing function, thereby partially or completely alleviating the disease; or stimulate inefficient processes; It includes the meaning of alleviating serious diseases.
  • enhanced efficacy e.g., improvement in efficacy
  • improved efficacy can be attributed to improved pharmacokinetic parameters and improved efficacy, which can be determined by comparing parameters such as clearance rate and tumor treatment or improvement in a test animal or human subject.
  • terapéuticaally effective amount refers to an amount of a compound or composition effective to prevent or treat a target disease, which is sufficient to treat the disease with a reasonable benefit/risk ratio applicable to medical treatment, and It means an amount that does not cause side effects.
  • the level of the effective amount may be determined by the patient's health condition, disease type, severity, drug activity, drug sensitivity, administration method, administration time, administration route and excretion rate, treatment period, factors including the combination or concurrently used drugs; It may be determined according to factors well known in the medical field.
  • a therapeutically effective amount refers to an amount of a drug effective to treat cancer.
  • the pharmaceutical composition may further include a pharmaceutically acceptable carrier.
  • the pharmaceutically acceptable carrier may be any non-toxic material suitable for delivery to a patient. Distilled water, alcohol, fats, waxes and inert solids may be included as carriers. Pharmaceutically acceptable adjuvants (buffers, dispersants) may also be included in the pharmaceutical composition.
  • the pharmaceutical composition may be prepared as a parenteral formulation according to the route of administration by a conventional method known in the art, including a pharmaceutically acceptable carrier in addition to the active ingredient.
  • pharmaceutically acceptable means that it does not inhibit the activity of the active ingredient and does not have toxicity beyond what the application (prescription) target can adapt.
  • the pharmaceutical composition When the pharmaceutical composition is prepared for parenteral use, it may be formulated in the form of injections, transdermal administrations, nasal inhalants and suppositories together with suitable carriers according to methods known in the art.
  • a suitable carrier may be sterile water, ethanol, polyol such as glycerol or propylene glycol, or a mixture thereof, preferably Ringer's solution, PBS (phosphate buffered saline) containing triethanolamine, or sterilized for injection. Water, an isotonic solution such as 5% dextrose, etc. may be used.
  • Formulation of pharmaceutical compositions is known in the art, and specifically, reference may be made to the literature [Remington's Pharmaceutical Sciences (19th ed., 1995)] and the like. This document is considered a part of this specification.
  • a preferred dosage of the pharmaceutical composition is in the range of 0.01 ⁇ g/kg to 10 g/kg, or 0.01 mg/kg to 1 g/kg per day, depending on the patient's condition, weight, sex, age, severity of the patient, and the route of administration. can be Administration may be performed once or divided into several times a day. Such dosages should not be construed as limiting the scope of the present invention in any respect.
  • compositions of the present application are mammals and humans, particularly preferably humans.
  • the pharmaceutical composition of the present application may further include any compound or natural extract known to have a tumor therapeutic effect.
  • Another aspect of the present invention is a first monomer comprising IL-12 or a variant thereof for treating cancer; and a second monomer comprising an antigen-binding site that specifically binds to CD20.
  • Another aspect of the present invention is a first monomer comprising IL-12 or a variant thereof for preparing a medicament for treating cancer; and a second monomer comprising an antigen-binding site that specifically binds to CD20.
  • Another aspect of the present invention is a first monomer comprising IL-12 or a variant thereof; And it provides a method for treating or preventing cancer, comprising administering to a subject a fusion protein comprising a second monomer comprising an antigen-binding site that specifically binds to CD20.
  • the subject may be a subject with cancer.
  • the subject may be a mammal, preferably a human.
  • the administration route, dosage, and frequency of administration of the fusion protein or fusion protein dimer may be administered to a subject in various methods and amounts depending on the patient's condition and presence or absence of side effects, and the optimal administration method, dosage and frequency of administration are A person skilled in the art can select within an appropriate range.
  • the fusion protein or fusion protein dimer may be administered in combination with other drugs or physiologically active substances with known therapeutic effects for the disease to be treated, or formulated in the form of a combination preparation with other drugs.
  • [seq1] consists of human anti-CD20 (anti-CD20) heavy chain variable region sequence and human IgG1 Fc in which a knob structure is formed with T366W mutation.
  • [seq2] consists of human anti-CD20 (anti-CD20) light chain sequence.
  • [seq3] consists of human IL-12 p40 (beta) region sequence, linker GGGGSGGGGSGGGGS, human interleukin 12 p35 (alpha) region sequence, linker GGGGSGGGGS and human IgG1 Fc in which a hole structure was formed with T366S, L368A and Y407V mutations.
  • [seq4] is a sequence in which lysine (K) at amino acids 280 and 285 involved in heparin binding in human IL-12 p40 (beta) region is mutated to alanine (A), linker GGGGSGGGGSGGGGS, human IL-12 p35 (alpha) Consists of a region sequence, a linker GGGGSGGGGS and a human IgG1 Fc hole.
  • [seq5] is a sequence in which lysine (K) at amino acids 280, 282, 285, and 286 involved in heparin binding in the human IL-12 p40 (beta) region is mutated to alanine (A), linker GGGGSGGGGSGGGGS, human IL Consists of -12 p35 (alpha) region sequence, linker GGGGSGGGGS and human IgG1 Fc hole.
  • [seq6] consists of human anti-CD20 (anti-CD20) heavy chain variable region sequence, linker GGGGSGGGGSGGGGS, human anti-CD20 (anti-CD20) heavy chain variable region sequence and human IgG1 Fc knob.
  • [seq7] consists of a human anti-CD20 (anti-CD20) light chain variable region sequence, a linker GGGGSGGGGSGGGGS, and a human anti-CD20 (anti-CD20) light chain sequence.
  • [seq8] is human anti-CD20 (anti-CD20) heavy chain variable region sequence and human IgG1 Fc knob, linker GGGGSGGGGSGGGGS, human anti-CD20 (anti-CD20) heavy chain variable region sequence, linker GGGGSGGGGSGGGGSGGGGS and human anti-CD20 (anti-CD20) CD20) light chain variable region sequence.
  • [seq9] is human anti-CD20 (anti-CD20) light chain sequence
  • linker GGGGSGGGGSGGGGS human anti-CD20 (anti-CD20) heavy chain variable region sequence
  • linker GGGGSGGGGSGGGGSGGGGS and human anti-CD20 (anti-CD20) light chain variable region sequence is composed
  • [seq10] is human anti-CD20 (anti-CD20) heavy chain sequence, human IgG1 Fc hole, linker GGGGSGGGGSGGGGS, human IL-12 p40 (beta) region sequence, linker GGGGSGGGGSGGGGS and human IL-12 p35 (alpha) region sequence is composed
  • [seq11] is a human anti-CD20 (anti-CD20) heavy chain sequence, human IgG1 Fc hole, linker GGGGSGGGGSGGGGS, and p40 (beta) region sequence of human IL-12 containing mutations (4) of amino acids involved in heparin binding , linker GGGGSGGGGSGGGGS and human IL-12 p35 (alpha) region sequence.
  • [seq12] consists of the heavy chain sequence of human anti-CD20 antibody and human IgG1 Fc knob DANG.
  • [seq13] consists of human IL-12 p40 (beta) region sequence, linker GGGGSGGGGSGGGGS, human IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS and human IgG1 Fc hole DANG.
  • [seq14] is a human IL-12 p40 (beta) region sequence containing mutations (2) of amino acids involved in heparin binding, a linker GGGGSGGGGSGGGGS, a human IL-12 p35 (alpha) region sequence, a linker GGGGSGGGGS and a human IgG1 Fc It is composed of hole DANG.
  • [seq15] is a human IL-12 p40 (beta) region sequence containing mutations (4) of amino acids involved in heparin binding, a linker GGGGSGGGGSGGGGS, a human IL-12 p35 (alpha) region sequence, and a linker GGGGSGGGGS and human IgG1 Fc is composed of
  • [seq16] consists of a human anti-FAP (anti-FAP) heavy chain variable region sequence and a human IgG1 Fc knob.
  • [seq17] consists of human anti-FAP (anti-FAP) light chain sequence.
  • [seq18] consists of human anti-FAP (anti-FAP) heavy chain variable region sequence and human IgG1 Fc knob DANG.
  • [seq19] consists only of human IgG1 Fc knob DANG.
  • [seq20] consists of only human IgG1 Fc hole DANG.
  • [seq21] is the heavy chain sequence of the human anti-CD20 (anti-CD20) antibody rituximab.
  • [seq272] is human IL-12 p40 (beta) region sequence and linker GGGGSGGGGSGGGGS, human IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS and human IgG1 Fc hole, linker GGGGSGGGGSGGGGS, human anti-CD20 (anti-CD20) heavy chain It consists of a variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS and a human anti-CD20 (anti-CD20) light chain variable region sequence.
  • [seq273] is a human IL-12 p40 (beta) region sequence containing amino acid mutations (4) involved in heparin binding, a linker GGGGSGGGGSGGGGS, a human IL-12 p35 (alpha) region sequence, a linker GGGGSGGGGS, and a human IgG1 Fc hole , a linker GGGGSGGGGSGGGGS, a human anti-CD20 (anti-CD20) heavy chain variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS and a human anti-CD20 (anti-CD20) light chain variable region sequence.
  • [seq274] consists of human anti-CD20 (anti-CD20) heavy chain sequence, human IgG1 Fc, linker GGGGSGGGGSGGGGS, human IL-12 p40 (beta) region sequence, linker GGGGSGGGGSGGGGS and human IL-12 p35 (alpha) region sequence do.
  • [seq275] is human anti-CD20 (anti-CD20) heavy chain sequence, human IgG1 Fc, linker GGGGSGGGGSGGGGS, p40 (beta) region sequence of human IL-12 containing mutations (4) of amino acids involved in heparin binding, Consists of linker GGGGSGGGGSGGGGS and human IL-12 p35 (alpha) region sequence.
  • [seq276] is human IL-12 p40 (beta) region sequence and linker GGGGSGGGGSGGGGS, human IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS and human IgG1 Fc, linker GGGGSGGGGSGGGGS, human anti-CD20 (anti-CD20) heavy chain variable It consists of a region sequence, a linker GGGGSGGGGSGGGGSGGGGS and a human anti-CD20 (anti-CD20) light chain variable region sequence.
  • [seq277] is a human IL-12 p40 (beta) region sequence containing amino acid mutations (4) involved in heparin binding, a linker GGGGSGGGGSGGGGS, a human IL-12 p35 (alpha) region sequence, a linker GGGGSGGGGS and a human IgG1 Fc; It consists of a linker GGGGSGGGGSGGGGS, a human anti-CD20 (anti-CD20) heavy chain variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS and a human anti-CD20 (anti-CD20) light chain variable region sequence.
  • T2.01 (seq1, seq2, seq3) is a dual antibody in which a human anti-CD20 sequence targeting the protein CD20 and a human IL-12 sequence form a knob-into-hole structure.
  • T2.02 (seq1, seq2, seq4) is a human anti-CD20 sequence that targets the protein CD20 and a human IL-12 sequence that contains mutations (2) of amino acids involved in heparin binding with a knob-into-hole structure It is a dual antibody that makes up
  • T2.03 (seq1, seq2, seq5) is a human anti-CD20 sequence targeting the protein CD20 and a human IL-12 sequence containing mutations (4) of amino acids involved in heparin binding, a knob-into-hole structure It is a dual antibody that makes up
  • T2.04 (seq3, seq6, seq7) is a dual variable domain immunoglobulin (dual variable domain Immunoglobulin, DVD-Ig) type of human anti-CD20 sequence and a human IL-12 sequence forming a knob-into-hole structure.
  • T2.05 (seq5, seq6, seq7) is a human anti-CD20 sequence in the form of dual variable domain immunoglobulin (DVD-Ig) and a human containing mutations (4) of amino acids involved in heparin binding It is a dual antibody in which the IL-12 sequence forms a knob-into-hole structure.
  • T2.06 (seq2, seq3, seq8) is a human anti-CD20 sequence in which a single chain fragment variable (scFv) of a human anti-CD20 sequence targeting protein CD20 is linked to the C terminus of the heavy chain and human It is a dual antibody in which the IL-12 sequence forms a knob-into-hole structure.
  • scFv single chain fragment variable
  • T2.07 is a human anti-CD20 sequence in which a single chain fragment variable (scFv) of a human anti-CD20 sequence targeting protein CD20 is linked to the C terminus of the heavy chain and heparin It is a double antibody in which the human IL-12 sequence including mutations (4) of amino acids involved in binding forms a knob-into-hole structure.
  • scFv single chain fragment variable
  • T2.08 (seq1, seq3, seq9) is a human anti-CD20 sequence in which a single chain fragment variable (scFv) of a human anti-CD20 sequence targeting protein CD20 is linked to the C terminus of the light chain and human It is a dual antibody in which the IL-12 sequence forms a knob-into-hole structure.
  • scFv single chain fragment variable
  • T2.09 (seq1, seq5, seq9) is a human anti-CD20 sequence in which a single chain fragment variable (scFv) of a human anti-CD20 sequence targeting protein CD20 is linked to the C terminus of the light chain and heparin It is a double antibody in which the human IL-12 sequence including mutations (4) of amino acids involved in binding forms a knob-into-hole structure.
  • scFv single chain fragment variable
  • T2.10 (seq1, seq2, seq10) is an antibody in which a human anti-CD20 sequence targeting protein CD20 and a human anti-CD20 sequence in which a human IL-12 sequence is linked to the C-terminus of the heavy chain have a knob-into-hole structure am.
  • T2.11 (seq1, seq2, seq11) is a human anti-CD20 sequence that targets protein CD20 and a human IL-12 sequence containing mutations (4) of amino acids involved in heparin binding at the C-terminus of the heavy chain It is an antibody in which the human anti-CD20 sequence forms a knob-into-hole structure.
  • T2.12 (seq2, seq12, seq14) is a human anti-CD20 sequence that targets the protein CD20 and a human IL-12 sequence that contains mutations (2) of amino acids involved in heparin binding with a knob-into-hole structure It is a double antibody with the effector function removed.
  • T2.13 (seq13, seq19) is an antibody in which the effector function of the knob-into-hole structure having only human IL-12 sequence has been removed.
  • T2.14 (seq14, seq19) is an antibody in which the effector function of the knob-into-hole structure has been removed having only the human IL-12 sequence containing mutations (two) of amino acids involved in heparin binding.
  • T2.15 (seq15) is an Fc-fusion-protein having only human IL-12 sequence including mutations (4) of amino acids involved in heparin binding.
  • T2.16 (seq4, seq16, seq17) is a human anti-FAP sequence targeting the protein FAP and a human IL-12 sequence containing mutations (2) of amino acids involved in heparin binding, a knob-into-hole structure It is a dual antibody that makes up
  • T2.17 (seq17, seq18, seq20) is an antibody in which the effector function of the knob-into-hole structure having only a human anti-FAP sequence targeting the protein FAP has been removed.
  • Rituximab (seq2, seq21) is a human anti-CD20 (rituximab) antibody that targets the protein CD20.
  • T2.18 (seq1, seq2, seq272) is a human IL-12 sequence in which a human anti-CD20 sequence and a single chain fragment variable (scFv) of the human anti-CD20 sequence are linked to the C-terminus of the knob-into It is a double antibody that forms a hole structure.
  • T2.19 (seq1, seq2, seq273) is a human anti-CD20 heavy chain sequence and a single chain fragment variable (scFv) of human anti-CD20 sequence linked to the C terminus of amino acids involved in heparin binding. It is a double antibody in which the human IL-12 sequence containing mutations (4) forms a knob-into-hole structure.
  • T2.20 (seq2, seq274) is an Fc-fusion protein dimer containing a human anti-CD20 sequence in which a human IL-12 sequence is linked to the C terminus of a heavy chain.
  • T2.21 (seq2, seq275) is an Fc-fusion protein dimer containing a human anti-CD20 sequence in which a human IL-12 sequence containing mutations (4) of amino acids involved in heparin binding is linked to the C terminus of the heavy chain .
  • T2.22 (seq276) is an Fc-fusion protein dimer including a human IL-12 sequence in which a single chain fragment variable (scFv) of a human anti-CD20 sequence is linked to the C terminus.
  • scFv single chain fragment variable
  • T2.23 (seq277) is human IL-12 containing mutations (4) of amino acids involved in heparin binding with a single chain fragment variable (scFv) of a human anti-CD20 sequence linked to the C terminus. It is an Fc-fusion protein dimer consisting of a sequence.
  • PROTEIN Format Description corresponding sequence T2.01m K&H anti-mu CD20/mu IL-12, mu IgG2a seq22, seq23, seq24 T2.02m K&H anti-mu CD20/mu IL-12 mut1, mu IgG2a seq22, seq23, seq25 T2.03m K&H anti-mu CD20/mu IL-12 mut2, mu IgG2a seq22, seq23, seq26 T2.04m K&H anti-mu CD20/mu IL-12, mu IgG2a (2+1) seq24, seq27, seq28 T2.05m K&H anti-mu CD20/mu IL-12 mut2, mu IgG2a (2+1) seq26, seq27, seq28 T2.06m K&H anti-mu CD20/mu IL-12, mu IgG2a (2+1, HC scFv) seq23, seq24, seq29 T
  • [seq22] is composed of mouse IgG2a Fc in which a knob structure was formed through T321W mutation in the mouse anti-CD20 antibody heavy chain sequence.
  • [seq23] consists of the light chain sequence of the mouse anti-CD20 (anti-CD20) antibody 18B12.
  • [seq24] consists of mouse IL-12 p40 (beta) region sequence, linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS, and mouse IgG2a Fc that formed a hole structure through T321S, M323A, Y362V mutations. do.
  • [seq25] is a sequence in which lysine (K) at amino acids 277 and 282 involved in heparin binding in the mouse IL-12 p40 (beta) region is mutated to alanine (A), linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) Consists of a region sequence, a linker GGGGSGGGGS and a mouse IgG2a Fc hole.
  • [seq26] is amino acid 276 arginine (R) involved in heparin binding in the mouse IL-12 p40 (beta) region to alanine (A), lysine 277, 278, and 282 lysine (K) to alanine (A) ), a linker GGGGSGGGGSGGGGS, a mouse IL-12 p35 (alpha) region sequence, a linker GGGGSGGGGS, and a mouse IgG2a Fc hole.
  • [seq27] consists of mouse anti-CD20 (anti-CD20) heavy chain variable region sequence, linker GGGGSGGGGSGGGGS, mouse anti-CD20 (anti-CD20) heavy chain variable region sequence, and mouse IgG2a Fc knob.
  • [seq28] consists of a mouse anti-CD20 (anti-CD20) light chain variable region sequence, a linker GGGGSGGGGSGGGGS, and a mouse anti-CD20 (anti-CD20) light chain sequence.
  • [seq29] is a mouse anti-CD20 (anti-CD20) heavy chain variable region sequence, a mouse IgG2a Fc knob, a linker GGGGSGGGGSGGGGS, a mouse anti-CD20 (anti-CD20) heavy chain variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS and a mouse anti-CD20 (anti-CD20) CD20) light chain variable region sequence.
  • [seq30] is a mouse anti-CD20 (anti-CD20) light chain sequence, a linker GGGGSGGGGSGGGGS, a mouse anti-CD20 (anti-CD20) heavy chain variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS, and a mouse anti-CD20 (anti-CD20) light chain variable region sequence. is composed
  • [seq31] is mouse anti-CD20 (anti-CD20) heavy chain variable region sequence, mouse IgG2a Fc hole, linker GGGGSGGGGSGGGGS, mouse IL-12 p40 (beta) region sequence, linker GGGGSGGGGSGGGGS and mouse IL-12 p35 (alpha) region consists of sequences.
  • [seq32] is mouse anti-CD20 (anti-CD20) heavy chain variable region sequence, mouse IgG2a Fc hole, linker GGGGSGGGGSGGGGS, and mouse IL-12 p40 (beta) containing mutations (4) of amino acids involved in binding to heparin It consists of a region sequence, a linker GGGGSGGGGSGGGGS and a mouse IL-12 p35 (alpha) region sequence.
  • [seq33] consists of the heavy chain variable region sequence of the mouse anti-CD20 antibody and the mouse IgG2a Fc knob DANG.
  • [seq34] consists of mouse IL-12 p40 (beta) region sequence, linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS and mouse IgG2a Fc hole DANG.
  • [seq35] is a mouse IL-12 p40 (beta) region sequence containing mutations (2) of amino acids involved in heparin binding, a linker GGGGSGGGGSGGGGS, a mouse IL-12 p35 (alpha) region sequence, a linker GGGGSGGGGS, and a mouse IgG2a Fc It is composed of hole DANG.
  • [seq36] is a mouse IL-12 p40 (beta) region sequence containing mutations (4) of amino acids involved in heparin binding, a linker GGGGSGGGGSGGGGS, a mouse IL-12 p35 (alpha) region sequence, and a linker GGGGSGGGGS and a mouse IgG2a Fc is composed of
  • [seq37] consists of a mouse anti-FAP (anti-FAP) heavy chain variable region sequence and a mouse IgG2a Fc knob.
  • [seq38] consists of a mouse anti-FAP (anti-FAP) light chain sequence.
  • [seq39] consists of mouse anti-FAP (anti-FAP) heavy chain variable region sequence and mouse IgG2a Fc knob DANG.
  • [seq40] consists only of mouse IgG2a Fc knob DANG.
  • [seq41] consists only of mouse IgG2a Fc hole DANG.
  • [seq42] is the heavy chain sequence of mouse anti-CD20 (anti-CD20) antibody 18B12.
  • [seq278] is mouse IL-12 p40 (beta) region sequence and linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS and mouse IgG2a Fc hole, linker GGGGSGGGGSGGGGS, mouse anti-CD20 (anti-CD20) heavy chain It consists of a variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS and a mouse anti-CD20 (anti-CD20) light chain variable region sequence.
  • [seq279] is a mouse IL-12 p40 (beta) region sequence containing amino acid mutations (4) involved in heparin binding, a linker GGGGSGGGGSGGGGS, a mouse IL-12 p35 (alpha) region sequence, a linker GGGGSGGGGS, and a mouse IgG2a Fc hole , a linker GGGGSGGGGSGGGGS, a mouse anti-CD20 (anti-CD20) heavy chain variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS, and a mouse anti-CD20 (anti-CD20) light chain variable region sequence.
  • [seq280] consists of mouse anti-CD20 (anti-CD20) heavy chain sequence, mouse IgG2a Fc, linker GGGGSGGGGSGGGGS, mouse IL-12 p40 (beta) region sequence, linker GGGGSGGGGSGGGGS and mouse IL-12 p35 (alpha) region sequence do.
  • [seq281] is the mouse anti-CD20 (anti-CD20) heavy chain sequence, mouse IgG2a Fc, linker GGGGSGGGGSGGGGS, p40 (beta) region sequence of mouse IL-12 containing mutations (4) of amino acids involved in heparin binding, It consists of the linker GGGGSGGGGSGGGGS and the mouse IL-12 p35 (alpha) region sequence.
  • [seq282] is mouse IL-12 p40 (beta) region sequence and linker GGGGSGGGGSGGGGS, mouse IL-12 p35 (alpha) region sequence, linker GGGGSGGGGS and mouse IgG2a Fc, linker GGGGSGGGGSGGGGS, mouse anti-CD20 (anti-CD20) heavy chain variable It consists of a region sequence, a linker GGGGSGGGGSGGGGSGGGGS and a mouse anti-CD20 (anti-CD20) light chain variable region sequence.
  • [seq283] is a mouse IL-12 p40 (beta) region sequence containing amino acid mutations (4) involved in heparin binding, a linker GGGGSGGGGSGGGGS, a mouse IL-12 p35 (alpha) region sequence, a linker GGGGSGGGGS and a mouse IgG2a Fc, It consists of a linker GGGGSGGGGSGGGGS, a mouse anti-CD20 (anti-CD20) heavy chain variable region sequence, a linker GGGGSGGGGSGGGGSGGGGS, and a mouse anti-CD20 (anti-CD20) light chain variable region sequence.
  • T2.01m (seq22, seq23, seq24) is a dual antibody in which a mouse anti-CD20 sequence targeting the protein CD20 and a mouse IL-12 sequence form a knob-into-hole structure.
  • T2.02m (seq22, seq23, seq25) has a knob-into-hole structure with a mouse anti-CD20 sequence targeting the protein CD20 and a mouse IL-12 sequence containing mutations (2) of amino acids involved in heparin binding. It is a dual antibody that makes up
  • T2.03m (seq22, seq23, seq26) has a knob-into-hole structure with a mouse anti-CD20 sequence targeting the protein CD20 and a mouse IL-12 sequence containing mutations (4) of amino acids involved in heparin binding. It is a dual antibody that makes up
  • T2.04m (seq24, seq27, seq28) is a dual variable domain immunoglobulin (DVD-Ig) type of mouse anti-CD20 sequence and a mouse IL-12 sequence forming a knob-into-hole structure.
  • T2.05m (seq26, seq27, seq28) is a mouse anti-CD20 sequence in the form of dual variable domain immunoglobulin (DVD-Ig) and a mouse containing mutations (4) of amino acids involved in heparin binding It is a dual antibody in which the IL-12 sequence forms a knob-into-hole structure.
  • T2.06m (seq23, seq24, seq29) is a mouse anti-CD20 sequence in which a single chain fragment variable (scFv) of a mouse anti-CD20 sequence targeting the protein CD20 is linked to the C terminus of the heavy chain and mouse It is a dual antibody in which the IL-12 sequence forms a knob-into-hole structure.
  • scFv single chain fragment variable
  • T2.07m is a mouse anti-CD20 sequence and heparin in which a single chain fragment variable (scFv) of a mouse anti-CD20 sequence targeting protein CD20 is linked to the C terminus of the heavy chain It is a double antibody in which the mouse IL-12 sequence including mutations (4) of amino acids involved in binding forms a knob-into-hole structure.
  • scFv single chain fragment variable
  • T2.08m (seq22, seq24, seq30) is a mouse anti-CD20 sequence in which a single chain fragment variable (scFv) of the mouse anti-CD20 sequence targeting the protein CD20 is linked to the C terminus of the light chain and mouse It is a dual antibody in which the IL-12 sequence forms a knob-into-hole structure.
  • scFv single chain fragment variable
  • T2.09m is a mouse anti-CD20 sequence in which a single chain fragment variable (scFv) of a mouse anti-CD20 sequence targeting the protein CD20 is linked to the C terminus of the light chain and heparin It is a double antibody in which the mouse IL-12 sequence including mutations (4) of amino acids involved in binding forms a knob-into-hole structure.
  • scFv single chain fragment variable
  • T2.10m (seq22, seq23, seq31) is an antibody in which a mouse anti-CD20 sequence targeting protein CD20 and a mouse anti-CD20 sequence in which a mouse IL-12 sequence is linked to the C-terminus of the heavy chain have a knob-into-hole structure am.
  • T2.11m (seq22, seq23, seq32) is a mouse anti-CD20 sequence targeting the protein CD20 and a mouse IL-12 sequence containing mutations (4) of amino acids involved in heparin binding at the C-terminus of the heavy chain It is an antibody in which the mouse anti-CD20 sequence forms a knob-into-hole structure.
  • T2.12m (seq23, seq33, seq35) has a knob-into-hole structure with a mouse anti-CD20 sequence targeting the protein CD20 and a mouse IL-12 sequence containing mutations (2) of amino acids involved in heparin binding. It is a double antibody with the effector function removed.
  • T2.13m (seq34, seq40) is an antibody in which the effector function of the knob-into-hole structure having only the mouse IL-12 sequence has been removed.
  • T2.14m (seq35, seq40) is an antibody in which the effector function of the knob-into-hole structure has been removed having only the mouse IL-12 sequence containing mutations (two) of amino acids involved in heparin binding.
  • T2.15m is an Fc-fusion protein having only the mouse IL-12 sequence including mutations (4) of amino acids involved in heparin binding.
  • T2.16m (seq25, seq37, seq38) contains a mouse anti-FAP sequence targeting the protein FAP and a mouse IL-12 sequence containing mutations (2) of amino acids involved in heparin binding, a knob-into-hole structure It is a dual antibody that makes up
  • T2.17m (seq38, seq39, seq41) is an antibody in which the effector function of the knob-into-hole structure having only a mouse anti-FAP sequence targeting the protein FAP has been removed.
  • 18B12 (seq23, seq42) is a mouse anti-CD20 (18B12) antibody that targets the protein CD20.
  • T2.18m (seq22, seq23, seq278) is a mouse anti-CD20 sequence and a mouse IL-12 sequence in which a single chain fragment variable (scFv) of the mouse anti-CD20 sequence is linked to the C-terminus of the knob-into It is a double antibody that forms a hole structure.
  • scFv single chain fragment variable
  • T2.19m (seq22, seq23, seq279) is an amino acid involved in heparin binding with a mouse anti-CD20 heavy chain sequence and a single chain fragment variable (scFv) of the mouse anti-CD20 sequence linked to the C terminus. It is a double antibody in which the mouse IL-12 sequence containing mutations (4) forms a knob-into-hole structure.
  • T2.20m (seq23, seq280) is an Fc-fusion protein dimer containing a mouse anti-CD20 sequence in which a mouse IL-12 sequence is linked to the C terminus of the heavy chain.
  • T2.21m (seq23, seq281) is an Fc-fusion protein dimer containing a mouse anti-CD20 sequence in which a mouse IL-12 sequence containing mutations (4) of amino acids involved in heparin binding is linked to the C terminus of the heavy chain .
  • T2.22m (seq282) is an Fc-fusion protein dimer including a mouse IL-12 sequence in which a single chain fragment variable (scFv) of a mouse anti-CD20 sequence is linked to the C terminus.
  • scFv single chain fragment variable
  • T2.23m (seq283) is mouse IL-12 containing mutations (4) of amino acids involved in heparin binding with a single chain fragment variable (scFv) of the mouse anti-CD20 sequence linked to the C terminus. It is an Fc-fusion protein dimer consisting of a sequence.
  • the synthesized DNA fragment was amplified through PCR, and the PCR product was purified by gel. After cutting the pTT5 vector with restriction enzymes EcoRI and BamHI, the gel was purified. Each PCR product and the linear vector were ligated using the In-Fusion kit. The resulting vector was transformed into ECOS101 DH5 ⁇ competent cells and cultured on 2xYT agar plates containing 100 ⁇ g/ml ampicillin. All manipulations were performed according to standard transformation protocols. Positive recombinants were confirmed by colony PCR, and sequence-verify sequencing was performed on the recombinant plasmid. A single colony was selected and seed inoculated into 5 ml 2xYT medium containing 100 ⁇ g/ml ampicillin. Incubated with shaking at 37°C for 8 hours.
  • the seed cells were diluted in 200 ml of selective 2xYT medium at a ratio of 1:1,000. Incubated with shaking at 37°C for 16 hours. Bacterial cells were harvested by centrifugation at 4°C and 4,700 rpm for 10 minutes. The bacterial pellet was resuspended in 12 ml of RES-EF solution. Thereafter, 12 ml of LYS-EF solution was added, and the sealed tube was vigorously inverted to thoroughly mix, followed by incubation at room temperature for 5 minutes. 12 ml of NEU-EF solution was added to the lysate and inverted vigorously to mix thoroughly.
  • a homogeneous suspension of the precipitate was prepared by inverting the lysate tube 3 times to prevent clogging of the filter. Then, the NucleoBond® Xtra column filter and the NucleoBond® Xtra column were washed with 10 ml of filter washing solution FIL-EF. Remove the NucleoBond® Xtra column filter by pulling out or inverting the column. The NucleoBond® Xtra column was washed with 90 ml of wash solution ENDO.
  • the NucleoBond® Xtra column was washed with 45 ml of wash solution WASH-EF. Plasmid DNA was eluted with 15 ml of elution solution ELU. The eluate was collected in a 50 ml centrifuge tube. 10.5 ml of room temperature isopropanol was added to precipitate the eluted plasmid DNA. After vortex, the mixture was left standing for 2 minutes.
  • the 293F seed strain into the complete medium was maintained in an incubator shaker at 130 rpm, 37° C., and 8% CO 2 . It was cultured at a density of 0.3 to 0.4 x 10 6 cell/ml, and the medium was changed every 2 to 3 days. 24 hours before transfection, a new passage number of 293F cells was prepared at 2.6 x 10 6 cell/ml. The prepared cells were cultured in an incubator shaker at 130 rpm, 37° C., and 8% CO 2 . On the day of transfection, cells were adjusted to a density of 5.0 x 10 6 cells/ml using fresh medium. A total volume of 1 L was performed in a 3 L shaker flask.
  • HC and 0.6 mg LC plasmids were diluted with 50 ml OPTI MEM I and filtered through a 0.22 ⁇ m filter. Thereafter, 2 mg PEI was diluted with 50 ml OPTI MEM I to prepare a transfection reagent.
  • Diluted PEI was added to the DNA mixture and mixed immediately. Then, incubated at room temperature for 15 minutes. A DNA-PEI mixture was added to the 293F cells prepared at 2.6 x 10 6 cell/ml. Thereafter, the cells were continuously cultured for 24 hours in an incubator shaker at 130 rpm, 37° C., and 8% CO 2 . 24 hours after transfection, 10% peptone was added to 1/20 of the culture solution to a final concentration of 0.5%. Thereafter, the cells were continuously cultured in an incubator shaker at 130 rpm, 37° C., and 8% CO 2 . Cell density/viability was measured and recorded daily during the 2-5 day period post-transfection. Cells were harvested for purification 7 days after transfection or when cell viability was less than 70%.
  • Proteins were purified through a Mabselect sure column. Specifically, the supernatant was harvested by centrifugation at 2,000 x g, 4°C for 20 minutes. Then, the supernatant was filtered through a Sartopore 2 filter. A 5 ml MabSelect Sure column equilibrated with solution A was loaded with the clarified supernatant. After that, the column was washed with solution A until the A280 absorbance reached the baseline. The column was washed with 10 CV solution B. The column was washed with 10 CV solution A. The bound protein was eluted with 6 CV solution C, and 1/6 volume of solution D was added to neutralize the eluted material. SDS-PAGE and SEC-HPLC analysis were performed.
  • the protein was purified using a HIC column.
  • the protein was then dialyzed against solution E at 4° C. overnight.
  • the supernatant was loaded onto a HIC column equilibrated with solution E.
  • the column was washed with solution E until the A280 absorbance reached a baseline value.
  • the bound protein was eluted by gradient elution (10 CV solution F 0%-40%).
  • the bound protein was eluted with 2 CV 100% solution F. SDS-PAGE analysis was performed.
  • the protein was dialyzed against the final solution at 4°C overnight. Then, SDS-PAGE and SEC-HPLC analysis were performed.
  • Table 9 below shows the change in the production of human anti-CD20/IL-12 dual antibody according to human IL-12 mutation.
  • the parentheses indicate the production scale of the protein, and the unit is L.
  • the number in front of the parentheses is the production per liter obtained by dividing the amount of purified protein by the production scale.
  • PROTEIN Description Amount of protein after passing through Protein A column (mg) (production scale, L) T2.01 anti-hu CD20/hu IL-12, hu IgG1 208 (1) T2.02 anti-hu CD20/hu IL-12 mut1, hu IgG1 234 (1) T2.03 anti-hu CD20/hu IL-12 mut2, hu IgG1 315 (1)
  • Table 10 shows changes in mouse anti-CD20/IL-12 double antibody production according to mouse IL-12 mutation.
  • PROTEIN Description Amount of protein after passing through Protein A column (mg) (production scale, L) T2.01m anti-mu CD20/mu IL-12, mu IgG2a 17.1 (1), 36.9 (3), 21.7 (7.5) T2.02m anti-mu CD20/mu IL-12 mut1, mu IgG2a 18.9 (1), 40.067 (3) T2.03m anti-mu CD20/mu IL-12 mut2, mu IgG2a 32.8 (1), 114.4 (1), 96.7 (8)
  • the amount of protein after passing through the Protein A column was compared by dividing the total protein production by the production scale.
  • the double antibody T2.02m in which amino acids 277 and 282 lysine (K) were mutated to alanine (A) was confirmed to have improved production compared to T2.01m.
  • the double antibody T2.03m in which arginine (R) at amino acid number 276 is mutated to alanine (A) and lysine (K) at amino acids 276, 278, and 282 to alanine (A) is T2.01m and T2.02m It was confirmed that the protein production was improved compared to .
  • it was confirmed that the production of T2.03m using the CHO cell line was improved by about 3 times compared to the production using the HEK293 cell line.
  • Human B-cell lymphoma cell line Raji, human B-cell lymphoma cell line Ramos, human T-line cell line Jurkat, and mouse B-cell lymphoma cell line A20 were supplied from ATCC (American Type Culture Collection, Manassas, VA, USA). was used. Raji, Ramos and Jurkat cells were maintained in RPMI-1640 (GIBCO, Grand Island, NY, USA) containing 10% FBS (GIBCO). A20 cells were maintained in RPMI-1640 (GIBCO) containing 10% FBS (GIBCO), 0.05 mM 2-mercaptoethanol (2-Mercaptoethanol).
  • HEK-Blue IL-12 cell line transformed with the IL-12 receptor gene and the STAT4-inducible SEAP reporter gene into HEK293 cells which are human embryonic kidney fibroblasts, was supplied from Invivogen (San Diego, USA) and used. did
  • HEK-Blue IL-12 cells were maintained in DMEM (GIBCO) containing 10% FBS (GIBCO), 100 ⁇ g/ml Normocin and 1xHEK-Blue selection.
  • PBMC peripheral blood mononuclear cells
  • PBMCs Thawed PBMCs were isolated from human T cells using an Easy sep (Stem cell) kit by a negative selection method. Human T cells were cultured on plates coated with 1 ⁇ g/ml anti-CD3 (OKT3, Invitrogen) and activated for 72 hours. Human T cells were maintained in RPMI-1640 (GIBCO) with 10% FBS (GIBCO).
  • the surface of the CM5 chip was activated with a 1:1 mixture of 50 nM N-hydroxysuccinimide (NHS) and 200 nM EDC (1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide), and 25 ⁇ g/ml of anti-human An IgG (Fc) antibody was immobilized for 400 seconds at a rate of 10 ⁇ l/min. The remaining active ester groups were blocked with 1 M ethanolamine. T2.01 and T2.02 were diluted to 2 ⁇ g/ml and reacted on a CM5 chip immobilized with an anti-human IgG (Fc) antibody.
  • NHS N-hydroxysuccinimide
  • EDC 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide
  • Recombinant human CD20 was diluted to 200 nM in 1 ⁇ HBS-EP+ buffer and diluted by serial dilution. The diluted recombinant human CD20 was reacted at a rate of 30 ⁇ l/min. The association and dissociation times were 180 s and 400 s, respectively. After stabilization for 60 seconds after the dissociation step, a regeneration step was performed for 30 seconds with a 10 mM glycine pH 1.5 solution at a rate of 30 ⁇ l/min.
  • T2.01 and T2.02 can specifically bind to recombinant human CD20.
  • T2.04, T2.05, T2.06, T2.07, T2.08, T2.09, T2.10 and T2.11 were confirmed by surface plasmon resonance.
  • Recombinant human CD20 was diluted to 100 nM or 200 nM in 1xHBS-EP+, 0.05% DDM (detergent dodecylmatoside), and 0.01% CHS (cholesteryl hemisuccinate) buffer solution, followed by serial dilution.
  • the diluted recombinant human CD20 was reacted at a rate of 30 ⁇ l/min.
  • the association and dissociation times were 180 s and 400 s, respectively.
  • a regeneration step was performed for 30 seconds with a 10 mM glycine pH 1.5 solution at a rate of 30 ⁇ l/min.
  • T2.04, T2.05, T2.06, T2.07, T2.08, T2.09, T2.10 and T2.11 bind to recombinant human CD20.
  • CD20 can be specifically targeted.
  • T2.01 and T2.02 bind to the CD20-expressing cell lines, Raji and Ramos.
  • Anti-CD20 monoclonal antibody (Rituximab, Roche) is an FDA (Food and Drug Administration) approved drug known to be capable of CD20 specific binding.
  • Cell lines were prepared by floating in FACS buffer at 1 x 10 5 cells/100 ⁇ l. Rituximab, T2.01 and T2.02 were treated with 1 ⁇ g each. Cells were washed twice using FACS buffer. Cells were stained using anti-human IgG antibody (Biolegend). Negative control samples were stained only with anti-human IgG Fc antibody (Biolegend). Expression rates of stained cells were measured using BD LSR and analyzed in FlowJo software.
  • T2.01 and T2.02 bind to the CD20-expressing cell line by 95% or more.
  • the cell line was prepared by floating in FACS buffer at 1 x 10 5 cells/100 ⁇ l and treated with 1 ⁇ g of 18B12, T2.01m and T2.02m, respectively. Cells were washed twice using FACS buffer. Cells were stained using anti-mouse IgG2a antibody (Biolegend). Negative control samples were stained only with anti-mouse IgG2a antibody (Biolegend). Expression rates of stained cells were measured using BD LSR and analyzed in FlowJo software.
  • T2.01m and T2.02m bind to the CD20-expressing cell line by 85% or more.
  • T2.01 and T2.02 bind to the recombinant human IL-12 receptor.
  • Rituximab, T2.01 and T2.02 were immobilized on a plate, and recombinant human IL-12 receptor protein conjugated with horseradish peroxidase (HRP) was bound. At this time, Rituximab was used as a control.
  • HRP horseradish peroxidase
  • the fusion protein according to the present invention binds to the recombinant human IL-12 receptor as follows.
  • Rituximab, T2.01 and T2.02 were suspended at 100 nM and diluted by serial dilution. Diluted Rituximab, T2.01 and T2.02 were aliquoted into 96-well immune plates and treated for 24 hours.
  • IL-12 receptor beta 1-biotin (IL-12R ⁇ 1-Biotin; Acrobiosystems, Newark, USA) was treated for 2 hours.
  • T2.01 and T2.02 bind to recombinant human IL-12 receptor protein in a concentration dependent manner.
  • Anti-CD20 monoclonal antibody binds to B-cell lymphoma and kills cells through antibody-dependent cytotoxicity. Therefore, the antibody-dependent cytotoxicity of the CD20-targeting monovalent fusion protein to B-cell lymphoma (Raji) was confirmed.
  • ADCC antibody-dependent cellular cytotoxicity
  • Target cells (Target cells, Raji) were suspended in RPMI-1640 containing 4% low level IgG serum at a concentration of 5 x 10 5 cells/ml, and 25 ⁇ l each was dispensed.
  • Effector cells were suspended in RPMI-1640 containing 4% low level IgG serum at a concentration of 3 x 10 6 cells/ml, and 25 ⁇ l each was dispensed.
  • BioGlo TM luciferase assay reagent BioGlo luciferase assay reagent; Promega
  • luminescence values Luminescence, Relative Luminescence Unit (RLU)
  • the sample treated with the anti-CD20 monoclonal antibody, Rituximab showed high antibody-dependent cytotoxicity of 31.1 ⁇ g/ml at a half effective concentration (50% Effective concentration, EC50), but T2.01 Antibody-dependent cytotoxicity was low in the sample treated with EC50 of 5.3 x 10 3 ⁇ g/ml, and EC50 of 6.7 x 10 3 ⁇ g/ml in the sample treated with T2.02.
  • the antibody-dependent cytotoxicity was not seen in the sample treated with control T2.12 without the Fc region being mutated and having no effector function.
  • IL-12 is known to initiate signal transduction by inducing phosphorylation of STAT4 (Signal transducer and activator or transcription 4), a signaling mediator, when it binds to the IL-12 receptor.
  • STAT4 Signal transducer and activator or transcription 4
  • the signaling ability of the fusion protein of Example 1 was evaluated in IL-12 sensing cells.
  • the IL-12 sensing cell HEK-Blue IL-12 cell line was diluted to 2.8 x 10 5 cells/ml and dispensed at 180 ⁇ l/well.
  • Recombinant human IL-12, T2.01m, T2.02m, T2.03m and 18B12 were suspended at 4 nM and diluted by serial dilution.
  • HEK-Blue IL-12 cells were treated with diluted recombinant human IL-12, T2.01m, T2.02m, T2.03m and 18B12. After 24 hours of treatment, the cell supernatant was collected and mixed with QUANTI-Blue Solution (Invivogen) in 96-well plates. The reporter expression level was measured at 620 nm with a spectrophotometer (Thermo Fisher).
  • the signaling ability of human T cells activated with anti-CD3 was confirmed using the AlphaLISA SureFire Ultra p-STAT4 (Tyr693) Assay Kit (PerkinElmer, Massachusetts, USA).
  • Recombinant human IL-12, T2.01, T2.02 and T2.17 were suspended at 100 ng/ml and diluted by serial dilution. The diluted recombinant human IL-12, T2.01, T2.02 and T2.17 were treated with activated human T cells. After 2 hours of treatment, cells were lysed and treated with a reagent (PerkinElmer) that detects phosphorylated STAT4 (p-STAT4).
  • p-STAT4 was detected at a stimulation wavelength of 680 nm and an emission wavelength of 615 nm with a spectrophotometer.
  • cytokine measurement an enzyme-linked immunosorbent assay (ELISA, R&D systems) for cytokine measurement was performed in the supernatant stored at -20 °C in the following steps.
  • ELISA enzyme-linked immunosorbent assay
  • Capture antibody was diluted according to the Certificate of Analysis (CoA) and coated on a 96-well plate for 24 hours.
  • the detection antibody was diluted according to the certificate of analysis, dispensed into the wells, and treated for 2 hours.
  • IFN- ⁇ Interferon-gamma secretion
  • IL-12 Interferon-gamma secretion
  • Rituximab T2.01, T2.02
  • T2.03 enzyme-linked immunoprecipitation assay
  • human T cells activated with anti-CD3 were diluted to 5 x 10 5 cells/ml and distributed at 200 ⁇ l/well in a 96-well plate.
  • Recombinant human IL-12, Rituximab, T2.01, T2.02 and T2.03 were diluted to 10 nM and dispensed at 20 ⁇ l/well.
  • Recombinant human IL-12, Rituximab, T2.01, T2.02 and T2.03 were each treated at 250 pM. After 48 hours of treatment, the cell supernatant was collected and samples were stored at -80°C.
  • fusion protein induces cytokine secretion when an artificial allogeneic immune response is generated by mixing human T cells and allogeneic dendritic cells. IFN- ⁇ concentrations in cell supernatants were assessed by enzyme-linked immunoprecipitation assay.
  • mature human dendritic cells were diluted to 4 x 10 5 cells/ml and dispensed in a 96-well plate at 50 ⁇ l/well.
  • Human T cells from different blood donors activated with anti-CD3 were diluted to 2 x 10 6 cells/ml, dispensed at 100 ⁇ l/well and mixed with the dispensed mature human dendritic cells (Mixed Lymphocyte Reaction, MLR).
  • MLR Mated Lymphocyte Reaction
  • Rituximab, T2.01 and T2.02 were diluted to 1 uM and dispensed at 50 ⁇ l/well. After 5 days of mixed culture, the cell supernatant was collected and the samples were stored at -80°C.
  • Example 4.1 Establishment of allograft mouse model and evaluation of anticancer efficacy
  • T2.01m 100 ⁇ g of T2.01m, 50 ⁇ g of T2.02m, 100 ⁇ g of T2.02m, and 300 ⁇ g of T2.02m were intraperitoneally injected three times at 3-day intervals.
  • CHOP1 100 mg/kg Cyclophosphamide, 6 mg/kg Doxolubicin, 0.1 mg/kg Vincristine, 0.2 mg/kg Dexamethasone
  • CHOP2 50 mg/kg Cyclophosphamide, 3 mg/kg kg Doxolubicin, 0.1 mg/kg Vincristine, 0.2 mg/kg Dexamethasone
  • mice per group were used. Tumor size and weight were measured twice a week. The anticancer activity was evaluated for two months.
  • T2.01m, T2.02m, CHOP1 and CHOP2 were injected intraperitoneally, and side effects were expressed as changes in body weight.
  • the tumor tissue was isolated from 3 animals in each group. The relative tumor tissue weights for each group were compared.
  • mice of each group were harvested from tumor tissues through the treatment method according to IACUC regulations on the 9th day after the first intraperitoneal injection.
  • the harvested tumor tissue was weighed with an electronic scale.
  • Tumor tissue was isolated from immune cells using a tumor dissociation (Tumor dissociation, Miltenyi, Germany) kit.
  • Cells were anti-mouse CD45 antibody (Biolegend), anti-mouse CD3 antibody (BD), anti-mouse CD4 antibody (Biolegend), anti-mouse CD8 antibody (eBioscience), anti-mouse CD19 antibody (Biolegend), anti-mouse CD49/b (Biolegend), Live/Dead (eBioscience) and Counting beads (eBioscience) were used for staining. Expression rates of stained cells were measured using BD LSR and analyzed in FlowJo software.
  • Example 4.2 Evaluation of tumor recurrence inhibition in a tumor recurrence model
  • Tumor re-challenge was performed using mice that showed complete remission.
  • a tumor recurrence model was induced in mice showing complete response (CR) by treatment with T2.02m in A20 cell allograft (syngeneic) mice.
  • A20 cells were suspended in PBS (Phosphate-buffered saline, GIBCO) at a concentration of 5 x 10 5 cells/100 ⁇ l, and 5 x 10 5 cells were subcutaneously injected into the right flank of the mouse.
  • 4T1 cells were suspended in PBS (Phosphate-buffered saline, GIBCO) at a concentration of 5 x 10 5 cells/100 ⁇ l, and 5 x 10 5 cells were subcutaneously injected into the left flank of the mouse.
  • a control group untreated mice of the same age as the experimental group were used.
  • mice of the same age as the experimental group were used. Five mice per group were used. Tumor size and weight were measured twice a week.
  • Example 4.3 Comparison of anti-tumor ability evaluation of CD20-specific fusion protein and CD20 antibody in an allograft mouse model
  • the antitumor effect of the CD20-specific fusion protein according to an embodiment and the non-specific fusion protein was compared.
  • in vivo in vivo was carried out. 6-week-old female BALB/c mice were used as supplied by Shanghai Lingchang Biotechnology Co,.Ltd (Shanghai, China). A20 cells were suspended in PBS (Phosphate-buffered saline, GIBCO) at a concentration of 5 x 10 5 cells/100 ⁇ l, and 5 ⁇ 10 5 cells were subcutaneously injected into the right flank of the mouse.
  • PBS Phosphate-buffered saline
  • the tumor size reached 100 mm 3 , they were randomly divided into groups.
  • the prepared 25 ⁇ g of T2.02m and 25 ⁇ g of 18B12 were intraperitoneally injected three times at 3-day intervals. Eight mice per group were used. The size and weight of the tumor were measured twice a week, and the anticancer ability was evaluated for one month.
  • Example 4.4 Evaluation of target-specific anticancer efficacy of CD20-specific fusion protein in an allograft mouse model
  • the antitumor effects of the target-specific fusion protein and the non-specific non-fusion protein according to an embodiment were compared.
  • the prepared 0.2 ⁇ g T2.02m and 0.2 ⁇ g T2.13m were intravenously injected twice at weekly intervals. Seven mice per group were used. Tumor size and weight were measured twice a week.
  • Example 4.5 Comparison of anticancer efficacy evaluation of CD20-specific fusion protein and CD20 antibody and cytokine co-administration in an allograft mouse model
  • in vivo in vivo was carried out. 6-week-old female BALB/c mice were used as supplied by Shanghai Lingchang Biotechnology Co,.Ltd (Shanghai, China). A20 cells were suspended in PBS (Phosphate-buffered saline, GIBCO) at a concentration of 5 x 10 5 cells/100 ⁇ l, and 5 x 10 5 cells were subcutaneously injected into the right flank of the mouse.
  • PBS Phosphate-buffered saline
  • tumor size reached 100 mm 3 , they were randomly divided into groups. group treated with prepared 0.2 ⁇ g of T2.02m; and 0.2 ⁇ g of T2.13m and 0.2 ⁇ g of 18B12. Each administration was administered intravenously three times at weekly intervals and evaluated for two weeks. Seven mice per group were used. Tumor size and weight were measured twice a week.
  • TGI tumor growth inhibition percent
  • Example 4.6 Comparison of evaluation of anticancer efficacy of attenuated cytokines of CD20-specific fusion protein in an allograft mouse model
  • the prepared 2 ⁇ g T2.01m, 2 ⁇ g T2.02m and 2 ⁇ g T2.03m were intravenously injected 3 times at weekly intervals to evaluate the anticancer ability in the mouse model for one month. Seven mice per group were used. Tumor size and weight were measured twice a week.
  • TGI tumor growth inhibition percent
  • T2.01m, T2.02m and T2.03m were administered intravenously, and side effects were expressed as changes in body weight.
  • T2.01m, T2.02m and T2.03m had no side effects after intravenous injection.

Abstract

본 발명은 IL-12 또는 이의 변이체 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 이중 특이적 항체를 제공한다. 상기 이중 특이적 항체는 IL-12에 의한 항암 효과를 나타낸다. 특히, 상기 항-CD20 항체를 하나의 항체에서 구현할 경우, 종양 내에서 특이적으로 발현이 높은 CD20을 대상으로 하여 IL-12를 종양 부위에 특이적으로 위치화(localization) 시킴으로써 효율적으로 암을 치료할 수 있다. 따라서, 상기 이중 특이적 항체는 항암 치료용 약학 조성물로서 활용할 수 있어 산업적 활용 가능성이 높다.

Description

IL-12 및 항-CD20 항체를 포함하는 융합단백질 및 이의 용도
본 발명은 IL-12 또는 이의 변이체; 및 항-CD20 항체를 포함하는 신규한 융합단백질 및 이를 포함하는 항암용 약학 조성물에 관한 것이다.
인터루킨-12(Interleukin-12)는 대표적인 염증성 사이토카인으로서 세포성 면역 반응을 효과적으로 유도하는데 필수적인 역할을 한다. IL-12는 이황화결합으로 연결된 40 kDa(p40) 및 35 kDa(p35) 서브유닛을 포함하는 헤테로다이머(heterodimeric) 단백질이며, 활성화된 대식세포, 단핵구, 수지상세포 및 활성 B 림프구에 의해 생성된다. IL-12는 T-helper 1 세포 면역을 증진시킬 수 있고, 세포성 T-림프구의 세포독성을 증가시키며, 혈관신생을 억제시킬 수 있다. 일반적으로 IL-12는 T 세포 및 NK 세포에서 IFN-γ 생산을 활성화시킨다.
IL-12의 국소적 발현은 종양세포가 T-세포 매개 세포독성에 민감하게 반응하도록 하며, 결과적으로 종양 성장 억제 및 체액성 면역의 구축을 가져온다. 그러나, IL-12의 임상 적용에 있어서의 단점은 투여 시 사이토카인 연관 독성이 전신에 나타날 수 있다는 점이다. 이러한 임상 결과는 암의 치료를 위한 단일치료제로서의 IL-12의 한계를 보여준다.
또한, CD20은 분자량이 대략 35 kDa인 미성숙 B(pre B) 림프구 및 성숙한 B 림프구 상에 위치하는 소수성 횡막 단백질로, B 세포 비-호지킨 림프종(NHL)에서 90% 이상 발현된다. 그러나, 조혈 줄기세포, 정상 형질세포 또는 기타 정상 조직에서는 발견되지 않는다. 인간 CD20 항원에 대한 항체인 리툭시맙(rituximab)은 B 세포 비-호지킨 림프종을 앓고 있는 환자의 치료를 위해 사용되어 왔으며, 미국등록특허 제5,776,456호에 "C2B8"로 언급된 항체이다. 상기 C2B8과 같은 항체의 성공에도 불구하고, 향상된 특성을 갖는 항-CD20에 대한 지속적인 요구가 있다.
이에 본 발명자들은 항암 효과를 가지는 신규한 융합단백질을 개발하기 위해 연구한 결과, IL-12 및 항-CD20 항체를 포함한 융합단백질이 전신 독성을 줄이면서 항암 활성이 증가함을 확인함으로써 본 발명을 완성하였다.
본 발명의 일 측면은, IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질을 제공한다.
본 발명의 다른 측면은, 상기 융합단백질을 유효성분으로 포함하는 암 예방 또는 치료용 약학 조성물을 제공한다.
본 발명의 다른 측면은, 상기 제1 단량체를 코딩하는 폴리뉴클레오티드를 제공한다.
본 발명의 다른 측면은, 상기 제2 단량체를 코딩하는 폴리뉴클레오티드를 제공한다.
본 발명의 다른 측면은, 상기 폴리뉴클레오티드를 포함하는 벡터를 제공한다.
본 발명의 다른 측면은, 상기 벡터가 도입된 형질전환 세포를 제공한다.
본 발명의 다른 측면은, i) 상기 형질전환 세포를 배양하는 단계; 및 ii) 제1 단량체 및 제2 단량체를 포함하는 융합단백질을 회수하는 단계를 포함하는 융합단백질의 생산방법을 제공한다.
본 발명의 또 다른 측면은, IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질을 개체에 투여하는 단계를 포함하는 암을 치료 또는 예방하는 방법을 제공한다.
본 발명의 또 다른 측면은, 암을 치료하기 위한 IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질의 용도를 제공한다.
본 발명의 또 다른 측면은, 암을 치료하기 위한 약을 제조하기 위한 IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질의 용도를 제공한다.
IL-12 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질은 IL-12에 의한 항암 효과를 나타낼 수 있다. 뿐만 아니라, 상기 항-CD20 항체를 하나의 항체에서 구현할 경우, 종양에 특이적으로 IL-12를 축적시킴으로써 전신 독성(systemic toxicity)을 줄이고, 종양 특이적 항암 효과를 나타냄을 확인하였다. 즉, 종양 내에서 특이적으로 발현이 높은 CD20을 대상으로 하여 IL-12를 종양 부위에 특이적으로 위치화(localization) 시킴으로써 효율적으로 암을 치료할 수 있다.
도 1은 일 실시예에 따른 T2.01, T2.02, T2.03, T2.04, T2.05, T2.06 및 T2.07에 대한 SDS-PAGE 결과이다.
도 2는 일 실시예에 따른 T2.08, T2.09, T2.10, T2.11, T2.12 및 T2.13에 대한 SDS-PAGE 결과이다.
도 3은 일 실시예에 따른 T2.14, T2.15, T2.16, T2.17 및 Rituximab에 대한 SDS-PAGE 결과이다.
도 4는 일 실시예에 따른 T2.01m, T2.02m, T2.03m, T2.04m, T2.05m, T2.06m 및 T2.07m에 대한 SDS-PAGE 결과이다.
도 5는 일 실시예에 따른 T2.08m, T2.09m, T2.10m, T2.11m, T2.12m 및 T2.13m에 대한 SDS-PAGE 결과이다.
도 6은 일 실시예에 따른 T2.15m, T2.16m, T2.17m 및 18B12에 대한 SDS-PAGE 결과이다.
도 7은 재조합 인간 CD20(recombinant human CD20, rhCD20)에 대한 T2.01 및 T2.02의 결합력을 표면 플라즈몬 공명 분석방법을 통해 나타낸 그래프이다.
도 8은 Raji 세포, Ramos 세포 및 Jurkat 세포에 대한 Rituximab, T2.01 및 T2.02의 결합력을 유세포 분석을 통해 나타낸 그래프이다.
도 9는 A20 세포에 대한 18B12, T2.01m 및 T2.02m의 결합력을 유세포 분석을 통해 나타낸 그래프이다.
도 10은 Rituximab, T2.01 및 T2.02의 IL-12 수용체 베타 1과의 결합력을 효소 결합 면역 침강 분석법을 통해 나타낸 그래프이다.
도 11은 Rituximab, T2.01, T2.02 및 T2.12의 항체 의존 독성능을 ADCC 리포터 분석을 통해 나타낸 도면이다.
도 12는 T2.01m, T2.02m, T2.03m 및 18B12의 IL-12 활성을 HEKblue 리포터 세포에서의 흡광도를 통해 확인한 그래프이다.
도 13은 T2.01, T2.02 및 T2.17의 IL-12 활성을 인간 T 세포의 신호전달능을 통해 나타낸 그래프이다.
도 14는 Rituximab, T2.01, T2.02 및 T2.03에 의해 인간 T 세포의 사이토카인 IFN-γ 분비능을 측정한 그래프이다.
도 15는 Rituximab, T2.01 및 T2.02를 혼합 림프구와 반응시킨 후, IFN-γ 분비능을 효소 결합 면역 침강 분석법을 통해 나타낸 그래프이다.
도 16은 A20 세포가 동종이식된 마우스 모델에 T2.01m, T2.02m 및 화학요법(chemotherapy)을 농도별 처리한 후 각 마우스의 종양 크기의 변화를 측정하여 스파이더 플랏(spider plot)으로 나타낸 그래프이다.
도 17은 A20 세포가 동종이식된 마우스 모델에 T2.01m, T2.02m 및 화학요법(chemotherapy)을 처리한 후 종양 크기의 변화를 측정하여 나타낸 그래프이다.
도 18은 A20 세포가 동종이식된 마우스 모델에 T2.01m, T2.02m 및 화학요법을 처리한 후, 부작용 확인을 위해 마우스의 무게를 측정하여 나타낸 그래프이다.
도 19는 A20 세포가 동종이식된 마우스 모델에 T2.01m, T2.02m 및 화학요법을 처리한 후 9일째에 마우스의 종양조직을 수확(harvest)하고, 그 무게를 측정하여 나타낸 그래프이다.
도 20은 A20 세포가 동종이식된 마우스 모델에 T2.01m, T2.02m 및 화학요법을 처리한 후 9일째에 수확된 종양조직으로부터 면역세포를 분리하고, 종양 내 면역세포의 분포도를 유세포분석을 통해 나타낸 그래프이다.
도 21은 A20 세포가 동종이식된 마우스 모델에 대해 T2.02m을 처리하여 완전관해가 일어난 마우스에 A20 세포와 4T1 세포를 세포를 동종이식하여 종양재발 모델을 구축하였다. 이후 A20 종양 크기의 변화를 나타낸 그래프이다.
도 22는 A20 세포가 동종이식된 마우스 모델에 대해 T2.02m을 처리하여 완전관해가 일어난 마우스에 A20 세포와 4T1 세포를 세포를 동종이식하여 종양재발 모델을 구축하였다. 이후 4T1 종양 크기의 변화를 나타낸 그래프이다.
도 23은 A20 세포가 동종이식된 마우스 모델에 대해 T2.02m을 처리하여 완전관해가 일어난 마우스에 A20 세포와 4T1 세포를 세포를 동종이식하여 종양재발 모델을 구축하였다. 이후 부작용 확인을 위해 마우스의 무게를 측정하여 나타낸 그래프이다.
도 24는 A20 세포가 동종이식된 마우스 모델에 T2.02m, 또는 18B12를 처리한 후 종양 크기의 변화를 측정하여 나타낸 그래프이다.
도 25는 A20 세포가 동종이식된 마우스 모델에 T2.02m 또는 T2.13m을 처리한 후 종양 크기의 변화를 측정하여 나타낸 그래프이다.
도 26은 A20 세포가 동종이식된 마우스 모델에 T2.02m 또는 18B12 및 T2.13m을 병용처리한 후 종양 크기의 변화를 측정하여 나타낸 그래프이다.
도 27은 A20 세포가 동종이식된 마우스 모델에 T2.01m, T2.02m 또는 T2.03m을 처리한 후 종양 크기의 변화를 측정하여 나타낸 그래프이다.
도 28은 A20 세포가 동종이식된 마우스 모델에 T2.01m, T2.02m 또는 T2.03m을 처리한 후, 부작용 확인을 위해 마우스의 무게를 측정하여 나타낸 그래프이다.
도 29는 재조합 인간 CD20에 대한 T2.04, T2.05, T2.06 및 T2.07의 결합력을 표면 플라즈몬 공명 분석을 통해 나타낸 그래프이다.
도 30은 재조합 인간 CD20에 대한 T2.08, T2.09, T2.10 및 T2.11의 결합력을 표면 플라즈몬 공명 분석을 통해 나타낸 그래프이다.
도 31은 항-CD20/IL-12 융합단백질(왼쪽으로부터 첫번째; 도면 중 왼쪽은 anti-CD20의 단량체이고, 오른쪽은 IL-12를 포함하는 단량체이다), 이중 가변 도메인을 가지는 항-CD20/IL-12 융합단백질, CD20에 특이적인 단일쇄 가변영역 단편(scFv)이 결합된 항-CD20/IL-12 이중 항체(세번째 및 네번째), IL-12가 Fc의 C 말단에 결합된 항-CD20/IL-12 융합단백질(다섯번째)의 모식도이다.
도 32는 CD20에 특이적인 Fab/CD20에 특이적인 단일쇄 가변영역 단편(scFv) 및 IL-12 융합단백질(왼쪽), CD20에 특이적인 Fab 및 IL-12를 포함하는 융합단백질 이량체(가운데) 및 CD20에 특이적인 단일쇄 가변영역 단편(scFv) 및 IL-12를 포함하는 융합단백질 이량체(오른쪽)의 모식도이다.
IL-12 및 CD20 항체를 포함하는 융합단백질
본 발명의 일 측면은, IL-12 또는 이의 변이체 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질을 제공한다. 구체적으로, 상기 융합단백질은 면역글로불린 Fc 영역을 포함할 수 있다. 이때, 상기 IL-12 또는 이의 변이체는 헤파린 결합능이 낮아진 변이체일 수 있다.
일 구체예로, IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질을 제공한다.
또 다른 구체예로서, IL-12 또는 이의 변이체 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질의 이량체를 제공한다.
IL-12 또는 이의 변이체
본 명세서에서 사용된 용어, "IL-12"는 각각 IL-12A 및 IL-12B의 2개의 개별적인 유전자에 의해 코딩되는 p35 및 p40 서브유닛으로 구성되는 이종이량체 사이토카인이다. IL-12는 대식세포와 같은 항원제시세포에 의해 생성되어 활성화된 T 세포 및 NK 세포들의 세포표면의 수용체에 결합한다. 상기 IL-12는 T 세포와 NK 세포들의 증식을 촉진하며, T 세포, NK 세포 및 대식세포의 세포독성 효과를 증진시킨다. 또한, IL-12는 IFN-γ, TNF-α 및 GM-CSF의 생성을 유도하며, Th1 세포의 활성화를 유도하는 작용을 한다. 한편, IL-12는 IL-12Rβ1 및 IL-12Rβ2에 의해 형성된 이종이량체 수용체인 IL-12 수용체에 결합한다.
본 명세서에서 사용된 용어, IL-12의 "변이체"는 야생형 IL-12 단백질과 유사하거나 동일한 기능을 가지는 아미노산 서열을 포함한다. 구체적으로, IL-12를 구성하는 p35 및 p40 서브유닛의 아미노산 서열이 야생형과 비교하여 치환, 삽입 또는 결실된 것일 수 있다.
상기 IL-12 또는 이의 변이체는 IL-12A(p35) 또는 이의 변이체 및 IL-12B(p40) 또는 이의 변이체를 포함할 수 있다.
또한, 상기 IL-12 또는 이의 변이체는 IL-12A 또는 이의 변이체; 및 IL-12B 또는 이의 변이체가 펩타이드 링커로 결합된 구조를 포함할 수 있다.
일 구체예에 있어서, 상기 IL-12 또는 이의 변이체는 하기 구조식 (I) 또는 구조식 (II)를 포함하는 융합단백질 일 수 있다.
N'-Y-[링커(1)]o-Z-C' (I)
N'-Z-[링커(1)]o-Y-C' (II)
이때, 상기 구조식 (I) 및 (II)에 있어서,
상기 N'은 융합단백질의 N-말단이고, 상기 C'는 융합단백질의 C-말단이며,
상기 Y는 IL-12A 또는 이의 변이체이고, 상기 Z는 IL-12B 또는 이의 변이체이며, 상기 링커(1)는 펩타이드 링커이고, 상기 o는 O 또는 1일 수 있다.
상기 IL-12 또는 이의 변이체의 일 구체예는 N 말단으로부터 IL-12B 또는 이의 변이체, 펩타이드 링커 및 IL-12A 또는 이의 변이체가 순차적으로 결합된 구조일 수 있다. 또한, 상기 IL-12 또는 이의 변이체의 일 구체예는 N 말단으로부터 IL-12A 또는 이의 변이체, 펩타이드 링커 및 IL-12B 또는 이의 변이체가 순차적으로 결합된 구조일 수 있다.
본 명세서에서 사용된 용어, "IL-12A"는 IL-12의 35 kDa 서브유닛(p35)으로서, 이황화 결합을 통해 IL-12의 40 kDa 서브유닛(p40)에 결합하여 활성 사이토카인을 생성한다.
상기 IL-12A의 아미노산 서열은 GenBank accession NO. AAK84425에 기재된 것일 수 있다(마우스 p35의 아미노산 서열은 GenBank accession No. AAA39292 참조). 또한, 상기 IL-12A 서브유닛을 코딩하는 서열로서 IL-12A(p35) 유전자는 GenBank accession No. AF404773에 기재된 서열 중 CDS(coding sequence)에 해당하는 뉴클레오타이드 서열일 수 있다(마우스 서열은 GenBank accession No. M86672 참조).
본 명세서에서 사용하는 용어, IL-12A의 "변이체"는 야생형 IL-12A 단백질과 유사하거나 동일한 기능을 가지는 아미노산 서열을 포함한다. 구체적으로, IL-12A의 아미노산 서열이 야생형과 비교하여 치환, 삽입 또는 결실을 갖는 것을 의미한다. 구체적으로, IL-12A 변이체는 IL-12A의 단편일 수 있으며, 서열번호 138의 1 내지 22번째 아미노산이 결실된 아미노산 서열을 가질 수 있다. 보다 구체적으로, IL-12A의 변이체는 서열번호 125의 아미노산 서열을 가질 수 있다.
또한, 본 발명의 일 실시예에서 사용된 IL-12A는 인간 IL-12A로서 서열번호 125의 아미노산 서열일 수 있다. 일 실시예에서 마우스 IL-12A는 서열번호 132의 아미노산 서열일 수 있다.
본 명세서에서 사용된 용어, "IL-12B"는 IL-12의 40 kDa 서브유닛(p40)으로서, 이황화 결합을 통해 IL-12의 35 kDa 서브유닛(p35)에 결합하여 IL-12를 형성하고, 이와 더불어 IL-23의 서브유닛 p19에 결합하여 IL-23을 형성하기도 한다. 한편, IL-12B는 자연살해세포 자극 인자 2(natural killer cell stimulating factor 2)라고도 한다.
상기 "IL-12B"의 아미노산 서열은 GenBank accession No. AAD56386에 기재된 것일 수 있다(마우스 p40의 아미노산 서열은 GenBank accession No. AAA39296 참조). 또한, 상기 IL-12B 서브유닛을 코딩하는 서열로서 IL-12B(p40) 유전자는 GenBank accession No. AF180563에 기재된 서열 중 CDS(coding sequence)에 해당하는 뉴클레오타이드 서열일 수 있다(마우스 서열은 GenBank accession No.M86671 참조).
또한, 본 발명의 일 실시예에서 사용된 IL-12B는 인간 IL-12B일 수 있으며, IL-12B는 구체적으로 서열번호 124의 아미노산 서열일 수 있다. 일 실시예에서 마우스 IL-12B는 서열번호 131의 아미노산 서열을 가질 수 있다.
본 명세서에서 사용된 용어, IL-12B의 "변이체"는 야생형 IL-12B 단백질과 유사하거나 동일한 기능을 가지는 아미노산 서열을 포함한다. 구체적으로, IL-12B의 야생형 아미노산 서열로부터 치환, 삽입 또는 결실을 갖는 것을 의미한다.
구체적으로, IL-12B 변이체는 서열번호 137의 1 내지 22번째 아미노산이 결실된 것일 수 있다. 보다 구체적으로, IL-12B 변이체는 상기 서열번호 124의 서열에서 1개 내지 8개의 아미노산이 치환된 것일 수 있다. 또한, 상기 IL-12B 변이체는 서열번호 139의 1 내지 22번째 아미노산이 결실된 것일 수 있다. 보다 구체적으로, IL-12B 변이체는 상기 서열번호 131의 서열에서 최대 1개 내지 8개의 아미노산이 치환된 것일 수 있다.
상기 IL-12B(p40)의 변이체는 IL-12의 헤파린 결합에 관여하는 아미노산이 치환된 것일 수 있다.
일 구체예에 있어서, 상기 IL-12B(p40)의 변이체는 IL-12B 내의 헤파린과 결합하는 라이신(K)이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 서열번호 124의 258번, 260번, 263번 및 264번의 라이신이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 상기 IL-12B(p40)의 변이체는 서열번호 124의 아미노산 서열에서 K258A, K260A, K263A 및 K264A으로 이루어지는 군으로부터 선택되는 하나 이상의 치환이 일어난 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 IL-12B(p40)의 변이체는 서열번호 124의 아미노산 서열에서 K258A 및 K263A의 치환이 일어난 아미노산 서열을 포함하거나, 서열번호 124의 아미노산 서열에서 K260A 및/또는 K264A의 변이를 더 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 IL-12B(p40)의 변이체는 IL-12B 내의 헤파린과 결합하는 알지닌(R) 또는 라이신(K)이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 서열번호 131의 254번의 알지닌 및/또는 255번, 256번 및 260번의 라이신이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 상기 IL-12B(p40)의 변이체는 서열번호 131의 아미노산 서열에서 R254A, K255A, K256A 및 K260A으로 이루어지는 군으로부터 선택되는 하나 이상의 치환이 일어난 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 IL-12B(p40)의 변이체는 서열번호 131의 아미노산 서열에서 R254A 및 K260A의 치환이 일어난 아미노산 서열을 포함하거나, 서열번호 131의 아미노산 서열에서 K255A 및/또는 K256A의 변이를 더 포함하는 것일 수 있다.
일 구체예에 있어서, IL-12B(p40)의 변이체는 상기 서열번호 127, 서열번호 129, 서열번호 134 또는 서열번호 136의 아미노산 서열을 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 인간 IL-12B 변이체는 하기 [구조식 A]로 이루어진 것일 수 있다.
[구조식 A]
X1-L-X2
여기서, X1은 서열번호 141의 아미노산 서열이고,
X2는 서열번호 142의 아미노산 서열이며,
L은 V-A1-A2-Q-A3-K*-A4-A5-A6-A7-K*-A8로 이루어진 아미노산 서열이다.
상기 A1은 R 또는 Q이고, A2는 V, A 또는 I이며, A3은 G 또는 R*이고, A4는 S, N 또는 K*이며, A5는 K*, N 또는 E이고, A6은 R 또는 K이며, A7은 E, M 또는 T이고, A8은 K* 또는 E이다.
상기 "*"로 표시된 하나 이상의 아미노산 잔기는 이에 제한되지는 않으나, A, G, I, L, M, F, P 및 V로 이루어진 군으로부터 선택된 비극성 아미노산 잔기로 치환될 수 있다.
일 구체예에 있어서, 상기 IL-12B(p40)의 변이체는 헤파린 결합에 관여하는 아미노산의 치환을 포함하여 암세포에 대한 사멸 효과는 유지하면서도, IL-12의 사이토카인 연관 독성을 감소시키는 것일 수 있다.
CD20 및 CD20에 특이적으로 결합하는 항원 결합 부위
본 명세서에서 사용된 용어, "CD20"은 pre-B 및 성숙 B 림프구 림프구의 표면 상에 발현되는 약 35 kDa의 분자량을 갖는 소수성 막관통 단백질이다. CD20은 B 세포 비-호지킨 림프종(NHL)의 90%에서 고도로 발현되나, 조혈 줄기세포, pro-B 세포, 정상 원형질 세포 또는 다른 정상 조직에서는 발견되지 않는다.
상기 CD20은 'CD20 항원'과 혼용될 수 있으며, 세포에 의해 천연적으로 발현되거나 CD20 유전자로 형질감염된 세포 상에서 발현되는 인간 CD20의 임의의 변이체, 동형 및 종 상동체를 포함한다. 본 발명의 항체는 CD20에 결합하여 CD20을 발현하는 세포(예컨대, 종양 세포)의 사멸을 매개할 수 있다. CD20을 발현하는 세포의 사멸은 ADCC(antibody-dependent cell cytotoxicity) 및 CDC(complement dependent cytotoxicity) 기작 중 하나 이상에 의해 일어날 수 있다.
본 명세서에서 사용된 용어 "특이적으로 결합하는"은 비-특이적 상호작용과 측정가능하게 상이한 결합을 의미한다. 특이적 결합은 결합 활성을 갖지 않는 표적과 유사한 대조군 분자와 경쟁함으로써 결정될 수 있다.
본 명세서에서 사용된 용어 "항원 결합 부위(Epitope)"는 항체의 가변 영역에서 특이적 항원 결합 부위와 상호작용하는 결정인자를 지칭한다. 상기 항원 결합 부위는 아미노산 또는 당 측쇄와 같은 분자의 그룹이며, 보통 특이적 구조적 특징뿐만 아니라 특이적 하전 특징을 가진다. 상기 CD20에 특이적으로 결합하는 항원 결합 부위는 CD20에 특이적으로 항원-항체 결합을 할 수 있는 분자를 총칭할 수 있다.
또한, 상기 항체 또는 이의 단편은 CD20과 특이적으로 결합할 수 있는 항원 결합 도메인을 포함하는 한 어떠한 형태로도 이용될 수 있다.
상기 항원 결합 부위는 결합에 직접적으로 수반되지 않는 다른 아미노산, 또는 항원 결합 부위의 아미노산 잔기에 의해 효과가 차단되는 아미노산을 포함할 수 있다.
구체적으로, 상기 항원 결합 부위는 CD20에 특이적으로 결합하는 항체 또는 이의 단편일 수 있다.
본 명세서에서 사용된 용어 "항체"는, 항원 결합 부위를 함유하는 분자, 및 항원 결합 부위를 함유하는 면역글로불린 분자의 면역학적 활성 단편을 지칭한다. 면역글로불린 분자는 IgG, IgE, IgM, IgD, IgA, IgY 또는 이의 하위부류(subclass)의 면역글로불린 분자일 수 있다. 항체는 합성 항체, 모노클로날 항체, 단일 도메인 항체, 단쇄 항체, 재조합적으로 생산된 항체, 다중특이적 항체(이중특이적 항체를 포함함), 인간 항체, 인간화 항체, 키메라 항체, 인트라바디(intrabody), scFv(예를 들어, 단일특이적 및 이중특이적 등을 포함함), Fab 단편, F(ab') 단편, 이황화-연결 Fv(sdFv), 항-이디오타입(anti-idiotypic)(항-Id) 항체, 및 상기 항체의 항원 결합 단편을 포함하나, 이에 제한되지 않는다.
본 명세서에서 사용된 용어 "항체 단편"은 항체의 일부, 예컨대, F(ab')2, F(ab)2, Fab', Fab, Fv, scFv일 수 있다. 구조와 상관없이, 항체 단편은 온전한(intact) 항체에 의해 인지되는 동일한 항원과 결합한다.
일 구체예에 있어서, 상기 CD20에 특이적으로 결합하는 항원 결합 부위는 서열번호 107의 HCDR1, 서열번호 108의 HCDR2 및 서열번호 109의 HCDR3를 포함하는 중쇄가변영역 및 서열번호 110의 LCDR1, 서열번호 111의 LCDR2, 서열번호 112의 LCDR3를 포함하는 경쇄가변영역을 포함할 수 있다. 이때, 일 구체예로, 상기 CD20에 특이적으로 결합하는 항원 결합 부위는 서열번호 113의 중쇄가변영역 및 서열번호 114의 경쇄가변영역을 가질 수 있다.
또한, 일 구체예로 서열번호 115의 HCDR1, 서열번호 116의 HCDR2 및 서열번호 117의 HCDR3를 포함하는 중쇄가변영역 및 서열번호 118의 LCDR1, 서열번호 119의 LCDR2, 서열번호 120의 LCDR3를 포함하는 경쇄가변영역을 포함할 수 있다. 이때, 일 구체예로 상기 CD20에 특이적으로 결합하는 항원 결합 부위는 서열번호 121의 중쇄 가변 영역 및 서열번호 122의 경쇄가변영역을 가질 수 있다.
일 구체예에 있어서, 상기 CD20에 특이적으로 결합하는 항원 결합 부위는 scFv일 수 있다. 이때, 상기 scFv는 상술한 중쇄 및 경쇄 CDR을 포함할 수 있다. 상기 CD20에 특이적으로 결합하는 scFv의 일 구체예로 서열번호 88 또는 서열번호 89의 아미노산 서열을 가질 수 있다.
또한, 상기 CD20에 특이적으로 결합하는 항원 결합 부위는 공지된 항-CD20 항체 또는 이의 단편을 포함하는 것일 수 있다. 상기 항-CD20 항체 또는 이의 단편은 당업자에게 알려진 항체를 제한 없이 의미할 수 있다.
상기 항-CD20 항체 또는 이의 단편은 Ocrelizumab(RG-1594), Obinutuzumab(RG-7159), Ofatumumab(GSK-1841157), 2B8(Biogen), Tositumomab(Bexxar), Ublituximab(EMAB-603), Epcortitamab(GEN-3013)의 7D8, Divozilimab(BCD-132), Odronextabmab(REGN-1979), Veltuzumab, MB-CART2019.1, Ocaratuzumab(LY-2469298), ADI-001의 3H7, Pamotamab(THG-338), DNL-1의 hA20 및 mAb-1.5.3으로 이루어지는 군으로부터 선택되는 하나 이상의 가변영역을 포함하는 것일 수 있다.
다른 한가지 예로, 상기 항체는 국제공개특허 WO 2004-056312 A2, 국제공개특허 WO 2005-044859 A2, 미국등록특허 US 8,529,902 B2, 미국등록특허 US 8,563,269 B2, 미국등록특허 US 9,694,071 B2, 국제공개특허 WO 2019-155008 A1, 국제공개특허 WO 2020-091634 A1, 미국공개특허 US 2017-0174781 A1, 국제공개특허 WO 2003-068821 A2, 미국공개특허 US 2020-0109210 A1, 미국등록특허 US 8,153,125 B2, 국제공개특허 WO 2020-072536 A1, 미국공개특허 US 2021-0095027 A1, 국제공개특허 WO 2003-068821 A2 또는 미국공개특허 US 2011-0129412 A1에 개시된 항-CD20 항체 또는 이의 단편을 사용할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 Ocrelizumab의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 143의 HCDR1, 서열번호 144의 HCDR2, 서열번호 145의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 146의 LCDR1, 서열번호 147의 LCDR2, 서열번호 148의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 240의 중쇄가변영역 및 서열번호 241의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 Afutuzumab 또는 Obinutuzumab의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 149의 HCDR1, 서열번호 150의 HCDR2, 서열번호 151의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 152의 LCDR1, 서열번호 153의 LCDR2, 서열번호 154의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 242의 중쇄가변영역 및 서열번호 243의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 Ofatumumab의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 155의 HCDR1, 서열번호 156의 HCDR2, 서열번호 157의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 158의 LCDR1, 서열번호 159의 LCDR2, 서열번호 160의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 244의 중쇄가변영역 및 서열번호 245의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 2B8의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 161의 HCDR1, 서열번호 162의 HCDR2, 서열번호 163의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 164의 LCDR1, 서열번호 165의 LCDR2, 서열번호 166의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 246의 중쇄가변영역 및 서열번호 247의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 Tositumomab의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 167의 HCDR1, 서열번호 168의 HCDR2, 서열번호 169의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 170의 LCDR1, 서열번호 171의 LCDR2, 서열번호 172의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 248의 중쇄가변영역 및 서열번호 249의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 Ublituximab의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 173의 HCDR1, 서열번호 174의 HCDR2, 서열번호 175의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 176의 LCDR1, 서열번호 177의 LCDR2, 서열번호 178의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 250의 중쇄가변영역 및 서열번호 251의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 Epcortitamab의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 179의 HCDR1, 서열번호 180의 HCDR2, 서열번호 181의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 182의 LCDR1, 서열번호 183의 LCDR2, 서열번호 184의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 252의 중쇄가변영역 및 서열번호 253의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 Divozilimab의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 185의 HCDR1, 서열번호 186의 HCDR2, 서열번호 187의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 188의 LCDR1, 서열번호 189의 LCDR2, 서열번호 190의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 254의 중쇄가변영역 및 서열번호 255의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 Odronextabmab의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 191의 HCDR1, 서열번호 192의 HCDR2, 서열번호 193의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 194의 LCDR1, 서열번호 195의 LCDR2, 서열번호 196의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 256의 중쇄가변영역 및 서열번호 257의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 Veltuzumab의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 197의 HCDR1, 서열번호 198의 HCDR2, 서열번호 199 또는 서열번호 200의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 201의 LCDR1, 서열번호 202의 LCDR2, 서열번호 203의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 258의 중쇄가변영역 및 서열번호 259의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 MB-CART2019.1의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 204의 HCDR1, 서열번호 205의 HCDR2, 서열번호 206의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 207의 LCDR1, 서열번호 208의 LCDR2, 서열번호 209의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 260의 중쇄가변영역 및 서열번호 261의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 Ocaratuzumab의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 210의 HCDR1, 서열번호 211의 HCDR2, 서열번호 212의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 213의 LCDR1, 서열번호 214의 LCDR2, 서열번호 215의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 262의 중쇄가변영역 및 서열번호 263의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 ADI-001의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 216의 HCDR1, 서열번호 217의 HCDR2, 서열번호 218의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 219의 LCDR1, 서열번호 220의 LCDR2, 서열번호 221의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 264의 중쇄가변영역 및 서열번호 265의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 Pamotamab의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 222의 HCDR1, 서열번호 223의 HCDR2, 서열번호 224의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 225의 LCDR1, 서열번호 226의 LCDR2, 서열번호 227의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 266의 중쇄가변영역 및 서열번호 267의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 DNL-1의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 228의 HCDR1, 서열번호 229의 HCDR2, 서열번호 230의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 231의 LCDR1, 서열번호 232의 LCDR2, 서열번호 233의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 268의 중쇄가변영역 및 서열번호 269의 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-CD20 항체는 mAb-1.5.3의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 234의 HCDR1, 서열번호 235의 HCDR2, 서열번호 236의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 237의 LCDR1, 서열번호 238의 LCDR2, 서열번호 239의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항-CD20 항체는 서열번호 270의 중쇄가변영역 및 서열번호 271의 경쇄가변영역을 포함할 수 있다.
상기 항-CD20 항체는 암세포상에 존재하는 CD20에 특이적으로 결합하여, 암세포의 사멸을 유발할 수 있는 한 어떠한 항체도 이용될 수 있다.
제1 단량체의 구조
상기 제1 단량체는 IL-12 또는 이의 변이체를 포함한다.
상기 제1 단량체는 CD20에 특이적으로 결합하는 항원 결합 부위를 추가적으로 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 제1 단량체는 IL-12 또는 이의 변이체; 및 Fc 영역 단편 또는 이의 변이체를 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 제1 단량체는 IL-12 또는 이의 변이체, Fc 영역 단편 또는 이의 변이체 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 것일 수 있다.
상기 제1 단량체는 하기 구조식 (III) 또는 구조식 (IV)를 포함하는 것일 수 있다.
N'-X-[링커(2)]p-Fc 영역 단편 또는 이의 변이체-[링커(3)]q-(T)r-C' (III)
N'-(T)r-[링커(2)]q -Fc 영역 단편 또는 이의 변이체-[링커(3)]p-X-C' (IV)
이때, 상기 구조식 (III) 및 (IV)에 있어서,
상기 N'은 융합단백질의 N-말단이고, 상기 C'는 융합단백질의 C-말단이며,
상기 X는 상기 구조식 (I) 또는 (II)이고,
상기 T는 CD20에 특이적으로 결합하는 항원 결합 부위이며,
상기 링커(2) 및 링커(3)는 펩타이드 링커이고, 상기 p, q 및 r은 각각 독립적으로 O 또는 1일 수 있다.
일 구체예에 있어서, 상기 r이 0인 경우, 상기 제1 단량체는 IL-12 또는 이의 변이체 및 Fc 영역 단편 또는 이의 변이체가 펩타이드 링커로 연결된 융합단백질 형태일 수 있다.
이때, 상기 제1 단량체는 서열번호 3번, 서열번호 4번, 서열번호 5번, 서열번호 13번, 서열번호 14번, 서열번호 15번, 서열번호 24번, 서열번호 25번, 서열번호 26번, 서열번호 34번, 서열번호 35번 또는 서열번호 36번의 아미노산 서열을 포함하는 것일 수 있다.
이때, 상기 구조식 (III)에서 상기 r이 1인 경우, 상기 제1 단량체는 IL-12 또는 이의 변이체에 항-CD20 항체의 단량체가 결합된 형태일 수 있다.
이때, 상기 구조식 (III)에서 r이 1인 경우, 상기 제1 단량체는 서열번호 272, 서열번호 273, 서열번호 276, 서열번호 277, 서열번호 278, 서열번호 279, 서열번호 282 또는 서열번호 283의 아미노산 서열을 포함하는 것일 수 있다.
이때, 상기 구조식 (IV)에서 r이 1인 경우, 상기 제1 단량체는 서열번호 274, 서열번호 275, 서열번호 280 또는 서열번호 281의 아미노산 서열을 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 r이 1인 경우, 상기 구조식 (III)은 하기 구조식 (III') 및 (III'')를 포함하는 것일 수 있다.
N'-X-[링커(2)]p-Fc 영역 단편 또는 이의 변이체-[링커(3)]q-(T')-C' (III')
N'-(T'')-C' (III'')
이때, 상기 구조식 (III') 및 (III'')에 있어서,
T'은 CD20에 특이적으로 결합하는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하거나 또는 항체의 경쇄 영역이고;
T''은 CD20에 특이적으로 결합하는 항체의 경쇄 영역이거나, 또는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하며;
이때, T' 및 T''은 결합하여 항체의 가변 영역을 형성하고, 이때, 상기 가변 영역은 CD20에 특이적으로 결합하며;
상기 링커(2) 내지 링커(3)는 펩타이드 링커이며, 상기 p 및 q은 각각 독립적으로 0 또는 1이고, N', X 및 C'는 상기에서 정의한 바와 같다.
일 구체예에 있어서, 상기 r이 1인 경우, 상기 구조식 (IV)는 하기 구조식 (IV') 및 (IV'')를 포함하는 것일 수 있다.
N'-(T')-[링커(2)]q-Fc 영역 단편 또는 이의 변이체-[링커(3)]p-X-C' (IV'); 및
N'-(T'')-C' (IV'')
이때, 상기 구조식 (IV') 및 (IV'')에 있어서,
T'은 CD20에 특이적으로 결합하는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하거나, 또는 항체의 경쇄 영역이고;
T''은 CD20에 특이적으로 결합하는 항체의 경쇄 영역이거나, 또는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하며;
이때, T' 및 T''은 결합하여 항체의 가변 영역을 형성하고, 이때, 상기 가변 영역은 CD20에 특이적으로 결합하며;
상기 링커(2) 내지 링커(3)는 펩타이드 링커이며, 상기 p 및 q은 각각 독립적으로 0 또는 1이고, N', X 및 C'는 상기에서 정의한 바와 같다.
이때, 상기 제1 단량체는 서열번호 10 및 서열번호 2; 서열번호 11 및 서열번호 2; 서열번호 31 및 서열번호 23; 또는 서열번호 32 및 서열번호 23; 서열번호 274 및 서열번호 2; 서열번호 275 및 서열번호 2; 서열번호 280 및 서열번호 23; 또는 서열번호 281 및 서열번호 23의 아미노산 서열을 포함하는 것일 수 있다.
제2 단량체의 구조
상기 제2 단량체는 CD20에 특이적으로 결합하는 항원 결합 부위를 추가적으로 더 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 제2 단량체는 제1 CD20 결합 부위; 및 제2 CD20 결합 부위를 포함하는 것일 수 있다.
상기 CD20에 특이적으로 결합하는 항원 결합 부위는 Fab, scFv, Fv 또는 이의 단편일 수 있다. 이때, 제1 CD20 결합 부위는 Fab이며, 제2 CD20 결합 부위는 Fv 또는 scFv일 수 있다.
상기 제2 CD20 결합 부위는 제2 단량체의 N 말단 또는 C 말단에 결합하는 것일 수 있다. 구체적으로, 제2 CD20 결합 부위는 중쇄의 C 말단, 경쇄의 C 말단, 가변부위의 N 말단에 추가적으로 결합된 것일 수 있다.
상기 제2 단량체는 하기 구조식 (V)를 포함하는 것일 수 있다.
N'-(R)s-[링커(4)]t-Q-[링커(5)]u-Fc 영역 단편 또는 이의 변이체-[링커(6)]v-(W)a-C' (V)
상기 구조식 (V)에 있어서,
상기 N'은 융합단백질의 N-말단이고, 상기 C'는 융합단백질의 C-말단이며,
상기 R 및 Q는 CD20에 특이적으로 결합하는 항원 결합 부위이고,
상기 W는 CD20에 특이적으로 결합하는 scFv; 또는 구조식 (I) 또는 (II)의 IL-12 또는 이의 변이체이고,
상기 링커(4), 링커(5) 및 링커(6)은 각각 펩타이드 링커이며, 상기 s, t, u, v 및 a는 각각 독립적으로 O 또는 1일 수 있다.
일 구체예에 있어서, 상기 구조식 (V)는 서열번호 1, 서열번호 2, 서열번호 6, 서열번호 7, 서열번호 8, 서열번호 9, 서열번호 12, 서열번호 21, 서열번호 22, 서열번호 23, 서열번호 27, 서열번호 28, 서열번호 29, 서열번호 30, 서열번호 33, 서열번호 42, 서열번호 274, 서열번호 275, 서열번호 280 및 서열번호 281으로 이루어지는 군으로부터 선택된 하나 이상의 아미노산 서열을 포함할 수 있다.
일 구체예에 있어서, 상기 구조식 (V)는 하기 구조식 (V') 및 (V'')을 포함하는 것일 수 있다.
N'-(R')s-[링커(4)]t-Q'-[링커(5)]u-Fc 영역 단편 또는 이의 변이체-[링커(6)]p-(W)a-C' (V')
N'-(R'')s-[링커(4)]t-Q''-[링커(7)]x-(W)b-C' (V'')
상기 구조식 (V') 및 (V'')에 있어서,
R'은 CD20에 특이적으로 결합하는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하거나, 또는 항체의 경쇄 영역이고;
R''은 CD20에 특이적으로 결합하는 항체의 경쇄 영역이거나, 또는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하며;
이때, R' 및 R''은 결합하여 항체의 가변 영역을 형성하고, 이때, 상기 가변 영역은 CD20에 특이적으로 결합하며;
Q'은 CD20에 특이적으로 결합하는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하거나, 또는 항체의 경쇄 영역이고;
Q''은 CD20에 특이적으로 결합하는 항체의 경쇄 영역이거나, 또는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하며;
이때, Q' 및 Q''는 결합하여 항체의 가변 영역을 형성하고, 이때, 상기 가변 영역은 CD20에 특이적으로 결합하며,
상기 W는 CD20에 특이적으로 결합하는 scFv; 또는 구조식 (I) 또는 (II)의 IL-12 또는 이의 변이체이고,
상기 링커(4), 링커(5), 링커(6) 및 링커(7)은 각각 펩타이드 링커이며, 상기 s, t, u, x, a 및 b는 각각 독립적으로 O 또는 1일 수 있다.
일 구체예에 있어서, 상기 구조식 (V')는 서열번호 1, 서열번호 6, 서열번호 8, 서열번호 12, 서열번호 21, 서열번호 22, 서열번호 27, 서열번호 29, 서열번호 33, 서열번호 42, 서열번호 274, 서열번호 275, 서열번호 280 또는 서열번호 281일 수 있다.
일 구체예에 있어서, 상기 구조식 (V'')는 서열번호 2, 서열번호 7, 서열번호 9, 서열번호 23, 서열번호 28 또는 서열번호 30일 수 있다.
일 구체예에 있어서, 상기 제2 단량체는 서열번호 113의 아미노산 서열로 이루어진 중쇄 및 서열번호 114의 아미노산 서열로 이루어진 경쇄; 또는 서열번호 121의 아미노산 서열로 이루어진 중쇄 및 서열번호 122의 아미노산 서열로 이루어진 경쇄를 포함하는 것일 수 있다.
또한, W가 scFv인 경우, 상기 W는 서열번호 88 또는 서열번호 89의 아미노산 서열을 가질 수 있다.
펩타이드 링커
본 명세서에서 사용하는 용어, "펩타이드 링커"는 융합 단백질 내에서 도메인과 도메인 사이에 물리 화학적 거리를 두거나, 혹은 연결을 위하여 사용되는 펩타이드이다. 상기 링커는 면역글로불린의 힌지 영역을 포함할 수 있다.
상기 펩타이드 링커(1) 내지 (7)은 아미노산으로 구성된 펩타이드 링커를 의미한다. 구체적으로, 상기 펩타이드 링커(2) 또는 펩타이드 링커(5)는 5 내지 80개의 연속된 아미노산, 7 내지 70개의 연속된 아미노산, 또는 10 내지 60개의 연속된 아미노산, 또는 12 내지 50개의 아미노산으로 이루어질 수 있다. 상기 펩타이드 링커는 (G4S)n(이때, n은 1 내지 10의 정수)을 포함할 수 있다. 이때, (G4S)n에서 n은 각각 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10일 수 있다.
상기 펩타이드 링커(2) 또는 펩타이드 링커(5)는 5 내지 80개의 연속된 아미노산, 7 내지 70개의 연속된 아미노산, 또는 10 내지 60개의 연속된 아미노산, 또는 12 내지 50개의 아미노산으로 이루어질 수 있다. 일 구체예로 펩타이드 링커(2)는 30개의 아미노산으로 이루어질 수 있다. 또한, 펩타이드 링커(2)는 적어도 하나의 시스테인을 포함할 수 있다. 구체적으로, 한 개, 두 개 또는 세 개의 시스테인을 포함할 수 있다. 또한, 상기 펩타이드 링커(2)는 면역글로불린의 힌지에서 유래된 것일 수 있고 (G4S)n(이때, n은 1 내지 10의 정수)을 추가로 더 포함할 수 있다. 구체적으로, 펩타이드 링커(2) 또는 펩타이드 링커(5)는 서열번호 94, 서열번호 95, 서열번호 96, 서열번호 97, 서열번호 98, 서열번호 99, 서열번호 100, 서열번호 101 및 서열번호 102 중 어느 하나의 아미노산 서열로 이루어진 힌지 영역을 포함할 수 있다.
또한, 펩타이드 링커(3), 펩타이드 링커(4), 펩타이드 링커(6) 및 펩타이드 링커(7)은 1 내지 30개의 연속된 아미노산, 5 내지 20개의 연속된 아미노산, 또는 10 내지 15개의 연속된 아미노산으로 이루어질 수 있다. 상기 펩타이드 링커는 (G4S)n(이때, n은 1 내지 10의 정수)을 포함할 수 있다. 이때, (G4S)n에서 n은 각각 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10일 수 있다.
일 구체예에 있어서, 상기 펩타이드 링커(1)은 서열번호 91, 서열번호 92 또는 서열번호 93의 아미노산 서열로 이루어진 펩타이드 링커일 수 있다.
또한, 구체적으로, 상기 펩타이드 링커(2), 펩타이드 링커(3) 또는 펩타이드 링커(5)는 서열번호 91 또는 서열번호 92을 포함할 수 있다.
본 발명의 일 실시예에서 펩타이드 링커(2) 또는 펩타이드 링커 (5)는 서열번호 100 또는 서열번호 102의 아미노산 서열을 포함하는 펩타이드 링커일 수 있다.
Fc 영역 또는 이의 단편
이때, 상술한 면역글로불린 단편은 면역글로불린의 Fc 영역일 수 있다. 상기 면역글로불린의 Fc 영역은 야생형 Fc 도메인뿐만 아니라, Fc 도메인 변이체일 수 있다. 이때, 상기 Fc 영역은 IgG, IgA, IgE, IgD 또는 IgM의 Fc 영역일 수 있으며, 구체적으로, IgG1 또는 IgG2a에서 유래한 것일 수 있다.
본 명세서에서 사용된 용어 "Fc 도메인 변이체"는 야생형 Fc 도메인의 당쇄 형태(glycosylation pattern)와 다르거나, 야생형 Fc 도메인에 비해 증가된 당쇄, 야생형 Fc 도메인에 비해 감소한 당쇄, 또는 당쇄가 제거된(deglycosylated) 형태일 수 있다. 또한 무당쇄(aglycosylated) Fc 도메인도 포함된다. Fc 도메인 혹은 변이체는 배양조건 혹은 호스트의 유전자 조작을 통해 조정된 숫자의 시알산(sialic acid), 퓨코실화(fucosylation), 당화(glycosylation)를 갖도록 한 것일 수 있다.
또한, 화학적 방법, 효소적 방법 및 미생물을 사용한 유전공학적 엔지니어링 방법 등과 같이 통상적인 방법으로 면역글로불린의 Fc 도메인의 당쇄를 변형시킬 수 있다. 또한, 상기 Fc 도메인 변이체는 면역글로불린 IgG, IgA, IgE, IgD 또는 IgM의 Fc 영역이 혼합된 형태일 수 있다. 또한, 상기 Fc 도메인 변이체는 상기 Fc 도메인의 일부 아미노산이 다른 아미노산으로 치환된 형태일 수 있다.
상기 치환 및/또는 부가에 의해 도입되는 "아미노산"은 라이신(K), 알라닌(A), 알지닌(R), 아스파라진(N), 아스파르트산(D), 시스테인(C), 글루타민(Q), 글루탐산(E), 글라이신(G), 히스티딘(H), 이소류신(I), 류신(L), 메티오닌(M), 페닐알라닌(F), 프롤린(P), 세린(S), 트레오닌(T), 트립토판(W), 타이로신(Y) 및 발린(V)으로 구성된 군에서 선택되는 어느 하나일 수 있다.
또한, 상기 Fc 영역은 놉 구조 또는 홀 구조를 포함할 수 있다.
본 명세서에서 사용된 용어 "놉-인투-홀(knob-into-hole)"은 이중특이적 항체, 다중특이적 항체, 또는 이종이량체 항체 등과 같이, 서로 다른 영역에 특이적으로 결합하는 항체를 제조하기 위한 설계 전략이다. 일반적으로, 이러한 기술은 제1 폴리펩티드의 경계면(가령, 제1 항체 중쇄의 제1 CH3 도메인)에 놉(knob)을 그리고 제2 폴리펩티드의 경계면(가령, 제2 항체 중쇄의 제2 CH3 도메인)에 상응하는 홀(hole)을 도입하는 것을 포함하고, 그리하여 놉을 홀 내에 위치시켜 이종이량체 형성을 촉진시키고 동종이량체 형성을 방해하도록 할 수 있다.
'놉'은 제1 폴리펩티드의 경계면(가령, 제1 항체 중쇄의 제1 CH3 도메인)으로부터의 소형 아미노산 측쇄들을 보다 큰 측쇄들(예컨대, 알지닌, 페닐알라닌, 타이로신 또는 트립토판)로 대체함으로써 구축된다. 상기 놉에 동일하거나 유사한 크기의 상보적 '홀'은 제2 폴리펩티드의 경계면(가령, 제2 항체 중쇄의 제2 CH3 도메인)에서 대형 아미노산 측쇄를 보다 작은 측쇄들(예컨대, 알라닌, 세린, 발린, 또는 트레오닌)로 대체함으로써 생성된다. 상기 놉 및 홀은 폴리펩티드를 인코딩하는 핵산을, 예컨대, 부위-특이적 돌연변이 유발에 의해, 또는 펩티드 합성에 의해 변경함으로써 생성될 수 있다.
일 구체예에 있어서, 상기 IgG1의 놉 구조는 서열번호 19 또는 103일 수 있고, 홀 구조는 서열번호 20 또는 104일 수 있다. 상기 놉 구조 또는 홀 구조는 서열번호 284의 아미노산 서열의 146번째, 148번째 및 187번째 아미노산이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 본 발명의 일 실시예에서 놉 구조 또는 홀 구조는 서열번호 284의 아미노산 서열이 T146W, T146S, L148A 및 Y187A로 치환된 형태일 수 있다. 구체적으로, 놉 구조는 T146W로 치환된 형태일 수 있고, 홀 구조는 T146S, L148A 및 Y187V로 치환된 형태일 수 있다.
한편, 본 발명의 일 실시예에서 IgG2a의 놉 구조는 서열번호 40 또는 105일 수 있고, 홀 구조는 서열번호 41 또는 106일 수 있다. 상기 놉 구조 또는 홀 구조는 서열번호 285의 아미노산 서열의 152번째, 154번째 및 193번째 아미노산이 다른 아미노산으로 치환된 형태일 수 있다. 구체적으로, 본 발명의 일 실시예에서 놉 구조 또는 홀 구조는 서열번호 285의 아미노산 서열이 T152W 또는 T152S, M154A 및 Y193V로 치환된 형태일 수 있다. 구체적으로, 놉 구조는 T152W로 치환된 형태일 수 있고, 홀 구조는 T152S, M154A 및 Y193V으로 치환된 형태일 수 있다.
일 구체예에 있어서, 상기 Fc 도메인 변이체는 DANG 변이 또는 NG 변이를 포함하는 것일 수 있다. 이때, "DANG 변이"는 인간 IgG1 또는 마우스 IgG2a 내의 효과기 기능을 제거하기 위한 D265A/N297G 돌연변이를 지칭한다.
IgG 분자에서 상기 Fc 영역이 매개하는 효과기 기능은 C1q 결합, 보체 의존성 세포독성, Fc 수용체 결합, 항체 의존성 세포 매개의 세포독성(ADCC), 식균작용, 세포 표면 수용체(예컨대, B 세포 수용체, BCR)의 저하 조절 등을 포함한다. 이러한 효과기 기능은 일반적으로 Fc 영역을 결합 도메인(예컨대, 항체 가변 도메인)과 결합시키는 것을 필요로 한다.
비변이 Fc 영역의 아미노산 서열의 치환으로 효과기 기능을 변화시킬 수 있으며, 효과기 기능이 변화된 Fc 영역은 예를 들어 C1q 결합 및/또는 FcR 결합을 변형시켜 이에 따라 CDC 활성 및/또는 ADCC 활성을 변화시킴으로써 설계할 수 있다. 즉, 상기 'DANG 변이'는 항체 제조시 원하지 않는 효과기 작용이 발생하지 않도록 IgG 분자에서 상기 Fc 영역이 매개하는 효과기 기능을 제거함을 의미한다.
일 실시예에 있어서, 상기 DANG 변이는 서열번호 104의 인간 IgG1 내 아미노산이 D45A/N77G로 치환된 형태일 수 있다. 또한, 서열번호 106의 마우스 IgG2a 내 아미노산이 D51A/N83G로 치환된 형태일 수 있다.
융합단백질의 구조
상기 융합단백질은 항체일 수 있다. 구체적으로, 상기 항체는 놉-인투-홀 구조를 포함하는 헤테로다이머 항체일 수 있다.
상기 융합단백질은 구조식 (III) 및 구조식 (V); 또는 구조식 (IV) 및 구조식 (V)를 포함하는 것일 수 있다.
보다 구체적으로, 상기 융합단백질의 일 구체예는 하기 (i) 또는 (ii)의 제1 단량체; 및 하기 (iii), (iv), (v) 또는 (vi)의 제2 단량체를 포함할 수 있다:
제1 단량체의 예시:
(i) r이 0인 경우의 구조식 (III)
(ii) r이 1인 경우의 구조식 (IV)
제2 단량체의 예시:
(iii) s, a 및 b가 0인 구조식 (V') 및 구조식 (V'')
(iv) s는 1이고, a 및 b가 0인 구조식 (V') 및 구조식 (V'')
(v) s 및 b는 0이고, a는 1인 구조식 (V') 및 구조식 (V'')
(vi) b는 1이고, s 및 a가 0인 구조식 (V') 및 구조식 (V'').
일 구체예에 있어서, 상기 융합단백질은 상기 (i)을 포함하는 제1 단량체; 및 상기 (iii)을 포함하는 제2 단량체를 포함할 수 있다(도 31의 왼쪽으로부터 첫번째). 이때, 상기 융합단백질은 서열번호 1, 서열번호 2, 서열번호 3, 서열번호 4, 서열번호 5, 서열번호 12, 서열번호 13, 서열번호 14, 서열번호 22, 서열번호 23, 서열번호 24, 서열번호 25, 서열번호 26, 서열번호 33, 서열번호 34 및 서열번호 35으로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 1, 서열번호 2 및 서열번호 3; 서열번호 1, 서열번호 2 및 서열번호 4; 서열번호 1, 서열번호 2 및 서열번호 5; 서열번호 2, 서열번호 12 및 서열번호 13; 서열번호 2, 서열번호 12 및 서열번호 14; 서열번호 22, 서열번호 23 및 서열번호 24; 서열번호 22, 서열번호 23 및 서열번호 25; 서열번호 22, 서열번호 23 및 서열번호 26; 서열번호 23, 서열번호 33 및 서열번호 34; 또는 서열번호 23, 서열번호 33 및 서열번호 35을 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 융합단백질은 상기 (i)을 포함하는 제1 단량체; 및 상기 (iv)를 포함하는 제2 단량체를 포함할 수 있다(도 31의 왼쪽으로부터 두번째). 이때, 상기 융합단백질은 서열번호 3, 서열번호 5, 서열번호 6, 서열번호 7, 서열번호 24, 서열번호 26, 서열번호 27 및 서열번호 28로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 3, 서열번호 6 및 서열번호 7; 서열번호 5, 서열번호 6 및 서열번호 7; 서열번호 24, 서열번호 27 및 서열번호 28; 또는 서열번호 26, 서열번호 27 및 서열번호 28을 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 융합단백질은 상기 (i)을 포함하는 제1 단량체; 및 상기 (v)를 포함하는 제2 단량체를 포함할 수 있다(도 31의 왼쪽으로부터 세번째). 이때, 상기 융합단백질은 서열번호 2, 서열번호 3, 서열번호 5, 서열번호 8, 서열번호 23, 서열번호 24, 서열번호 26 및 서열번호 29로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 2, 서열번호 3 및 서열번호 8; 서열번호 2, 서열번호 5 및 서열번호 8; 서열번호 23, 서열번호 24 및 서열번호 29; 또는 서열번호 23, 서열번호 26 및 서열번호 29을 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 융합단백질은 상기 (i)을 포함하는 제1 단량체; 및 상기 (vi)을 포함하는 제2 단량체를 포함할 수 있다(도 31의 왼쪽으로부터 네번째). 이때, 상기 융합단백질은 서열번호 1, 서열번호 3, 서열번호 5, 서열번호 9, 서열번호 22, 서열번호 24, 서열번호 26 및 서열번호 30으로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 1, 서열번호 3 및 서열번호 9; 서열번호 1, 서열번호 5 및 서열번호 9; 서열번호 22, 서열번호 24 및 서열번호 30; 또는 서열번호 22, 서열번호 26 및 서열번호 30을 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 융합단백질은 상기 (ii)을 포함하는 제1 단량체; 및 상기 (iii)을 포함하는 제2 단량체를 포함할 수 있다(도 31의 왼쪽으로부터 다섯번째). 이때, 상기 융합단백질은 서열번호 1, 서열번호 2, 서열번호 10, 서열번호 11, 서열번호 22, 서열번호 23, 서열번호 31 및 서열번호 32으로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 1, 서열번호 2 및 서열번호 10; 서열번호 1, 서열번호 2 및 서열번호 11; 서열번호 22, 서열번호 23 및 서열번호 31; 또는 서열번호 22, 서열번호 23 및 서열번호 32를 포함하는 것일 수 있다.
또한, 일 구체예에 있어서, IL-12 또는 이의 변이체 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질 이량체는 상기 구조식 (III)의 단량체 및 상기 구조식 (V)의 단량체를 포함하는 융합단백질 이량체일 수 있다(도 32의 왼쪽). 이때, 상기 상기 구조식 (III)에서 r은 1이고, 상기 구조식 (V)에서 s, a 및 t는 0이다. 이때, 상기 구조식 (V)는 (V') 및 (V'')를 포함할 수 있다. 이때, 상기 (V') 및 (V'')에서 s, a, t 및 b는 0이다. 또한, 상기 이량체의 Fc 영역은 놉-인투-홀 구조를 가지며, 이러한 구조를 통해 서로 상이한 융합단백질이 결합될 수 있다.
구체적으로, 상기 융합단백질은 서열번호 1, 서열번호 2, 서열번호 22, 서열번호 23, 서열번호 272, 서열번호 273, 서열번호 278 및 서열번호 279로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 1, 서열번호 2 및 서열번호 272; 서열번호 1, 서열번호 2 및 서열번호 273; 서열번호 22, 서열번호 23 및 서열번호 278; 또는 서열번호 22, 서열번호 23 및 서열번호 279를 포함하는 것일 수 있다.
또한, IL-12 또는 이의 변이체 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질 이량체는 상기 구조식 (V)의 구조를 포함하는 융합단백질 이량체일 수 있다(도 32의 가운데). 이때, 상기 융합단백질 이량체는 (V') 및 (V'')를 포함할 수 있다. 이때, 상기 구조식 (V)에서 s 및 t는 0, a는 1이다. 또한, 상기 (V') 및 (V'')에서 s, t 및 b는 0, a는 1이다. 또한, 상기 융합단백질 이량체는 상기 구조식 (IV)의 구조를 포함하는 융합단백질 이량체일 수 있다. 이때, 상기 구조식 (IV)에서 r은 1이다.
구체적으로, 상기 융합단백질은 서열번호 2, 서열번호 23, 서열번호 274, 서열번호 275, 서열번호 280 및 서열번호 281으로 이루어진 군으로부터 선택된 하나 이상의 아미노산 서열을 포함하는 것일 수 있다. 구체적으로, 상기 융합단백질은 서열번호 2 및 서열번호 274; 서열번호 2 및 서열번호 275; 서열번호 23 및 서열번호 280 또는 서열번호 23 및 서열번호 281을 포함하는 것일 수 있다.
일 구체예에 있어서, IL-12 또는 이의 변이체 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 융합단백질 이량체는 상기 구조식 (III)의 구조를 포함하는 융합단백질 이량체일 수 있다(도 32의 오른쪽). 이때, 상기 구조식 (III)에서 r은 1이다.
구체적으로, 상기 융합단백질은 서열번호 276, 서열번호 277, 서열번호 282 또는 서열번호 283을 포함하는 것일 수 있다.
본원 다중 특이적 융합 단백질은 화학적으로 변형된 형태일 수 있다. 일 실시예에서, 상기 융합 단백질은 글리코실화, 아세틸화, 페길화, 인산화, 아미드화, 공지된 보호기/차단기에 의한 유도체화, 단백질 분해 절단 및/또는 세포 리간드 또는 다른 단백질을 결합하여 화학적으로 변형될 수 있다. 이처럼 수많은 화학적 변형은 알려진 기술에 의해 수행될 수 있다.
융합단백질을 코딩하는 폴리뉴클레오티드
본 발명의 다른 측면은, 상기 제1 단량체를 코딩하는 폴리뉴클레오티드 또는 상기 제2 단량체를 코딩하는 폴리뉴클레오티드를 제공한다.
일 구체예에 있어서, 상기 제1 단량체의 폴리펩티드는 서열번호 3, 서열번호 4, 서열번호 5, 서열번호 10, 서열번호 11, 서열번호 13, 서열번호 14, 서열번호 15, 서열번호 24, 서열번호 25, 서열번호 26, 서열번호 31, 서열번호 32, 서열번호 34, 서열번호 35, 서열번호 36, 서열번호 272, 서열번호 273, 서열번호 274, 서열번호 275, 서열번호 276, 서열번호 277, 서열번호 278, 서열번호 279, 서열번호 280, 서열번호 281, 서열번호 282, 또는 서열번호 283과 적어도 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99%, 또는 적어도 약 100%의 동일성을 가지는 아미노산 서열을 포함할 수 있다.
일 구체예에 있어서, 상기 제1 단량체를 코딩하는 폴리뉴클레오티드는 서열번호 45, 서열번호 46, 서열번호 47, 서열번호 52, 서열번호 53, 서열번호 55, 서열번호 56, 서열번호 57, 서열번호 66, 서열번호 67, 서열번호 68, 서열번호 73, 서열번호 74, 서열번호 76, 서열번호 77, 서열번호 78과 적어도 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99%, 또는 적어도 약 100%의 동일성을 가지는 것일 수 있다.
일 구체예에 있어서, 상기 제2 단량체의 폴리펩티드는 서열번호 1, 서열번호 2, 서열번호 6, 서열번호 7, 서열번호 8, 서열번호 9, 서열번호 12, 서열번호 21, 서열번호 22, 서열번호 23, 서열번호 27, 서열번호 28, 서열번호 29, 서열번호 30, 서열번호 33, 서열번호 42, 서열번호 274, 서열번호 275, 서열번호 280 또는 서열번호 281와 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99%, 또는 적어도 약 100%의 동일성을 가지는 아미노산 서열을 포함할 수 있다.
일 구체예에 있어서, 상기 제2 단량체를 코딩하는 폴리뉴클레오티드는 서열번호 43, 서열번호 44, 서열번호 48, 서열번호 49, 서열번호 50, 서열번호 51, 서열번호 54, 서열번호 63, 서열번호 64, 서열번호 65, 서열번호 69, 서열번호 70, 서열번호 71, 서열번호 72, 서열번호 75, 서열번호 84와 적어도 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99%, 또는 적어도 약 100%의 동일성을 가지는 것일 수 있다.
상기 폴리뉴클레오티드는 신호서열(Signal sequence) 또는 리더 서열(Leader sequence)을 코딩하는 핵산을 추가적으로 포함할 수 있다. 본 명세서에서 사용한 용어 "신호서열"은 목적 단백질의 분비를 지시하는 신호펩타이드를 의미한다. 상기 신호펩타이드는 숙주 세포에서 번역된 후에 절단된다. 구체적으로, 상기 신호서열은 ER(Endoplasmic reticulum) 막을 관통하는 단백질의 이동을 개시하는 아미노산 서열이다.
상기 신호서열은 당업계에 그 특징이 잘 알려져 있으며, 통상 16 내지 30개의 아미노산 잔기를 포함하나, 그보다 더 많거나 적은 아미노산 잔기를 포함할 수 있다. 통상적인 신호 펩타이드는 기본 N-말단 영역, 중심의 소수성 영역, 및 보다 극성인(polar) C-말단 영역의 세 영역으로 구성된다. 중심 소수성 영역은 미성숙 폴리펩타이드가 이동하는 동안 막지질 이중층을 통하여 신호서열을 고정시키는 4 내지 12개의 소수성 잔기를 포함한다.
개시 이후에, 신호서열은 흔히 신호 펩티다아제(Signal peptidase)로 알려진 세포 효소에 의하여 ER의 루멘(Lumen) 내에서 절단된다. 이때, 상기 신호서열은 tPa(Tissue Plasminogen Activation), HSV gDs(Signal sequence of Herpes simplex virus glycoprotein D), 또는 성장 호르몬(Growth hormone)의 분비신호서열일 수 있다. 바람직하게, 포유동물 등을 포함하는 고등 진핵 세포에서 사용되는 분비 신호서열을 사용할 수 있다. 또한, 상기 신호서열은 야생형 신호서열을 사용하거나, 숙주세포에서 발현 빈도가 높은 코돈으로 치환하여 사용할 수 있다.
폴리뉴클레오티드가 적재된 벡터
본 발명의 다른 측면은, 상기 폴리뉴클레오티드를 포함하는 벡터를 제공한다.
상기 벡터는 숙주 세포에 도입되어 숙주 세포 유전체 내로 재조합 및 삽입될 수 있다. 또는 상기 벡터는 에피좀으로서 자발적으로 복제될 수 있는 폴리뉴클레오티드 서열을 포함하는 핵산 수단으로 이해된다. 상기 벡터는 선형 핵산, 플라스미드, 파지미드, 코스미드, RNA 벡터, 바이러스 벡터 및 이의 유사체들을 포함한다. 바이러스 벡터의 예로는 레트로바이러스, 아데노바이러스, 및 아데노-관련 바이러스를 포함하나 이에 제한되지 않는다.
구체적으로, 상기 벡터는 플라스미드 DNA, 파아지 DNA 등이 될 수 있고, 상업적으로 개발된 플라스미드(pUC18, pBAD, pIDTSAMRT-AMP 등), 대장균 유래 플라스미드(pYG601BR322, pBR325, pUC118, pUC119 등), 바실러스 서브틸리스 유래 플라스미드(pUB110, pTP5 등), 효모-유래 플라스미드(YEp13, YEp24, YCp50 등), 파아지 DNA(Charon4A, Charon21A, EMBL3, EMBL4, λgt10, λgt11, λZAP 등), 동물 바이러스 벡터(레트로바이러스(Retrovirus), 아데노바이러스(Adenovirus), 백시니아 바이러스(Vaccinia virus) 등), 곤충 바이러스 벡터(배큘로바이러스(Baculovirus) 등)이 될 수 있다. 상기 벡터는 숙주 세포에 따라서 단백질의 발현량과 수식 등이 다르게 나타나므로, 목적에 가장 적합한 숙주세포를 선택하여 사용함이 바람직하다.
본 명세서에서 사용된 용어, 목적 단백질의 "유전자 발현" 또는 "발현"은, DNA 서열의 전사, mRNA 전사체의 번역 및 융합단백질 생산물 또는 이의 단편의 분비를 의미하는 것으로 이해된다. 유용한 발현 벡터는 RcCMV(Invitrogen, Carlsbad) 또는 이의 변이체일 수 있다. 상기 발현 벡터는 포유류 세포에서 목적 유전자의 연속적인 전사를 촉진하기 위한 인간 CMV(Cytomegalovirus) 프로모터, 및 전사 후 RNA의 안정상태 수준을 높이기 위한 우태 성장 인자(Bovine growth hormone) 폴리아데닐레이션 신호서열을 포함할 수 있다.
융합단백질을 발현하는 형질전환 세포
본 발명의 다른 측면은, 상기 벡터가 도입된 형질전환 세포를 제공한다.
상기 형질전환 세포의 숙주세포로서, 원핵세포, 진핵세포, 포유동물, 식물, 곤충, 균류 또는 세포성 기원의 세포를 포함할 수 있지만 이에 한정되지 않는다. 상기 원핵세포의 일 예로는 대장균을 사용할 수 있다. 또한, 진핵세포의 일 예로는 효모를 사용할 수 있다. 또한, 상기 포유동물 세포로 CHO 세포, F2N 세포, CSO 세포, BHK 세포, 바우스(Bowes) 흑색종 세포, HeLa 세포, 911 세포, AT1080 세포, A549 세포, HEK293 세포 또는 HEK293T 세포 등을 사용할 수 있으나, 이에 한정되지 않으며, 당업자에게 알려진 포유동물 숙주세포로 사용 가능한 세포는 모두 이용 가능하다.
또한, 숙주세포로 발현벡터를 도입하는 경우, CaCl2 침전법, CaCl2 침전법에 DMSO(Dimethyl sulfoxide)라는 환원물질을 사용함으로써 효율을 높인 Hanahan 방법, 전기천공법(Electroporation), 인산칼슘 침전법, 원형질 융합법, 실리콘 카바이드 섬유를 이용한 교반법, 아그로박테리아 매개된 형질전환법, PEG를 이용한 형질전환법, 덱스트란 설페이트, 리포펙타민 및 건조/억제 매개된 형질전환 방법 등이 사용될 수 있다.
전술한 바와 같이, 융합단백질의 치료제로서의 특성을 최적하거나 기타 다른 목적을 위해 호스트 세포가 갖고 있는 당화(Glycosylation) 관련 유전자를 당업자에게 알려져 있는 방법을 통해 조작하여 융합단백질의 당쇄 패턴(예를 들어, 시알산, 퓨코실화, 당화)을 조정할 수 있다.
융합단백질의 생산방법
본 발명의 다른 측면은, i) 상기 형질전환 세포를 배양하는 단계; 및 ii) 제1 단량체 및 제2 단량체를 포함하는 융합단백질을 회수하는 단계를 포함하는 융합단백질의 생산방법을 제공한다.
상기 형질전환 세포를 배양하는 방법은 당업계에 널리 알려져 있는 방법을 이용하여 수행할 수 있다. 구체적으로, 상기 배양은 배치 공정 또는 주입 배치 또는 반복 주입 배치 공정(Fed batch 또는 Repeated fed batch process)에서 연속식으로 배양할 수 있다.
융합단백질의 용도
본 발명의 다른 측면은, 상기 융합단백질을 유효성분으로 포함하는 암 예방 또는 치료용 약학 조성물을 제공한다.
이때, 상기 암은 위암, 간암, 폐암, 대장암, 유방암, 전립선암, 피부암, 골암, 다발성골수종, 신경교종, 난소암, 췌장암, 자궁경부암, 갑상선암, 후두암, 급성 골수성 백혈병, 만성 골수성 백혈병, 급성 림프모구성 백혈병, 만성 림프모구성 백혈병, 뇌종양, 신경모세포종, 망막 모세포종, 두경부암, 침샘암 및 림프종으로 구성된 군에서 선택되는 어느 하나일 수 있다.
상기 약학 조성물의 바람직한 투여량은 환자의 상태 및 체중, 질병의 정도, 약물형태, 투여경로 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있다. 본 발명의 종양 치료용 또는 예방용 약학 조성물에서 그 유효성분은 종양 치료 활성을 나타내거나, 특히, 암에 치료 효과를 나타낼 수 있는 한, 용도, 제형, 배합 목적 등에 따라 임의의 양(유효량)으로 포함될 수 있는데, 통상적인 유효량은 조성물 전체 중량을 기준으로 할 때 0.001 중량% 내지 20.0 중량% 범위 내에서 결정될 것이다. 여기서 "유효량"이란 질환의 상태 개선 또는 치료(treatment) 효과, 특히 암의 상태 개선 또는 치료 효과를 유도할 수 있는 유효성분의 양을 말한다. 이러한 유효량은 당업자의 통상의 능력 범위 내에서 실험적으로 결정될 수 있다.
본 명세서에서 사용된 용어, "치료"는 치료학적 처리 및 예방적 처리를 모두 포함하는 의미로 사용될 수 있다. 이때, 예방은 개체의 병리학적 상태 또는 질환을 완화시키거나 감소시키는 의미로 사용될 수 있다. 일 구체예에서, 용어 "치료"는 인간을 포함한 포유류에서 질환을 치료하기 위한 적용이나 어떠한 형태의 투약을 모두 포함한다. 또한, 상기 용어는 질환의 진행을 억제하거나 늦추는 것을 포함하며; 손상되거나, 결손된 기능을 회복시키거나, 수리하여, 질환을 부분적이거나 완전하게 완화시키거나; 또는 비효율적인 프로세스를 자극하거나; 심각한 질환을 완화하는 의미를 포함한다.
생체이용률과 같은 약동학적 파라미터(Pharmacokinetic parameters) 및 클리어런스율(clearance rate)과 같은 기본적인 파라미터(underlying parameters)도 효능에 영향을 줄 수 있다. 따라서, "향상된 효능" (예를 들어, 효능의 개선)은 향상된 약동학적 파라미터 및 향상된 효능에 기인할 수 있으며, 시험 동물 또는 인간 대상체에서 클리어런스율 및 종양 치료 또는 개선과 같은 파라미터를 비교하여 측정될 수 있다.
여기서 "치료학적으로 유효한 양" 또는 "약학적으로 유효한 양"이란 대상 질환을 예방 또는 치료하는데 유효한 화합물 또는 조성물의 양으로서, 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분하며 부작용을 일으키지 않을 정도의 양을 의미한다. 상기 유효량의 수준은 환자의 건강상태, 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 방법, 투여 시간, 투여 경로 및 배출 비율, 치료 기간, 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 일 구체예에서 치료학적으로 유효한 양은 암을 치료하는데 효과적인 약물의 양을 의미한다.
이때, 상기 약학 조성물은 약학적으로 허용 가능한 담체를 더 포함할 수 있다. 상기 약학적으로 허용 가능한 담체는 환자에게 전달하기에 적절한 비-독성 물질이면 어떠한 담체라도 가능하다. 증류수, 알코올, 지방, 왁스 및 비활성 고체가 담체로 포함될 수 있다. 약물학적으로 허용되는 애쥬번트(완충제, 분산제) 또한 약학 조성물에 포함될 수 있다.
구체적으로, 상기 약학 조성물은 유효성분 이외에 약제학적으로 허용되는 담체를 포함하여 당업계에 공지된 통상의 방법으로 투여 경로에 따라 비경구용 제형으로 제조될 수 있다. 여기서 "약제학적으로 허용되는" 의미는 유효성분의 활성을 억제하지 않으면서 적용(처방) 대상이 적응 가능한 이상의 독성을 지니지 않는다는 의미이다.
상기 약학 조성물이 비경구용 제형으로 제조될 경우, 적합한 담체와 함께 당업계에 공지된 방법에 따라 주사제, 경피 투여제, 비강 흡입제 및 좌제의 형태로 제제화될 수 있다. 주사제로 제제화할 경우 적합한 담체로서는 멸균수, 에탄올, 글리세롤이나 프로필렌 글리콜 등의 폴리올 또는 이들의 혼합물을 사용할 수 있으며, 바람직하게는 링거 용액, 트리에탄올 아민이 함유된 PBS(phosphate buffered saline)나 주사용 멸균수, 5% 덱스트로스 같은 등장 용액 등을 사용할 수 있다. 약제학적 조성물의 제제화와 관련하여서는 당업계에 공지되어 있으며, 구체적으로 문헌[Remington's Pharmaceutical Sciences(19th ed., 1995)] 등을 참조할 수 있다. 상기 문헌은 본 명세서의 일부로서 간주된다.
상기 약학 조성물의 바람직한 투여량은 환자의 상태, 체중, 성별, 연령, 환자의 중증도, 투여 경로에 따라 1일 0.01 ㎍/㎏ 내지 10 g/㎏ 범위, 또는 0.01 ㎎/㎏ 내지 1 g/㎏ 범위일 수 있다. 투여는 1일 1회 또는 수회로 나누어 이루어질 수 있다. 이러한 투여량은 어떠한 측면으로든 본원 발명의 범위를 제한하는 것으로 해석되어서는 아니 된다.
상기 약학 조성물이 적용(처방)될 수 있는 대상은 포유동물 및 인간이며, 특히 인간인 경우가 바람직하다. 본원의 약학 조성물은 유효성분 이외에, 종양 치료 효과를 갖는 것으로 공지된 임의의 화합물이나 천연 추출물을 추가로 포함할 수 있다.
본 발명의 다른 측면은, 암을 치료하기 위한 IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질의 용도를 제공한다.
본 발명의 다른 측면은, 암을 치료하기 위한 약을 제조하기 위한 IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질의 용도를 제공한다.
본 발명의 또 다른 측면은, IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질을 개체에 투여하는 단계를 포함하는 암을 치료 또는 예방하는 방법을 제공한다.
이때, 상기 개체는 암에 걸린 개체일 수 있다. 또한 상기 개체는 포유동물일 수 있으며, 바람직하게는 인간일 수 있다.
상기 융합단백질 또는 융합단백질 이량체의 투여경로, 투여량 및 투여횟수는 환자의 상태 및 부작용의 유무에 따라 다양한 방법 및 양으로 대상에게 투여될 수 있고, 최적의 투여방법, 투여량 및 투여횟수는 통상의 기술자가 적절한 범위로 선택할 수 있다. 또한, 상기 융합 단백질 또는 융합단백질 이량체는 치료하고자 하는 질환에 대하여 치료효과가 공지된 다른 약물 또는 생리학적 활성물질과 병용하여 투여되거나, 다른 약물과의 조합 제제 형태로 제형화될 수 있다.
이하, 본원 발명을 하기 실시예에 의하여 더욱 상세하게 설명한다. 단, 하기 실시예는 본원 발명을 예시하기 위한 것일 뿐, 본원 발명의 범위가 한정되는 것은 아니다.
준비예 1. anti-CD20/IL-12 IgG1 인간 버전 융합단백질의 개요
Code Format Description 해당서열
T2.01 K&H anti-hu CD20/hu IL-12, hu IgG1 seq1, seq2, seq3
T2.02 K&H anti-hu CD20/hu IL-12 mut1, hu IgG1 seq1, seq2, seq4
T2.03 K&H anti-hu CD20/hu IL-12 mut2, hu IgG1 seq1, seq2, seq5
T2.04 K&H anti-hu CD20/hu IL-12, hu IgG1 (2+1) seq3, seq6, seq7
T2.05 K&H anti-hu CD20/hu IL-12 mut2, hu IgG1 (2+1) seq5, seq6, seq7
T2.06 K&H anti-hu CD20/hu IL-12, hu IgG1 (2+1, HC scFv) seq2, seq3, seq8
T2.07 K&H anti-hu CD20/hu IL-12 mut2, hu IgG1 (2+1, HC scFv) seq2, seq5, seq8
T2.08 K&H anti-hu CD20/hu IL-12, hu IgG1 (2+1, LC scFv) seq1, seq3, seq9
T2.09 K&H anti-hu CD20/hu IL-12 mut2, hu IgG1 (2+1, LC scFv) seq1, seq5, seq9
T2.10 K&H anti-hu CD20/anti-hu CD20-hu IL-12, hu IgG1 (2+1) seq1, seq2, seq10
T2.11 K&H anti-hu CD20/anti-hu CD20-hu IL-12 mut2, hu IgG1 (2+1) seq1, seq2, seq11
T2.12 K&H anti-hu CD20/hu IL-12 mut1, hu IgG1 DANG seq2, seq12, seq14
T2.13 K&H null/hu IL-12, hu IgG1 DANG seq13, seq19
T2.14 K&H null/hu IL-12 mut1, hu IgG1 DANG seq14, seq19
T2.15 Fc-fusion hu IL-12 mut2, huIgG1 seq15
T2.16 K&H anti-hu FAP/hu IL-12 mut1, hu IgG1 seq4, seq16, seq17
T2.17 K&H anti-hu FAP/null, hu IgG1 DANG seq17, seq18, seq20
Rituximab Mab anti-hu CD20 (Rituximab) seq2, seq21
T2.18 K&H anti-hu CD20/hu IL-12-anti-hu CD20 scFv, hu IgG1 (2+1) seq1, seq2, seq272
T2.19 K&H anti-hu CD20/hu IL-12 mut2-anti-hu CD20 scFv, hu IgG1 (2+1) seq1, seq2, seq273
T2.20 Fc-fusion anti-hu CD20-hu IL-12, hu IgG1 seq2, seq274
T2.21 Fc-fusion anti-hu CD20-hu IL-12 mut2, hu IgG1 seq2, seq275
T2.22 Fc-fusion hu IL-12-anti-hu CD20 scFv, hu IgG1 Seq276
T2.23 Fc-fusion hu IL-12 mut2-anti-hu CD20 scFv, hu IgG1 Seq277
[seq1]은 인간 항-CD20(anti-CD20) 중쇄 가변영역 서열과 T366W 변이로 놉 구조를 형성한 인간 IgG1 Fc로 구성된다.
[seq2]는 인간 항-CD20(anti-CD20) 경쇄 서열로 구성된다.
[seq3]은 인간 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 인간 인터루킨 12 p35(알파) 영역 서열, 링커 GGGGSGGGGS와 T366S, L368A 및 Y407V 변이로 홀 구조를 형성한 인간 IgG1 Fc로 구성된다.
[seq4]는 인간 IL-12 p40(베타) 영역에서 헤파린 결합에 관여하는 아미노산 280번, 285번 라이신(K)을 알라닌(A)으로 변이한 서열, 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc hole로 구성된다.
[seq5]는 인간 IL-12 p40(베타) 영역에서 헤파린 결합에 관여하는 아미노산 280번, 282번, 285번, 286번 라이신(K)을 알라닌(A)으로 변이한 서열, 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc hole로 구성된다.
[seq6]은 인간 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGS, 인간 항-CD20(anti-CD20) 중쇄 가변영역 서열 및 인간 IgG1 Fc knob으로 구성된다.
[seq7]은 인간 항-CD20(anti-CD20) 경쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGS, 인간 항-CD20(anti-CD20) 경쇄 서열로 구성된다.
[seq8]은 인간 항-CD20(anti-CD20) 중쇄 가변영역 서열과 인간 IgG1 Fc knob, 링커 GGGGSGGGGSGGGGS, 인간 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
[seq9]는 인간 항-CD20(anti-CD20) 경쇄 서열, 링커 GGGGSGGGGSGGGGS, 인간 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
[seq10]은 인간 항-CD20(anti-CD20) 중쇄 서열과 인간 IgG1 Fc hole, 링커 GGGGSGGGGSGGGGS, 인간 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 인간 IL-12 p35(알파) 영역 서열로 구성된다.
[seq11]은 인간 항-CD20(anti-CD20) 중쇄 서열과 인간 IgG1 Fc hole, 링커 GGGGSGGGGSGGGGS, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 인간 IL-12 p35(알파) 영역 서열로 구성된다.
[seq12]는 인간 항-CD20(anti-CD20) 항체의 중쇄 서열 및 인간 IgG1 Fc knob DANG으로 구성된다.
[seq13]은 인간 IL-12 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc hole DANG으로 구성된다.
[seq14]는 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 인간 IL-12 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc hole DANG으로 구성된다.
[seq15]는 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 p40 (베타) 영역 서열, 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열 및 링커 GGGGSGGGGS과 인간 IgG1 Fc로 구성된다.
[seq16]은 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열 및 인간 IgG1 Fc knob으로 구성된다.
[seq17]은 인간 항-FAP(anti-FAP) 경쇄 서열로 구성된다.
[seq18]은 인간 항-FAP(anti-FAP) 중쇄 가변영역 서열 및 인간 IgG1 Fc knob DANG으로 구성된다.
[seq19]는 인간 IgG1 Fc knob DANG만으로 구성된다.
[seq20]은 인간 IgG1 Fc hole DANG만으로 구성된다.
[seq21]은 인간 항-CD20(anti-CD20) 항체 리툭시맙의 중쇄 서열이다.
[seq272]는 인간 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc hole, 링커 GGGGSGGGGSGGGGS, 인간 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
[seq273]은 헤파린 결합에 관여하는 아미노산 변이(4개)가 포함된 인간 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc hole, 링커 GGGGSGGGGSGGGGS, 인간 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
[seq274]는 인간 항-CD20(anti-CD20) 중쇄 서열과 인간 IgG1 Fc, 링커 GGGGSGGGGSGGGGS, 인간 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 인간 IL-12 p35(알파) 영역 서열로 구성된다.
[seq275]는 인간 항-CD20(anti-CD20) 중쇄 서열과 인간 IgG1 Fc, 링커 GGGGSGGGGSGGGGS, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 인간 IL-12 p35(알파) 영역 서열로 구성된다.
[seq276]은 인간 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc, 링커 GGGGSGGGGSGGGGS, 인간 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
[seq277]은 헤파린 결합에 관여하는 아미노산 변이(4개)가 포함된 인간 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 인간 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 인간 IgG1 Fc, 링커 GGGGSGGGGSGGGGS, 인간 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 인간 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
T2.01(seq1, seq2, seq3)은 단백질 CD20를 표적으로 하는 인간 항-CD20 서열 및 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.02(seq1, seq2, seq4)는 단백질 CD20를 표적으로 하는 인간 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.03(seq1, seq2, seq5)은 단백질 CD20를 표적으로 하는 인간 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.04(seq3, seq6, seq7)는 이중 가변 도메인 면역글로블린(dual variable domain Immunoglobulin, DVD-Ig) 형태의 인간 항-CD20 서열 및 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.05(seq5, seq6, seq7)는 이중 가변 도메인 면역글로블린(dual variable domain Immunoglobulin, DVD-Ig) 형태의 인간 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.06(seq2, seq3, seq8)은 중쇄의 C 말단에 단백질 CD20을 표적으로 하는 인간 항-CD20 서열의 단일쇄 가변영역 단편 (single chain fragment variable, scFv)이 연결된 인간 항-CD20 서열과 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.07(seq2, seq5, seq8)은 중쇄의 C 말단에 단백질 CD20을 표적으로 하는 인간 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 인간 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.08(seq1, seq3, seq9)은 경쇄의 C 말단에 단백질 CD20를 표적으로 하는 인간 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 인간 항-CD20 서열 및 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.09(seq1, seq5, seq9)는 경쇄의 C 말단에 단백질 CD20를 표적으로 하는 인간 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 인간 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.10(seq1, seq2, seq10)은 단백질 CD20을 표적으로 하는 인간 항-CD20 서열과 중쇄의 C말단에 인간 IL-12 서열이 연결된 인간 항-CD20 서열이 놉-인투-홀 구조를 이루는 항체이다.
T2.11(seq1, seq2, seq11)은 단백질 CD20을 표적으로 하는 인간 항-CD20 서열과 중쇄의 C말단에 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 연결된 인간 항-CD20 서열이 놉-인투-홀 구조를 이루는 항체이다.
T2.12(seq2, seq12, seq14)는 단백질 CD20를 표적으로 하는 인간 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 인간 IL-12 서열이 놉-인투-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T2.13(seq13, seq19)은 인간 IL-12 서열만을 갖는 놉-인투-홀 구조의 이펙터 기능이 제거된 항체이다.
T2.14(seq14, seq19)는 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 인간 IL-12 서열만을 갖는 놉-인투-홀 구조의 이펙터 기능이 제거된 항체이다.
T2.15(seq15)는 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열만을 갖는 Fc-퓨전-단백질이다.
T2.16(seq4, seq16, seq17)은 단백질 FAP을 표적으로 하는 인간 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.17(seq17, seq18, seq20)은 단백질 FAP을 표적으로 하는 인간 항-FAP 서열만을 갖는 놉-인투-홀 구조의 이펙터 기능이 제거된 항체이다.
Rituximab(seq2, seq21)은 단백질 CD20을 표적으로 하는 인간 항-CD20(리툭시맙) 항체이다.
T2.18(seq1, seq2, seq272)은 인간 항-CD20 서열과 C 말단에 인간 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.19(seq1, seq2, seq273)는 인간 항-CD20 중쇄 서열과 C 말단에 인간 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 채 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.20(seq2, seq274)은 중쇄의 C 말단에 인간 IL-12 서열이 연결된 인간 항-CD20 서열을 포함한 Fc-퓨전 단백질 이량체이다.
T2.21(seq2, seq275)은 중쇄의 C 말단에 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 인간 IL-12 서열이 연결된 인간 항-CD20 서열을 포함한 Fc-퓨전 단백질 이량체이다.
T2.22(seq276)는 C 말단에 인간 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 인간 IL-12 서열을 포함한 Fc-퓨전 단백질 이량체이다.
T2.23(seq277)은 C 말단에 인간 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 채 헤파린 결합에 관여하는 아미노산의 변이(4개)를 포함한 인간 IL-12 서열로 구성된 Fc-퓨전 단백질 이량체이다.
[seq1] anti-hu CD20 HC hu IgG1 Fc knob
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq2] anti-hu CD20 LC
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
[seq3] hu scIL-12-hu IgG1 Fc hole
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq4] hu scIL-12 mut1-hu IgG1 Fc hole
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGASKREAKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq5] hu scIL-12 mut2-hu IgG1 Fc hole
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGASAREAADRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq6] (anti-hu CD20 VH)2-hu IgG1 Fc knob
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAGGGGSGGGGSGGGGSQVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq7] (anti-hu CD20 VL)2
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKGGGGSGGGGSGGGGSQIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
[seq8] anti-hu CD20 HC hu IgG1 Fc knob-anti-hu CD20 scFv
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSQVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAGGGGSGGGGSGGGGSGGGGSQIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIK
[seq9] anti-hu CD20 LC-anti-hu CD20 scFv
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECGGGGSGGGGSGGGGSQVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAGGGGSGGGGSGGGGSGGGGSQIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIK
[seq10] anti-hu CD20 HC hu IgG1 Fc hole-hu scIL-12
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
[seq11] anti-hu CD20 HC hu IgG1 Fc hole-hu scIL-12 mut2
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGGGGSIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGASAREAADRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
[seq12] anti-hu CD20 HC hu IgG1 Fc knob DANG
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq13] hu scIL-12-hu IgG1 Fc hole DANG
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq14] hu scIL-12 mut1-hu IgG1 Fc hole DANG
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGASKREAKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq15] hu scIL-12 mut2-hu IgG1 Fc
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGASAREAADRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq16] anti-hu FAP HC IgG1 Fc knob
QVQLVQSGAEVKKPGASVKVSCKTSRYTFTEYTIHWVRQAPGQRLEWIGGINPNNGIPNYNQKFKGRVTITVDTSASTAYMELSSLRSEDTAVYYCARRRIAYGYDEGHAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq17] anti-hu FAP LC
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSRNQKNYLAWYQQKPGQPPKLLIFWASTRESGVPDRFSGSGFGTDFTLTISSLQAEDVAVYYCQQYFSYPLTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
[seq18] anti-hu FAP HC hu IgG1 Fc knob DANG
QVQLVQSGAEVKKPGASVKVSCKTSRYTFTEYTIHWVRQAPGQRLEWIGGINPNNGIPNYNQKFKGRVTITVDTSASTAYMELSSLRSEDTAVYYCARRRIAYGYDEGHAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq19] hu IgG1 Fc knob DANG
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq20] hu IgG1 Fc hole DANG
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[seq21] anti-hu CD20 (Rituximab) HC
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Figure PCTKR2021010611-appb-I000001
Figure PCTKR2021010611-appb-I000002
Figure PCTKR2021010611-appb-I000003
Figure PCTKR2021010611-appb-I000004
Figure PCTKR2021010611-appb-I000005
Figure PCTKR2021010611-appb-I000006
준비예 2. anti-CD20/IL-12 IgG2a, mouse version 융합단백질의 개요
PROTEIN Format Description 해당서열
T2.01m K&H anti-mu CD20/mu IL-12, mu IgG2a seq22, seq23, seq24
T2.02m K&H anti-mu CD20/mu IL-12 mut1, mu IgG2a seq22, seq23, seq25
T2.03m K&H anti-mu CD20/mu IL-12 mut2, mu IgG2a seq22, seq23, seq26
T2.04m K&H anti-mu CD20/mu IL-12, mu IgG2a (2+1) seq24, seq27, seq28
T2.05m K&H anti-mu CD20/mu IL-12 mut2, mu IgG2a (2+1) seq26, seq27, seq28
T2.06m K&H anti-mu CD20/mu IL-12, mu IgG2a (2+1, HC scFv) seq23, seq24, seq29
T2.07m K&H anti-mu CD20/mu IL-12 mut2, mu IgG2a (2+1, HC scFv) seq23, seq26, seq29
T2.08m K&H anti-mu CD20/mu IL-12, mu IgG2a (2+1, LC scFv) seq22, seq24, seq30
T2.09m K&H anti-mu CD20/mu IL-12 mut2, mu IgG2a (2+1, LC scFv) seq22, seq26, seq30
T2.10m K&H anti-mu CD20/anti-mu CD20-mu IL-12, mu IgG2a (2+1) seq22, seq23, seq31
T2.11m K&H anti-mu CD20/anti-mu CD20-mu IL-12 mut2, mu IgG2a (2+1) seq22, seq23, seq32
T2.12m K&H anti-mu CD20/mu IL-12 mut1, mu IgG2a DANG seq23, seq33, seq35
T2.13m K&H null/mu IL-12, mu IgG2a DANG seq34, seq40
T2.14m K&H null/mu IL-12 mut1, mu IgG2a DANG seq35, seq40
T2.15m Fc-fusion mu IL-12 mut2, mu IgG2a seq36
T2.16m K&H anti-mu FAP/mu IL-12 mut1, mu IgG2a seq25, seq37, seq38
T2.17m K&H anti-mu FAP/null, mu IgG2a DANG seq38, seq39, seq41
18B12 Mab anti-mu CD20 (18B12) seq23, seq42
T2.18m K&H anti-mu CD20/mu IL-12-anti-mu CD20 scFv, mu IgG2a (2+1) seq22, seq23, seq278
T2.19m K&H anti-mu CD20/mu IL-12 mut2-anti-mu CD20 scFv, mu IgG2a (2+1) seq22, seq23, seq279
T1.20m Fc-fusion anti-mu CD20-mu IL-12, mu IgG2a seq23, seq280
T1.21m Fc-fusion anti-mu CD20-mu IL-12 mut2, mu IgG2a seq23, seq281
T1.22m Fc-fusion mu IL-12-anti-mu CD20 scFv, mu IgG2a seq282
T1.23m Fc-fusion mu IL-12 mut2-anti-mu CD20 scFv, mu IgG2a seq283
[seq22]는 마우스 항-CD20(anti-CD20) 항체 중쇄 서열에 T321W 변이를 통해 놉 구조를 형성한 마우스 IgG2a Fc로 구성된다.
[seq23]은 마우스 항-CD20(anti-CD20) 항체 18B12의 경쇄 서열로 구성된다.
[seq24]는 마우스 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35 (알파) 영역 서열, 링커 GGGGSGGGGS 및 T321S, M323A, Y362V 변이를 통해 홀 구조를 형성한 마우스 IgG2a Fc로 구성된다.
[seq25]는 마우스 IL-12 p40(베타) 영역에서 헤파린 결합에 관여하는 아미노산 277번, 282번 라이신(K)을 알라닌(A)으로 변이한 서열, 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc hole로 구성된다.
[seq26]은 마우스 IL-12 p40(베타) 영역에서 헤파린 결합에 관여하는 아미노산 276번 알지닌(R)을 알라닌(A)으로, 277번, 278번, 282번 라이신(K)을 알라닌(A)으로 변이한 서열, 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35 (알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc hole로 구성된다.
[seq27]은 마우스 항-CD20(anti-CD20) 중쇄 가변영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 항-CD20(anti-CD20) 중쇄 가변영역 서열 및 마우스 IgG2a Fc knob으로 구성된다.
[seq28]은 마우스 항-CD20(anti-CD20) 경쇄 가변영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 항-CD20(anti-CD20) 경쇄 서열로 구성된다.
[seq29]는 마우스 항-CD20(anti-CD20) 중쇄 가변영역 서열과 마우스 IgG2a Fc knob, 링커 GGGGSGGGGSGGGGS, 마우스 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
[seq30]은 마우스 항-CD20(anti-CD20) 경쇄 서열과 링커 GGGGSGGGGSGGGGS, 마우스 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
[seq31]은 마우스 항-CD20(anti-CD20) 중쇄 가변영역 서열과 마우스 IgG2a Fc hole, 링커 GGGGSGGGGSGGGGS, 마우스 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 마우스 IL-12 p35(알파) 영역 서열로 구성된다.
[seq32]는 마우스 항-CD20(anti-CD20) 중쇄 가변영역 서열과 마우스 IgG2a Fc hole, 링커 GGGGSGGGGSGGGGS, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 마우스 IL-12 p35(알파) 영역 서열로 구성된다.
[seq33]은 마우스 항-CD20(anti-CD20) 항체의 중쇄 가변영역 서열과 마우스 IgG2a Fc knob DANG으로 구성된다.
[seq34]는 마우스 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35 (알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc hole DANG으로 구성된다.
[seq35]는 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 마우스 IL-12 p40 (베타) 영역 서열, 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc hole DANG으로 구성된다.
[seq36]은 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열 및 링커 GGGGSGGGGS과 마우스 IgG2a Fc로 구성된다.
[seq37]은 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열 및 마우스 IgG2a Fc knob으로 구성된다.
[seq38]은 마우스 항-FAP(anti-FAP) 경쇄 서열로 구성된다.
[seq39]는 마우스 항-FAP(anti-FAP) 중쇄 가변영역 서열 및 마우스 IgG2a Fc knob DANG으로 구성된다.
[seq40]은 마우스 IgG2a Fc knob DANG만으로 구성된다.
[seq41]은 마우스 IgG2a Fc hole DANG만으로 구성된다.
[seq42]는 마우스 항-CD20(anti-CD20) 항체 18B12의 중쇄 서열이다.
[seq278]은 마우스 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc hole, 링커 GGGGSGGGGSGGGGS, 마우스 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
[seq279]는 헤파린 결합에 관여하는 아미노산 변이(4개)가 포함된 마우스 IL-12 p40(베타) 영역 서열 과 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc hole, 링커 GGGGSGGGGSGGGGS, 마우스 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
[seq280]은 마우스 항-CD20(anti-CD20) 중쇄 서열과 마우스 IgG2a Fc, 링커 GGGGSGGGGSGGGGS, 마우스 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 마우스 IL-12 p35(알파) 영역 서열로 구성된다.
[seq281]은 마우스 항-CD20(anti-CD20) 중쇄 서열과 마우스 IgG2a Fc, 링커 GGGGSGGGGSGGGGS, 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12의 p40(베타) 영역 서열, 링커 GGGGSGGGGSGGGGS 및 마우스 IL-12 p35(알파) 영역 서열로 구성된다.
[seq282]는 마우스 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc, 링커 GGGGSGGGGSGGGGS, 마우스 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
[seq283]은 헤파린 결합에 관여하는 아미노산 변이(4개)가 포함된 마우스 IL-12 p40(베타) 영역 서열과 링커 GGGGSGGGGSGGGGS, 마우스 IL-12 p35(알파) 영역 서열, 링커 GGGGSGGGGS 및 마우스 IgG2a Fc, 링커 GGGGSGGGGSGGGGS, 마우스 항-CD20(anti-CD20) 중쇄 가변영역 서열, 링커 GGGGSGGGGSGGGGSGGGGS 및 마우스 항-CD20(anti-CD20) 경쇄 가변영역 서열로 구성된다.
T2.01m(seq22, seq23, seq24)은 단백질 CD20를 표적으로 하는 마우스 항-CD20 서열 및 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.02m(seq22, seq23, seq25)은 단백질 CD20를 표적으로 하는 마우스 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.03m(seq22, seq23, seq26)은 단백질 CD20를 표적으로 하는 마우스 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.04m(seq24, seq27, seq28)은 이중 가변 도메인 면역글로블린(dual variable domain Immunoglobulin, DVD-Ig) 형태의 마우스 항-CD20 서열과 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.05m(seq26, seq27, seq28)은 이중 가변 도메인 면역글로블린(dual variable domain Immunoglobulin, DVD-Ig) 형태의 마우스 항-CD20 서열 및 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.06m(seq23, seq24, seq29)은 중쇄의 C 말단에 단백질 CD20를 표적으로 하는 마우스 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 마우스 항-CD20 서열 및 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.07m(seq23, seq26, seq29)은 중쇄의 C 말단에 단백질 CD20를 표적으로 하는 마우스 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 마우스 항-CD20 서열 및 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.08m(seq22, seq24, seq30)은 경쇄의 C 말단에 단백질 CD20를 표적으로 하는 마우스 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 마우스 항-CD20 서열 및 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.09m(seq22, seq26, seq30)은 경쇄의 C 말단에 단백질 CD20를 표적으로 하는 마우스 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 마우스 항-CD20 서열과 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.10m(seq22, seq23, seq31)은 단백질 CD20를 표적으로 하는 마우스 항-CD20 서열과 중쇄의 C말단에 마우스 IL-12 서열이 연결된 마우스 항-CD20 서열이 놉-인투-홀 구조를 이루는 항체이다.
T2.11m(seq22, seq23, seq32)은 단백질 CD20를 표적으로 하는 마우스 항-CD20 서열과 중쇄의 C말단에 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 연결된 마우스 항-CD20 서열이 놉-인투-홀 구조를 이루는 항체이다.
T2.12m(seq23, seq33, seq35)은 단백질 CD20를 표적으로 하는 마우스 항-CD20 서열 및 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 마우스 IL-12 서열이 놉-인투-홀 구조를 이루며, 이펙터 기능이 제거된 이중 항체이다.
T2.13m(seq34, seq40)은 마우스 IL-12 서열만을 갖는 놉-인투-홀 구조의 이펙터 기능이 제거된 항체이다.
T2.14m(seq35, seq40)은 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 마우스 IL-12 서열만을 갖는 놉-인투-홀 구조의 이펙터 기능이 제거된 항체이다.
T2.15m(seq36)은 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열만을 갖는 Fc-퓨전 단백질이다.
T2.16m(seq25, seq37, seq38)은 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열과 헤파린 결합에 관여하는 아미노산의 변이(2개)가 포함된 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.17m(seq38, seq39, seq41)은 단백질 FAP을 표적으로 하는 마우스 항-FAP 서열만을 갖는 놉-인투-홀 구조의 이펙터 기능이 제거된 항체이다.
18B12(seq23, seq42)은 단백질 CD20를 표적으로 하는 마우스 항-CD20(18B12) 항체이다.
T2.18m(seq22, seq23, seq278)은 마우스 항-CD20 서열과 C 말단에 마우스 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.19m(seq22, seq23, seq279)은 마우스 항-CD20 중쇄 서열과 C 말단에 마우스 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 채 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 놉-인투-홀 구조를 이루는 이중 항체이다.
T2.20m(seq23, seq280)은 중쇄의 C 말단에 마우스 IL-12 서열이 연결된 마우스 항-CD20 서열을 포함한 Fc-퓨전 단백질 이량체이다.
T2.21m(seq23, seq281)은 중쇄의 C 말단에 헤파린 결합에 관여하는 아미노산의 변이(4개)가 포함된 마우스 IL-12 서열이 연결된 마우스 항-CD20 서열을 포함한 Fc-퓨전 단백질 이량체이다.
T2.22m(seq282)은 C 말단에 마우스 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 마우스 IL-12 서열을 포함한 Fc-퓨전 단백질 이량체이다.
T2.23m(seq283)은 C 말단에 마우스 항-CD20 서열의 단일쇄 가변영역 단편(single chain fragment variable, scFv)이 연결된 채 헤파린 결합에 관여하는 아미노산의 변이(4개)를 포함한 마우스 IL-12 서열로 구성된 Fc-퓨전 단백질 이량체이다.
[seq22] anti-mu CD20 HC mu IgG2a Fc knob
QVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGVIDPSDNYTKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAREGYYGSSPWFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLWCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq23] anti-mu CD20 LC
QIVMSQSPAILSASPGEKVTMTCRARSSVSYIHWYQQKPGSSPKPWIYATSNLASGVPGRFSGSGSGTSYSLTITRVEAEDAATYYCQQWSSKPPTFGGGTKLEIKRTDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
[seq24] mu scIL-12-mu IgG2a Fc hole
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGGGGSGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAGGGGSGGGGSEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMVSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq25] mu scIL-12 mut1-mu IgG2a Fc hole
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRAKEKMAETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGGGGSGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAGGGGSGGGGSEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMVSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq26] mu scIL-12 mut2-mu IgG2a Fc hole
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQAAAEKMAETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGGGGSGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAGGGGSGGGGSEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMVSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq27] (anti-mu CD20 VH)2-mu IgG2a Fc knob
QVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGVIDPSDNYTKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAREGYYGSSPWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSQVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGVIDPSDNYTKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAREGYYGSSPWFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLWCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq28] (anti-mu CD20 VL)2
QIVMSQSPAILSASPGEKVTMTCRARSSVSYIHWYQQKPGSSPKPWIYATSNLASGVPGRFSGSGSGTSYSLTITRVEAEDAATYYCQQWSSKPPTFGGGTKLEIKGGGGSGGGGSGGGGSQIVMSQSPAILSASPGEKVTMTCRARSSVSYIHWYQQKPGSSPKPWIYATSNLASGVPGRFSGSGSGTSYSLTITRVEAEDAATYYCQQWSSKPPTFGGGTKLEIKRTDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
[seq29] anti-mu CD20 HC mu IgG2a Fc knob-anti-mu CD20 scFv
QVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGVIDPSDNYTKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAREGYYGSSPWFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLWCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKGGGGSGGGGSGGGGSQVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGVIDPSDNYTKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAREGYYGSSPWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSQIVMSQSPAILSASPGEKVTMTCRARSSVSYIHWYQQKPGSSPKPWIYATSNLASGVPGRFSGSGSGTSYSLTITRVEAEDAATYYCQQWSSKPPTFGGGTKLEIK
[seq30] anti-mu CD20 LC-anti-mu CD20 scFv
QIVMSQSPAILSASPGEKVTMTCRARSSVSYIHWYQQKPGSSPKPWIYATSNLASGVPGRFSGSGSGTSYSLTITRVEAEDAATYYCQQWSSKPPTFGGGTKLEIKRTDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSGGGGSGGGGSQVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGVIDPSDNYTKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAREGYYGSSPWFAYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSQIVMSQSPAILSASPGEKVTMTCRARSSVSYIHWYQQKPGSSPKPWIYATSNLASGVPGRFSGSGSGTSYSLTITRVEAEDAATYYCQQWSSKPPTFGGGTKLEIK
[seq31] anti-mu CD20 HC mu IgG2a Fc hole-mu scIL-12
QVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGVIDPSDNYTKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAREGYYGSSPWFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMVSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKGGGGSGGGGSGGGGSMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGGGGSGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
[seq32] anti-mu CD20 HC mu IgG2a Fc hole-mu scIL-12 mut2
QVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGVIDPSDNYTKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAREGYYGSSPWFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMVSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKGGGGSGGGGSGGGGSMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQAAAEKMAETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGGGGSGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
[seq33] anti-mu CD20 HC mu IgG2a Fc knob DANG
QVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGVIDPSDNYTKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAREGYYGSSPWFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLWCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq34] mu scIL-12-mu IgG2a Fc hole DANG
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGGGGSGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAGGGGSGGGGSEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMVSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq35] mu scIL-12 mut1-mu IgG2a Fc hole DANG
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRAKEKMAETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGGGGSGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAGGGGSGGGGSEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMVSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq36] mu scIL-12 mut2-mu IgG2a Fc
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQAAAEKMAETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGGGGSGGGGSGGGGSRVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAGGGGSGGGGSEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq37] anti-mu FAP HC mu IgG2a Fc knob
QVQLQQSGAELARPGASVNLSCKASGYTFTNNGINWLKQRTGQGLEWIGEIYPRSTNTLYNEKFKGKATLTADRSSNTAYMELRSLTSEDSAVYFCARTLTAPFAFWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLWCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq38] anti-mu FAP LC
QIVLTQSPAIMSASPGEKVTMTCSASSGVNFMHWYQQKSGTSPKRWIFDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSFNPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
[seq39] anti-mu FAP HC mu IgG2a Fc knob DANG
QVQLQQSGAELARPGASVNLSCKASGYTFTNNGINWLKQRTGQGLEWIGEIYPRSTNTLYNEKFKGKATLTADRSSNTAYMELRSLTSEDSAVYFCARTLTAPFAFWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLWCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq40] mu IgG2a Fc knob DANG
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLWCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq41] mu IgG2a Fc hole DANG
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLSCAVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMVSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[seq42] anti-mu CD20 (18B12) HC
QVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGVIDPSDNYTKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAREGYYGSSPWFAYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
Figure PCTKR2021010611-appb-I000007
Figure PCTKR2021010611-appb-I000008
Figure PCTKR2021010611-appb-I000009
Figure PCTKR2021010611-appb-I000010
Figure PCTKR2021010611-appb-I000011
Figure PCTKR2021010611-appb-I000012
제조예 1. 융합단백질의 제조
하기 표 3 및 표 4에 시약 및 장비를 기재하였다.
시약 제조사 Catalog#
pTT5 chempartner
In-Fusion HD cloning kit Clontech 639648
Accuprime pfx DNA polymerase Invitrogen 12344-04
Gel DNA fragment purication Kit TaKaRa D823A
FastDigest®BamHI Fermentas FD0055
FastDigest®EcoRI Fermentas FD0275
장비 및 도구 제조사 모델명
생물 안전 작업대 NUAIRE LabGard class ±
원심분리기 Eppendorf 5424
젤 이미징 시스템 Tanon 2500R
PCR을 통해 합성한 DNA 단편을 증폭시키고, 젤로 PCR 생성물을 정제하였다. 제한효소 EcoRI와 BamHI로 pTT5 벡터를 자르고 난 후 젤을 정제하였다. In-Fusion 키트를 이용해 각각의 PCR 생성물과 선형 벡터를 연결하였다. 생성된 벡터를 ECOS101 DH5α competent cell에 형질전환 시키고, 100 ㎍/㎖ 엠피실린을 함유하는 2xYT 한천 판에 배양하였다. 모든 조작 과정은 표준 형질 전환 프로토콜을 따라 수행하였다. 콜로니 PCR로 양성 재조합체를 확인하고, 재조합 플라스미드를 sequence-verify sequencing을 수행하였다. 단일 콜로니를 선택하여 100 ㎍/㎖ 엠피실린을 함유하는 5 ㎖ 2xYT 배지에 종균을 접종하였다. 37℃에서 8시간 동안 흔들면서 배양하였다.
이후, 종균을 1:1,000의 비율로 200 ㎖의 선택적 2xYT 배지에 희석하였다. 37℃에서 16시간 동안 흔들면서 배양하였다. 4℃, 4,700 rpm에서 10분 동안 원심 분리하여 박테리아 세포를 수확하였다. 12 ㎖의 RES-EF 용액에 박테리아 펠릿을 재부유 시켰다. 그 후, 12 ㎖의 LYS-EF 용액을 첨가하고, 밀봉한 튜브를 힘차게 뒤집어 완전히 혼합한 뒤, 실온에서 5분간 배양하였다. 12 ㎖의 NEU-EF 용액을 용해물에 첨가하고, 힘차게 뒤집어 빠르게 완전히 혼합하였다.
NucleoBond® Xtra 컬럼 필터에 용해물을 주입하기 전, 필터의 막힘을 방지하기 위해 용해물 튜브를 3번 정도 뒤집어 침전물의 균질한 현탁을 제조하였다. 그 후, 10 ㎖의 필터 세척 용액 FIL-EF로 NucleoBond® Xtra 컬럼 필터와 NucleoBond® Xtra 컬럼을 세척하였다. NucleoBond® Xtra 컬럼 필터를 빼내거나 컬럼을 거꾸로 뒤집어 제거하였다. 90 ㎖의 세척 용액 ENDO로 NucleoBond® Xtra 컬럼을 세척하였다.
45 ㎖의 세척 용액 WASH-EF로 NucleoBond® Xtra 컬럼을 세척하였다. 15 ㎖의 용출 용액 ELU로 플라스미드 DNA를 용출시켰다. 용출액은 50 ㎖ 원심분리 튜브에 수집하였다. 10.5 ㎖의 상온 이소프로판올을 첨가하여 용출된 플라스미드 DNA를 침전시켰다. Vortex 후, 혼합물을 2분간 그대로 방치하였다.
그 후, 5 ㎖의 70% 에탄올을 펠릿에 첨가하였다. 파이펫 팁을 이용해 튜브에서 에탄올을 조심스럽게 완전히 제거하였다. 펠릿을 상온(20℃)에서 건조시켰다. 그 후, DNA 펠릿을 1,000 ㎕의 H2O로 용해시켰다.
제조예 2. 세포 형질 주입과 단백질 발현
제조예 2.1. 세포 형질 주입
하기 표 5에 사용한 재료 및 시약 기재하였다.
재료 및 시약 제조사 (Product #)
293F cells Invitrogen (R790-07)
OPM 293 OPM (81075-001)
Pluronic®F-68, 10% (100X) Gibco (24040-032)
1 ㎎/㎖ PEI Polyscience (23966)
OPTI MEM I Gibco (31985088)
Peptone (20x) FLUKA(P0521-1KG)
셰이커 플라스크
ISF1-X 배양기 셰이커 Kuhner shaker
Complete 배지를 넣은 293F seed strain을 130 rpm, 37℃, 8% CO2의 배양기 셰이커에서 유지하였다. 0.3 내지 0.4 x 106 cell/㎖의 밀도로 배양하고, 매 2 내지 3일마다 배지를 교환하였다. 형질 주입 24시간 전, 새로운 계대수의 293F 세포를 2.6 x 106 cell/㎖로 준비하였다. 준비한 세포는 130 rpm, 37℃, 8% CO2의 배양기 셰이커에서 배양하였다. 형질 주입 당일, 새로운 배지를 사용하여 5.0 x 106 cells/㎖의 밀도로 세포를 조정하였다. 3 L 셰이커 플라스크에서 1 L의 총 부피로 수행하였다. 0.4 ㎎ HC 및 0.6 ㎎ LC 플라스미드를 50 ㎖ OPTI MEM I으로 희석하고, 0.22 ㎛ 필터로 여과하였다. 그 후, 2 ㎎ PEI를 50 ㎖ OPTI MEM I으로 희석하여 형질 주입 시약을 준비하였다.
희석된 PEI를 DNA 혼합물에 첨가한 뒤, 즉시 혼합하였다. 이후 15분간 상온에서 배양하였다. 2.6 x 106 cell/㎖로 준비한 293F 세포에 DNA-PEI 혼합물을 첨가하였다. 이후, 세포는 130 rpm, 37℃, 8% CO2의 배양기 셰이커에서 24시간 동안 계속 배양하였다. 형질 주입 24시간 후, 최종 농도가 0.5%가 되도록 배양액의 1/20에 10% 펩톤을 첨가하였다. 이후 세포는 130 rpm, 37℃, 8% CO2의 배양기 셰이커에서 계속 배양하였다. 형질 주입 후 2 내지 5일 기간에는 매일 세포 밀도/생존 능력을 측정하고 기록하였다. 형질 주입 7일 후 혹은 세포 생존 능력이 70% 미만에서 정제를 위해 세포를 수확하였다.
제조예 2.2. 단백질 정제
하기 표 6 내지 표 8에 단백질 정제를 위해 사용한 시약, 용액의 구성 및 장비를 기술하였다.
시약 제조사 Catalog#
Mabselect SuRe GE Healthcare 11003493
Tris SIGMA 77-86-1
NaCl ACROS ORGANIVS 7647-14-5
Sodium citrate Adamas-beta 76198B
Citric acid GENERAL-Reagent G83162B
Arginine VETEC V900343-500G
Succinic acid Sigma-Aldrich S9512-500G
Triton X-100 ABCONE X10010-1L
TRITON X-114 SIGMA-ALDRICH X114
Millex-GP Filter Unit 0.22 μm Sterile MILLIPORE SLGP033RS
NaOH Merck B146369740
용액 A 25 mM Tris, 150 mM NaCl, pH 8.0
용액 B 25 mM Tris, 150 mM NaCl,0.1% Triton X-100, 0.1% Triton X-114 pH 8.0
용액 C 100 mM Sodium Citrate, 150 mM NaCl, pH 3.0
용액 D 1 M Arginine, 400 mM Succinic acid, pH 9.0
용액 E 20 mM PB pH 6.5, 1 M (NH4)2SO4
용액 F 20 mM PB pH 6.5, 25% isopropyl alcohol
최종용액 20 mM HEPES, pH 7.5, 240 mM sucrose 혹은 20 mM his acetate pH 5.5, 240 mM sucrose
기기 제조사 모델명
AKTA Pure GE Healthcare 29-0182-24
원심분리기 Beckman J-26xp
젤 이미징 시스템 Tanon 2500R
Sartopore 2 filter Sartorius 5445307H9-OO-A
Mabselect sure 컬럼을 통한 단백질을 정제하였다. 구체적으로, 2,000 x g, 4℃에서 20분간 원심 분리하여 상층액을 수확하였다. 그 후, Sartopore 2 필터로 상층액을 여과하였다. 용액 A로 평형화된 5 ㎖ MabSelect Sure 컬럼에 정화된 상층액을 로딩하였다. 그 후, A280 흡광도가 기준치에 도달할 때까지 용액 A로 컬럼을 세척하였다. 10 CV 용액 B로 컬럼을 세척하였다. 10 CV 용액 A로 컬럼을 세척하였다. 6 CV 용액 C로 결합된 단백질을 용출하고, 1/6 부피의 용액 D를 넣어 용출한 물질을 중화하였다. SDS-PAGE와 SEC-HPLC 분석을 진행하였다.
그 후, HIC 컬럼을 이용해 단백질을 정제하였다. 그 후, 밤새 4℃에서 용액 E에 대해 단백질을 투석하였다. 용액 E로 평형화된 HIC 컬럼에 상층액을 로딩하였다. 그 후, A280 흡광도가 기준치에 도달할 때까지 용액 E로 컬럼을 세척하였다. 기울기 용리(10 CV 용액 F 0%-40%)로 결합된 단백질을 용출하였다. 2 CV 100% 용액 F로 결합된 단백질을 용출하였다. SDS-PAGE 분석을 진행하였다.
정제된 단백질들을 한 군데로 모아준 후, 밤새 4℃에서 최종 용액에 대해 단백질을 투석하였다. 그 후, SDS-PAGE와 SEC-HPLC 분석을 수행하였다.
그 결과, 도 1 내지 도 6에 나타낸 것과 같이, 일 실시예의 융합 단백질이 정제되었음을 확인하였다.
제조예 3. 이중 항체 생산량 개선
제조예 3.1. 인간 IL-12를 포함하는 융합단백질 생산량 개선 변화 확인
하기 표 9에는 인간 IL-12 변이에 따른 인간 항-CD20/IL-12 이중 항체 생산량의 변화를 나타내었다. 괄호는 단백질의 생산 규모를 의미하며, 단위는 L이다. 괄호 앞의 숫자는 정제된 단백질의 양을 생산규모로 나누어 얻은 1L 당 생산량이다.
PROTEIN Description Protein A column을 거친 후 단백질의 양 (mg)(생산 규모, L)
T2.01 anti-hu CD20/hu IL-12, hu IgG1 208 (1)
T2.02 anti-hu CD20/hu IL-12 mut1, hu IgG1 234 (1)
T2.03 anti-hu CD20/hu IL-12 mut2, hu IgG1 315 (1)
상기 표 9에 나타낸 것과 같이, 인간 IL-12 p40(베타) 영역에서 헤파린 결합에 관여하는 아미노산의 변이 개수를 증가시킴에 따라 Protein A 컬럼 (MabSelect Sure 컬럼)을 통한 정제된 단백질의 양이 향상되었다. 아미노산 280번, 285번의 라이신(K)을 알라닌(A)으로 변이한 이중 항체 T2.02는 T2.01과 비교하여 생산량이 개선되었음을 확인하였다. 아미노산 280번, 282번, 285번, 286번의 라이신(K)을 알라닌(A)으로 변이한 이중항체 T2.03은 T2.01과 비교하여 생산량이 약 1.5배 개선되었음을 확인하였다.
제조예 3.2. 마우스 IL-12를 포함하는 융합단백질 생산량 개선 변화 확인
하기 표 10에는 마우스 IL-12 변이에 따른 마우스 항-CD20/IL-12 이중 항체 생산량의 변화를 나타내었다.
PROTEIN Description Protein A column을 거친 후 단백질의 양 (mg)(생산 규모, L)
T2.01m anti-mu CD20/mu IL-12, mu IgG2a 17.1 (1), 36.9 (3), 21.7 (7.5)
T2.02m anti-mu CD20/mu IL-12 mut1, mu IgG2a 18.9 (1), 40.067 (3)
T2.03m anti-mu CD20/mu IL-12 mut2, mu IgG2a 32.8 (1), 114.4 (1), 96.7 (8)
상기 표 10에 나타낸 것과 같이, 마우스 IL-12 p40(베타) 영역에서 헤파린 결합에 관여하는 아미노산의 변이 개수를 증가시킴에 따라 Protein A 컬럼 (MabSelect Sure 컬럼)을 통해 정제하여 얻은 단백질의 양이 증가되었다.
각 표에서 Protein A 컬럼을 거친 후 단백질의 양은 총 단백질 생산량을 생산규모로 나누어 비교하였다. 아미노산 277번, 282번 라이신(K)을 알라닌(A)으로 변이한 이중 항체 T2.02m은 T2.01m과 비교하였을 때, 생산량이 개선되었음을 확인하였다. 또한, 아미노산 276번 알지닌(R)을 알라닌(A)으로, 277번, 278번, 282번 라이신(K)을 알라닌(A)으로 변이한 이중 항체 T2.03m은 T2.01m 및 T2.02m과 비교하여 단백질 생산량이 개선되었음을 확인하였다. 이와 함께, CHO 세포주를 이용한 T2.03m의 생산은 HEK293 세포주를 이용한 생산량과 비교하여 약 3배 개선됨을 확인하였다.
제조예 4. 세포주 및 세포주 배양
인간 B-세포 림포마 세포주 Raji, 인간 B-세포 림포마 세포주 Ramos, 인간 T-계열 세포주 Jurkat, 마우스 B-세포 림포마 세포주 A20은 ATCC(American Type Culture Collection, Manassas, VA, USA)로부터 공급받아 사용하였다. Raji, Ramos 및 Jurkat 세포는 10% FBS(GIBCO)를 포함하는 RPMI-1640(GIBCO, Grand Island, NY, USA)에서 유지되었다. A20 세포는 10% FBS(GIBCO), 0.05 mM 2-메르캅토에탄올(2-Mercaptoethanol)을 포함하는 RPMI-1640(GIBCO)에서 유지되었다.
인간 배아 신장 섬유아세포(Human embryonic kidney fibroblast)인 HEK293 세포에 IL-12 수용체 유전자와 STAT4 유도적인 SEAP 리포터 유전자를 형질전환 시킨 HEK-Blue IL-12 세포주는 Invivogen(San Diego, USA)로부터 공급받아 사용하였다.
HEK-Blue IL-12 세포는 10% FBS(GIBCO), 100 ㎍/㎖ 노르모신(Normocin)과 1xHEK-Blue 선별(selection)을 포함하는 DMEM(GIBCO)에서 유지되었다.
제조예 5. 인간 면역세포 분리 및 활성화
IRB(Institutional Review Board)의 승인을 받아 대한적십자사(Korean Red Cross, Korea)로부터 혈액팩을 공급받아 말초 혈액 단핵구 세포(Peripheral blood mononuclear cell, PBMC)를 분리하여 동결하였다. 해동한 PBMC는 양성선택(Positive selection) 방법으로 Easy sep(Stem cell, Vancouver, BC, CA) 키트(Kit)로 인간 단핵구 세포를 분리하였다. 분리한 단핵구 세포는 수지상 세포 배양 키트(Stem cell) 방법으로 5일간 미성숙 수지상 세포로 분화시켰다. 미성숙 수지상 세포는 수지상 세포 배양 키트(Stem cell) 방법으로 5일간 성숙되었다.
해동한 PBMC는 음성선택(Negative selection) 방법으로 Easy sep(Stem cell) 키트(Kit)로 인간 T 세포를 분리하였다. 인간 T 세포는 1 ㎍/㎖ 항-CD3(OKT3, Invitrogen)가 코팅된 플레이트에서 배양하여 72시간 활성화시켰다. 인간 T 세포는 10% FBS(GIBCO)가 포함된 RPMI-1640(GIBCO)에서 유지되었다.
실시예 1. 융합단백질의 결합 친화도 확인
실시예 1.1. 재조합 인간 CD20에 대한 융합 단백질의 결합 확인
T2.01 및 T2.02의 재조합 인간 CD20에 대한 결합을 표면 플라즈몬 공명(Surface plasmon resonance, SPR)으로 확인하였다.
구체적으로, CM5 칩의 표면을 50 nM NHS(N-hydroxysuccinimide)와 200 nM EDC(1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide)의 1:1 혼합물로 활성화시키고 25 ㎍/㎖의 항-인간 IgG(Fc) 항체를 10 ㎕/min의 속도로 400초간 고정화(Immobilization) 하였다. 남아있는 활성화 에스터 그룹(Active ester groups)은 1 M 에탄올아민(ethanolamine)으로 블로킹(Blocking) 하였다. T2.01 및 T2.02을 2 ㎍/㎖로 희석하여 항-인간 IgG(Fc) 항체가 고정화된 CM5 칩에 반응시켰다. 재조합 인간 CD20을 1ХHBS-EP+ 버퍼용액에 200 nM로 희석하고 연속 희석법으로 희석하였다. 희석한 재조합 인간 CD20을 30 ㎕/min의 속도로 반응시켰다. 결합과 해리 시간은 각각 180초와 400초였다. 해리 단계 후 60초간 안정화한 후, 10 mM 글라이신(Glycine) pH 1.5 용액으로 30 ㎕/min의 속도로 30초간 재생(Regeneration) 단계를 수행하였다.
그 결과, 도 7에 나타낸 것과 같이, T2.01 및 T2.02이 재조합 인간 CD20에 특이적으로 결합할 수 있음을 확인하였다.
또한 T2.04, T2.05, T2.06, T2.07, T2.08, T2.09, T2.10 및 T2.11의 재조합 인간 CD20에 대한 결합을 표면 플라즈몬 공명으로 확인하였다. T2.04, T2.05, T2.06, T2.07, T2.08, T2.09, T2.10 및 T2.11을 각각 15 ㎍/㎖, 2 ㎍/㎖, 2 ㎍/㎖, 2 ㎍/㎖, 10 ㎍/㎖, 2 ㎍/㎖, 20 ㎍/㎖, 20 ㎍/㎖로 희석하여 단백질 A가 고정된 칩에 반응시켰다. 재조합 인간 CD20을 1xHBS-EP+, 0.05% DDM(detergent dodecylmatoside), 0.01% CHS(cholesteryl hemisuccinate) 버퍼용액에 100 nM 혹은 200 nM로 희석하고 연속 희석법으로 희석하였다. 희석한 재조합 인간 CD20을 30 ㎕/min의 속도로 반응시켰다. 결합과 해리 시간은 각각 180초와 400초였다. 해리 단계 후 60초간 안정화한 후, 10 mM 글라이신 pH 1.5 용액으로 30 ㎕/min의 속도로 30초간 재생(Regeneration) 단계를 수행하였다.
그 결과, 도 29 내지 도 30에 나타낸 것과 같이, T2.04, T2.05, T2.06, T2.07, T2.08, T2.09, T2.10 및 T2.11이 재조합 인간 CD20에 결합하여, CD20을 특이적으로 표적할 수 있음을 확인하였다.
실시예 1.2. CD20 발현 세포와의 결합 확인
T2.01 및 T2.02가 CD20을 발현하는 세포주인 Raji 및 Ramos에 결합하는지 확인하였다.
구체적으로, Raji, Ramos 및 Jurkat 세포에 T2.01 및 T2.02를 처리하여 결합 정도를 확인하였다. CD20을 발현하지 않는 Jurkat T 세포는 대조군으로 사용하였다.
항-CD20 단일 클론 항체(Anti-CD20 monoclonal antibody; 리툭시맙(Rituximab), Roche)는 CD20 특이적인 결합을 할 수 있다고 알려진 FDA(Food and Drug Administration) 승인 약물이다.
세포주를 1 x 105 cells/100 ㎕로 FACS 완충용액에 부유하여 준비하였다. Rituximab, T2.01 및 T2.02를 각각 1 ㎍ 처리하였다. 세포들은 FACS 완충용액을 이용하여 두 차례 세척되었다. 세포들은 항-인간 IgG 항체(Biolegend)를 사용하여 염색하였다. 음성대조군(Negative control)시료는 항-인간 IgG Fc 항체(Biolegend)로만 염색되었다. 염색된 세포들의 발현 비율은 BD LSR을 사용하여 측정되었고, 플로우조(FlowJo) 소프트웨어에서 분석되었다.
그 결과, 도 8에 나타낸 것과 같이, T2.01 및 T2.02가 CD20을 발현하는 세포주에 95% 이상 결합함을 확인하였다.
다음으로, 마우스 대용(Mouse surrogate) 항체 단백질, 18B12, T2.01m 및 T2.02m의 A20 세포에 대한 결합 정도를 확인하였다.
세포주를 1 x 105 cells/100 ㎕로 FACS 완충용액에 부유하여 준비하고 18B12, T2.01m 및 T2.02m을 각각 1 ㎍ 처리하였다. 세포들은 FACS 완충용액을 이용하여 두 차례 세척되었다. 세포들은 항-마우스 IgG2a 항체(Biolegend)를 사용하여 염색하였다. 음성대조군(Negative control) 시료는 항-마우스 IgG2a 항체(Biolegend)로만 염색되었다. 염색된 세포들의 발현 비율은 BD LSR을 사용하여 측정되었고, 플로우조(FlowJo) 소프트웨어에서 분석되었다.
그 결과, 도 9에 나타낸 것과 같이, T2.01m 및 T2.02m가 CD20을 발현하는 세포주에 85% 이상 결합함을 확인하였다.
실시예 1.3. 재조합 인간 IL-12 수용체에 대한 융합 단백질의 결합 확인
융합 단백질의 IL-12가 작용하기 위해서는, 융합단백질이 IL-12 수용체에 결합해야 함을 고려하여, T2.01 및 T2.02이 재조합 인간 IL-12 수용체에 결합하는 것을 확인하였다.
Rituximab, T2.01 및 T2.02를 플레이트에 고정하고 겨자무과산화효소(Horseradish peroxidase, HRP)가 접합된 재조합 인간 IL-12 수용체 단백질을 결합시켰다. 이때, Rituximab은 대조군으로 사용하였다.
구체적으로, 하기와 같이 재조합 인간 IL-12 수용체에 대한 본 발명에 따른 융합 단백질이 결합하는 것을 확인하였다.
(i) Rituximab, T2.01 및 T2.02를 100 nM로 부유하여 연속 희석법으로 희석하였다. 희석한 Rituximab, T2.01 및 T2.02를 96-웰 면역 플레이트(96-well immune plate)에 분주하고 24시간 처리하였다.
(ii) 세척용액으로 웰(well)을 세척한 후, 1% BSA(Bovine serum albumin, Sigma) 용액으로 1시간 블로킹(Blocking) 하였다.
(iii) 세척용액으로 웰을 세척한 후, 1 nM의 IL-12 수용체 베타 1-바이오틴(IL-12Rβ1-Biotin; Acrobiosystems, Newark, USA)을 2시간 처리하였다.
(iv) 세척용액으로 웰을 세척한 후, 스트렙타비딘-HRP(Streptavidin-HRP)로 20분간 처리되었다.
(v) 세척용액으로 웰을 세척한 후, 기질 용액(Substrate solution)이 20분간 처리되었다.
(vi) 정지 용액(Stop solution)을 처리하고 450 ㎚ 흡광도에서 측정되었다.
그 결과, 도 10에 나타낸 것과 같이, T2.01 및 T2.02가 농도 의존적인 방법(Concentration dependent manner)으로 재조합 인간 IL-12 수용체 단백질에 결합함을 확인하였다
실시예 1.4. 융합 단백질의 항체의존성 세포독성능 확인
항-CD20 단일 클론 항체(Anti-CD20 monoclonal antibody)는 B-세포 림포마(B-cell lymphoma)에 결합하여 항체의존성 세포독성능을 통해 세포를 사멸한다. 따라서, CD20을 표적하는 1가(Monovalent) 형태의 융합 단백질의 B-세포 림포마(Raji)에 대한 항체의존성 세포 독성능을 확인하였다.
구체적으로, Rituximab, T2.01, T2.02 및 T2.12의 항체의존성 세포독성능(Antibody-Dependent cellular cytotoxicity, ADCC)을 ADCC 리포터 바이오 어세이(ADCC Reporter Bioassay; Promega, Wisconsin, USA) 키트(Kit)로 하기와 같이 확인하였다.
(i) 타겟 세포(Target cell, Raji)를 4% 저(Low) 수준의 IgG 혈청(serum)이 포함된 RPMI-1640에 5 x 105 cells/㎖ 농도로 부유하여 각 25 ㎕씩 분주하였다.
(ii) Rituximab, T2.01, T2.02 및 T2.12를 4% 저(Low) 수준의 IgG 혈청이 포함된 RPMI-1640에 250 ㎍/㎖로 부유하여 연속 희석법(Serial dilution)으로 희석하였다. 희석한 Rituximab, T2.01, T2.02 및 T2.12를 각 25 ㎕씩 분주하였다.
(iii) 효과 세포(Effector cell)를 4% 저(Low) 수준의 IgG 혈청이 포함된 RPMI-1640에 3 x 106 cells/㎖ 농도로 부유하여 각 25 ㎕씩 분주하였다.
(iv) 6시간 배양 후, BioGloTM 루시퍼라아제 어세이 시약(BioGlo luciferase assay reagent; Promega)를 처리하고 발광값(Luminescence, RLU(Relative Luminescence Unit))을 측정하였다.
그 결과, 도 11에 나타낸 것과 같이, 항-CD20 단일 클론 항체인 Rituximab을 처리한 시료에서는 반수유효농도(50% Effective concentration, EC50) 31.1 ㎍/㎖의 높은 항체의존성 세포독성능을 보였지만 T2.01을 처리한 시료에서는 EC50 5.3 x 103 ㎍/㎖, T2.02를 처리한 시료에서는 EC50 6.7 x 103 ㎍/㎖의 낮은 항체의존성 세포독성능을 보였다. Fc 부분이 변이되어 이펙터 기능 (effector function)이 없는 컨트롤 T2.12을 처리한 시료에서는 항체의존성 세포독성능이 보이지 않았다.
실시예 2. 융합단백질의 신호전달 유도능 확인
실시예 2.1. IL-12 감지 세포에서의 신호전달능 확인
IL-12는 IL-12 수용체에 결합하였을 때 신호전달 매개 물질인 STAT4(Signal transducer and activator or transcription 4)의 인산화를 유도하여 신호전달을 진행한다고 알려져 있음을 고려하여, IL-12 수용체를 발현하는 IL-12 감지 세포에서 일 실시예의 융합 단백질의 신호전달능력을 평가하였다.
구체적으로, IL-12 감지 세포인 HEK-Blue IL-12 세포주를 2.8 x 105 cells/㎖로 희석하여 180 ㎕/well로 분배되었다. 재조합 인간 IL-12(Recombinant human IL-12), T2.01m, T2.02m, T2.03m 및 18B12를 4 nM로 부유하여 연속 희석법으로 희석하였다. 희석한 재조합 인간 IL-12(Recombinant human IL-12), T2.01m, T2.02m, T2.03m 및 18B12를 HEK-Blue IL-12 세포에 처리하였다. 처리 24시간 후, 세포 상층액이 수집되었고, 96-웰(well) 플레이트에서 QUANTI-Blue Solution(Invivogen)과 혼합되었다. 분광광도계(Spectrophotometer, Thermo Fisher)로 620 ㎚에서 리포터 발현 정도를 측정하였다.
그 결과, 도 12에 나타낸 것과 같이, 재조합 인간 IL-12, T2.01m, T2.02m 및 T2.03m의 경우 620 ㎚ 흡광도에서 IL-12를 감지하여 STAT4가 인산화됨으로서 리포터 유전자를 발현시켰음을 확인하였다. 더불어, 18B12는 IL-12 감지 세포에 처리하였을 때, IL-12를 감지하지 못함을 확인하였다. 이러한 결과는, 일 구체예의 융합 단백질이 IL-12 수용체에 특이적으로 결합하여 신호전달을 유도함을 의미한다.
실시예 2.2. 인간 T 세포에서의 신호전달능 확인
인간 T 세포의 IL-12 수용체에 IL-12가 결합하였을 때 신호전달 매개 물질인 STAT4의 인산화를 유도하여 신호전달을 진행하는지 확인하였다
구체적으로, 항-CD3(OKT3, Invitrogen)으로 활성화시킨 인간 T 세포를 AlphaLISA SureFire Ultra p-STAT4(Tyr693) Assay Kit(PerkinElmer, Massachusetts, USA)를 사용하여 인간 T 세포에서의 신호전달능을 확인하였다. 재조합 인간 IL-12, T2.01, T2.02 및 T2.17를 100 ng/㎖로 부유하여 연속 희석법으로 희석하였다. 희석한 재조합 인간 IL-12, T2.01, T2.02 및 T2.17를 활성화시킨 인간 T 세포에 처리하였다. 처리 2시간 후, 세포를 용해시키고 p-STAT4(phosphorylated STAT4)를 감지하는 시약(PerkinElmer)을 처리하였다. 분광광도계(Spectrophotometer)로 자극파장 680 ㎚ 및 발광파장 615 ㎚에서 p-STAT4를 감지하였다.
그 결과, 도 13에 나타낸 것과 같이, 재조합 인간 IL-12를 처리한 시료에서는 반수유효농도(EC50) 0.1946 ng/㎖, T2.01을 처리한 시료에서는 EC50 0.5547 ng/㎖, T2.02를 처리한 시료에서는 EC50 1.555 ng/㎖을 보였다. EC50 비교를 통해 IL-12 mutation으로 인해 T 세포 신호전달 능력이 약화되었음을(attenuated) 확인하였다. T2.17을 처리한 시료에서는 인산화된 STAT4가 확인되지 않았다. 이러한 결과는, IL-12 돌연변이가 T 세포 신호전달 능력을 약화시켰음을 의미한다.
실시예 3. 융합단백질의 사이토카인 분비능 확인
실시예 3.1. 사이토카인 측정을 위한 효소 결합 면역 침강 분석
사이토카인 측정을 위해, 하기와 같은 단계로 -20℃에서 보관된 상층액에서 사이토카인 측정을 위한 효소 결합 면역 침강 분석(Enzyme-linked immunosorbent assay, ELISA, R&D systems)을 진행하였다.
(i) 포획 항체(Capture antibody)를 분석증명서(Certificate of Analysis, CoA)에 따라 희석하여 96-웰 플레이트(96-well plate)에 24시간 코팅하였다.
(ii) 세척용액으로 웰(well)을 세척한 후, 1% BSA(Bovine serum albumin, Sigma) 용액으로 1시간 블로킹(Blocking) 하였다.
(iii) 세척용액으로 웰을 세척한 후, 시료를 2시간 처리하였다.
(iv) 세척용액으로 웰을 세척한 후, 탐지 항체(Detection antibody)를 분석증명서에 따라 희석하여 웰에 분주한 후 2시간 처리하였다.
(v) 세척용액으로 웰을 세척한 후, 스트렙타비딘-HRP(Streptavidin-HRP)로 20분간 처리되었다.
(vi) 세척용액으로 웰을 세척한 후, 기질 용액(Substrate solution)으로 20분간 처리되었다.
(vii) 정지 용액(Stop solution)을 처리하고 450 ㎚에서 흡광도를 측정하였다.
실시예 3.2. 인간 T 세포에서의 사이토카인 분비능 확인
인간 T 세포에 IL-12를 처리하였을 때 주요 면역반응인 IFN-γ(Interferon-gamma) 분비가 일어남을 고려하여, 인간 T 세포에 재조합 인간 IL-12, Rituximab, T2.01, T2.02 및 T2.03를 처리하였을 경우의 효소 결합 면역 침강 분석을 통해 세포 상층액 내의 IFN-γ 분비능을 평가하였다.
구체적으로, 항-CD3(OKT3, Invitrogen)으로 활성화시킨 인간 T 세포를 5 x 105 cells/㎖로 희석하여 96-웰(well) 플레이트에 200 ㎕/well로 분배하였다. 재조합 인간 IL-12, Rituximab, T2.01, T2.02 및 T2.03는 10 nM로 희석하여 20 ㎕/well로 분배하였다. 재조합 인간 IL-12, Rituximab, T2.01, T2.02 및 T2.03를 각 250 pM씩 처리하였다. 처리 48시간 후, 세포 상층액이 수집되었고, 시료들은 -80℃에서 보관되었다.
그 결과, 도 14에 나타낸 것과 같이, 재조합 인간 IL-12를 처리한 시료에서는 평균 1,640 pg/㎖, T2.01을 처리한 시료에서는 평균 1,170 pg/㎖, T2.02를 처리한 시료에서는 평균 956 ng/㎖, T2.03를 처리한 시료에서는 평균 662 pg/㎖의 IFN-γ가 확인되었다. Rituximab를 처리한 시료에서는 IFN-γ가 확인되지 않았다. 이러한 결과는, T2.01, T2.02 및 T2.03이 인간 T 세포에 작용하여 IFN-γ 분비를 유도함을 의미한다.
실시예 3.3. 혼합림프구반응 시험을 통한 사이토카인 분비능 확인
인간 T 세포와 동종의 수지상 세포를 혼합하여 인위적인 동종 면역반응을 일으켰을 때 융합 단백질이 사이토카인 분비를 유도하는지 확인하였다. 효소 결합 면역 침강 분석을 통해 세포 상층액 내의 IFN-γ 농도를 평가하였다.
구체적으로, 성숙된 인간 수지상 세포를 4 x 105 cells/㎖로 희석하여 96-웰(well) 플레이트에 50 ㎕/well로 분배하였다. 항-CD3로 활성화시킨 서로 다른 혈액공여자로부터의 인간 T 세포를 2 x 106 cells/㎖로 희석하여 100 ㎕/well로 분배하여 분배된 성숙된 인간 수지상세포와 혼합하였다(Mixed Lymphocyte Reaction, MLR). Rituximab, T2.01 및 T2.02는 1 uM로 희석하여 50 ㎕/well로 분배하였다. 혼합 배양 5일 후, 세포 상층액이 수집되었고, 시료들은 -80℃에서 보관되었다.
그 결과, 도 15에 나타낸 것과 같이, T2.01을 처리한 시료에서는 평균 487 pg/㎖, T2.02를 처리한 시료에서는 평균 587 pg/㎖의 IFN-γ가 확인되었다. 이에 반해, Rituximab를 처리한 시료에서는 IFN-γ가 확인되지 않았다. 이러한 결과는, 혼합림프구 면역반응시 T2.01 및 T2.02가 IFN-γ 분비를 유도함을 의미한다.
실시예 4. 동종이식 마우스 모델에서의 항암효능 평가
실시예 4.1. 동종이식 마우스 모델의 확립 및 항암효능 평가
생명윤리위원회(Institutional animal care and use committee, IACUC, Crownbio, U.S)의 승인을 받아 인비보(in vivo)를 진행하였다. 6 주령 암컷 BALB/c 마우스는 Shanghai Lingchang Biotechnology Co,.Ltd(Shanghai, China)에서 공급받아 사용하였다. A20 세포를 PBS(Phosphate-buffered saline, GIBCO)에 5 x 105 cells/100 ㎕ 농도로 부유시킨 후 마우스의 오른쪽 옆구리에 5Х105 cells씩 피하주사하였다.
종양의 크기가 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하였다. 100 ㎍의 T2.01m, 50 ㎍의 T2.02m, 100 ㎍의 T2.02m 및 300 ㎍의 T2.02m를 3일 간격으로 3회 복강주사하였다. 화학요법(Chemotherapy) 그룹은 CHOP1(100 ㎎/㎏ Cyclophosphamide, 6 ㎎/㎏ Doxolubicin, 0.1 ㎎/㎏ Vincristine, 0.2 ㎎/㎏ Dexamethasone)을 1회 복강주사, CHOP2(50 ㎎/㎏ Cyclophosphamide, 3 ㎎/㎏ Doxolubicin, 0.1 ㎎/㎏ Vincristine, 0.2 ㎎/㎏ Dexamethasone)을 1주 간격 2회 복강주사하였다. 마우스는 그룹별 10마리가 사용되었다. 종양의 크기와 몸무게를 주 2회 측정하였다. 항암능력은 두 달간 평가되었다.
그 결과, 도 16 및 17에 나타낸 것과 같이, 첫 복강주사 후 20일 째에, T2.02m을 50 ㎍/㎖ 처리한 군에서 완전관해반응(Complete response, CR) 43%(3/7), T2.02m을 100 ㎍/㎖ 처리한 군에서 CR 100%(7/7), T2.02m을 300 ㎍/㎖ 처리한 군에서 CR 100%(7/7)이 확인되어 T2.02m의 항암효과가 뛰어남을 확인하였다. T2.01m을 100 ㎍/㎖ 처리한 군에서는 CR 86%(6/7)을 확인하였다. 반면, 화학요법 CHOP1을 처리한 군에서 CR 28.5%(2/7)을 확인하였고, 화학요법 CHOP2를 처리한 군에서는 CR을 확인할 수 없었다.
더불어, T2.01m, T2.02m, CHOP1 및 CHOP2를 복강주사하고 이에 따른 부작용을 몸무게 변화로 나타내었다.
그 결과, 도 18에 나타낸 것과 같이, T2.01m, T2.02m, CHOP1 및 CHOP2를 복강주사로 인한 몸무게 변화는 관찰되지 않았다. 이러한 결과는, 일 실시예의 융합단백질의 복강주사 후 부작용이 없음을 의미한다.
다음으로, 화학요법 그룹과 일 실시예의 융합단백질의 항암효과를 비교하기 위하여, T2.01m, T2.02m, CHOP1 및 CHOP2를 복강주사 후 9일 째에 각 그룹별 3마리로부터 종양조직을 분리하여 그룹별 상대적인 종양조직 무게를 비교하였다.
구체적으로, 상기 실험군에서 각 그룹별 3마리는 첫 복강주사 후 9일 째에 IACUC 규정에 따른 처치방법을 통해 종양조직을 수확(Harvest)하였다. 수확한 종양조직은 전자저울로 무게가 측정되었다. 종양조직은 종양분리(Tumor dissociation, Miltenyi, Germany) 키트(kit)를 사용하여 면역세포를 분리하였다. 세포들은 항-마우스 CD45 항체(Biolegend), 항-마우스 CD3 항체(BD), 항-마우스 CD4 항체(Biolegend), 항-마우스 CD8 항체(eBioscience), 항-마우스 CD19 항체(Biolegend), 항-마우스 CD49/b(Biolegend), Live/Dead(eBioscience) 및 Counting beads(eBioscience)를 사용하여 염색하였다. 염색된 세포들의 발현 비율은 BD LSR을 사용하여 측정되었고, 플로우조(FlowJo) 소프트웨어에서 분석되었다.
그 결과, 도 19에 나타낸 것과 같이, 복강주사한 T2.02m의 용량이 클수록 종양조직 무게가 줄어든 것을 확인할 수 있었다. 이러한 결과는, T2.02m의 용량에 비례하여 항암효과가 뛰어남을 의미한다.
또한, 종양조직내 면역세포 분포 분석을 통해 상기와 같은 효과가 융합 단백질에 의한 면역세포의 활성에 따른 항암효과인지 확인하였다.
그 결과, 도 20에 나타낸 것과 같이, T2.02m을 처리한 군의 CD3+ CD4+ T 세포 또는 CD3+ CD8+ T 세포의 분포도가 대조군, 화학요법 CHOP1 및 화학요법 CHOP2 군과 비교했을 때 차이는 없지만, 절대적인 면역세포의 수가 차이남을 확인하였다. 이러한 결과는, 상기와 같은 결과가 T2.02m에 의한 효과 세포의 침투 증가에 따른 항암효과임을 의미한다.
실시예 4.2. 종양 재발 모델에서의 종양 재발 억제 평가
완전관해가 나타난 마우스를 이용하여 종양재발평가(Tumor re-challenge)를 수행하였다.
A20 세포가 동종이식(Syngeneic)된 마우스에 T2.02m를 처리하여 완전관해(Complete response, CR)가 나타난 마우스를 대상으로 종양 재발 모델을 유도하였다.
구체적으로, A20 세포를 PBS(Phosphate-buffered saline, GIBCO)에 5 x 105 cells/100 ㎕ 농도로 부유하고 마우스의 오른쪽 옆구리에 5 x 105 cells를 피하주사하였다. 4T1 세포를 PBS(Phosphate-buffered saline, GIBCO)에 5 x 105 cells/100 ㎕ 농도로 부유하고 마우스의 왼쪽 옆구리에 5 x 105 cells를 피하주사하였다. 대조군으로는 실험군과 주령이 같은 비처리(untreated)마우스를 사용하였다. 대조군 그룹의 마우스는 실험군과 주령이 동일한 마우스를 사용하였다. 마우스는 그룹별 5마리가 사용되었다. 종양의 크기와 몸무게를 주 2회 측정하였다.
그 결과, 도 21 및 도 22에 나타낸 것과 같이, T2.02m을 처리하여 완전관해가 일어난 군에서는 4T1 종양이 자라지만, A20 종양은 자라지 않음을 확인하였다. 반면, 대조군은 4T1 종양과 A20 종양 모두 자랐음을 확인하였다. 이러한 결과는, 융합 단백질에 의해 종양재발을 억제할 수 있음을 의미한다.
또한, 상기 완전관해모델의 몸무게를 측정하여 부작용 여부 또한 확인하였다. 그 결과, 도 23에 나타낸 것과 같이, 융합 단백질에 의한 종양재발은 부작용이 없이 나타남을 확인하였다.
실시예 4.3. 동종이식 마우스 모델에서 CD20 특이적인 융합 단백질과 CD20 항체의 항종양 능력 평가 비교
일 실시예에 따른 CD20 특이적 융합단백질과, 비특이적 융합단백질의 항종양 효과를 비교하였다.
구체적으로, 생명윤리위원회(Institutional animal care and use committee, IACUC, Crownbio, U.S)의 승인을 받아 인비보(in vivo)를 진행하였다. 6 주령 암컷 BALB/c 마우스는 Shanghai Lingchang Biotechnology Co,.Ltd(Shanghai, China)에서 공급받아 사용하였다. A20 세포는 PBS(Phosphate-buffered saline, GIBCO)에 5 x 105 cells/100 ㎕ 농도로 부유하고 마우스의 오른쪽 옆구리에 5Х105 cells씩 피하주사하였다.
종양의 크기가 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하였다. 준비된 25 ㎍의 T2.02m 및 25 ㎍의 18B12를 3일 간격으로 3회 복강주사하였다. 마우스는 그룹별 8마리가 사용되었다. 종양의 크기와 몸무게를 주 2회 측정하였고, 한달간 항암능력을 평가하였다.
그 결과, 도 24에 나타낸 것과 같이, 첫 복강주사 후 11일 째에, T2.02m을 처리한 군에서 완전관해반응(CR)이 일어났고, 첫 복강주사 후 18일 째에는 CR 100%(8/8)이 확인되어 T2.02m의 항암효과가 뛰어남을 보여주었다. 반면, 비융합 단백질인 18B12를 처리한 군의 경우 항암효과를 확인할 수 없었다. 이러한 결과는, 비융합 단백질보다 일 실시예의 융합단백질의 항암효과가 더 뛰어남을 의미한다.
실시예 4.4. 동종이식 마우스 모델에서 CD20 특이적인 융합 단백질의 타겟 특이적인 항암효능 평가
일 실시예에 따른 타겟 특이적 융합단백질 및 비특이적 비융합 단백질의 항종양 효과를 비교하였다.
생명윤리위원회(Institutional animal care and use committee, IACUC, Crownbio, U.S)의 승인을 받아 인비보(in vivo)를 진행하였다. 6 주령 암컷 BALB/c 마우스는 Shanghai Lingchang Biotechnology Co,.Ltd(Shanghai, China)에서 공급받아 사용하였다. A20 세포는 PBS(Phosphate-buffered saline, GIBCO)에 5 x 105 cells/100 ㎕ 농도로 부유하고 마우스의 오른쪽 옆구리에 5Х105 cells를 피하주사하였다.
종양의 크기가 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하였다. 준비된 0.2 ㎍의 T2.02m 및 0.2 ㎍의 T2.13m을 일주일 간격으로 2회 정맥주사하였다. 마우스는 그룹별 7마리가 사용되었다. 종양의 크기와 몸무게를 주 2회 측정하였다.
그 결과, 도 25에 나타낸 것과 같이, 첫 정맥주사 후 11일 째에, T2.02m을 처리한 군에서 63%의 종양성장억제율(Tumor growth inhibition percent, TGI)이 확인되었고, 반면 T2.13m을 처리한 군에서는 20%의 종양성장억제율이 확인되었다. 이러한 결과는, 일 실시예의 타겟 특이적인 융합단백질이 타겟 특이적이지 않은 비융합 단백질보다 항암효과가 뛰어남을 의미한다.
실시예 4.5. 동종이식 마우스 모델에서 CD20 특이적인 융합 단백질과 CD20 항체와 사이토카인 병용투여의 항암효능 평가 비교
일 실시예의 타겟 특이적 융합단백질과 비특이적 융합단백질의 병용요법 간 효과를 비교하였다.
구체적으로, 생명윤리위원회(Institutional animal care and use committee, IACUC, Crownbio, U.S)의 승인을 받아 인비보(in vivo)를 진행하였다. 6 주령 암컷 BALB/c 마우스는 Shanghai Lingchang Biotechnology Co,.Ltd(Shanghai, China)에서 공급받아 사용하였다. A20 세포는 PBS(Phosphate-buffered saline, GIBCO)에 5 x 105 cells/100 ㎕ 농도로 부유하고 마우스의 오른쪽 옆구리에 5 x 105 cells를 피하주사하였다.
종양의 크기가 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하였다. 준비된 0.2 ㎍의 T2.02m을 처리한 군; 및 0.2 ㎍의 T2.13m 및 0.2 ㎍의 18B12를 처리한 군으로 그룹화하였다. 각 투여는 일주일 간격으로 3회 정맥주사하였으며 이주간 평가하였다. 마우스는 그룹별 7마리가 사용되었다. 종양의 크기와 몸무게를 주 2회 측정하였다.
그 결과, 도 26에 나타낸 것과 같이, 첫 정맥주사 후 10일 째에, T2.02m을 처리한 군에서 80% 종양성장억제율(Tumor growth inhibition percent, TGI)이 확인되었고, 18B12와 T2.13m을 함께 처리한 군에서는 65%의 종양성장억제율이 확인되었다. 이러한 결과는 타겟 특이적인 융합단백질이 타겟 특이적이지 않은 비융합 단백질들의 병용요법보다 항암효과가 뛰어남을 의미하고, 일 실시예의 융합단백질 구조의 동반상승효과를 확인한다.
실시예 4.6. 동종이식 마우스 모델에서 CD20 특이적인 융합 단백질의 약화된 사이토카인의 항암효능 평가 비교
헤파린 결합부위 변이를 포함하는 T2.03m과 T2.02m의 IL-12의 효과가 T2.01m에 비해 약화되는지 확인하였다.
생명윤리위원회(Institutional animal care and use committee, IACUC, Crownbio, U.S)의 승인을 받아 인비보(in vivo)를 진행하였다. 6 주령 암컷 BALB/c 마우스는 Shanghai Lingchang Biotechnology Co,.Ltd(Shanghai, China)에서 공급받아 사용하였다. A20 세포는 PBS(Phosphate-buffered saline, GIBCO)에 5 x 105 cells/100 ㎕ 농도로 부유하고 마우스의 오른쪽 옆구리에 5 x 105 cells씩 피하주사하였다.
종양의 크기가 100 ㎣에 도달하였을 때, 무작위로 나누어 그룹화하였다. 준비된 2 ㎍의 T2.01m, 2 ㎍의 T2.02m 및 2 ㎍의 T2.03m을 일주일 간격으로 3회 정맥주사하여 마우스모델에서의 항암능력을 한달간 평가하였다. 마우스는 그룹별 7마리가 사용되었다. 종양의 크기와 몸무게를 주 2회 측정하였다.
그 결과, 도 27에 나타낸 것과 같이, 첫 복강주사 후 20일 째에, T2.01m을 처리한 군에서 87%의 종양성장억제율(Tumor growth inhibition percent, TGI), T2.02m을 처리한 군에서 98%의 TGI, T2.03m을 처리한 군에서 40%의 TGI가 확인되었다.
더불어, T2.01m, T2.02m 및 T2.03m을 정맥주사하고 이에 따른 부작용을 몸무게 변화로 나타내었다.
그 결과, 도 28에 나타낸 것과 같이, T2.01m, T2.02m 및 T2.03m가 정맥주사 후 부작용이 없음을 확인하였다.

Claims (34)

  1. IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및
    CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질.
  2. 제1항에 있어서,
    IL-12 또는 이의 변이체는 IL-12A(p35) 또는 이의 변이체; 및 IL-12B(p40) 또는 이의 변이체를 포함하는 것인, 융합단백질.
  3. 제2항에 있어서,
    IL-12 또는 이의 변이체는 하기 구조식(I) 또는 구조식(II)로 이루어진 것인, 융합단백질:
    N'-Y-[링커(1)]o-Z-C' (I)
    N'-Z-[링커(1)]o-Y-C' (II)
    이때, 상기 구조식(I) 및 (II)에 있어서,
    상기 N'은 융합단백질의 N-말단이고,
    상기 C'는 융합단백질의 C-말단이며,
    상기 Y는 IL-12A 또는 이의 변이체이고,
    상기 Z는 IL-12B 또는 이의 변이체이며,
    상기 링커(1)는 펩타이드 링커이고,
    상기 o는 O 또는 1이다.
  4. 제2항에 있어서,
    상기 IL-12B(p40)의 변이체는 서열번호 124의 아미노산 서열에서 K258A, K260A, K263A 및 K264A로 이루어지는 군으로부터 선택되는 하나 이상의 치환이 일어난 아미노산 서열을 포함하는 것인, 융합단백질.
  5. 제2항에 있어서,
    상기 IL-12B(p40)는 서열번호 124 또는 서열번호 131의 아미노산 서열을 포함하는 것인, 융합단백질.
  6. 제4항에 있어서,
    상기 IL-12B(p40)의 변이체는 서열번호 127, 서열번호 129, 서열번호 134 또는 서열번호 136의 아미노산 서열을 포함하는 것인, 융합단백질.
  7. 제2항에 있어서,
    상기 IL-12A(p35)는 서열번호 125 또는 서열번호 132의 아미노산 서열을 포함하는 것인, 융합단백질.
  8. 제1항에 있어서,
    상기 IL-12는 서열번호 123, 서열번호 126, 서열번호 128, 서열번호 130, 서열번호 133 또는 서열번호 135의 아미노산 서열을 포함하는 것인, 융합단백질.
  9. 제1항에 있어서,
    상기 CD20에 특이적으로 결합하는 항원 결합 부위는
    서열번호 107의 HCDR1, 서열번호 108의 HCDR2 및 서열번호 109의 HCDR3를 포함하는 중쇄가변영역 및 서열번호 110의 LCDR1, 서열번호 111의 LCDR2, 서열번호 112의 LCDR3를 포함하는 경쇄가변영역;
    서열번호 115의 HCDR1, 서열번호 116의 HCDR2 및 서열번호 117의 HCDR3를 포함하는 중쇄가변영역 및 서열번호 118의 LCDR1, 서열번호 119의 LCDR2, 서열번호 120의 LCDR3를 포함하는 경쇄가변영역;
    서열번호 143의 HCDR1, 서열번호 144의 HCDR2, 서열번호 145의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 146의 LCDR1, 서열번호 147의 LCDR2, 서열번호 148의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 149의 HCDR1, 서열번호 150의 HCDR2, 서열번호 151의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 152의 LCDR1, 서열번호 153의 LCDR2, 서열번호 154의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 155의 HCDR1, 서열번호 156의 HCDR2, 서열번호 157의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 158의 LCDR1, 서열번호 159의 LCDR2, 서열번호 160의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 161의 HCDR1, 서열번호 162의 HCDR2, 서열번호 163의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 164의 LCDR1, 서열번호 165의 LCDR2, 서열번호 166의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 167의 HCDR1, 서열번호 168의 HCDR2, 서열번호 169의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 170의 LCDR1, 서열번호 171의 LCDR2, 서열번호 172의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 173의 HCDR1, 서열번호 174의 HCDR2, 서열번호 175의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 176의 LCDR1, 서열번호 177의 LCDR2, 서열번호 178의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 179의 HCDR1, 서열번호 180의 HCDR2, 서열번호 181의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 182의 LCDR1, 서열번호 183의 LCDR2, 서열번호 184의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 185의 HCDR1, 서열번호 186의 HCDR2, 서열번호 187의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 188의 LCDR1, 서열번호 189의 LCDR2, 서열번호 190의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 191의 HCDR1, 서열번호 192의 HCDR2, 서열번호 193의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 194의 LCDR1, 서열번호 195의 LCDR2, 서열번호 196의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 197의 HCDR1, 서열번호 198의 HCDR2, 서열번호 199 또는 서열번호 200의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 201의 LCDR1, 서열번호 202의 LCDR2, 서열번호 203의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 204의 HCDR1, 서열번호 205의 HCDR2, 서열번호 206의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 207의 LCDR1, 서열번호 208의 LCDR2, 서열번호 209의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 210의 HCDR1, 서열번호 211의 HCDR2, 서열번호 212의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 213의 LCDR1, 서열번호 214의 LCDR2, 서열번호 215의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 216의 HCDR1, 서열번호 217의 HCDR2, 서열번호 218의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 219의 LCDR1, 서열번호 220의 LCDR2, 서열번호 221의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 222의 HCDR1, 서열번호 223의 HCDR2, 서열번호 224의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 225의 LCDR1, 서열번호 226의 LCDR2, 서열번호 227의 LCDR3을 포함하는 경쇄가변영역;
    서열번호 228의 HCDR1, 서열번호 229의 HCDR2, 서열번호 230의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 231의 LCDR1, 서열번호 232의 LCDR2, 서열번호 233의 LCDR3을 포함하는 경쇄가변영역; 또는
    서열번호 234의 HCDR1, 서열번호 235의 HCDR2, 서열번호 236의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 237의 LCDR1, 서열번호 238의 LCDR2, 서열번호 239의 LCDR3을 포함하는 경쇄가변영역;
    을 포함하는 것인, 융합단백질.
  10. 제1항에 있어서,
    상기 CD20에 특이적으로 결합하는 항원 결합 부위는
    서열번호 113의 중쇄가변영역 및 서열번호 114의 경쇄가변영역;
    서열번호 121의 중쇄가변영역 및 서열번호 122의 경쇄가변영역;
    서열번호 240의 중쇄가변영역 및 서열번호 241의 경쇄가변영역;
    서열번호 242의 중쇄가변영역 및 서열번호 243의 경쇄가변영역;
    서열번호 244의 중쇄가변영역 및 서열번호 245의 경쇄가변영역;
    서열번호 246의 중쇄가변영역 및 서열번호 247의 경쇄가변영역;
    서열번호 248의 중쇄가변영역 및 서열번호 249의 경쇄가변영역;
    서열번호 250의 중쇄가변영역 및 서열번호 251의 경쇄가변영역;
    서열번호 252의 중쇄가변영역 및 서열번호 253의 경쇄가변영역;
    서열번호 254의 중쇄가변영역 및 서열번호 255의 경쇄가변영역;
    서열번호 256의 중쇄가변영역 및 서열번호 257의 경쇄가변영역;
    서열번호 258의 중쇄가변영역 및 서열번호 259의 경쇄가변영역;
    서열번호 260의 중쇄가변영역 및 서열번호 261의 경쇄가변영역;
    서열번호 262의 중쇄가변영역 및 서열번호 263의 경쇄가변영역;
    서열번호 264의 중쇄가변영역 및 서열번호 265의 경쇄가변영역;
    서열번호 266의 중쇄가변영역 및 서열번호 267의 경쇄가변영역;
    서열번호 268의 중쇄가변영역 및 서열번호 269의 경쇄가변영역;
    서열번호 270의 중쇄가변영역 및 서열번호 271의 경쇄가변영역;
    서열번호 88의 scFv를 포함하는 것; 또는
    서열번호 89의 scFv를 포함하는 것인, 융합단백질.
  11. 제1항에 있어서,
    제1 단량체는 CD20에 특이적으로 결합하는 항원 결합 부위를 추가적으로 포함하는 것인, 융합단백질.
  12. 제1항에 있어서,
    상기 제1 단량체는 하기 구조식 (III) 또는 구조식 (IV)로 이루어진 것인, 융합단백질:
    N'-X-[링커(2)]p-Fc 영역 단편 또는 이의 변이체-[링커(3)]q-(T)r-C' (III)
    N'-(T)r-[링커(2)]q -Fc 영역 단편 또는 이의 변이체-[링커(3)]p-X-C' (IV)
    이때, 상기 구조식 (III) 및 (IV)에 있어서,
    상기 N'은 융합단백질의 N-말단이고,
    상기 C'는 융합단백질의 C-말단이며,
    상기 X는 상기 구조식 (I) 또는 (II)이고,
    상기 T는 CD20에 특이적으로 결합하는 항원 결합 부위이며,
    상기 링커(2) 및 링커(3)는 펩타이드 링커이고,
    상기 p, q 및 r은 각각 독립적으로 O 또는 1이다.
  13. 제3항 또는 제12항에 있어서,
    상기 링커는 (G4S)n 링커를 포함할 수 있으며,
    상기 n은 1 내지 10의 정수 중 어느 하나인 것인, 융합단백질.
  14. 제12항에 있어서,
    상기 제1 단량체의 Fc 영역은 인간 IgG1 또는 마우스 IgG2a 유래인, 융합단백질.
  15. 제12항에 있어서,
    상기 제1 단량체의 Fc는 놉 구조 또는 홀 구조를 포함하는 것인, 융합단백질.
  16. 제1항에 있어서,
    상기 제2 단량체는 CD20에 특이적으로 결합하는 항원 결합 부위를 추가적으로 포함하는 것인, 융합단백질.
  17. 제16항에 있어서,
    상기 CD20에 특이적으로 결합하는 항원 결합 부위는 Fab, scFv, Fv 또는 이의 단편인 것인, 융합단백질.
  18. 제16항에 있어서,
    상기 추가적으로 결합된 CD20에 특이적으로 결합하는 항원 결합 부위는 제2 단량체의 N 말단 또는 C 말단에 결합되는 것인, 융합단백질.
  19. 제3항에 있어서,
    상기 제2 단량체는 하기 구조식 (V)를 포함하는 것인, 융합단백질:
    N'-(R)s-[링커(4)]t-Q-[링커(5)]u-Fc 영역 단편 또는 이의 변이체-[링커(6)]v-(W)a-C' (V)
    구조식 (V)에 있어서,
    상기 N'은 융합단백질의 N-말단이고,
    상기 C'는 융합단백질의 C-말단이며,
    상기 R은 CD20에 특이적으로 결합하는 항원 결합 부위이고,
    상기 Q는 CD20에 특이적으로 결합하는 항원 결합 부위이며,
    상기 W는 CD20에 특이적으로 결합하는 scFv; 또는 구조식 (I) 또는 (II)의 IL-12 또는 이의 변이체이고,
    상기 링커(4) 내지 링커(6)는 펩타이드 링커이며,
    상기 s, t, u 및 v은 각각 독립적으로 O 또는 1이다.
  20. 제19항에 있어서,
    상기 구조식 (V)는 하기 구조식 (V') 및 (V'')을 포함하는 것인, 융합단백질:
    N'-(R')s-[링커(4)]t-Q'-[링커(5)]u-Fc 영역 단편 또는 이의 변이체-[링커(6)]p-(W)a-C' (V')
    N'-(R'')s-[링커(4)]t-Q''-[링커(7)]x-(W)b-C' (V'')
    이때, 상기 구조식 (V') 및 (V'')에 있어서,
    R'은 CD20에 특이적으로 결합하는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하거나, 또는 항체의 경쇄 영역이고;
    R''은 CD20에 특이적으로 결합하는 항체의 경쇄 영역이거나, 또는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하며;
    이때, R' 및 R''은 결합하여 항체의 가변 영역을 형성하고, 이때, 상기 가변 영역은 CD20에 특이적으로 결합하며;
    Q'은 CD20에 특이적으로 결합하는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하거나, 또는 항체의 경쇄 영역이고;
    Q''은 CD20에 특이적으로 결합하는 항체의 경쇄 영역이거나, 또는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하며;
    이때, Q' 및 Q''는 결합하여 항체의 가변 영역을 형성하고, 이때, 상기 가변 영역은 CD20에 특이적으로 결합하며,
    R' 및 Q'은 각각 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하거나, 또는 항체의 경쇄 영역이고;
    R'' 및 Q''은 각각 항체의 경쇄 영역이거나, 또는 항체의 중쇄 영역으로서 가변영역 및 CH1 영역을 포함하며;
    이때, R' 및 R''; 및 Q' 및 Q''은 결합하여 항체의 가변 영역을 형성하고, 이때, 상기 가변 영역은 CD20에 특이적으로 결합하며,
    상기 W는 CD20에 특이적으로 결합하는 scFv이고,
    상기 링커(4), 링커(5) 및 링커(7)은 펩타이드 링커이며,
    상기 s, t, u, x, a 및 b는 각각 독립적으로 O 또는 1이다.
  21. 제1항에 있어서,
    상기 융합단백질은 구조식 (III) 및 구조식 (V); 구조식 (IV) 및 구조식 (V); 구조식 (III) 및 구조식 (III); 구조식 (IV) 및 구조식 (IV); 또는 구조식 (V) 및 구조식 (V)를 포함하는 것인, 융합단백질.
  22. 제1항에 있어서,
    상기 제2 단량체는 서열번호 113의 아미노산 서열로 이루어진 중쇄 및 서열번호 114의 아미노산 서열로 이루어진 경쇄; 또는
    서열번호 121의 아미노산 서열로 이루어진 중쇄 및 서열번호 122의 아미노산 서열로 이루어진 경쇄를 포함하는 것인, 융합단백질.
  23. 제2항에 있어서,
    상기 제2 단량체의 Fc는 놉 구조 또는 홀 구조를 포함하는 것인, 융합단백질.
  24. 제1항 내지 제23항 중 어느 한 항의 융합단백질을 유효성분으로 포함하는 암 예방 또는 치료용 약학 조성물.
  25. 제24항에 있어서,
    상기 암은 위암, 간암, 폐암, 대장암, 유방암, 전립선암, 피부암, 골암, 다발성골수종, 신경교종, 난소암, 췌장암, 자궁경부암, 갑상선암, 후두암, 급성 골수성 백혈병, 만성 골수성 백혈병, 급성 림프모구성 백혈병, 만성 림프모구성 백혈병, 뇌종양, 신경모세포종, 망막 모세포종, 두경부암, 침샘암 및 림프종으로 구성된 군에서 선택되는 어느 하나인, 약학 조성물.
  26. 제1항의 상기 제1 단량체를 코딩하는 폴리뉴클레오티드.
  27. 제26항의 폴리뉴클레오티드를 포함하는 벡터.
  28. 제1항의 상기 제2 단량체를 코딩하는 폴리뉴클레오티드.
  29. 제28항의 폴리뉴클레오티드를 포함하는 벡터.
  30. 제27항 및 제29항의 벡터가 도입된 형질전환 세포.
  31. i) 제30항의 형질전환 세포를 배양하는 단계; 및
    ii) 제1 단량체 및 제2 단량체를 포함하는 융합단백질을 회수하는 단계를 포함하는 융합단백질의 생산방법.
  32. IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질을 개체에 투여하는 단계를 포함하는 암을 치료 또는 예방하는 방법.
  33. 암을 치료하기 위한 IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질의 용도.
  34. 암을 치료하기 위한 약을 제조하기 위한 IL-12 또는 이의 변이체를 포함하는 제1 단량체; 및 CD20에 특이적으로 결합하는 항원 결합 부위를 포함하는 제2 단량체를 포함하는 융합단백질의 용도.
PCT/KR2021/010611 2020-08-11 2021-08-10 Il-12 및 항-cd20 항체를 포함하는 융합단백질 및 이의 용도 WO2022035200A1 (ko)

Priority Applications (3)

Application Number Priority Date Filing Date Title
CN202180069741.3A CN116390937A (zh) 2020-08-11 2021-08-10 一种包含il-12和抗cd20抗体的融合蛋白及其应用
EP21856206.4A EP4198050A4 (en) 2020-08-11 2021-08-10 FUSION PROTEIN WITH IL-12 AND ANTI-CD20 ANTIBODIES AND USE THEREOF
US18/040,632 US20230295327A1 (en) 2020-08-11 2021-08-10 Fusion protein comprising il-12 and anti-cd20 antibody and use thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20200100229 2020-08-11
KR10-2020-0100229 2020-08-11

Publications (1)

Publication Number Publication Date
WO2022035200A1 true WO2022035200A1 (ko) 2022-02-17

Family

ID=80247416

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/KR2021/010611 WO2022035200A1 (ko) 2020-08-11 2021-08-10 Il-12 및 항-cd20 항체를 포함하는 융합단백질 및 이의 용도
PCT/KR2021/010613 WO2022035201A1 (ko) 2020-08-11 2021-08-10 Il-12 및 항-fap 항체를 포함하는 융합단백질 및 이의 용도

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/010613 WO2022035201A1 (ko) 2020-08-11 2021-08-10 Il-12 및 항-fap 항체를 포함하는 융합단백질 및 이의 용도

Country Status (12)

Country Link
US (2) US20230295327A1 (ko)
EP (2) EP4198050A4 (ko)
JP (1) JP2023533042A (ko)
KR (2) KR20220020227A (ko)
CN (2) CN116323672A (ko)
AU (1) AU2021324738B2 (ko)
BR (1) BR112022026577A2 (ko)
CA (1) CA3191454A1 (ko)
IL (1) IL300534A (ko)
MX (1) MX2022015475A (ko)
TW (1) TWI819352B (ko)
WO (2) WO2022035200A1 (ko)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20230162310A (ko) * 2022-05-20 2023-11-28 주식회사 카나프테라퓨틱스 Light 단백질 및 항-fap 항체를 포함하는 융합단백질 및 이의 용도

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5776456A (en) 1992-11-13 1998-07-07 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma
US8314213B2 (en) * 2008-04-18 2012-11-20 Xencor, Inc. Human equivalent monoclonal antibodies engineered from nonhuman variable regions
KR20130133300A (ko) * 2011-04-29 2013-12-06 로슈 글리카트 아게 면역접합체

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3924445A (en) 1973-09-28 1975-12-09 Toyota Motor Co Ltd Flow rate measuring system with calibration means
WO1993005804A1 (en) 1991-09-18 1993-04-01 Sloan-Kettering Institute For Cancer Research Activated stromal fibroblast-specific antibody, f19 and methods of using the same
US6455677B1 (en) * 1998-04-30 2002-09-24 Boehringer Ingelheim International Gmbh FAPα-specific antibody with improved producibility
US8617557B2 (en) * 2010-03-12 2013-12-31 The Regents Of The University Of California Antibody fusion with IL-12 proteins with disrupted heparin-binding activity
HUE036077T2 (hu) 2010-08-13 2018-06-28 Roche Glycart Ag Anti-FAP ellenanyagok és alkalmazásukra szolgáló eljárások
MX365382B (es) * 2012-08-07 2019-05-31 Roche Glycart Ag Una combinación de inmunoconjugado y anticuerpo para usarse en el tratamiento de cáncer.
GB201402006D0 (en) 2014-02-06 2014-03-26 Oncomatryx Biopharma S L Antibody-drug conjugates and immunotoxins
JP7082604B2 (ja) * 2016-03-21 2022-06-08 マレンゴ・セラピューティクス，インコーポレーテッド 多重特異性および多機能性分子ならびにその使用
GB201713765D0 (en) 2017-08-28 2017-10-11 Psioxus Therapeutics Ltd Modified adenovirus
TW202112804A (zh) 2019-06-04 2021-04-01 瑞士商分子夥伴股份有限公司 多特異性蛋白質

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5776456A (en) 1992-11-13 1998-07-07 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma
US8314213B2 (en) * 2008-04-18 2012-11-20 Xencor, Inc. Human equivalent monoclonal antibodies engineered from nonhuman variable regions
KR20130133300A (ko) * 2011-04-29 2013-12-06 로슈 글리카트 아게 면역접합체

Non-Patent Citations (7)

* Cited by examiner, † Cited by third party
Title
"GenBank", Database accession no. AF 180563
"Remington's Pharmaceutical Sciences", 1995
HALIN C, GAFNER V, VILLANI M E, BORSI L, BERNDT A, KOSMEHL H, ZARDI L, NERI D.: "Synergistic therapeutic effects of a tumor targeting antibody fragment, fused to interleukin 12 and to tumor necrosis factor alpha.", CANCER RESEARCH, vol. 63, no. 12, 15 June 2003 (2003-06-15), US , pages 3202 - 3210, XP002727460, ISSN: 0008-5472 *
LEE D.: "Development of highly efficacious and safe targeted cancer immunotherapy via IL12-based TMEkine™ platform", JOURNAL FOR IMMUNO THERAPY OF CANCER, vol. 8, no. 3, 10 December 2020 (2020-12-10), pages A378 - A379, XP055900935 *
LURIA-PÉREZ ROSENDO, CANDELARIA PIERRE V., DANIELS-WELLS TRACY R., RODRÍGUEZ JOSÉ A., HELGUERA GUSTAVO, PENICHET MANUEL L.: "Amino acid residues involved in the heparin-binding activity of murine IL-12 in the context of an antibody-cytokine fusion protein", CYTOKINE, vol. 120, 1 August 2019 (2019-08-01), US , pages 220 - 226, XP055900916, ISSN: 1043-4666, DOI: 10.1016/j.cyto.2019.04.004 *
MURER PATRIZIA; NERI DARIO: "Antibody-cytokine fusion proteins: A novel class of biopharmaceuticals for the therapy of cancer and of chronic inflammation", NEW BIOTECHNOLOGY, vol. 52, 1 January 1900 (1900-01-01), NL , pages 42 - 53, XP085726498, ISSN: 1871-6784, DOI: 10.1016/j.nbt.2019.04.002 *
See also references of EP4198050A4

Also Published As

Publication number Publication date
TW202219068A (zh) 2022-05-16
KR20220020227A (ko) 2022-02-18
BR112022026577A2 (pt) 2023-02-23
AU2021324738B2 (en) 2024-05-09
JP2023533042A (ja) 2023-08-01
CN116390937A (zh) 2023-07-04
CN116323672A (zh) 2023-06-23
EP4198051A1 (en) 2023-06-21
CA3191454A1 (en) 2022-02-17
EP4198051A4 (en) 2024-05-01
EP4198050A4 (en) 2024-05-01
EP4198050A1 (en) 2023-06-21
IL300534A (en) 2023-04-01
AU2021324738A1 (en) 2023-03-23
MX2022015475A (es) 2023-04-03
TWI819352B (zh) 2023-10-21
US20230295258A1 (en) 2023-09-21
WO2022035201A1 (ko) 2022-02-17
KR20220020229A (ko) 2022-02-18
US20230295327A1 (en) 2023-09-21

Similar Documents

Publication Publication Date Title
WO2020060122A1 (ko) Il-2 단백질 및 cd80 단백질을 포함하는 융합단백질 및 이의 용도
WO2015058573A1 (zh) 拮抗抑制程序性死亡受体pd-1与其配体结合的单克隆抗体及其编码序列与用途
WO2018194381A1 (ko) Lrig-1 단백질에 특이적인 결합 분자 및 이의 용도
WO2010123290A2 (ko) 체내 지속성을 유지함으로 체내 반감기가 증가된 단백질 또는 펩티드 융합체, 및 이를 이용하여 체내 반감기를 증가시키는 방법
WO2019225787A1 (ko) 항-b7-h3 항체 및 그 용도
WO2020050667A1 (ko) 고형암을 위한 키메라 항원 수용체 및 키메라 항원 수용체가 발현된 t 세포
WO2018030806A1 (ko) 항체 중쇄불변부위 이종이중체에 융합된 사이토카인 및 이를 포함하는 약제학적 조성물
WO2020218829A1 (ko) 플라젤린 융합 단백질 및 이의 용도
WO2014090053A1 (zh) 拮抗抑制血管内皮细胞生长因子与其受体结合的单克隆抗体及其编码序列与用途
WO2019112347A2 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2016137108A1 (en) Novel antibody binding to tfpi and composition comprising the same
WO2018026248A1 (ko) 프로그램화된 세포 사멸 단백질(pd-1)에 대한 신규 항체 및 이의 용도
WO2022039490A1 (en) Anti-b7-h4/anti-4-1bb bispecific antibodies and use thereof
WO2019135668A1 (ko) Ige fc 수용체의 알파 서브유닛의 세포외 도메인, 이를 포함하는 약학적 조성물 및 이의 제조방법
WO2021107689A1 (ko) Il-2 단백질 및 cd80 단백질을 포함하는 융합단백질 및 면역관문 억제제를 포함하는 암 치료용 약학 조성물
WO2022035200A1 (ko) Il-12 및 항-cd20 항체를 포함하는 융합단백질 및 이의 용도
WO2020080854A1 (ko) Lrig-1 단백질에 특이적인 결합 분자 및 이의 용도
WO2020101365A1 (ko) 안정성이 향상된 항 c-met 항체 또는 그의 항원 결합 단편
WO2019125070A1 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2019135666A1 (ko) Ige fc 수용체의 알파 서브유닛의 세포외 도메인을 포함하는 약학적 조성물
WO2016199964A1 (ko) 분리된 비멘틴 유래 펩타이드에 특이적으로 결합하는 항체 또는 상기 펩타이드의 결합 단편
WO2021071319A1 (ko) 다중 특이적 융합 단백질 및 이의 용도
WO2018026249A1 (ko) 프로그램화된 세포 사멸 단백질 리간드-1 (pd-l1)에 대한 항체 및 이의 용도
WO2023224429A1 (ko) Light 단백질 및 항-fap 항체를 포함하는 융합단백질 및 이의 용도
WO2020138868A1 (ko) 타입 1 인터페론 중화 fc-융합 단백질 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21856206

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021856206

Country of ref document: EP

Effective date: 20230313