WO2021102052A1 - Directed conjugation technologies - Google Patents
Directed conjugation technologies Download PDFInfo
- Publication number
- WO2021102052A1 WO2021102052A1 PCT/US2020/061127 US2020061127W WO2021102052A1 WO 2021102052 A1 WO2021102052 A1 WO 2021102052A1 US 2020061127 W US2020061127 W US 2020061127W WO 2021102052 A1 WO2021102052 A1 WO 2021102052A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- moiety
- amino acid
- agent
- independently
- group
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CCC(C=CI(*)=C1)=C1F Chemical compound CCC(C=CI(*)=C1)=C1F 0.000 description 50
- KQLKNRHIPMOKEQ-UHFFFAOYSA-N CC(C)NC(OCc(cc1)ccc1OC(C)=O)=O Chemical compound CC(C)NC(OCc(cc1)ccc1OC(C)=O)=O KQLKNRHIPMOKEQ-UHFFFAOYSA-N 0.000 description 2
- XOTCVINISYCAQR-UHFFFAOYSA-N CC(C)NC(OCc(cc1F)cc(F)c1NC(C)=O)=O Chemical compound CC(C)NC(OCc(cc1F)cc(F)c1NC(C)=O)=O XOTCVINISYCAQR-UHFFFAOYSA-N 0.000 description 2
- JRRDYLKVNIFZPW-UHFFFAOYSA-N CC(C)NC(OCc(cc1F)cc(F)c1OC(C)=O)=O Chemical compound CC(C)NC(OCc(cc1F)cc(F)c1OC(C)=O)=O JRRDYLKVNIFZPW-UHFFFAOYSA-N 0.000 description 2
- VQOOHKXOPBQFJY-UHFFFAOYSA-N CC(C)NC(OCc(cc1F)ccc1OC(C)=O)=O Chemical compound CC(C)NC(OCc(cc1F)ccc1OC(C)=O)=O VQOOHKXOPBQFJY-UHFFFAOYSA-N 0.000 description 2
- JZKXXXDKRQWDET-QMMMGPOBSA-N N[C@@H](Cc1cc(O)ccc1)C(O)=O Chemical compound N[C@@H](Cc1cc(O)ccc1)C(O)=O JZKXXXDKRQWDET-QMMMGPOBSA-N 0.000 description 2
- VCRQSDUZEFWZPB-IFLLZMBLSA-N CC(C)(C)C([C@H](CCCCN)NC([C@H](Cc(cc1)ccc1O)NC([C@H](CCCCN)NC(CNC([C@H](CCCNC(N)=N)NC([C@H](Cc1ccccc1)NC([C@H](CCCCN)NC([C@H](CC(N)=O)N)=O)=O)=O)=O)=O)=O)=O)=O Chemical compound CC(C)(C)C([C@H](CCCCN)NC([C@H](Cc(cc1)ccc1O)NC([C@H](CCCCN)NC(CNC([C@H](CCCNC(N)=N)NC([C@H](Cc1ccccc1)NC([C@H](CCCCN)NC([C@H](CC(N)=O)N)=O)=O)=O)=O)=O)=O)=O)=O VCRQSDUZEFWZPB-IFLLZMBLSA-N 0.000 description 1
- BYPBNFSENIRKGD-UHFFFAOYSA-O CC(C)(C)Cc(cc1N)ccc1[OH2+] Chemical compound CC(C)(C)Cc(cc1N)ccc1[OH2+] BYPBNFSENIRKGD-UHFFFAOYSA-O 0.000 description 1
- LLERQVLVRRWUQB-MUUNZHRXSA-N CC(C)(C)OC(CC[C@H](C(NCCOCCOCCOCCOCCNC(CCCNC(c1cc(NC(c2c[n](cc[s]3)c3n2)=O)ccc1OC)=O)=O)=O)N)=O Chemical compound CC(C)(C)OC(CC[C@H](C(NCCOCCOCCOCCOCCNC(CCCNC(c1cc(NC(c2c[n](cc[s]3)c3n2)=O)ccc1OC)=O)=O)=O)N)=O LLERQVLVRRWUQB-MUUNZHRXSA-N 0.000 description 1
- GRZXYDOPKQHJJX-UHFFFAOYSA-N CC(C)C(NCc(cc1F)ccc1OC(C)=O)=O Chemical compound CC(C)C(NCc(cc1F)ccc1OC(C)=O)=O GRZXYDOPKQHJJX-UHFFFAOYSA-N 0.000 description 1
- UWQWLSXLMXIECC-UHFFFAOYSA-N CC(C)C(OCc(cc1F)cc(F)c1OC(SC)=O)=O Chemical compound CC(C)C(OCc(cc1F)cc(F)c1OC(SC)=O)=O UWQWLSXLMXIECC-UHFFFAOYSA-N 0.000 description 1
- RRLFXWQBCFQCRI-UHFFFAOYSA-N CC(C)C(OCc(cc1F)ccc1OC(S)=O)=O Chemical compound CC(C)C(OCc(cc1F)ccc1OC(S)=O)=O RRLFXWQBCFQCRI-UHFFFAOYSA-N 0.000 description 1
- DJCDDCXVMKTRGX-JTQLQIEISA-N CC(C)C([C@H](Cc1cnccc1)N)=O Chemical compound CC(C)C([C@H](Cc1cnccc1)N)=O DJCDDCXVMKTRGX-JTQLQIEISA-N 0.000 description 1
- OFUCECQHSZYGNW-UHFFFAOYSA-N CC(C)CCCNC(N)=N Chemical compound CC(C)CCCNC(N)=N OFUCECQHSZYGNW-UHFFFAOYSA-N 0.000 description 1
- NQCGHYWRKHKHFZ-UHFFFAOYSA-N CC(C)CNC(c(cc1)ccc1OC(C)=O)=O Chemical compound CC(C)CNC(c(cc1)ccc1OC(C)=O)=O NQCGHYWRKHKHFZ-UHFFFAOYSA-N 0.000 description 1
- DMJGYBAVIFIZLY-UHFFFAOYSA-N CC(C)CNC(c(cc1F)cc(F)c1OC(C)=O)=O Chemical compound CC(C)CNC(c(cc1F)cc(F)c1OC(C)=O)=O DMJGYBAVIFIZLY-UHFFFAOYSA-N 0.000 description 1
- BFVZXMREWLKCRF-UHFFFAOYSA-N CC(C)CNC(c(cc1F)ccc1OC(C)=O)=O Chemical compound CC(C)CNC(c(cc1F)ccc1OC(C)=O)=O BFVZXMREWLKCRF-UHFFFAOYSA-N 0.000 description 1
- FHXOKMGKMGVBQX-XISZIBLSSA-N CC(C)C[C@@H](C(NCC(N[C@@H](CCC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](Cc1c[nH]c2ccccc12)C(N[C@@H](CCCC[n]1nnc(CC[C@@H](C(N[C@@H](C)C(N[C@@H](Cc2c[nH]c3ccccc23)C(N[C@H]2Cc3c[nH]cn3)=O)=O)=O)N=C)c1)C(N[C@@H]([C@@H](C)O)C(N)=O)=O)=O)=O)=O)=O)=O)=O)NC2=O Chemical compound CC(C)C[C@@H](C(NCC(N[C@@H](CCC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](Cc1c[nH]c2ccccc12)C(N[C@@H](CCCC[n]1nnc(CC[C@@H](C(N[C@@H](C)C(N[C@@H](Cc2c[nH]c3ccccc23)C(N[C@H]2Cc3c[nH]cn3)=O)=O)=O)N=C)c1)C(N[C@@H]([C@@H](C)O)C(N)=O)=O)=O)=O)=O)=O)=O)=O)NC2=O FHXOKMGKMGVBQX-XISZIBLSSA-N 0.000 description 1
- DZGMTIQAHCEIIK-UHFFFAOYSA-N CC(C)NC(OCc(cc1)ccc1NC(C)=O)=O Chemical compound CC(C)NC(OCc(cc1)ccc1NC(C)=O)=O DZGMTIQAHCEIIK-UHFFFAOYSA-N 0.000 description 1
- XLDIRTKYCLFGRV-UHFFFAOYSA-N CC(C)NC(OCc(cc1F)ccc1NC(C)=O)=O Chemical compound CC(C)NC(OCc(cc1F)ccc1NC(C)=O)=O XLDIRTKYCLFGRV-UHFFFAOYSA-N 0.000 description 1
- XDKQMLJUJRHYGD-CQSZACIVSA-N CC(C)NC([C@@H](CCC1)N1C(N(C)c(cc1)cc(Cl)c1Cl)=O)=O Chemical compound CC(C)NC([C@@H](CCC1)N1C(N(C)c(cc1)cc(Cl)c1Cl)=O)=O XDKQMLJUJRHYGD-CQSZACIVSA-N 0.000 description 1
- GJKIAAKZYWVAKJ-UHFFFAOYSA-N CC(C)NC(c(cc1)cc([N+]([O-])=O)c1OC(C)=O)=O Chemical compound CC(C)NC(c(cc1)cc([N+]([O-])=O)c1OC(C)=O)=O GJKIAAKZYWVAKJ-UHFFFAOYSA-N 0.000 description 1
- GZZYRBSVOCTNTB-UHFFFAOYSA-N CC(C)OC(C1=CCCCC1S(Nc(c(F)cc(COC(C)=O)c1)c1F)(=O)=O)=O Chemical compound CC(C)OC(C1=CCCCC1S(Nc(c(F)cc(COC(C)=O)c1)c1F)(=O)=O)=O GZZYRBSVOCTNTB-UHFFFAOYSA-N 0.000 description 1
- XQPZSZYVRYXZAW-UIIMVTGHSA-N CC(C)[C@@H](C(C)=O)NC(C(Cc1c[nH]c2ccccc12)NC(CNC([C@H](CCCNC(N)=N)NC([C@H](Cc1c[nH]c2ccccc12)NC([C@H](Cc1c[nH]cn1)N)=O)=O)=O)=O)=O Chemical compound CC(C)[C@@H](C(C)=O)NC(C(Cc1c[nH]c2ccccc12)NC(CNC([C@H](CCCNC(N)=N)NC([C@H](Cc1c[nH]c2ccccc12)NC([C@H](Cc1c[nH]cn1)N)=O)=O)=O)=O)=O XQPZSZYVRYXZAW-UIIMVTGHSA-N 0.000 description 1
- RDCIQIIACBDJAC-WWPZGOAOSA-N CC(C)[C@@H](C(N[C@@H](Cc1c[nH]c2ccccc12)C(N[C@@H](Cc1ccccc1)C(C)=O)=O)=O)NC([C@H](CC(O)=O)NC([C@H](Cc(cc1)ccc1O)NC([C@H](Cc1c[nH]c2ccccc12)NC([C@H](Cc(cc1)ccc1O)NC([C@H](CO)NC(CNC)=O)=O)=O)=O)=O)=O Chemical compound CC(C)[C@@H](C(N[C@@H](Cc1c[nH]c2ccccc12)C(N[C@@H](Cc1ccccc1)C(C)=O)=O)=O)NC([C@H](CC(O)=O)NC([C@H](Cc(cc1)ccc1O)NC([C@H](Cc1c[nH]c2ccccc12)NC([C@H](Cc(cc1)ccc1O)NC([C@H](CO)NC(CNC)=O)=O)=O)=O)=O)=O RDCIQIIACBDJAC-WWPZGOAOSA-N 0.000 description 1
- DDBUWIIWHJBWLD-UHFFFAOYSA-N CC(NC(c(cc1)ccc1C(C)=O)=O)S Chemical compound CC(NC(c(cc1)ccc1C(C)=O)=O)S DDBUWIIWHJBWLD-UHFFFAOYSA-N 0.000 description 1
- OFMRRAQGSGKPCC-UHFFFAOYSA-N CC(NCc(cc1F)cc(F)c1NS(C1C(C(O)=O)=CCCC1)(=O)=O)=O Chemical compound CC(NCc(cc1F)cc(F)c1NS(C1C(C(O)=O)=CCCC1)(=O)=O)=O OFMRRAQGSGKPCC-UHFFFAOYSA-N 0.000 description 1
- MUFIAQJBLNMCGX-UHFFFAOYSA-N CC(NCc(cc1F)cc(F)c1OC(C)=O)=O Chemical compound CC(NCc(cc1F)cc(F)c1OC(C)=O)=O MUFIAQJBLNMCGX-UHFFFAOYSA-N 0.000 description 1
- IFFCICYPVAPPFO-UHFFFAOYSA-N CC(Nc(cc(cc1)OC(C)=O)c1F)=O Chemical compound CC(Nc(cc(cc1)OC(C)=O)c1F)=O IFFCICYPVAPPFO-UHFFFAOYSA-N 0.000 description 1
- ICSNDDKMIQQOKP-UHFFFAOYSA-N CC(Nc1ccc(COC(NC)=O)cc1)=O Chemical compound CC(Nc1ccc(COC(NC)=O)cc1)=O ICSNDDKMIQQOKP-UHFFFAOYSA-N 0.000 description 1
- IZMWRMWXMUXVNT-UHFFFAOYSA-N CC(O)Oc1ccc(CNC(C)=O)cc1 Chemical compound CC(O)Oc1ccc(CNC(C)=O)cc1 IZMWRMWXMUXVNT-UHFFFAOYSA-N 0.000 description 1
- ZRIPMUJCUKYVGM-UHFFFAOYSA-N CC(OCc(cc1F)ccc1NS(C1C(C(OC)=O)=CCCC1)(=O)=O)=O Chemical compound CC(OCc(cc1F)ccc1NS(C1C(C(OC)=O)=CCCC1)(=O)=O)=O ZRIPMUJCUKYVGM-UHFFFAOYSA-N 0.000 description 1
- BMGBUTGSECCKSN-UHFFFAOYSA-N CCCCC[n]1nnc(CCC)c1 Chemical compound CCCCC[n]1nnc(CCC)c1 BMGBUTGSECCKSN-UHFFFAOYSA-N 0.000 description 1
- MUBFGIKURIKWCA-UHFFFAOYSA-N CCCCNc1nc(NCc2cccc(F)c2)nc(NCCOCCOCCC(NCc(cc2)cc(F)c2O)=O)n1 Chemical compound CCCCNc1nc(NCc2cccc(F)c2)nc(NCCOCCOCCC(NCc(cc2)cc(F)c2O)=O)n1 MUBFGIKURIKWCA-UHFFFAOYSA-N 0.000 description 1
- ICJGWEHIDKUPCL-WGOFTBHKSA-N CCC[C@@H](C(N[C@@H](C(C)C)C(N[C@@H](Cc1c[nH]c2ccccc12)C(NC(CC1)(CCN1C(CC[C@@H](C(N[C@@H](C)C(NC(C1)(C1c1c[nH]c2c1cccc2)C(N[C@@H](Cc1c[nH]cn1)C(NC(CC(C)C)C(NCC(N[C@H]1CCC(O)=O)=O)=O)=O)=O)=O)=O)NC)=O)C(N[C@@H](C(C)O)C(N)=O)=O)=O)=O)=O)NC1=O Chemical compound CCC[C@@H](C(N[C@@H](C(C)C)C(N[C@@H](Cc1c[nH]c2ccccc12)C(NC(CC1)(CCN1C(CC[C@@H](C(N[C@@H](C)C(NC(C1)(C1c1c[nH]c2c1cccc2)C(N[C@@H](Cc1c[nH]cn1)C(NC(CC(C)C)C(NCC(N[C@H]1CCC(O)=O)=O)=O)=O)=O)=O)=O)NC)=O)C(N[C@@H](C(C)O)C(N)=O)=O)=O)=O)=O)NC1=O ICJGWEHIDKUPCL-WGOFTBHKSA-N 0.000 description 1
- NZHSAOPSTOLFPK-POGVJTHOSA-N CC[C@@H](C(NCC(N[C@@H](CCC(O)=O)C(N[C@@H](CCSC)C(N[C@@H](CC1CC1)C(N[C@@H](Cc1cnccc1)C(NCCCC(/C=N/C)C(N(CCC1)[C@H]1C(N[C@@H](Cc1c[s]cn1)C(N[C@H]1Cc2c[nH]cn2)=O)=O)=O)=O)=O)=O)=O)=O)=O)NC1=O Chemical compound CC[C@@H](C(NCC(N[C@@H](CCC(O)=O)C(N[C@@H](CCSC)C(N[C@@H](CC1CC1)C(N[C@@H](Cc1cnccc1)C(NCCCC(/C=N/C)C(N(CCC1)[C@H]1C(N[C@@H](Cc1c[s]cn1)C(N[C@H]1Cc2c[nH]cn2)=O)=O)=O)=O)=O)=O)=O)=O)=O)NC1=O NZHSAOPSTOLFPK-POGVJTHOSA-N 0.000 description 1
- IHHXYTIKYUHTQU-UHFFFAOYSA-N CCc1ccc(C(F)(F)F)cc1 Chemical compound CCc1ccc(C(F)(F)F)cc1 IHHXYTIKYUHTQU-UHFFFAOYSA-N 0.000 description 1
- KYEACNNYFNZCST-UHFFFAOYSA-N CN(C(CC1)=O)C1=O Chemical compound CN(C(CC1)=O)C1=O KYEACNNYFNZCST-UHFFFAOYSA-N 0.000 description 1
- DCENJQFJAWBFBO-LLVKDONJSA-N CNC([C@@H](CCC1)N1C(Nc1ccccc1)=O)=O Chemical compound CNC([C@@H](CCC1)N1C(Nc1ccccc1)=O)=O DCENJQFJAWBFBO-LLVKDONJSA-N 0.000 description 1
- IHSMKADSGAQNNM-UFYCRDLUSA-N CN[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O)=O)=O)=O Chemical compound CN[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O)=O)=O)=O IHSMKADSGAQNNM-UFYCRDLUSA-N 0.000 description 1
- YXDKYNKHLZIQAL-UHFFFAOYSA-N COc(ccc(NC(c1c[n](cc[s]2)c2n1)=O)c1)c1C(NCCCC(O)=O)=O Chemical compound COc(ccc(NC(c1c[n](cc[s]2)c2n1)=O)c1)c1C(NCCCC(O)=O)=O YXDKYNKHLZIQAL-UHFFFAOYSA-N 0.000 description 1
- RSJHBGNNGMWNPX-BJDJZHNGSA-N C[C@@H](C(N(CCC1)[C@@H]1C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(I)=O)=O)=O)=O)N Chemical compound C[C@@H](C(N(CCC1)[C@@H]1C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(I)=O)=O)=O)=O)N RSJHBGNNGMWNPX-BJDJZHNGSA-N 0.000 description 1
- VEQTUKNWSAVDJU-YRJXDFQMSA-N C[C@@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](Cc1ccccc1)C(N[C@@H](Cc(cc1)ccc1O)C(N[C@@H](CCCCN)C(C)=O)=O)=O)=O)=O)=O)NC([C@H](CC(N)=O)N)=O Chemical compound C[C@@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](Cc1ccccc1)C(N[C@@H](Cc(cc1)ccc1O)C(N[C@@H](CCCCN)C(C)=O)=O)=O)=O)=O)=O)NC([C@H](CC(N)=O)N)=O VEQTUKNWSAVDJU-YRJXDFQMSA-N 0.000 description 1
- GKBFLGYRMQHFDE-RKDXNWHRSA-N C[C@@H]([C@H](CCC1)CCc2c1nn[n]2N)C=N Chemical compound C[C@@H]([C@H](CCC1)CCc2c1nn[n]2N)C=N GKBFLGYRMQHFDE-RKDXNWHRSA-N 0.000 description 1
- ORLDODHBZMZGAH-HRDYMLBCSA-N C[C@@H]1[C@H](CC2)[C@@H]1CCc1c2nn[n]1C Chemical compound C[C@@H]1[C@H](CC2)[C@@H]1CCc1c2nn[n]1C ORLDODHBZMZGAH-HRDYMLBCSA-N 0.000 description 1
- GPVAOFRRZVHTOX-VTRWRZSMSA-N C[C@H]([C@@H](C(N)=O)NC([C@H](CCCC[n]1nnc(CC[C@@H](C(C)=O)NC([C@H](CC(O)=O)NC)=O)c1)NC)=O)O Chemical compound C[C@H]([C@@H](C(N)=O)NC([C@H](CCCC[n]1nnc(CC[C@@H](C(C)=O)NC([C@H](CC(O)=O)NC)=O)c1)NC)=O)O GPVAOFRRZVHTOX-VTRWRZSMSA-N 0.000 description 1
- KBRQREDMYGHNDO-RVFOSREFSA-N C[C@H]([C@@H](C(N)=O)NC([C@H](CCCNC(C[C@@H](C(C)=O)NC([C@H](CC(O)=O)NC)=O)=O)NC)=O)O Chemical compound C[C@H]([C@@H](C(N)=O)NC([C@H](CCCNC(C[C@@H](C(C)=O)NC([C@H](CC(O)=O)NC)=O)=O)NC)=O)O KBRQREDMYGHNDO-RVFOSREFSA-N 0.000 description 1
- YYNNFHAMDMWEAM-BLDNINTCSA-N C[C@H]([C@@H](C(N)=O)NC([C@H](CCSCC[C@@H](C(C)=O)NC([C@H](CC(O)=O)NC)=O)NC)=O)O Chemical compound C[C@H]([C@@H](C(N)=O)NC([C@H](CCSCC[C@@H](C(C)=O)NC([C@H](CC(O)=O)NC)=O)NC)=O)O YYNNFHAMDMWEAM-BLDNINTCSA-N 0.000 description 1
- VFCCNSDQMLZGFI-UHFFFAOYSA-N C[n]1c(ccc(C(Nc2nc(-c3ncccc3)c[s]2)=O)c2)c2nc1 Chemical compound C[n]1c(ccc(C(Nc2nc(-c3ncccc3)c[s]2)=O)c2)c2nc1 VFCCNSDQMLZGFI-UHFFFAOYSA-N 0.000 description 1
- NLIOVTBTQHQXHO-UHFFFAOYSA-N Cc(c(F)c1)ccc1S Chemical compound Cc(c(F)c1)ccc1S NLIOVTBTQHQXHO-UHFFFAOYSA-N 0.000 description 1
- BYFNZOKBMZKTSC-UHFFFAOYSA-N Cc1cc([N+]([O-])=O)cc(C)c1 Chemical compound Cc1cc([N+]([O-])=O)cc(C)c1 BYFNZOKBMZKTSC-UHFFFAOYSA-N 0.000 description 1
- WZLHWOFRHIRGER-UHFFFAOYSA-N Cc1nc(cc(cc2)C(Nc3nc(-c4ccccn4)c[s]3)=O)c2[n]1C Chemical compound Cc1nc(cc(cc2)C(Nc3nc(-c4ccccn4)c[s]3)=O)c2[n]1C WZLHWOFRHIRGER-UHFFFAOYSA-N 0.000 description 1
- GRNBARVPSATNSI-XSVPUZAPSA-N NC(NCCC[C@@H](C(NCC(N[C@@H](CC1c(cccc2)c2NC1)C(O)=O)=O)=O)NC([C@H](CCCNC(N)=N)NC(CCOCCOCCOCCOCCOCCOCCOCCOCCNC(c(cc1)ccc1OC(CCOCCOCCOCCOCCOCCOCCNC(Nc1ccc(C(c(ccc(O)c2)c2Oc2c3)(c2ccc3O)OC2=O)c2c1)=S)=O)=O)=O)=O)=N Chemical compound NC(NCCC[C@@H](C(NCC(N[C@@H](CC1c(cccc2)c2NC1)C(O)=O)=O)=O)NC([C@H](CCCNC(N)=N)NC(CCOCCOCCOCCOCCOCCOCCOCCOCCNC(c(cc1)ccc1OC(CCOCCOCCOCCOCCOCCOCCNC(Nc1ccc(C(c(ccc(O)c2)c2Oc2c3)(c2ccc3O)OC2=O)c2c1)=S)=O)=O)=O)=O)=N GRNBARVPSATNSI-XSVPUZAPSA-N 0.000 description 1
- HYZLWMHMOCWKDL-UHFFFAOYSA-N NCCOCCOCCOCCOCCNC(CCCNC(CCCc1c[nH]c2c1cccc2)=O)=O Chemical compound NCCOCCOCCOCCOCCNC(CCCNC(CCCc1c[nH]c2c1cccc2)=O)=O HYZLWMHMOCWKDL-UHFFFAOYSA-N 0.000 description 1
- RQUZQOIUPJVKGS-QMMMGPOBSA-N N[C@@H](CC(NCc(cc1)cc(F)c1O)=O)C(O)=O Chemical compound N[C@@H](CC(NCc(cc1)cc(F)c1O)=O)C(O)=O RQUZQOIUPJVKGS-QMMMGPOBSA-N 0.000 description 1
- SIWSXOIXKUSMOB-VIFPVBQESA-N N[C@@H](CC(NCc(cc1)ccc1O)=O)C(O)=O Chemical compound N[C@@H](CC(NCc(cc1)ccc1O)=O)C(O)=O SIWSXOIXKUSMOB-VIFPVBQESA-N 0.000 description 1
- FRTMMAXKRCVQJG-QMMMGPOBSA-N N[C@@H](CCC(Nc(cc(cc1)O)c1F)=O)C(O)=O Chemical compound N[C@@H](CCC(Nc(cc(cc1)O)c1F)=O)C(O)=O FRTMMAXKRCVQJG-QMMMGPOBSA-N 0.000 description 1
- JTEDVYBZBROSJT-UHFFFAOYSA-N OC(CCCc1c[nH]c2ccccc12)=O Chemical compound OC(CCCc1c[nH]c2ccccc12)=O JTEDVYBZBROSJT-UHFFFAOYSA-N 0.000 description 1
- MKNYNHWBBNLWHN-UHFFFAOYSA-N Oc(c(F)cc(CNC(CCCc1c[nH]c2c1cccc2)=O)c1)c1F Chemical compound Oc(c(F)cc(CNC(CCCc1c[nH]c2c1cccc2)=O)c1)c1F MKNYNHWBBNLWHN-UHFFFAOYSA-N 0.000 description 1
- RHMPLDJJXGPMEX-UHFFFAOYSA-N Oc(cc1)ccc1F Chemical compound Oc(cc1)ccc1F RHMPLDJJXGPMEX-UHFFFAOYSA-N 0.000 description 1
- WRIZFUVYABPOLN-UHFFFAOYSA-N Sc1cc2ccccc2cn1 Chemical compound Sc1cc2ccccc2cn1 WRIZFUVYABPOLN-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6889—Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/545—Heterocyclic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6855—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6875—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody being a hybrid immunoglobulin
- A61K47/6879—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody being a hybrid immunoglobulin the immunoglobulin having two or more different antigen-binding sites, e.g. bispecific or multispecific immunoglobulin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C229/00—Compounds containing amino and carboxyl groups bound to the same carbon skeleton
- C07C229/02—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton
- C07C229/34—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton containing six-membered aromatic rings
- C07C229/36—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton containing six-membered aromatic rings with at least one amino group and one carboxyl group bound to the same carbon atom of the carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C237/00—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups
- C07C237/02—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups having the carbon atoms of the carboxamide groups bound to acyclic carbon atoms of the carbon skeleton
- C07C237/14—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups having the carbon atoms of the carboxamide groups bound to acyclic carbon atoms of the carbon skeleton the carbon skeleton being saturated and containing rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C237/00—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups
- C07C237/02—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups having the carbon atoms of the carboxamide groups bound to acyclic carbon atoms of the carbon skeleton
- C07C237/20—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups having the carbon atoms of the carboxamide groups bound to acyclic carbon atoms of the carbon skeleton the carbon skeleton containing six-membered aromatic rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C311/00—Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
- C07C311/30—Sulfonamides, the carbon skeleton of the acid part being further substituted by singly-bound nitrogen atoms, not being part of nitro or nitroso groups
- C07C311/36—Sulfonamides, the carbon skeleton of the acid part being further substituted by singly-bound nitrogen atoms, not being part of nitro or nitroso groups having the sulfur atom of at least one of the sulfonamide groups bound to a carbon atom of a ring other than a six-membered aromatic ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C2601/00—Systems containing only non-condensed rings
- C07C2601/12—Systems containing only non-condensed rings with a six-membered ring
- C07C2601/14—The ring being saturated
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C2603/00—Systems containing at least three condensed rings
- C07C2603/02—Ortho- or ortho- and peri-condensed systems
- C07C2603/04—Ortho- or ortho- and peri-condensed systems containing three rings
- C07C2603/06—Ortho- or ortho- and peri-condensed systems containing three rings containing at least one ring with less than six ring members
- C07C2603/10—Ortho- or ortho- and peri-condensed systems containing three rings containing at least one ring with less than six ring members containing five-membered rings
- C07C2603/12—Ortho- or ortho- and peri-condensed systems containing three rings containing at least one ring with less than six ring members containing five-membered rings only one five-membered ring
- C07C2603/18—Fluorenes; Hydrogenated fluorenes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2875—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- reactions conjugating moieties of interest e.g., detection moieties, drug moieties, etc.
- target molecules e.g., antibodies for antibody-drug conjugates
- product conjugate compositions are often highly heterogeneous, comprising a number of individual conjugate types each independently having its own copy number of moieties of interest, conjugation locations (e.g., different amino acid residues of proteins), etc.
- manufacturing of conjugates involves multiple steps and includes various reactions, such as reduction, oxidation, hydrolysis, etc., and such reactions may cause undesired transformations, e.g., at one or more locations of target agent moieties (e.g., at one or more residues, and/or one or more modifications (e.g., glycans) of antibody moieties). Such undesired transformations may further lower efficiency and/or increase heterogeneity of product conjugate compositions, complicate characterization, assessment and/or purification processes and increase product cost.
- the present disclosure provides conjugation technologies for conjugating various moieties of interest to targets (e.g., proteins).
- provided technologies provide directed conjugation in that moieties of interest are selectively conjugated at certain locations of targets (e.g., proteins such as antibodies). In some embodiments, provided technologies utilizes fewer steps. In some embodiments, provided technologies utilizes mild reaction conditions. In some embodiments, provided technologies include no reaction conditions such as reduction, oxidation, and/or hydrolysis. In some embodiments, provided technologies include substantially no cleavage from conjugate molecules comprising target agent moieties and moieties of interest (e.g., no cleavage of a group from target agent moieties, moieties of interest and/or linker moieties). In some embodiments, moieties of interest are detectable moieties (e.g., FITC).
- targets e.g., proteins such as antibodies.
- provided technologies utilizes fewer steps. In some embodiments, provided technologies utilizes mild reaction conditions. In some embodiments, provided technologies include no reaction conditions such as reduction, oxidation, and/or hydrolysis. In some embodiments, provided technologies include substantially no cleavage
- moieties of interest are drug moieties (e.g., various drug moieties utilized in antibody-drug conjugates).
- moieties of interest are protein moieties (e.g., antibody agents conjugated to other antibody agents (as target agent moieties)).
- moieties of interest are or comprise reaction groups.
- moieties of interest are or comprise reaction groups so that other moieties of interest can be further incorporated through reactions at the reaction groups.
- the present disclosure provides improved efficiency and/or selectivity, reduced levels of heterogeneity, and/or reduced undesired transformations (e.g., through fewer steps of reactions (in some embodiments, only one), avoidance of certain reaction conditions (e.g., reduction, oxidation, hydrolysis, etc.).
- the present disclosure provides agents comprising moieties of interest are conjugated at certain locations of target agent moieties.
- the present disclosure provides compositions of increased homogeneity compared to compositions from a reference technology (e.g., a technology without using target binding moieties (e.g., LG) as described in provided methods).
- a reference technology e.g., a technology without using target binding moieties (e.g., LG) as described in provided methods.
- 1 daratumumab
- 2 I-45, 2.5 Eq, 1 mg/ml
- 3 I-45, 3.0 Eq, 1 mg/ml
- 4 I-45, 3.5 Eq, 1 mg/ml
- 6 I-9, 3.0 Eq, 1 mg/ml
- 7 I-9, 3.5 Eq, 1 mg/ml
- 8 I-45, 2.5 Eq, 4 mg/ml
- 9 I-45, 3.0 Eq, 4 mg/ml
- 10 I-45, 3.5 Eq, 4 mg/ml
- 12 I-9, 3.0 Eq, 4 mg/ml
- 13 I-9, 3.5 Eq, 4 mg/ml.
- FIG. 1 Western blot data showing that provided technologies can provide various advantages (e.g., improved efficiency, improved selectivity, etc. without extra reaction steps). Certain reactions were as described in Table 30-10.
- FIG. 7 Antibody conjugates maintain properties/activities of antibodies. Reactions were set up with daratumumab using 30 M eq of indicated reagent in borate buffer pH 8.3 for 20h at 37 °C. From left to right: daratumumab; conjugates using I-46; I-24; I-25, I-35, 8: I-36, and I-37; no antibody. [0014] Figure 8. Antibody conjugates maintain properties/activities of antibodies. Reactions were set up with daratumumab using 5 M eq of indicated reagent in bicarbonate buffer pH 8.3 for 20h at 37 °C.
- Figure 12. Certain intact mass data of daratumumab conjugated with I-45 as examples.
- (a) FITC DAR is 0.43.
- (b) FITC DAR is 1.09.
- (c) FITC DAR is 0.90.
- Figure 13 Certain peptide mapping data of daratumumab conjugated with I-45 as examples.
- (a) FITC DAR is 0.43.
- (b) FITC DAR is 1.09.
- FITC DAR is 0.90.
- Figure 14 Certain intact mass data of daratumumab conjugated with I-9 as examples.
- Figure 19 Provided agents comprising multiple antibody agent moieties can provide additional properties and/or activities compared to individual antibody agent moieties.
- III-1 CD20 x CD3
- CD3 can be a component of T-cell receptor complex.
- incorporation of CD3 can provide antibody function responsible for T-cell recruitment and activities.
- Figure 20 Provided agents comprising multiple antibody agent moieties maintain properties and/or activities of individual antibody agent moieties.
- III-1 (CD20 x CD3) maintains its binding to CD16 Fc receptor (CD16a-V158), and its function responsible for NK cell recruitment. Shown are ELISA data.
- Figure 21 Provided agents comprising multiple antibody agent moieties maintain or improve properties and/or activities of individual antibody agent moieties.
- III-1 (CD20 x CD3) maintains or even improved its binding to FcRn Fc receptor, indicating that antibody recycling mechanism is maintained.
- Figure 22 Provided technologies can provide selective conjugation at certain sites. As shown, I-44 can selectively provide conjugation at sites 246 or 248 of heavy chains (A) compared to a reference compound, e.g., I-10 (B).
- Figure 23 Figure 23.
- Provided technologies can effectively remove agents comprising released target binding moieties from reactions. Demonstrated herein is removal of certain target binding moiety by treatment with acidic solutions.
- Figure 24 Provided technologies can provide antibody-antibody conjugates. Illustrated are certain data for trastuzumab (TRA)-cetuximab (CTX) bispecific antibodies.
- Figure 25 Provided antibody-antibody conjugates bind to targets of each antibody. For example, certain data from ELISA binding assays confirm that a trastuzumab (TRA)-cetuximab (CTX) conjugate binds to both HER2 and EGFR.
- Figure 26 Provided antibody-antibody conjugates bind to Fc receptors.
- TRA trastuzumab
- CX cetuximab
- Provided technologies can provide highly efficient and/or selective conjugation for various types of antibody agents.
- provided technologies e.g., I- 44
- Provided technologies can provide highly efficient and/or selective conjugation for various types of antibody agents.
- provided technologies can among other things provide efficient and specific conjugation for an IgG4 antibody Nivolumab.
- Provided technologies can provide scFv-antibody conjugates with high activities.
- a CD3(scFv)-rituximab conjugate can activate T-cells (A) with minimal IL6 (B) increase, and can be up to 10x more potent in B-cell depletion (C).
- Figure 30 Provided technologies can activates various effector cells. In some embodiments, as shown in Figure 30 III-1 can activate PBMC effector cells.
- T cell receptor (TCR)/CD3 engagement and T cell activation effector Jurkat cells stably expressing NFAT-RE upstream of luciferase were used. Activation was measured by luminescence. For effector + target, EC50 is 0.10 nM for III-1, and 0.56 nM for Fc silent III-1. For effector only, EC 50 is >10 nM for both III-1 and Fc silent III-1.
- B In some embodiments, PBMCs were stained with fluorescently-labeled anti-human antibodies specific for CD2, CD56, CD14, and CD19, and PBMC subpopulations were analyzed for CD69 activation marker by flow cytometry. [0037] Figure 31.
- A Daudi (CD20 + ) B lymphoblast cells were engineered to stably express a beta-gal reporter fragment using KILR retroparticles (Eurofins DiscoverX). Target cells were treated with III-1, rituximab, and relevant controls at varying concentrations. Effector cells from unfractionated and NK cell-depleted PBMCs were prepared from freshly-thawed or PHA + IL-2 prestimulated (5 days) PBMCs. Cells were cultured at an effector:target ratio of 15:1 and incubated for 18 hrs. Luminescence signal was obtained with luminometer to reflect target cell death.
- FIG. 32 A-431 (EGFR + ) epidermoid carcinoma cells were treated with varying concentrations of cetuximab (CTX)-CD3 MATE, control mAbs, or scFv. Target cell death was measured using CytoTox-Glo reagent (Promega).
- CTX cetuximab
- FIG. 32 Certain compositions may induce activating and inflammatory cytokines in a target cell-dependent manner in vitro. Freshly-thawed unfractionated PBMCs were cultured with (20:1 effector-to-target ratio) or without Daudi target cells, and treated with varying concentrations of III-1, rituximab, or control scFv (not shown) for 18 hrs.
- FIG. 33 Provided technologies can provide activities with minimal increase of pro- inflamatory cytokines/chemokines levels in vivo.
- T cells were identified as CD45 + CD3 + , and activation was marked by CD69 and CD44.
- B cells were identified as CD45 + CD3-CD14-NKG2A- HLADR + . Absolute numbers and frequency of immune cell subsets were monitored.
- human PBMCs were treated in vitro for 18 hrs and identified as CD19 + , and percent of PBMCs was calculated.
- the term “a” or “an” may be understood to mean “at least one”; (ii) the term “or” may be understood to mean “and/or”; (iii) the terms “comprising”, “comprise”, “including” (whether used with “not limited to” or not), and “include” (whether used with “not limited to” or not) may be understood to encompass itemized components or steps whether presented by themselves or together with one or more additional components or steps; (iv) the term “another” may be understood to mean at least an additional/second one or more; (v) the terms “about” and “approximately” may be understood to permit standard variation as would be understood by those of ordinary skill in the art; and (vi) where ranges are provided, endpoints are included.
- agents described herein may be provided and/or utilized in a salt form, particularly a pharmaceutically acceptable salt form.
- agent may be used to refer to a compound or entity of any chemical class including, for example, a polypeptide, nucleic acid, saccharide, lipid, small molecule, metal, or combination or complex thereof.
- the term may be utilized to refer to an entity that is or comprises a cell or organism, or a fraction, extract, or component thereof.
- the term may be used to refer to a natural product in that it is found in and/or is obtained from nature.
- the term may be used to refer to one or more entities that is man-made in that it is designed, engineered, and/or produced through action of the hand of man and/or is not found in nature.
- an agent may be utilized in isolated or pure form; in some embodiments, an agent may be utilized in crude form.
- potential agents may be provided as collections or libraries, for example that may be screened to identify or characterize active agents within them.
- the term “agent” may refer to a compound or entity that is or comprises a polymer; in some cases, the term may refer to a compound or entity that comprises one or more polymeric moieties.
- the term “agent” may refer to a compound or entity that is not a polymer and/or is substantially free of any polymer and/or of one or more particular polymeric moieties. In some embodiments, the term may refer to a compound or entity that lacks or is substantially free of any polymeric moiety.
- an agent is a compound (e.g., a small molecule, a protein, a nucleic acid, etc.). In some embodiments, an agent is a mono-, bi- or polyvalent moiety of a compound (e.g., by removing one (for a monovalent moiety) or more (for a bi- or polyvalent moiety) hydrogen atoms and/or other monovalent groups from a compound).
- Aliphatic means a straight-chain (i.e., unbranched) or branched, substituted or unsubstituted hydrocarbon chain that is completely saturated or that contains one or more units of unsaturation, or a substituted or unsubstituted monocyclic, bicyclic, or polycyclic hydrocarbon ring that is completely saturated or that contains one or more units of unsaturation (but not aromatic), or combinations thereof.
- aliphatic groups contain 1-50 aliphatic carbon atoms. In some embodiments, aliphatic groups contain 1-20 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-10 aliphatic carbon atoms.
- aliphatic groups contain 1-9 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-8 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-7 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-6 aliphatic carbon atoms. In still other embodiments, aliphatic groups contain 1-5 aliphatic carbon atoms, and in yet other embodiments, aliphatic groups contain 1, 2, 3, or 4 aliphatic carbon atoms.
- Suitable aliphatic groups include, but are not limited to, linear or branched, substituted or unsubstituted alkyl, alkenyl, alkynyl groups and hybrids thereof such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl or (cycloalkyl)alkenyl.
- Alkenyl As used herein, the term “alkenyl” refers to an aliphatic group, as defined herein, having one or more double bonds.
- Alkyl As used herein, the term “alkyl” is given its ordinary meaning in the art and may include saturated aliphatic groups, including straight-chain alkyl groups, branched-chain alkyl groups, cycloalkyl (alicyclic) groups, alkyl substituted cycloalkyl groups, and cycloalkyl substituted alkyl groups. In some embodiments, an alkyl has 1-100 carbon atoms. In certain embodiments, a straight chain or branched chain alkyl has about 1-20 carbon atoms in its backbone (e.g., C 1 -C 20 for straight chain, C 2 -C 20 for branched chain), and alternatively, about 1-10.
- cycloalkyl rings have from about 3-10 carbon atoms in their ring structure where such rings are monocyclic, bicyclic, or polycyclic, and alternatively about 5, 6 or 7 carbons in the ring structure.
- an alkyl group may be a lower alkyl group, wherein a lower alkyl group comprises 1-4 carbon atoms (e.g., C 1 -C 4 for straight chain lower alkyls).
- Alkynyl As used herein, the term “alkynyl” refers to an aliphatic group, as defined herein, having one or more triple bonds.
- Aryl refers to monocyclic, bicyclic or polycyclic ring systems having a total of five to thirty ring members, wherein at least one ring in the system is aromatic.
- an aryl group is a monocyclic, bicyclic or polycyclic ring system having a total of five to fourteen ring members, wherein at least one ring in the system is aromatic, and wherein each ring in the system contains 3 to 7 ring members.
- an aryl group is a biaryl group.
- aryl may be used interchangeably with the term “aryl ring.”
- aryl refers to an aromatic ring system which includes, but is not limited to, phenyl, biphenyl, naphthyl, binaphthyl, anthracyl and the like, which may bear one or more substituents.
- aryl is a group in which an aromatic ring is fused to one or more non–aromatic rings, such as indanyl, phthalimidyl, naphthimidyl, phenanthridinyl, or tetrahydronaphthyl, and the like.
- Antibody refers to a polypeptide that includes canonical immunoglobulin sequence elements sufficient to confer specific binding to a particular target antigen. As is known in the art, intact antibodies as produced in nature are approximately 150 kD tetrameric agents comprised of two identical heavy chain polypeptides (about 50 kD each) and two identical light chain polypeptides (about 25 kD each) that associate with each other into what is commonly referred to as a “Y-shaped” structure.
- Each heavy chain is comprised of at least four domains (each about 110 amino acids long)– an amino-terminal variable (VH) domain (located at the tips of the Y structure), followed by three constant domains: CH1, CH2, and the carboxy-terminal CH3 (located at the base of the Y’s stem).
- VH amino-terminal variable
- CH1, CH2, and the carboxy-terminal CH3 located at the base of the Y’s stem.
- a short region known as the “switch”, connects the heavy chain variable and constant regions.
- the “hinge” connects CH2 and CH3 domains to the rest of the antibody. Two disulfide bonds in this hinge region connect the two heavy chain polypeptides to one another in an intact antibody.
- Each light chain is comprised of two domains – an amino-terminal variable (VL) domain, followed by a carboxy-terminal constant (CL) domain, separated from one another by another “switch”.
- Intact antibody tetramers are comprised of two heavy chain-light chain dimers in which the heavy and light chains are linked to one another by a single disulfide bond; two other disulfide bonds connect the heavy chain hinge regions to one another, so that the dimers are connected to one another and the tetramer is formed.
- Naturally-produced antibodies are also glycosylated, typically on the CH2 domain.
- Each domain in a natural antibody has a structure characterized by an “immunoglobulin fold” formed from two beta sheets (e.g., 3-, 4-, or 5-stranded sheets) packed against each other in a compressed antiparallel beta barrel.
- Each variable domain contains three hypervariable loops known as “complement determining regions” (CDR1, CDR2, and CDR3) and four somewhat invariant “framework” regions (FR1, FR2, FR3, and FR4).
- CDR1, CDR2, and CDR3 three hypervariable loops known as “complement determining regions” (CDR1, CDR2, and CDR3) and four somewhat invariant “framework” regions (FR1, FR2, FR3, and FR4).
- the Fc region of naturally-occurring antibodies binds to elements of the complement system, and also to receptors on effector cells, including for example effector cells that mediate cytotoxicity.
- affinity and/or other binding attributes of Fc regions for Fc receptors can be modulated through glycosylation or other modification.
- antibodies produced and/or utilized in accordance with the present disclosure include glycosylated Fc domains, including Fc domains with modified or engineered such glycosylation.
- any polypeptide or complex of polypeptides that includes sufficient immunoglobulin domain sequences as found in natural antibodies can be referred to and/or used as an “antibody”, whether such polypeptide is naturally produced (e.g., generated by an organism reacting to an antigen), or produced by recombinant engineering, chemical synthesis, or other artificial system or methodology.
- an antibody is polyclonal; in some embodiments, an antibody is monoclonal.
- an antibody has constant region sequences that are characteristic of mouse, rabbit, primate, or human antibodies.
- antibody sequence elements are humanized, primatized, chimeric, etc., as is known in the art.
- an antibody utilized in accordance with the present disclosure is in a format selected from, but not limited to, intact IgA, IgG, IgE or IgM antibodies; bi- or multi- specific antibodies (e.g., Zybodies ® , additional bi- or multi- specific antibodies described in Ulrich Brinkmann & Roland E.
- antibodies may have enhanced Fc domains.
- antibodies may comprise one or more unnatural amino acid residues.
- an antibody may lack a covalent modification (e.g., attachment of a glycan) that it would have if produced naturally.
- an antibody is an afucosylated antibody.
- an antibody is conjugated with another entity.
- an antibody may contain a covalent modification (e.g., attachment of a glycan, a payload [e.g., a detectable moiety, a therapeutic moiety, a catalytic moiety, etc], or other pendant group [e.g., poly- ethylene glycol, etc.]).
- Comparable refers to two or more agents, entities, situations, sets of conditions, etc., that may not be identical to one another but that are sufficiently similar to permit comparison there between so that one skilled in the art will appreciate that conclusions may reasonably be drawn based on differences or similarities observed.
- comparable sets of conditions, circumstances, individuals, or populations are characterized by a plurality of substantially identical features and one or a small number of varied features.
- Cycloaliphatic The term “cycloaliphatic,” “carbocycle,” “carbocyclyl,” “carbocyclic radical,” and “carbocyclic ring,” are used interchangeably, and as used herein, refer to saturated or partially unsaturated, but non-aromatic, cyclic aliphatic monocyclic, bicyclic, or polycyclic ring systems, as described herein, having, unless otherwise specified, from 3 to 30 ring members.
- Cycloaliphatic groups include, without limitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, cycloheptenyl, cyclooctyl, cyclooctenyl, norbornyl, adamantyl, and cyclooctadienyl.
- a cycloaliphatic group has 3–6 carbons.
- a cycloaliphatic group is saturated and is cycloalkyl.
- cycloaliphatic may also include aliphatic rings that are fused to one or more aromatic or nonaromatic rings, such as decahydronaphthyl or tetrahydronaphthyl.
- a cycloaliphatic group is bicyclic.
- a cycloaliphatic group is tricyclic.
- a cycloaliphatic group is polycyclic.
- cycloaliphatic refers to C 3 -C 6 monocyclic hydrocarbon, or C 8 -C 10 bicyclic or polycyclic hydrocarbon, that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic, that has a single point of attachment to the rest of the molecule, or a C 9 -C 16 polycyclic hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic, that has a single point of attachment to the rest of the molecule.
- Heteroaliphatic The term “heteroaliphatic”, as used herein, is given its ordinary meaning in the art and refers to aliphatic groups as described herein in which one or more carbon atoms are independently replaced with one or more heteroatoms (e.g., oxygen, nitrogen, sulfur, silicon, phosphorus, and the like). In some embodiments, one or more units selected from C, CH, CH 2 , and CH 3 are independently replaced by one or more heteroatoms (including oxidized and/or substituted forms thereof). In some embodiments, a heteroaliphatic group is heteroalkyl. In some embodiments, a heteroaliphatic group is heteroalkenyl.
- Heteroalkyl The term “heteroalkyl”, as used herein, is given its ordinary meaning in the art and refers to alkyl groups as described herein in which one or more carbon atoms are independently replaced with one or more heteroatoms (e.g., oxygen, nitrogen, sulfur, silicon, phosphorus, and the like).
- heteroalkyl groups include, but are not limited to, alkoxy, poly(ethylene glycol)-, alkyl- substituted amino, tetrahydrofuranyl, piperidinyl, morpholinyl, etc.
- Heteroaryl refers to monocyclic, bicyclic or polycyclic ring systems having a total of five to thirty ring members, wherein at least one ring in the system is aromatic and at least one aromatic ring atom is a heteroatom.
- a heteroaryl group is a group having 5 to 10 ring atoms (i.e., monocyclic, bicyclic or polycyclic), in some embodiments 5, 6, 9, or 10 ring atoms.
- a heteroaryl group has 6, 10, or 14 ⁇ electrons shared in a cyclic array; and having, in addition to carbon atoms, from one to five heteroatoms.
- Heteroaryl groups include, without limitation, thienyl, furanyl, pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, indolizinyl, purinyl, naphthyridinyl, and pteridinyl.
- a heteroaryl is a heterobiaryl group, such as bipyridyl and the like.
- heteroaryl and heteroheteroar— also include groups in which a heteroaromatic ring is fused to one or more aryl, cycloaliphatic, or heterocyclyl rings, where the radical or point of attachment is on the heteroaromatic ring.
- Non-limiting examples include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, 4H–quinolizinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, and pyrido[2,3–b]–1,4–oxazin–3(4H)–one.
- heteroaryl group may be monocyclic, bicyclic or polycyclic.
- heteroaryl may be used interchangeably with the terms “heteroaryl ring,” “heteroaryl group,” or “heteroaromatic,” any of which terms include rings that are optionally substituted.
- heteroarylkyl refers to an alkyl group substituted by a heteroaryl group, wherein the alkyl and heteroaryl portions independently are optionally substituted.
- a heteroatom is boron, oxygen, sulfur, nitrogen, phosphorus, or silicon (including various forms of such atoms, such as oxidized forms (e.g., of nitrogen, sulfur, phosphorus, or silicon), quaternized form of a basic nitrogen or a substitutable nitrogen of a heterocyclic ring (for example, N as in 3,4-dihydro-2H-pyrrolyl), NH (as in pyrrolidinyl) or NR + (as in N-substituted pyrrolidinyl) etc.).
- a heteroatom is oxygen, sulfur or nitrogen.
- Heterocycle As used herein, the terms “heterocycle,” “heterocyclyl,” “heterocyclic radical,” and “heterocyclic ring”, as used herein, are used interchangeably and refer to a monocyclic, bicyclic or polycyclic ring moiety (e.g., 3-30 membered) that is saturated or partially unsaturated and has one or more heteroatom ring atoms.
- a heterocyclyl group is a stable 5– to 7– membered monocyclic or 7– to 10–membered bicyclic heterocyclic moiety that is either saturated or partially unsaturated, and having, in addition to carbon atoms, one or more, preferably one to four, heteroatoms, as defined above.
- nitrogen includes substituted nitrogen.
- the nitrogen may be N (as in 3,4–dihydro– 2H–pyrrolyl), NH (as in pyrrolidinyl), or + NR (as in N–substituted pyrrolidinyl).
- a heterocyclic ring can be attached to its pendant group at any heteroatom or carbon atom that results in a stable structure and any of the ring atoms can be optionally substituted.
- saturated or partially unsaturated heterocyclic radicals include, without limitation, tetrahydrofuranyl, tetrahydrothienyl, pyrrolidinyl, piperidinyl, pyrrolinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, oxazolidinyl, piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl, thiazepinyl, morpholinyl, and quinuclidinyl.
- heterocycle used interchangeably herein, and also include groups in which a heterocyclyl ring is fused to one or more aryl, heteroaryl, or cycloaliphatic rings, such as indolinyl, 3H– indolyl, chromanyl, phenanthridinyl, or tetrahydroquinolinyl.
- a heterocyclyl group may be monocyclic, bicyclic or polycyclic.
- heterocyclylalkyl refers to an alkyl group substituted by a heterocyclyl, wherein the alkyl and heterocyclyl portions independently are optionally substituted.
- Lower alkyl refers to a C 1-4 straight or branched alkyl group. Example lower alkyl groups are methyl, ethyl, propyl, isopropyl, butyl, isobutyl, and tert-butyl.
- Lower haloalkyl The term “lower haloalkyl” refers to a C 1-4 straight or branched alkyl group that is substituted with one or more halogen atoms.
- compounds of the disclosure may contain optionally substituted and/or substituted moieties.
- substituted whether preceded by the term “optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent.
- an “optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position.
- an optionally substituted group is unsubstituted.
- Suitable monovalent substituents on R o are independently halogen, —(CH 2 ) 0–2 R ⁇ , – (haloR ⁇ ), –(CH 2 ) 0–2 OH, –(CH 2 ) 0–2 OR ⁇ , –(CH 2 ) 0–2 CH(OR ⁇ ) 2 ; ⁇ O(haloR ⁇ ), –CN, –N 3 , –(CH 2 ) 0–2 C(O)R ⁇ , – (CH 2 ) 0–2 C(O)OH, –(CH 2 ) 0–2 C(O)OR ⁇ , –(CH 2 ) 0–2 SR ⁇ , –(CH 2 ) 0–2 SH, –(CH 2 ) 0–2 NH 2 , –(CH 2 )
- Suitable divalent substituents that are bound to vicinal substitutable carbons of an “optionally substituted” group include: –O(CR * 2) 2–3 O–, wherein each independent occurrence of R * is selected from hydrogen, C 1–6 aliphatic which may be substituted as defined below, and an unsubstituted 5–6–membered saturated, partially unsaturated, and aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, and sulfur. [0062] Suitable substituents on the aliphatic group of R * are independently halogen,
- each R* is unsubstituted or where preceded by “halo” is substituted only with one or more halogens, and is independently C 1-4 aliphatic, -CH 2 Ph, -O(CH 2 ) 0-1 Ph, or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- suitable substituents on a substitutable nitrogen are independently
- each R ⁇ is independently hydrogen, C 1 _ 6 aliphatic which may be substituted as defined below, unsubstituted -OPh, or an unsubstituted 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or, notwithstanding the definition above, two independent occurrences of R ⁇ , taken together with their intervening atom(s) form an
- Suitable substituents on the aliphatic group of R ⁇ are independently halogen,
- each R* is unsubstituted or where preceded by “halo” is substituted only with one or more halogens, and is independently C 1-4 aliphatic, -CH 2 Ph, -O(CH 2 ) 0 _ 1 Ph, or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- Partially unsaturated refers to a ring moiety that includes at least one double or triple bond.
- the term “partially unsaturated” is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aryl or heteroaryl moieties, as herein defined.
- composition refers to an active agent, formulated together with one or more pharmaceutically acceptable carriers.
- an active agent is present in unit dose amount appropriate for administration in a therapeutic regimen that shows a statistically significant probability of achieving a predetermined therapeutic effect when administered to a relevant population.
- compositions may be specially formulated for administration in solid or liquid form, including those adapted for the following: oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin, lungs, or oral cavity; intravaginally or intrarectally, for example, as a pessary, cream, or foam; sublingually; ocularly; transdermally; or nasally, pulmonary, and to other mucosal surfaces.
- oral administration for example, drenches (aqueous or non-aqueous solutions or suspension
- compositions or vehicles which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- pharmaceutically acceptable carrier means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
- Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
- materials which can serve as pharmaceutically-acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydrox
- compositions that are appropriate for use in pharmaceutical contexts, i.e., salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio.
- Pharmaceutically acceptable salts are well known in the art. For example, S. M. Berge, et al. describes pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 66: 1-19 (1977).
- pharmaceutically acceptable salt include, but are not limited to, nontoxic acid addition salts, which are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
- nontoxic acid addition salts which are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
- pharmaceutically acceptable salts include, but are not limited to, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy- ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palm
- a provided compound comprises one or more acidic groups and a pharmaceutically acceptable salt is an alkali, alkaline earth metal, or ammonium (e.g., an ammonium salt of N(R) 3 , wherein each R is independently defined and described in the present disclosure) salt.
- Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
- a pharmaceutically acceptable salt is a sodium salt.
- a pharmaceutically acceptable salt is a potassium salt.
- a pharmaceutically acceptable salt is a calcium salt.
- pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, alkyl having from 1 to 6 carbon atoms, sulfonate and aryl sulfonate.
- a provided compound comprises more than one acid groups.
- a pharmaceutically acceptable salt, or generally a salt, of such a compound comprises two or more cations, which can be the same or different.
- all ionizable hydrogen e.g., in an aqueous solution with a pKa no more than about 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2; in some embodiments, no more than about 7; in some embodiments, no more than about 6; in some embodiments, no more than about 5; in some embodiments, no more than about 4; in some embodiments, no more than about 3 in the acidic groups are replaced with cations.
- Protecting group The term “protecting group,” as used herein, is well known in the art and includes those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M.
- Suitable amino–protecting groups include methyl carbamate, ethyl carbamante, 9–fluorenylmethyl carbamate (Fmoc), 9–(2–sulfo)fluorenylmethyl carbamate, 9–(2,7–dibromo)fluoroenylmethyl carbamate, 2,7–di–t–butyl–[9–(10,10–dioxo–10,10,10,10– tetrahydrothioxanthyl)]methyl carbamate (DBD–Tmoc), 4–methoxyphenacyl carbamate (Phenoc), 2,2,2– trichloroethyl carbamate (Troc), 2–trimethylsilylethyl carbamate (Teoc), 2–phenylethyl carbamate (hZ), 1–(1–adamantyl)–1–methylethyl carbamate (Adpoc), 1,1–dimethyl–2–haloe
- Suitably protected carboxylic acids further include, but are not limited to, silyl–, alkyl–, alkenyl–, aryl–, and arylalkyl–protected carboxylic acids.
- suitable silyl groups include trimethylsilyl, triethylsilyl, t–butyldimethylsilyl, t–butyldiphenylsilyl, triisopropylsilyl, and the like.
- suitable alkyl groups include methyl, benzyl, p–methoxybenzyl, 3,4–dimethoxybenzyl, trityl, t–butyl, tetrahydropyran–2–yl.
- suitable alkenyl groups include allyl.
- suitable aryl groups include optionally substituted phenyl, biphenyl, or naphthyl.
- suitable arylalkyl groups include optionally substituted benzyl (e.g., p–methoxybenzyl (MPM), 3,4–dimethoxybenzyl, O– nitrobenzyl, p–nitrobenzyl, p–halobenzyl, 2,6–dichlorobenzyl, p–cyanobenzyl), and 2– and 4–picolyl.
- Suitable hydroxyl protecting groups include methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), t–butylthiomethyl, (phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), p–methoxybenzyloxymethyl (PMBM), (4–methoxyphenoxy)methyl (p–AOM), guaiacolmethyl (GUM), t–butoxymethyl, 4–pentenyloxymethyl (POM), siloxymethyl, 2– methoxyethoxymethyl (MEM), 2,2,2–trichloroethoxymethyl, bis(2–chloroethoxy)methyl, 2– (trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3–bromotetrahydropyranyl, tetrahydrothiopyranyl, 1–methoxycyclohexyl, 4–methoxytetrahydropyrany
- the protecting groups include methylene acetal, ethylidene acetal, 1–t– butylethylidene ketal, 1–phenylethylidene ketal, (4–methoxyphenyl)ethylidene acetal, 2,2,2– trichloroethylidene acetal, acetonide, cyclopentylidene ketal, cyclohexylidene ketal, cycloheptylidene ketal, benzylidene acetal, p–methoxybenzylidene acetal, 2,4–dimethoxybenzylidene ketal, 3,4– dimethoxybenzylidene acetal, 2–nitrobenzylidene acetal, methoxymethylene acetal, ethoxymethylene acetal, dimethoxymethylene ortho ester, 1–methoxyethy
- a hydroxyl protecting group is acetyl, t-butyl, tbutoxymethyl, methoxymethyl, tetrahydropyranyl, 1 -ethoxyethyl, 1 -(2-chloroethoxy)ethyl, 2- trimethylsilylethyl, p- chlorophenyl, 2,4-dinitrophenyl, benzyl, benzoyl, p-phenylbenzoyl, 2,6- dichlorobenzyl, diphenylmethyl, p-nitrobenzyl, triphenylmethyl (trityl), 4,4'-dimethoxytrityl, trimethylsilyl, triethylsilyl, t- butyldimethylsilyl, t-butyldiphenylsilyl, triphenylsilyl, triisopropylsilyl, benzoylformate, chloroacetyl, trichlor
- each of the hydroxyl protecting groups is, independently selected from acetyl, benzyl, t- butyldimethylsilyl, t-butyldiphenylsilyl and 4,4'- dimethoxytrityl.
- the hydroxyl protecting group is selected from the group consisting of trityl, monomethoxytrityl and 4,4'-dimethoxytrityl group.
- a phosphorous linkage protecting group is a group attached to the phosphorous linkage (e.g., an internucleotidic linkage) throughout oligonucleotide synthesis.
- a protecting group is attached to a sulfur atom of an phosphorothioate group. In some embodiments, a protecting group is attached to an oxygen atom of an internucleotide phosphorothioate linkage. In some embodiments, a protecting group is attached to an oxygen atom of the internucleotide phosphate linkage.
- a protecting group is 2-cyanoethyl (CE or Cne), 2-trimethylsilylethyl, 2-nitroethyl, 2- sulfonylethyl, methyl, benzyl, o-nitrobenzyl, 2-(p-nitrophenyl)ethyl (NPE or Npe), 2-phenylethyl, 3-(N- tert-butylcarboxamido)-1-propyl, 4-oxopentyl, 4-methylthio-l-butyl, 2-cyano-1,1-dimethylethyl, 4-N- methylaminobutyl, 3-(2-pyridyl)-1-propyl, 2-[N-methyl-N-(2-pyridyl)]aminoethyl, 2-(N-formyl,N- methyl)aminoethyl, or 4-[N-methyl-N-(2,2,2-trifluoroacetyl)amino]butyl
- Subject refers to any organism to which a compound or composition is administered in accordance with the present disclosure e.g., for experimental, diagnostic, prophylactic and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.) and plants. In some embodiments, a subject is a human. In some embodiments, a subject may be suffering from and/or susceptible to a disease, disorder and/or condition. [0075] Substantially: As used herein, the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
- therapeutic agent in general refers to any agent that elicits a desired effect (e.g., a desired biological, clinical, or pharmacological effect) when administered to a subject.
- a desired effect e.g., a desired biological, clinical, or pharmacological effect
- an agent is considered to be a therapeutic agent if it demonstrates a statistically significant effect across an appropriate population.
- an appropriate population is a population of subjects suffering from and/or susceptible to a disease, disorder or condition.
- an appropriate population is a population of model organisms. In some embodiments, an appropriate population may be defined by one or more criterion such as age group, gender, genetic background, preexisting clinical conditions, prior exposure to therapy.
- a therapeutic agent is a substance that alleviates, ameliorates, relieves, inhibits, prevents, delays onset of, reduces severity of, and/or reduces incidence of one or more symptoms or features of a disease, disorder, and/or condition in a subject when administered to the subject in an effective amount.
- a “therapeutic agent” is an agent that has been or is required to be approved by a government agency before it can be marketed for administration to humans.
- a “therapeutic agent” is an agent for which a medical prescription is required for administration to humans.
- a therapeutic agent is a compound described herein.
- Therapeutically effective amount means an amount of a substance (e.g., a therapeutic agent, composition, and/or formulation) that elicits a desired biological response when administered as part of a therapeutic regimen.
- a therapeutically effective amount of a substance is an amount that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, diagnose, prevent, and/or delay the onset of the disease, disorder, and/or condition.
- the effective amount of a substance may vary depending on such factors as the desired biological endpoint, the substance to be delivered, the target cell or tissue, etc.
- the effective amount of compound in a formulation to treat a disease, disorder, and/or condition is the amount that alleviates, ameliorates, relieves, inhibits, prevents, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of the disease, disorder, and/or condition.
- a therapeutically effective amount is administered in a single dose; in some embodiments, multiple unit doses are required to deliver a therapeutically effective amount.
- Treat refers to any method used to partially or completely alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of, and/or reduce incidence of one or more symptoms or features of a disease, disorder, and/or condition.
- Treatment may be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition.
- treatment may be administered to a subject who exhibits only early signs of the disease, disorder, and/or condition, for example for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition.
- Unsaturated means that a moiety has one or more units of unsaturation.
- structures depicted herein are also meant to include all isomeric (e.g., enantiomeric, diastereomeric, and geometric (or conformational)) forms of the structure; for example, the R and S configurations for each asymmetric center, Z and E double bond isomers, and Z and E conformational isomers. Therefore, single stereochemical isomers as well as enantiomeric, diastereomeric, and geometric (or conformational) mixtures of the present compounds are within the scope of the present disclosure.
- the present disclosure provides technologies that can conjugate moieties of interest to targets with high efficiency, high selectivity, and/or reduced side transformations (e.g., due to numbers of chemical reactions and/or conditions/types of chemical reactions).
- the present disclosure provides useful reagents and methods for conjugation, and provide product compositions with enhanced homogeneity (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more fold, increase of modification/conjugation at one or more desired sites of target agents, and/or 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more fold, decrease of modification/conjugation at one or more undesired sites of target agents), purity and/or reduced undesired modifications (e.g., to certain protein residues as results of side reactions).
- enhanced homogeneity e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more fold
- the present disclosure provides a compound of formula R-I or a salt thereof as described herein.
- a compound of formula R-I or a salt thereof is useful for introducing a moiety of interest to a target in one step of reaction.
- the present disclosure provides agents of formula P-I or P-II, or a salt thereof.
- a product composition comprise a plurality of agents having the structure of formula P-I or P-II, or a salt thereof, wherein the product composition has a higher level of homogeneity of said agents compared to a reference product composition (e.g., a product composition from a method in which a compound of formula R-I or a salt thereof is replaced with a compound which has the same structure as the compound of formula R-I or a salt thereof except that each target binding moiety is replaced with ⁇ H).
- a reference product composition e.g., a product composition from a method in which a compound of formula R-I or a salt thereof is replaced with a compound which has the same structure as the compound of formula R-I or a salt thereof except that each target binding moiety is replaced with ⁇ H.
- the present disclosure provides a method, comprising steps of: 1) contacting a target agent with a reaction partner comprising: a first group comprising a target binding moiety that binds to a target agent, a reactive group; a moiety of interest; and optionally one or more linker moieties; 2) forming an agent comprising: a target agent moiety; a moiety of interest; and optionally one or more linker moieties.
- a reaction group is located between a first group and a moiety of interest, and is connected to a first group and a moiety of interest independently and optionally through a linker moiety.
- a reaction partner is a compound of formula R-I or a salt thereof.
- a first group is or comprises a LG group as described herein. In some embodiments, a first group is or comprises a LG group as described herein.
- the present disclosure provides a method comprising steps of: 1) contacting a target agent with a reaction partner having the structure of formula R-I: LG ⁇ RG ⁇ L RM ⁇ MOI, (R-I) or a salt thereof, wherein: LG is a group comprising a target binding domain that binds to a target agent, RG is a reactive group; L RM is a linker; and MOI is a moiety of interest; and 2) forming an agent having the structure of formula P-I: P ⁇ L PM ⁇ MOI, (P-I) or a salt thereof, wherein: P is a target agent moiety; L PM is a linker; and MOI is a moiety of interest.
- a target agent is a protein agent. In some embodiments, a target agent. In some embodiments, a target agent is an antibody. In some embodiments, a target agent is an IgG antibody. In some embodiments, a target is a protein, and a moiety of interest is conjugated at one or more lysine residues. In some embodiments, an agent of formula P-I or a salt thereof is an agent of formula P-II or a salt thereof.
- the present disclosure provides a method of manufacturing an agent having the structure of P-II: P ⁇ N ⁇ L PM ⁇ MOI, (P-II) wherein: P-N is a protein agent moiety comprising a lysine residue; L PM is a linker; and MOI is a moiety of interest; the method comprising: contacting P-N with a reaction partner having a structure of formula R-I: LG ⁇ RG ⁇ L RM ⁇ MOI, (R-I) or a salt thereof, wherein: LG is a group comprising a protein-binding domain that binds to P-N, RG is a reactive group; L RM is a linker; and MOI is a moiety of interest.
- contacting is performed under conditions and for a time sufficient for the lysine residue N to react and form a bond with an atom of RG and release LG.
- Targets [0088] Those skilled in the art after reading the present disclosure will appreciate that provided technologies herein are useful for conjugating various target agents to many types of moieties of interest. In some embodiments, provided technologies are particularly useful for conjugating protein agents with various moieties of interest. In some embodiments, target agents are or comprise nucleic acids. [0089] In some embodiments, a target agent is or comprises a protein agent. In some embodiments, a target agent is a protein agent.
- a target agent is a natural protein in a cell, tissue, organ or organism. In some embodiments, a target agent is an endogenous protein. In some embodiments, a target agent is an exogenous protein. In some embodiments, a target agent is a manufactured protein, e.g., a protein produced using various biotechnologies. In some embodiments, a target agent is an antibody agent. In some embodiments, a target agent is an antibody useful as therapeutics. Various such antibodies are known in the art and can be utilized as target agents. In some embodiments, an antibody is a monoclonal antibody. In some embodiments, an antibody is a polyclonal antibody. In some embodiments, an antibody is an IgG antibody.
- an antibody is IVIG (in some embodiments, pooled from healthy donors).
- a protein comprises a Fc region.
- an antibody comprises a Fc region.
- a Fc region comprises a single heavy chain or a fragment thereof.
- a Fc region comprises two heavy chains or fragments thereof.
- an antibody is a human antibody.
- an antibody is a chimeric antibody.
- an antibody is a humanized antibody.
- an antibody is a mouse antibody.
- an antibody when characterizing polyclonal antibody agents or IVIG agents, either before, during or after conjugation, digestions are performed, e.g., enzyme digestions using IdeZ, IdeS, etc., so that certain regions of antibodies (e.g., Fab) are removed to provide compositions with improved homogeneity for characterization (e.g., by MS).
- an antibody is a therapeutic antibody, e.g., a FDA-approved antibody for therapeutic uses.
- a therapeutic antibody is useful for treating cancer.
- an antibody is adalimumab, alemtuzumab, atezolizumab, avelumab, ipilimumab, cetuximab, daratumumab, dinutuximab, elotuzumab, ibritumomab tiuxetan, imgatuzumab, infliximab, ipilimumab, necitumumab, obinutuzumab, ofatumumab, pertuzumab, reslizumab, rituximab, trastuzumab, mogamulizumab, AMP-224, FS-102, GSK-2857916, ARGX-111, ARGX-110, AFM-13, APN-301, BI- 836826, BI-836858, enoblituzumab, otlertuzumab, veltuzuma
- an antibody is rituximab, basiliximab, infliximab, cetuximab, siltuximab, dinutuximab, altertoxaximab, daclizumab, palivizumab, trastuzumab, alemtuzumab, omalizumab, efalizumab, bevacizumab, natalizumab, tocilizumab, eculizumab, mogamulizumab, pertuzumab, obinutuzumab, vedolizumab, pembrolizumab, mepolizumab, elotuzumab, daratumumab, ixekizumab, reslizumab, and atezolizumab, adalimumab, panitumumab, golimumab, ustekinumab, canakinumab, ofatumumab,
- an antibody is cetuximab.
- a provided compound or agent comprising an antibody agent moiety is useful for treating a condition, disorder or disease that may be treated by the antibody agent.
- Antibodies may be prepared in a number of technologies in accordance with the present disclosure.
- antibodies may have engineered structures compared to natural immunoglobulins.
- antibodies may comprise certain tags for purification, identification, assessment, etc.
- antibodies may contain fragments (e.g., CDR and/or Fc, etc.) and not full immunoglobulins.
- target agents are or comprise native antibody agents.
- target agents are or comprise engineered antibody agents.
- target agents e.g., antibodies
- target agents comprise no engineered unnatural amino acid residues.
- Partner Compounds [0094]
- the present disclosure provides compounds each independently comprising a first group comprising a target binding moiety that binds to a target agent, a reactive group, a moiety of interest, and optionally one or more linker moieties linking such groups/moieties.
- such a compound is useful as reaction partners for conjugating moieties of interest to targets.
- the present disclosure provides compounds for conjugating moieties of interest to targets, e.g., various proteins.
- provided compounds each comprise a moiety of interest, a reactive group, a target binding moiety, and optionally one or more linker moieties (linkers) linking such moieties.
- a target binding moiety is part of a leaving group that is released upon contacting such a compound with a target and reacting a reactive group of the compound with a reactive group of a target (e.g., ⁇ NH 2 of a Lys residue of a target protein).
- a target binding moiety is part of a leaving group that is released upon contacting such a compound with a target and reacting a reactive group of the compound with a reactive group of a target (e.g., ⁇ NH 2 of a Lys residue of a target protein).
- a provided compound has the structure of formula R-I or a salt thereof: LG ⁇ RG ⁇ L RM ⁇ MOI, (R-I) or a salt thereof, wherein: LG is a group comprising a target binding moiety that binds to a target agent, RG is a reactive group; L RM is a linker; and MOI is a moiety of interest.
- a first group is LG.
- LG is or comprises a target binding moiety that can bind to a target agent, and optionally a linker moiety.
- a moiety generally refers to a part of a molecule, e.g., in an ester RCOOR’, the alcohol moiety is RO ⁇ .
- a moiety of a compound e.g., a target agent, a protein agent, an antibody agent, etc.
- a target binding moiety can bind to a target, optionally in a comparable fashion, as its corresponding target binding compound; in some embodiments, a target agent moiety maintains one or more desired structural features, properties, functions, and/or properties comparable to its corresponding target agent compound; in some embodiments, an antibody agent moiety maintains one or more desired structural features, properties, functions, and/or properties (e.g., 3-dimension structure, antigen specificity, antigen-binding capacity, and/or immunological functions, etc.) comparable to its corresponding antibody agent compound.
- a moiety of a compound e.g., a target agent moiety, a protein agent moiety, an antibody agent moiety, etc.
- a monovalent radical is formed by removing a monovalent part (e.g., hydrogen, halogen, another monovalent group like alkyl, aryl, etc.) from a compound.
- a bivalent or polyvalent radical is formed by removing one or more monovalent (e.g., hydrogen, halogen, monovalent groups like alkyl, aryl, etc.), bivalent and/or polyvalent parts from a compound.
- radicals are formed by removing hydrogen atoms.
- a moiety is monovalent.
- a moiety is bivalent.
- a moiety is polyvalent. [0098]
- LG is or comprises R LG ⁇ L LG ⁇ , wherein R LG is or comprises a target binding moiety, and L LG is L LG1 as described herein.
- L LG is ⁇ L LG1 ⁇ L LG2 ⁇ , wherein each of L LG1 and L LG2 is independently as described herein.
- L LG is ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ , wherein each of L LG1 , L LG2 and L LG3 is independently as described herein.
- L LG is ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ , wherein each of L LG1 , L LG2 , L LG3 and L LG4 is independently as described herein.
- L LG1 is bonded to R LG .
- L LG1 is bonded to moiety of interest.
- L LG is ⁇ L LG1 ⁇
- a reactive group comprises L LG2 , L LG3 and L LG4 .
- L LG is ⁇ L LG1 ⁇ L LG2 ⁇
- a reactive group comprises L LG3 and L LG4 .
- L LG is ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇
- a reactive group comprises L LG4 .
- target binding moieties, first groups, and/or LG are released after reactions, e.g., after partner compounds react with target agents.
- a first group is released after a reaction.
- a target binding moiety is released after a reaction.
- LG is released after a reaction.
- a first group is released as part of a compound having the structure of LG ⁇ H or a salt thereof.
- a target binding moiety is released as part of a compound having the structure of LG ⁇ H or a salt thereof.
- LG is released as part of a compound having the structure of LG ⁇ H or a salt thereof.
- a first group is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof.
- a target binding moiety is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof. In some embodiments, a target binding moiety is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein R LG is or comprises the target binding moiety.
- LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein LG is R LG ⁇ L LG , and L LG is ⁇ L LG1 ⁇ , ⁇ L LG1 ⁇ L LG2 ⁇ , ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ , or ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ .
- LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein LG is R LG ⁇ L LG1 ⁇ .
- LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein LG is R LG ⁇ L LG1 ⁇ L LG2 .
- LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein LG is R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 .
- LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein LG is R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 .
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1-100 group comprising one or more aliphatic moieties, aryl moieties, heteroaliphatic moieties each independently having 1-20 heteroatoms, heteroaromatic moieties each independently having 1-20 heteroatoms, or any combinations of any one or more of such moieties, wherein one or more methylene units of the group are optionally and independently replaced with C 1-6 alkylene, C 1-6 alkenylene, a bivalent C 1-6 heteroaliphatic group having 1-5 heteroatoms, , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’)
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1-100 aliphatic or heteroaliphatic group 1-20 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , ⁇ C(O)O ⁇ , ⁇ P(O
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1 , C 2 , C 3 , C 4 , C 5 , C 10 , C 15 , C 20 , C 25 , C 30 , C 40 , C 50 , C 60 , C 1-2 , C 1-5 , C 1-10 , C 1-15 , C 1-20 , C 1-30 , C 1-40 , C 1-50 , C 1-60 , C 1-70 , C 1-80 , or C 1-90 aliphatic or heteroaliphatic group 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’)
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1 , C 2 , C 3 , C 4 , C 5 , C 10 , C 15 , C 20 , C 25 , C 30 , C 40 , C 50 , C 60 , C 1-2 , C 1-5 , C 1-10 , C 1-15 , C 1-20 , C 1-30 , C 1-40 , C 1-50 , C 1-60 , C 1-70 , C 1-80 , or C 1-90 aliphatic or heteroaliphatic group 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C ⁇ C ⁇ , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1 , C 2 , C 3 , C 4 , C 5 , C 10 , C 15 , C 20 , C 25 , C 30 , C 40 , C 50 , C 60 , C 1-2 , C 1-5 , C 1-10 , C 1-15 , C 1-20 , C 1-30 , C 1-40 , C 1-50 , C 1-60 , C 1-70 , C 1-80 , or C 1-90 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ O ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O)
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1 , C 2 , C 3 , C 4 , C 5 , C 10 , C 15 , C 20 , C 25 , C 30 , C 40 , C 50 , C 60 , C 1-2 , C 1-5 , C 1-10 , C 1-15 , C 1-20 , C 1-30 , C 1-40 , C 1-50 , C 1-60 , C 1-70 , C 1-80 , or C 1-90 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ O ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O)
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1-10 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ O ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ Cy ⁇ , or ⁇ [( ⁇ O ⁇ C(R’) 2 ⁇ C(R’) 2 ⁇ ) n ] ⁇ , wherein n is 1-10.
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1-10 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ O ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , or ⁇ [( ⁇ O ⁇ C(R’) 2 ⁇ C(R’) 2 ⁇ ) n ] ⁇ , wherein n is 1-10.
- L comprises no ⁇ C(O)O ⁇ . In some embodiments, L comprises no ⁇ C(O) ⁇ N(R’) ⁇ . In some embodiments, L comprises no ⁇ S ⁇ . In some embodiments, L comprises no ⁇ S ⁇ Cy ⁇ . In some embodiments, L comprises no ⁇ S ⁇ S ⁇ . In some embodiments, L does not contain one or more or any of ⁇ C(O)O ⁇ , ⁇ C(O) ⁇ N(R’) ⁇ , ⁇ S ⁇ , and ⁇ S ⁇ S ⁇ . In some embodiments, L does not contain one or more or any of ⁇ C(O)O ⁇ , ⁇ C(O) ⁇ N(R’) ⁇ , ⁇ S ⁇ Cy ⁇ , and ⁇ S ⁇ S ⁇ .
- L does not contain one or more or any of ⁇ C(O)O ⁇ , ⁇ S ⁇ , and ⁇ S ⁇ S ⁇ . In some embodiments, L does not contain one or more or any of ⁇ C(O)O ⁇ , ⁇ S ⁇ Cy ⁇ , and ⁇ S ⁇ S ⁇ . In some embodiments, L contains none of ⁇ C(O)O ⁇ , ⁇ S ⁇ , and ⁇ S ⁇ S ⁇ . In some embodiments, L contains none of ⁇ C(O)O ⁇ , ⁇ S ⁇ Cy ⁇ , and ⁇ S ⁇ S ⁇ . In some embodiments, L contains none of ⁇ C(O)O ⁇ and ⁇ S ⁇ S ⁇ .
- each amino acid residue is independently a residue of an amino acid having the structure of formula A-I or a salt thereof. In some embodiments, each amino acid residue independently has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ or a salt form thereof. In some embodiments, each amino acid residue independently has the structure of ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ CO ⁇ or a salt form thereof. [0102] In some embodiments, L is a covalent bond. In some embodiments, L is not a covalent bond.
- L LG1 is a covalent bond. In some embodiments, L LG1 is not a covalent bond. In some embodiments, L LG1 is or comprises ⁇ (CH 2 CH 2 O)n ⁇ . In some embodiments, L LG1 is or comprises ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted. In some embodiments, L LG1 is ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted.
- L LG1 is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted. In some embodiments, L LG1 is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein. [0104] In some embodiments, L LG1 is ⁇ CH 2 ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ .
- L LG1 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 ) 3 NH ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 ) 3 NH ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ C(O) ⁇ (CH 2 ) 3 NH ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ C(O) ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ C(O) ⁇ (CH 2 ) 3 ⁇ .
- L LG1 is ⁇ NHC(O) ⁇ (CH 2 ) 3 NH ⁇ C(O) ⁇ . In some embodiments, a ⁇ CH 2 ⁇ is bonded to a target binding moiety. [0105] In some embodiments, L LG1 is ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ C(O)NH ⁇ .
- L LG1 is ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ C(O)NH ⁇ CH 2 ⁇ . In some embodiments, ⁇ CH 2 CH 2 ⁇ is bonded to a target binding moiety. [0106] In some embodiments, L LG1 is ⁇ (CH 2 CH 2 O)n ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 CH 2 O)n ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 CH 2 O)n ⁇ CH 2 ⁇ CH 2 ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 CH 2 O) 2 ⁇ CH 2 ⁇ CH 2 ⁇ C(O) ⁇ .
- L LG1 is ⁇ (CH 2 CH 2 O) 4 ⁇ CH 2 ⁇ CH 2 ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 CH 2 O) 8 ⁇ CH 2 ⁇ CH 2 ⁇ C(O) ⁇ . In some embodiments, ⁇ C(O) ⁇ is bonded to a target binding moiety. [0107] In some embodiments, L LG1 is ⁇ N(R’) ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )]n ⁇ .
- L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )]n ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )]n ⁇ CH 2 CH 2 ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )]n ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ . In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, L LG1 is ⁇ NH ⁇ CH 2 CH 2 ⁇ O ⁇ .
- L LG1 is ⁇ NH ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ . [0108] In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 2 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 2 ⁇ CH 2 CH 2 ⁇ .
- L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 2 ⁇ CH 2 CH 2 ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 2 ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ . [0109] In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 3 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 3 ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 3 ⁇ CH 2 CH 2 ⁇ NH ⁇ .
- L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 3 ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 4 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 4 ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 4 ⁇ CH 2 CH 2 ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 4 ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ .
- L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 5 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 5 ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 5 ⁇ CH 2 CH 2 ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 5 ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ . In some embodiments, ⁇ NH ⁇ is bonded to a target binding moiety. [0110] In some embodiments, L LG1 is ⁇ CH 2 ⁇ .
- L LG1 is ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ CH 2 CH 2 NH ⁇ . In some embodiments, L LG1 is ⁇ CH 2 CH 2 NH ⁇ (CO) ⁇ . In some embodiments, ⁇ CH 2 ⁇ is bonded to a target binding moiety. [0111] In some embodiments, L LG1 is ⁇ CH 2 ⁇ . In some embodiments, L LG1 is ⁇ CH 2 C(O) ⁇ . In some embodiments, L LG1 is ⁇ CH 2 C(O)NH ⁇ . In some embodiments, L LG1 is ⁇ CH 2 (CO)NHCH 2 ⁇ .
- ⁇ CH 2 ⁇ C(O) ⁇ is bonded to a target binding moiety at ⁇ CH 2 ⁇ .
- L LG2 is a covalent bond. In some embodiments, L LG2 is not a covalent bond. In some embodiments, L LG2 is ⁇ N(R’)C(O) ⁇ . In some embodiments, L LG2 is ⁇ NHC(O) ⁇ . In some embodiments, L LG2 is ⁇ (CH 2 )n ⁇ N(R’)C(O) ⁇ , wherein ⁇ (CH 2 )n ⁇ is optionally substituted.
- L LG2 is ⁇ (CH 2 )n ⁇ OC(O) ⁇ , wherein ⁇ (CH 2 )n ⁇ is optionally substituted. In some embodiments, L LG2 is ⁇ (CH 2 )n ⁇ OC(O)N(R’) ⁇ , wherein ⁇ (CH 2 )n ⁇ is optionally substituted. In some embodiments, L LG2 is ⁇ (CH 2 )n ⁇ OC(O)NH ⁇ , wherein ⁇ (CH 2 )n ⁇ is optionally substituted. In some embodiments, n is 1-10, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3.
- ⁇ (CH 2 )n ⁇ is substituted. In some embodiments, ⁇ (CH 2 )n ⁇ is unsubstituted.
- L LG2 is ⁇ CH 2 N(CH 2 CH 2 CH 2 S(O) 2 OH) ⁇ C(O) ⁇ . In some embodiments, L LG2 is ⁇ C(O) ⁇ NHCH 2 ⁇ . In some embodiments, L LG2 is ⁇ C(O) ⁇ NHCH 2 CH 2 ⁇ . In some embodiments, L LG2 is ⁇ C(O)O ⁇ CH 2 ⁇ . In some embodiments, L LG2 is ⁇ NH ⁇ C(O)O ⁇ CH 2 ⁇ . In some embodiments, ⁇ C(O) ⁇ is bonded to L LG3 .
- L LG2 is ⁇ N(R’) ⁇ . In some embodiments, L LG2 is ⁇ N(R) ⁇ . In some embodiments, L LG2 is ⁇ NH ⁇ . [0114] In some embodiments, L LG2 is optionally substituted bivalent C 1-6 aliphatic. In some embodiments, L LG2 is ⁇ CH 2 ⁇ . In some embodiments, L LG2 is ⁇ CH 2 NH ⁇ . In some embodiments, L LG2 is ⁇ CH 2 NH ⁇ C(O) ⁇ .
- L LG2 is ⁇ CH 2 NH ⁇ C(O) ⁇ CH 2 ⁇ .
- L LG3 is or comprises an optionally substituted aryl ring.
- L LG3 is or comprises an optionally substituted phenyl ring.
- L LG3 is a phenyl ring substituted with one or more electron-withdrawing groups.
- an electron-withdrawing group is halogen.
- an electron-withdrawing group is ⁇ F. In some embodiments, it is ⁇ Cl.
- X is a heteroatom.
- Y is a heteroatom.
- each of X and Y is independently a heteroatom.
- Y is O.
- Y is S.
- X is C.
- X is N.
- X is P.
- X is S.
- an electron-withdrawing group is ⁇ C(O) ⁇ L ⁇ R’. In some embodiments, an electron-withdrawing group is ⁇ C(O) ⁇ R’. In some embodiments, it is ⁇ NO 2 . In some embodiments, it is ⁇ S(O) ⁇ L ⁇ R’. In some embodiments, it is ⁇ S(O) ⁇ R’. In some embodiments, it is ⁇ S(O) 2 ⁇ L ⁇ R’.
- it is ⁇ S(O) 2 ⁇ O ⁇ R’. In some embodiments, it is ⁇ S(O) 2 ⁇ N(R’) 2 . In some embodiments, it is ⁇ P(O)( ⁇ L ⁇ R’) 2 . In some embodiments, it is ⁇ P(O)(R’) 2 . In some embodiments, it is ⁇ P(O)(OR’) 2 . In some embodiments, it is ⁇ P(O)[N(R’) 2 ] 2 .
- L LG3 is ⁇ L LG3a ⁇ L LG3b ⁇ , wherein L LG3a is a covalent bond or ⁇ C(O)O ⁇ CH 2 ⁇ , wherein ⁇ CH 2 ⁇ is optionally substituted, and L LG3b is an optionally substituted aryl ring.
- L LG3a is bonded to L LG2
- L LG3b is bonded to L LG4 .
- L LG3a is a covalent bond.
- L LG3a is ⁇ C(O)O ⁇ CH 2 ⁇ , wherein ⁇ CH 2 ⁇ is optionally substituted.
- L LG3a is ⁇ C(O)O ⁇ CH 2 ⁇ , wherein ⁇ CH 2 ⁇ is substituted. In some embodiments, L LG3a is ⁇ C(O)O ⁇ CH 2 ⁇ , wherein ⁇ CH 2 ⁇ is unsubstituted. [0118] In some embodiments, a first group, a target binding moiety, and/or LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ H or a salt thereof. [0119] In some embodiments, L LG3b is an optionally substituted phenyl ring. In some embodiments, at least one substituent is an electron-withdrawing group as described herein.
- L LG3 is , wherein s is 0-4, each R s is independently halogen, ⁇ NO 2 , ⁇ L ⁇ R’, ⁇ C(O) ⁇ L ⁇ R’, ⁇ S(O) ⁇ L ⁇ R’, ⁇ S(O) 2 ⁇ L ⁇ R’, or ⁇ P(O)( ⁇ L ⁇ R’) 2 .
- C1 is bonded to L LG4 .
- L LG3 is In some embodiments, L LG3 is In some embodiments, L LG3 is In some embodiments, L LG3 is .
- L LG3 is n some embodiments, L LG3 [0121]
- L LG3b is , wherein s is 0-4, each R s is independently halogen, ⁇ NO 2 , ⁇ L ⁇ R’, ⁇ C(O) ⁇ L ⁇ R’, ⁇ S(O) ⁇ L ⁇ R’, ⁇ S(O) 2 ⁇ L ⁇ R’, or ⁇ P(O)( ⁇ L ⁇ R’) 2 .
- C1 is bonded to L LG4 .
- L LG3b is .
- L LG3b is In some embodi LG3b ments, L In some embodiments, L LG3b i LG3b In some embodiments, L is n some embodiments, L LG3b i [0122] In some embodiments, s is 0. In some embodiments, s is 1-4. In some embodiments, s is 1. In some embodiments, s is 2. In some embodiments, s is 3. In some embodiments, s is 4. [0123] In some embodiments, s is 1-4, and at least one R s is an electron-withdrawing group, e.g., an electron-withdrawing group described above. In some embodiments, at least one R s is ⁇ NO 2 .
- At least one R s is ⁇ F.
- each R s is independently an electron- withdrawing group.
- each R s is ⁇ NO 2 .
- each R s is ⁇ F.
- an electron-withdrawing group or R s is at C2.
- an electron-withdrawing group or R s is at C3.
- an electron- withdrawing group or R s is at C4.
- an electron-withdrawing group or R s is at C2 and C5.
- L LG3 is .
- L LG3 is .
- L LG3 is .
- L LG3 is .
- L LG3 is .
- L LG3 is . In some embodiments, L LG3 is . In some embodiments, L ome embodiments, L LG3 i In some embodiments, L LG3 is . [0126] In some embodiments, L LG3b LG3b LG3b In some embodiments, L is . In some embodiments, L LG3b is LG3b In some embodiments, L is In some embodiments, L LG . In some embodiments, L some embodiments, L LG3b is In some embodiments, L LG3b is [0127] In some embodiments, L LG3b is optionally substituted . In some embodiments, the nitrogen atom is boned to L LG4 which is ⁇ O ⁇ .
- the nitrogen atom is boned to L LG4 which is ⁇ O ⁇ , and ⁇ L RG1 ⁇ L RG2 ⁇ is ⁇ C(O) ⁇ .
- ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ is ⁇ O ⁇ C(O) ⁇ .
- ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ is ⁇ S ⁇ C(O) ⁇ .
- ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ is ⁇ S ⁇ C(O) ⁇ .
- L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ is ⁇ S ⁇ C(O) ⁇ .
- L LG4 is a covalent bond. In some embodiments, L LG4 is not a covalent bond.
- L LG4 is ⁇ O ⁇ . In some embodiments, L LG4 is ⁇ N(R’) ⁇ . In some embodiments, L LG4 is ⁇ NH ⁇ . In some embodiments, L LG4 is ⁇ N(CH 3 ) ⁇ . In some embodiments, L LG4 is ⁇ N(R’) ⁇ , and L LG3 is ⁇ O ⁇ . In some embodiments, R’ is optionally substituted C 1-6 alkyl. In some embodiments, L LG4 is ⁇ S ⁇ . [0130] As described herein, in some embodiments, R LG is or comprises a target binding moiety. In some embodiments, R LG is or comprises a protein binding moiety. In some embodiments, R LG is or comprises an antibody binding moiety.
- R LG is a target binding moiety. In some embodiments, R LG is a protein binding moiety. In some embodiments, R LG is an antibody binding moiety. [0131] In some embodiments, R LG is or comprises as described herein. In some embodiments, R LG is or comprises R c ⁇ (Xaa)z ⁇ as described herein. In some embodiments, R LG is or comprises a small molecule moiety. In some embodiments, R LG is or comprises a peptide agent. In some embodiments, R LG is or comprises a nucleic acid agent. In some embodiments, R LG is or comprises an aptamer agent. In some embodiments, a target binding moiety is or comprises as described herein.
- a protein binding moiety is or comprises as described herein. In some embodiments, an antibody binding moiety is or comprises as described herein. In some embodiments, a target binding moiety is or comprises R c ⁇ (Xaa)z ⁇ as described herein. In some embodiments, a protein binding moiety is or comprises R c ⁇ (Xaa)z ⁇ as described herein. In some embodiments, an antibody binding moiety is or comprises R c ⁇ (Xaa)z ⁇ as described herein. Target Binding Moieties [0132] As appreciated by those skilled in the art, various target binding moieties can be utilized in accordance with the present disclosure.
- a target binding moiety is or comprises a small molecule moiety. In some embodiments, a target binding moiety is or comprises a polymeric moiety. In some embodiments, a target binding moiety is or comprises nucleic acid or fragments thereof. In some embodiments, a target binding moiety is or comprises a peptide moiety. In some embodiments, a target binding moiety is a polypeptide moiety. [0134] In some embodiments, provided technologies comprise one and no more than one target binding moiety. In some embodiments, provided technologies comprise two or more target binding moieties.
- provided compounds may comprise two or more target binding moieties that can bind to target antibody agents.
- a target binding moiety is or comprises a small molecule moiety that can selectively bind to a target agent.
- Small molecule binders to target agents including various protein agents are widely known in the art and can be utilized in accordance with the present disclosure.
- a small molecule binder is or is a moiety of a therapeutic agent, e.g., a drug, an antibody-drug conjugate, etc.
- a target binding moiety is a small molecule moiety.
- a small molecule moiety has a molecular weight no more than 8000, 7000, 6000, 5000, 4000, 3000, 2000, 1500, 1000, 900, 800, 700, or 600. In some embodiments, a small molecule moiety has a molecular weight no more than 8000. In some embodiments, a small molecule moiety has a molecular weight no more than 7000. In some embodiments, a small molecule moiety has a molecular weight no more than 6000. In some embodiments, a small molecule moiety has a molecular weight no more than 5000. In some embodiments, a small molecule moiety has a molecular weight no more than 4000.
- a small molecule moiety has a molecular weight no more than 3000. In some embodiments, a small molecule moiety has a molecular weight no more than 2000. In some embodiments, a small molecule moiety has a molecular weight no more than 1500. In some embodiments, a small molecule moiety has a molecular weight no more than 1000. In some embodiments, a small molecule moiety has a molecular weight no more than 900.
- a target binding moiety is or comprises a peptide agent. In some embodiments, a target binding moiety is a peptide moiety.
- a peptide moiety can either be linier or cyclic.
- a target binding moiety is or comprises a cyclic peptide moiety.
- Various peptide target binding moieties are known in the art and can be utilized in accordance with the present disclosure.
- a target binding moiety is or comprises a peptide aptamer agent.
- Aptamer Agents [0139] In some embodiments, a target binding moiety is or comprises a nucleic acid agent. In some embodiments, a target binding moiety is or comprises an oligonucleotide moiety. In some embodiments, a target binding moiety is or comprises an aptamer agent.
- a target binding moiety is an antibody binding moiety. Such target binding moieties are, among other things, for conjugating moieties of interest to antibody agents.
- Antibody Binding Moieties [0141]
- targets are antibody agents.
- target binding moieties are antibody binding moieties.
- provided compounds and/or agents comprise antibody binding moieties.
- antibody binding moieties can be utilized in accordance with the present disclosure.
- antibody binding moieties are universal antibody binding moieties which can bind to antibodies having different Fab regions and different specificity.
- antibody binding moieties of the present disclosure bind to Fc regions.
- binding of antibody binding moieties to Fc regions can happen at the same time as binding of Fc receptors, e.g., CD16a, to the same Fc regions (e.g., may at different locations/amino acid residues of the same Fc regions).
- an Fc region upon binding of antibody binding moieties, e.g., those in provided agents, compounds, methods, etc., an Fc region can still interact with Fc receptors and perform one or more or all of its immune activities, including recruitment of immune cells (e.g., effector cells such as NK cells), and/or triggering, generating, encouraging, and/or enhancing immune system activities toward target cells, tissues, objects and/or entities, for example, antibody-dependent cell-mediated cytotoxicity (ADCC) and/or ADCP.
- Various antibody binding moieties including universal antibody binding moieties can be utilized in accordance with the present disclosure.
- an antibody binding moiety comprises one or more amino acid residues, each independently natural or unnatural.
- a target binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)), has the structure of or a salt form thereof, wherein: each of R 1 , R 3 and R 5 is independently hydrogen or an optionally substituted group selected from C 1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur; or: R 1 and R 1’ are optional
- L 1 is an optionally substituted trivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- a target binding moiety e.g. a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)), has the structure of salt form thereof, wherein: each of R 7 is independently hydrogen or an optionally substituted group selected from C 1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur; or: an R 7 group and the R 7’ group attached to the same carbon atom are optional
- an antibody binding moiety e.g., a universal antibody binding moiety is or comprises a peptide moiety, e.g., a moiety having the structure of R c ⁇ (Xaa)z ⁇ or a salt form thereof, wherein each of R c , z and Xaa is independently as described herein.
- one or more Xaa are independently an unnatural amino acid residue.
- side chains of two or more amino acid residues may be linked together to form bridges.
- side chains of two cysteine residues may form a disulfide bridge comprising ⁇ S ⁇ S ⁇ (which, as in many proteins, can be formed by two ⁇ SH groups).
- a target binding moiety e.g. a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)), is or comprises a cyclic peptide moiety, e.g., a moiety having the structure o or a salt form thereof, wherein: each Xaa is independently a residue of an amino acid or an amino acid analog; t is 0-50; z is 1-50; L is a linker moiety; each R c is independently ⁇ L a ⁇ R’; each L a is independently a covalent bond, or an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ ,
- a heteroatom is independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- a target binding moiety is or comprises R c ⁇ (Xaa)z ⁇ or a salt form thereof, wherein each variable is as described herein.
- a protein binding moiety is or comprises R c ⁇ (Xaa)z ⁇ or a salt form thereof, wherein each variable is as described herein.
- an antibody binding moiety e.g., a universal antibody binding moiety, is or comprises R c ⁇ (Xaa)z ⁇ or a salt form thereof, wherein each variable is as described herein.
- a target binding moiety is or comprises or a salt form thereof, wherein each variable is as described herein.
- a protein binding moiety is or comprises or a salt form thereof, wherein each variable is as described herein.
- an antibody binding moiety e.g., a universal antibody binding moiety, is or comprises or a salt form thereof, wherein each variable is as described herein.
- an antibody binding moiety e.g., a universal antibody binding moiety is R c ⁇ (Xaa)z ⁇ or , or a salt form thereof, and is or comprises a peptide unit.
- ⁇ (Xaa)z ⁇ is or comprises a peptide unit.
- amino acid residues may form bridges, e.g., connections formed by side chains optionally through linker moieties (e.g., L); for example, as in many polypeptides, cysteine residues may form disulfide bridges.
- a peptide unit comprises an amino acid residue (e.g., at physiological pH about 7.4, “positively charged amino acid residue”, Xaa P ), e.g., a residue of an amino acid of formula A-I that has a positively charged side chain.
- a peptide unit comprises R.
- at least one Xaa is R.
- a peptide unit is or comprises APAR.
- a peptide unit is or comprises RAPA.
- a peptide unit comprises an amino acid residue, e.g., a residue of an amino acid of formula A-I, that has a side chain comprising an aromatic group (“aromatic amino acid residue”, Xaa A ).
- a peptide unit comprises a positively charged amino acid residue and an aromatic amino acid residue.
- a peptide unit comprises W.
- a peptide unit comprises a positively charged amino acid residue and an aromatic amino acid residue.
- a peptide unit is or comprises Xaa A XaaXaa P Xaa P .
- a peptide unit is or comprises Xaa P Xaa P XaaXaa A . In some embodiments, a peptide unit is or comprises Xaa P Xaa A Xaa P . In some embodiments, a peptide unit is or comprises two or more Xaa P Xaa A Xaa P . In some embodiments, a peptide unit is or comprises Xaa P Xaa A Xaa P XaaXaa P Xaa A Xaa P . In some embodiments, a peptide unit is or comprises Xaa P Xaa P Xaa A Xaa P .
- a peptide unit is or comprises Xaa P Xaa P Xaa P Xaa A . In some embodiments, a peptide unit is or comprises two or more Xaa A Xaa A Xaa P . In some embodiments, a peptide residue comprises one or more proline residues. In some embodiments, a peptide unit is or comprises HWRGWA. In some embodiments, a peptide unit is or comprises WGRR. In some embodiments, a peptide unit is or comprises RRGW. In some embodiments, a peptide unit is or comprises NKFRGKYK. In some embodiments, a peptide unit is or comprises NRFRGKYK.
- a peptide unit is or comprises NARKFYK. In some embodiments, a peptide unit is or comprises NARKFYKG. In some embodiments, a peptide unit is or comprises HWRGWV. In some embodiments, a peptide unit is or comprises KHFRNKD. In some embodiments, a peptide unit comprises a positively charged amino acid residue, an aromatic amino acid residue, and an amino acid residue, e.g., a residue of an amino acid of formula A-I, that has a negatively charged side chain (e.g., at physiological pH about 7.4, “negatively charged amino acid residue”, Xaa N ). In some embodiments, a peptide unit comprises RHRFNKD.
- a peptide unit is RHRFNKD. In some embodiments, a peptide unit comprises TY. In some embodiments, a peptide unit is TY. In some embodiments, a peptide unit comprises TYK. In some embodiments, a peptide unit is TYK. In some embodiments, a peptide unit comprises RTY. In some embodiments, a peptide unit is RTY. In some embodiments, a peptide unit comprises RTYK. In some embodiments, a peptide unit is RTYK. In some embodiments, a peptide unit is or comprises a sequence selected from PAM. In some embodiments, a peptide unit comprises WHL.
- a peptide unit is WHL. In some embodiments, a peptide unit is or comprises WXL, wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.). In some embodiments, a peptide unit comprises WDL. In some embodiments, a peptide unit is WDL. In some embodiments, a peptide unit comprises ELVW. In some embodiments, a peptide unit is ELVW. In some embodiments, a peptide unit comprises GELVW. In some embodiments, a peptide unit is GELVW.
- a peptide unit is or comprises a sequence selected from AWHLGELVW. In some embodiments, a peptide unit is or comprises AWHLGELVW. In some embodiments, a peptide unit is or comprises a sequence selected from AWDLGELVW. In some embodiments, a peptide unit is or comprises AWDLGELVW. In some embodiments, a peptide unit is or comprises AWXLGELVW, wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises a sequence selected from DCAWHLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises DCAWHLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises a sequence selected from DCAWXLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises DCAWXLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins
- X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- X comprises ⁇ COOH or a salt or activated form thereof in its side chain.
- a peptide unit is or comprises a sequence selected from DCAWDLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises DCAWDLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises a sequence selected from Fc-III.
- a peptide unit is or comprises Fc-III.
- a peptide unit is or comprises a sequence selected from DpLpAWXLGELVW, wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises DpLpAWXLGELVW, wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises a sequence selected from DpLpAWDLGELVW.
- a peptide unit is or comprises DpLpAWDLGELVW.
- a peptide unit is or comprises a sequence selected from DpLpAWHLGELVW, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises DpLpAWHLGELVW (e.g., FcBP-1), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises a sequence selected from FcBP-1.
- a peptide unit is or comprises a sequence selected from DpLpDCAWXLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises DpLpDCAWXLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises a sequence selected from DpLpDCAWHLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises DpLpDCAWHLGELVWCT (e.g., FcBP-2), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises a sequence selected from DpLpDCAWDLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises DpLpDCAWDLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises a sequence selected from FcBP-2.
- a peptide unit is or comprises a sequence selected from CDCAWXLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises CDCAWXLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises a sequence selected from CDCAWHLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
- a peptide unit is or comprises CDCAWHLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
- a peptide unit is or comprises a sequence selected from CDCAWDLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
- a peptide unit is or comprises CDCAWDLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
- a peptide unit is or comprises a sequence selected from Fc-III-4c.
- a peptide unit is or comprises a sequence selected from FcRM.
- a peptide unit is or comprises a cyclic peptide unit.
- a cyclic peptide unit comprises amide group formed by an amino group of a side chain and the C-terminus ⁇ COOH. It is appreciated by those skilled in the art that in various embodiments, when a peptide unit is connected to another moiety, an amino acid residue of a peptide unit may be connected through various positions, e.g., its backbone, its side chain, etc. In some embodiments, an amino acid residue is modified for connection. In some embodiments, an amino acid residue is replaced with another suitable residue for connection while maintaining one or more properties and/or activities a peptide unit (e.g., binding to an antibody as described herein).
- an amino acid residue is replaced with an amino acid residue with a side chain comprising ⁇ COOH or a salt or activated form thereof (e.g., side chain being ⁇ CH 2 ⁇ COOH or a salt or activated form thereof).
- H may be replaced with D (e.g., in various peptide units comprising WHL).
- a peptide unit is connected to another moiety through ⁇ COOH or a salt or activated form thereof, e.g., through formation of e.g., ⁇ CON(R’) ⁇ .
- R’ is ⁇ H.
- ⁇ COOH is in a side chain of an amino acid residue.
- 1-5 e.g., 1, 2, 3, 4, or 5 amino acid residues may be independently and optionally replaced with another amino acid residue
- 1-5 e.g., 1, 2, 3, 4, or 5 amino acid residues may be independently and optionally deleted
- 1-5 e.g., 1, 2, 3, 4, or 5 amino acid residues may be independently and optionally inserted.
- a peptide moiety is connected to the rest of a molecule through its N-terminus. In some embodiments, it is connected to the rest of a molecule through its C-terminus.
- the total number of replacement, deletion and insertion is no more than 10 (e.g., 0, or no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10). In some embodiments, the total number is 0. In some embodiments, the total number is no more than 1. In some embodiments, the total number is no more than 2. In some embodiments, the total number is no more than 3. In some embodiments, the total number is no more than 4. In some embodiments, the total number is no more than 5.
- the total number is no more than 6. In some embodiments, the total number is no more than 7. In some embodiments, the total number is no more than 8. In some embodiments, the total number is no more than 9. In some embodiments, the total number is no more than 10. In some embodiments, there are no insertions. In some embodiments, there are no deletions.
- ⁇ (Xaa)z ⁇ is or comprises [X 1 ] p1 [X 2 ] p2 - X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 -[X 13 ] p13 -[X 14 ] p14 [X 15 ] p15 [X 16 ] p16 , wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 is independently an amino acid residue, e.g., of an amino acid of formula A- I, and each of p1, p2, p13, p14, p15 and p16 is independently 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 is independently an amino acid residue of an amino acid of formula A-I. In some embodiments, each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 is independently a natural amino acid residue.
- X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 are independently an unnatural amino acid residue as described in the present disclosure.
- a peptide unit comprises a functional group in an amino acid residue that can react with a functional group of another amino acid residue.
- a peptide unit comprises an amino acid residue with a side chain which comprises a functional group that can react with another functional group of the side chain of another amino acid residue to form a linkage (e.g., see moieties described in Table A-1, Table 1, etc.).
- one functional group of one amino acid residue is connected to a functional group of another amino acid residue to form a linkage (or bridge).
- Linkages are bonded to backbone atoms of peptide units and comprise no backbone atoms.
- a peptide unit comprises a linkage formed by two side chains of non-neighboring amino acid residues.
- a linkage is bonded to two backbone atoms of two non- neighboring amino acid residues. In some embodiments, both backbone atoms bonded to a linkage are carbon atoms. In some embodiments, a linkage has the structure of L b , wherein L b is L a as described in the present disclosure, wherein L a is not a covalent bond. In some embodiments, L a comprises ⁇ Cy ⁇ . In some embodiments, L a comprises ⁇ Cy ⁇ , wherein ⁇ Cy ⁇ is optionally substituted heteroaryl. In some embodiments, ⁇ Cy ⁇ is a In some embodiments, L is .
- such an L a can be formed by a ⁇ N 3 group of the side chain of one amino acid residue, and the ⁇ of the side chain of another amino acid residue.
- a linkage is formed through connection of two thiol groups, e.g., of two cysteine residues.
- L a comprises ⁇ S ⁇ S ⁇ .
- L a is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ .
- a linkage is formed through connection of an amino group (e.g., ⁇ NH 2 in the side chain of a lysine residue) and a carboxylic acid group (e.g., ⁇ COOH in the side chain of an aspartic acid or glutamic acid residue).
- L a comprises ⁇ C(O) ⁇ N(R’) ⁇ .
- L a comprise ⁇ C(O) ⁇ NH ⁇ .
- L a is ⁇ CH 2 CONH ⁇ (CH 2 ) 3 ⁇ .
- L a comprises ⁇ C(O) ⁇ N(R’) ⁇ , wherein R’ is R, and is taken together with an R group on the peptide backbone to form a ring (e.g., in A- 34).
- L a is ⁇ (CH 2 ) 2 ⁇ N(R’) ⁇ CO ⁇ (CH 2 ) 2 ⁇ .
- ⁇ Cy ⁇ is optionally substituted phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,2-phenylene.
- L a is .
- L a is .
- L a is optionally substituted bivalent C 2 - 20 bivalent aliphatic.
- two amino acid residues bonded to a linkage are separated by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more than 15 amino acid residues between them (excluding the two amino acid residues bonded to the linkage).
- the number is 1. In some embodiments, the number is 2. In some embodiments, the number is 3. In some embodiments, the number is 4. In some embodiments, the number is 5. In some embodiments, the number is 6.
- the number is 7. In some embodiments, the number is 8. In some embodiments, the number is 9. In some embodiments, the number is 10. In some embodiments, the number is 11. In some embodiments, the number is 12. In some embodiments, the number is 13. In some embodiments, the number is 14. In some embodiments, the number is 15. [0153] In some embodiments, each of p1, p2, p13, p14, p15 and p16 is 0.
- ⁇ (Xaa)z ⁇ is or comprises ⁇ X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 ⁇ , wherein: each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue; X 6 is Xaa A or Xaa P ; X 9 is Xaa N ; and X 12 is Xaa A or Xaa P .
- each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-I as described in the present disclosure.
- X 5 is Xaa A or Xaa P .
- X 5 is Xaa A .
- X 5 is Xaa P .
- X 5 is an amino acid residue whose side chain comprises an optionally substituted 5 saturated, partially saturated or aromatic ring.
- X is .
- X 5 is .
- X 6 is Xaa A . In some embodiments, X 6 is Xaa P . In some embodiments, X 6 is His. In some embodiments, X 12 is Xaa A . In some embodiments, X 12 is Xaa P . In some embodiments, X 9 is Asp. In some embodiments, X 9 is Glu. In some embodiments, X 12 is In some embodiments, X 12 is In some emb 7 odiments, each of X , X 10 , and X 11 is independently an amino acid residue with a hydrophobic side chain (“hydrophobic amino acid residue”, Xaa H ). In some embodiments, X 7 is Xaa H .
- X In some embodiments, X 7 is Val. In some embodiments, X 10 is Xaa H . In some embodiments, X 10 is Met. In some embodiments, some embodiments, X 11 is Xaa H . In some embodiments, X 11 is . In some embodiments, X 8 is Gly. In some embodiments, X 4 is Pro. In some embodiments, X 3 is Lys. In some embodiments, the ⁇ COOH of X 12 forms an amide bond with the side chain amino group of Lys (X 3 ), and the other amino group of the Lys (X 3 ) is connected to a linker moiety and then a target binding moiety.
- ⁇ (Xaa)z ⁇ is or comprises ⁇ X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 ⁇ , wherein: each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue; at least two amino acid residues are connected through one or more linkages L b ; L b is an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇
- each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-I as described in the present disclosure.
- two non-neighboring amino acid residues are connected by L b .
- X 5 and X 10 are connected by L b .
- X 6 is Xaa A .
- X 6 is Xaa P .
- X 6 is His.
- X 9 is Asp.
- X 9 is Glu.
- X 12 is Xaa A .
- X 12 is .
- X 12 is In some embodiments, s .
- each of X 4 , X 7 , and X 11 is independently Xaa H .
- X 4 is Xaa H .
- X 4 is Ala.
- X 7 is Xaa H .
- X 7 In some embodi 11 H 11 ments, X is Xaa .
- X is .
- X 8 is Gly.
- X 3 is Lys.
- the ⁇ COOH of X 12 forms an amide bond with the side chain amino group of Lys (X 3 ), and the other amino group of the Lys (X 3 ) is connected to a linker moiety and then a target binding moiety.
- L b In some embodiments, L b i In some embodiments, L b connects two alpha-carbon atoms of two different amino acid residues.
- both X 5 and X 10 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- ⁇ (Xaa)z ⁇ is or comprises ⁇ X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 ⁇ , wherein: each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue; at least two amino acid residues are connected through one or more linkages L b ; L b is an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇
- each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-I as described in the present disclosure.
- two non-neighboring amino acid residues are connected by L b .
- X 2 and X 12 are connected by L b .
- L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ .
- L b is ⁇ CH 2 ⁇ CH 2 ⁇ S ⁇ CH 2 ⁇ .
- L b is In some embodiments, L b i In some embodiments, L b is ⁇ CH 2 CH 2 CO ⁇ N(R’) ⁇ CH 2 CH 2 ⁇ . In some embodiments, R’ are taken together with an R group on the backbone atom that ⁇ N(R’) ⁇ CH 2 CH 2 ⁇ is bonded to to form a ring, e.g., as in A-34. In some embodiments, a formed ring is 3-, 4-, 5-, 6-, 7- or 8-membered. In some embodiments, a formed ring is monocyclic. In some embodiments, a formed ring is saturated.
- L b is In some embodiments, L b connects two alpha-carbon atoms of two different amino acid residues.
- X 4 is Xaa A . In some embodiments, X 4 is Tyr.
- X 5 is Xaa A . In some embodiments, X 5 is Xaa P . In some embodiments, X 5 is His.
- X 8 is Asp. In some embodiments, X 8 is Glu.
- X 11 is Tyr.
- both X 2 and X 12 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- each of X 3 , X 6 , X 9 , and X 10 is independently Xaa H .
- X 3 is Xaa H .
- X 3 is Ala.
- X 6 is Xaa H .
- X 6 is Leu.
- X 9 is Xaa H .
- X 9 is Leu.
- X 9 is In some embodiments, X 10 is Xaa H .
- X 10 is Val.
- X 10 is In som 7 e embodiments, X is Gly.
- p1 is 1.
- X 1 is Asp. In some embodiments, p13 is 1. In some embodiments, p14, p15 and p16 are 0. In some embodiments, X 13 is an amino acid residue comprising a polar uncharged side chain (e.g., at physiological pH, “polar uncharged amino acid residue”, Xaa L ). In some embodiments, X 13 is Thr. In some embodiments, X 13 is Val. In some embodiments, p13 is 0. In some embodiments, R c is ⁇ NHCH 2 CH(OH)CH 3 . In some embodiments, R c is (R) ⁇ NHCH 2 CH(OH)CH 3 .
- R c is (S) ⁇ NHCH 2 CH(OH)CH 3 .
- ⁇ (Xaa)z ⁇ is or comprises ⁇ X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 ⁇ , wherein: each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue; at least two amino acid residues are connected through one or more linkages L b ; L b is an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇
- each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-I as described in the present disclosure.
- two non-neighboring amino acid residues are connected by L b .
- X 2 and X 12 are connected by L b .
- X 4 and X 9 are connected by L b .
- X 4 and X 10 are connected by L b .
- L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ .
- L b i In some embodiments, both X 2 and X 12 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- both X 4 and X 10 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- X 4 and X 9 are connected by L b , wherein L b is In some embodiments, X 4 and X 9 are connected by L b , wherein L b is In some embodiments, 5 A 5 P X is Xaa . In some embodiments, X is Xaa . In some embodiments, X 5 is His. In some embodiments, X 8 is Asp. In some embodiments, X 8 is Glu. In some embodiments, X 11 is Tyr. In some embodiments, X In some embodiments, X 2 and X 12 are connected by L b , wherein L b is ⁇ CH 2 ⁇ S ⁇ CH 2 CH 2 ⁇ .
- L b connects two alpha-carbon atoms of two different amino acid residues.
- each of X 3 , X 6 , and X 9 is independently Xaa H .
- X 3 is Xaa H .
- X 3 is Ala.
- X 6 is Xaa H .
- X 6 is Leu.
- X 6 is .
- X 9 is Xaa H .
- X 9 is Leu.
- X 9 is In some embodiments, X 10 is Xaa H . In some embodiments, X 10 is Val.
- X 7 is Gly.
- p1 is 1.
- X 1 is Xaa N .
- X 1 is Asp.
- X 1 is Glu.
- p13 is 1.
- p14, p15 and p16 are 0.
- X 13 is Xaa L .
- X 13 is Thr.
- X 13 is Val.
- ⁇ (Xaa)z ⁇ is or comprises ⁇ X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 X 15 X 16 ⁇ , wherein: each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , and X 16 is independently an amino acid residue; at least two amino acid residues are connected through a linkage L b ; L b is an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇
- each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-I as described in the present disclosure.
- two non-neighboring amino acid residues are connected by L b .
- X 2 are connected to X 16 by L b .
- X 4 are connected to X 14 by L b .
- both X 2 and X 16 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- both X 4 and X 14 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- L b connects two alpha-carbon atoms of two different amino acid residues.
- X 3 is Asp.
- X 3 is Glu.
- X 5 is Xaa H . In some embodiments, X 5 is Ala. In some embodiments, X 6 is Xaa A . In some embodiments, X 6 is Tyr. In some embodiments, X 7 is Xaa A . In some embodiments, X 7 is Xaa P . In some embodiments, X 7 is His. In some embodiments, X 8 is Xaa H . In some embodiments, X 8 is Ala. In some embodiments, X 9 is Gly. In some embodiments, X 10 is Asp. In some embodiments, X 10 is Glu. In some embodiments, X 11 is Xaa H . In some embodiments, X 11 is Leu.
- X 12 is Xaa H . In some embodiments, X 12 is Val. In some embodiments, X 13 is Xaa A . In some embodiments, X 13 is Tyr. In some embodiments, X 15 is Xaa L . In some embodiments, X 15 is Thr. In some embodiments, X 15 is Val. In some embodiments, p1 is 1. In some embodiments, In some embodiments, X 1 is Xaa N . In some embodiments, X 1 is Asp. In some embodiments, X 1 is Glu.
- an amino acid residue may be replaced by another amino acid residue having similar properties, e.g., one Xaa H (e.g., Val, Leu, etc.) may be replaced with another Xaa H (e.g., Leu, Ile, Ala, etc.), one Xaa A may be replaced with another Xaa A , one Xaa P may be replaced with another Xaa P , one Xaa N may be replaced with another Xaa N , one Xaa L may be replaced with another Xaa L , etc.
- a target binding moiety is or comprises optionally substituted moiety of Table A-1.
- a protein binding moiety is or comprises optionally substituted moiety of Table A-1.
- an antibody binding moiety e.g., a universal antibody binding moiety, is or comprises optionally substituted moiety of Table A-1.
- a target binding moiety is selected from able A-1.
- a protein binding moiety is selected from able A-1.
- an antibody binding moiety e.g., a universal antibody binding moiety, is selected from able A-1.
- C-terminus and/or N- terminus are optionally capped (e.g., for C-terminus, by converting ⁇ COOH into ⁇ C(O)N(R’) 2 like ⁇ C(O)NH 2 ; for N-terminus, by adding R’C(O) ⁇ like CH 3 C(O) ⁇ to an amino group).
- Table A-1 Exemplary antibody binding moieties.
- a target binding moiety is an antibody binding moiety described herein.
- a protein binding moiety is an antibody binding moiety described herein.
- ⁇ COOH and/or amino groups of amino acid residues e.g., those at the C-terminus or N-terminus, is optionally capped.
- a ⁇ COOH group e.g., a C- terminus ⁇ COOH
- is amidated e.g., converted into ⁇ CON(R’) 2 , e.g., ⁇ C(O)NHR (e.g., ⁇ C(O)NH 2 )
- an amino group e.g.
- ⁇ NH 2 (e.g., a N-terminus ⁇ NH 2 ) is capped with R’ ⁇ or R’C(O) ⁇ (e.g., in some embodiments, by conversion ⁇ NH 2 into ⁇ NHR’ (e.g., ⁇ NHC(O)R, (e.g., ⁇ NHC(O)CH 3 ))).
- a target binding moiety is or comprises optionally substituted A-1.
- a target binding moiety is or comprises optionally substituted A-2.
- a target binding moiety is or comprises optionally substituted A-3.
- a target binding moiety is or comprises optionally substituted A-4.
- a target binding moiety is or comprises optionally substituted A-5. In some embodiments, a target binding moiety is or comprises optionally substituted A-6. In some embodiments, a target binding moiety is or comprises optionally substituted A-7. In some embodiments, a target binding moiety is or comprises optionally substituted A-8. In some embodiments, a target binding moiety is or comprises optionally substituted A-9. In some embodiments, a target binding moiety is or comprises optionally substituted A-10. In some embodiments, a target binding moiety is or comprises optionally substituted A-11. In some embodiments, a target binding moiety is or comprises optionally substituted A-12. In some embodiments, a target binding moiety is or comprises optionally substituted A-13.
- a target binding moiety is or comprises optionally substituted A-14. In some embodiments, a target binding moiety is or comprises optionally substituted A-15. In some embodiments, a target binding moiety is or comprises optionally substituted A-16. In some embodiments, a target binding moiety is or comprises optionally substituted A-17. In some embodiments, a target binding moiety is or comprises optionally substituted A- 18. In some embodiments, a target binding moiety is or comprises optionally substituted A-19. In some embodiments, a target binding moiety is or comprises optionally substituted A-20. In some embodiments, a target binding moiety is or comprises optionally substituted A-21. In some embodiments, a target binding moiety is or comprises optionally substituted A-22.
- a target binding moiety is or comprises optionally substituted A-23. In some embodiments, a target binding moiety is or comprises optionally substituted A-24. In some embodiments, a target binding moiety is or comprises optionally substituted A-25. In some embodiments, a target binding moiety is or comprises optionally substituted A-26. In some embodiments, a target binding moiety is or comprises optionally substituted A- 27. In some embodiments, a target binding moiety is or comprises optionally substituted A-28. In some embodiments, a target binding moiety is or comprises optionally substituted A-29. In some embodiments, a target binding moiety is or comprises optionally substituted A-30.
- a target binding moiety is or comprises optionally substituted A-31. In some embodiments, a target binding moiety is or comprises optionally substituted A-32. In some embodiments, a target binding moiety is or comprises optionally substituted A-33. In some embodiments, a target binding moiety is or comprises optionally substituted A-34. In some embodiments, a target binding moiety is or comprises optionally substituted A-35. In some embodiments, a target binding moiety is or comprises optionally substituted A- 36. In some embodiments, a target binding moiety is or comprises optionally substituted A-37. In some embodiments, a target binding moiety is or comprises optionally substituted A-38.
- a target binding moiety is or comprises optionally substituted A-39. In some embodiments, a target binding moiety is or comprises optionally substituted A-40. In some embodiments, a target binding moiety is or comprises optionally substituted A-41. In some embodiments, a target binding moiety is or comprises optionally substituted A-42. In some embodiments, a target binding moiety is or comprises optionally substituted A-43. In some embodiments, a target binding moiety is or comprises optionally substituted A-44. In some embodiments, a target binding moiety is or comprises optionally substituted A- 45. In some embodiments, a target binding moiety is or comprises optionally substituted A-46.
- a target binding moiety is or comprises optionally substituted A-47. In some embodiments, a target binding moiety is or comprises optionally substituted A-48. In some embodiments, a target binding moiety is or comprises optionally substituted A-49. In some embodiments, such a target binding moiety is an antibody binding moiety. In some embodiments, such a target binding moiety is a universal antibody binding moiety. [0163] In some embodiments, a target binding moiety is A-1. In some embodiments, a target binding moiety is A-2. In some embodiments, a target binding moiety is A-3. In some embodiments, a target binding moiety is A-4. In some embodiments, a target binding moiety is A-5.
- a target binding moiety is A-6. In some embodiments, a target binding moiety is A-7. In some embodiments, a target binding moiety is A-8. In some embodiments, a target binding moiety is A-9. In some embodiments, a target binding moiety is A-10. In some embodiments, a target binding moiety is A-11. In some embodiments, a target binding moiety is A-12. In some embodiments, a target binding moiety is A-13. In some embodiments, a target binding moiety is A-14. In some embodiments, a target binding moiety is A-15. In some embodiments, a target binding moiety is A-16. In some embodiments, a target binding moiety is A-17.
- a target binding moiety is A-18. In some embodiments, a target binding moiety is A-19. In some embodiments, a target binding moiety is A-20. In some embodiments, a target binding moiety is A-21. In some embodiments, a target binding moiety is A-22. In some embodiments, a target binding moiety is A-23. In some embodiments, a target binding moiety is A-24. In some embodiments, a target binding moiety is A-25. In some embodiments, a target binding moiety is A-26. In some embodiments, a target binding moiety is A-27. In some embodiments, a target binding moiety is A-28. In some embodiments, a target binding moiety is A-29.
- a target binding moiety is A-30. In some embodiments, a target binding moiety is A-31. In some embodiments, a target binding moiety is A-32. In some embodiments, a target binding moiety is A-33. In some embodiments, a target binding moiety is A-34. In some embodiments, a target binding moiety is A-35. In some embodiments, a target binding moiety is A-36. In some embodiments, a target binding moiety is A-37. In some embodiments, a target binding moiety is A-38. In some embodiments, a target binding moiety is A-39. In some embodiments, a target binding moiety is A-40. In some embodiments, a target binding moiety is A-41.
- a target binding moiety is A-42. In some embodiments, a target binding moiety is A-43. In some embodiments, a target binding moiety is A-44. In some embodiments, a target binding moiety is A-45. In some embodiments, a target binding moiety is A-46. In some embodiments, a target binding moiety is A-47. In some embodiments, a target binding moiety is A-48. In some embodiments, a target binding moiety is A-49. In some embodiments, such a target binding moiety is an antibody binding moiety. In some embodiments, such a target binding moiety is a universal antibody binding moiety.
- a target binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)) comprises a peptide unit, and is connected to a linker moiety through the C-terminus of the peptide unit. In some embodiments, it is connected to a linker moiety through the N-terminus of the peptide unit. In some embodiments, it is connected to a linker through a side chain group of the peptide unit.
- a protein binding moiety e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)
- a linker moiety comprises a peptide unit, and is connected to a linker moiety through the C-terminus of the peptide unit. In some embodiments, it is connected to a linker moiety through the N-terminus of the peptide unit. In some embodiments, it is connected to a linker through a side chain group of the peptide unit
- an antibody binding moiety e.g., a universal antibody binding moiety comprises a peptide unit, and is connected to a target binding moiety optionally through a linker moiety through the C-terminus of the peptide unit.
- a target binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)) comprises a peptide unit, and is connected to a target binding moiety optionally through a linker moiety through the N-terminus of the peptide unit.
- a target binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)) comprises a peptide unit, and is connected to a target binding moiety optionally through a linker moiety through a side chain of the peptide unit.
- a protein binding moiety e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)
- a target binding moiety comprises a peptide unit, and is connected to a target binding moiety optionally through a linker moiety through a side chain of the peptide unit.
- a target binding moiety is or comprises (DCAWHLGELVWCT) ⁇ , wherein 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally replaced with another amino acid residue, 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally deleted, and/or 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally inserted. In some embodiments, it is connected to the rest of a molecule through its N- terminus. In some embodiments, it is connected to the rest of a molecule through its C-terminus.
- a target binding moiety is or comprises wherein X is an amino acid residue bonded to the rest of a compound or agent, and wherein 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally replaced with another amino acid residue, 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally deleted, and/or 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally inserted.
- 1-5 e.g., 1, 2, 3, 4, or 5
- the total number of replacement, deletion and insertion is no more than 10 (e.g., 0, or no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10). In some embodiments, the total number is 0. In some embodiments, the total number is no more than 1. In some embodiments, the total number is no more than 2. In some embodiments, the total number is no more than 3. In some embodiments, the total number is no more than 4. In some embodiments, the total number is no more than 5. In some embodiments, the total number is no more than 6. In some embodiments, the total number is no more than 7. In some embodiments, the total number is no more than 8. In some embodiments, the total number is no more than 9. In some embodiments, the total number is no more than 10.
- a target binding moiety is or , wherein X is an amino acid residue bonded to the rest of a compound or agent.
- X is ⁇ N(R’) ⁇ CH( ⁇ ) ⁇ C(O) ⁇ .
- X is ⁇ N(R’) ⁇ CH( ⁇ L LG1 ⁇ ) ⁇ C(O) ⁇ .
- X is ⁇ N(R’) ⁇ CH( ⁇ L LG1 ⁇ L LG2 ⁇ ) ⁇ C(O) ⁇ .
- X is ⁇ N(R’) ⁇ CH( ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ ) ⁇ C(O) ⁇ . In some embodiments, X is ⁇ N(R’) ⁇ CH( ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ ) ⁇ C(O) ⁇ .
- a target binding moiety is or comprises . In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises .
- a target binding moiety is or comprises In some embodiments, X is a residue of In some embodiments, X is a residue of In some embodiments, X is a residue of In some embodiments, X is a residue of In some embodiments, X is a residue of In some embodiments, X is a residue of In some embodiments, X is a residue of In some embodiments, X is a residue of . In some embodiments, X is K. In some embodiments, X is D. In some embodiments, X is a residue of Dab. In some embodiments, X is E. In some embodiments, X is a residue of In some embodiments, the present disclosure provides an amino acid having the structure of
- an antibody binding moiety e.g., a universal antibody binding moiety, is or comprises a small molecule entity, with a molecular weight of, e.g., less than 10000, 9000, 8000, 7000, 6000, 5000, 4000, 3000, 2000, 1500, 1000, etc.
- Suitable such antibody binding moieties include small molecule Fc binder moieties, e.g., those described in US 9,745,339, US 201/30131321, etc.
- an antibody binding moiety is of such a structure that its corresponding compound is a compound described in US 9,745,339 or US 2013/0131321, the compounds of each of which are independently incorporated herein by reference.
- an antibody binding moiety ABT is of such a structure that H ⁇ ABT is a compound described in US 9,745,339 or US 2013/0131321, the compounds of each of which are independently incorporated herein by reference.
- such a compound can bind to an antibody.
- a target binding moiety is or comprises optionally substituted .
- a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises optionally substituted . In some embodiments, a target binding moiety is or comprises . n some embodiments, a target binding moiety is or comprises . In some embodiments, a target binding moiety is or comprises optionally substituted In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiment
- target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiments, a target binding moiety is or comprises In some embodiments, target binding moiety is or comprises optionally substituted . In some embodiments, target binding moiety is or comprises . In some embodiments, a target binding moiety is or comprises optionally substituted . In some embodiments, a target binding moiety is or comprises some embodiments, a target binding moiety is or comprises . In some embodiments, a target binding moiety is or comprises optionally substituted . In some embodiments, a target binding moiety is or comprises . In some embodiments, a target binding moiety is or comprises optionally substituted . In some embodiments, a target binding moiety is or comprises . In some embodiments, a target binding moiety is or comprises optionally substituted .
- a target binding moiety is or comprises . In some embodiments, such target binding moieties are antibody binding moieties. [0168] In some embodiments, target binding moiety is or comprises , wherein each variable is independently as described herein. In some embodiments, m is 4 to 13. In some embodiments, a target binding moiety is or comprises , wherein b is 1-20, and each other variable is independently as described herein. In some embodiments, b is 4-13. In some embodiments, a target binding moiety, e.g., R c ⁇ (Xaa)z ⁇ , is or comprises some embodiments, a target binding moiety, e.g.,
- R c ⁇ (Xaa)z ⁇ is or comprises target binding moiety, e.g., R c ⁇ (Xaa)z ⁇ , is or comprises .
- a target binding moiety, e.g., R c ⁇ (Xaa)z ⁇ is or comprises.
- a target binding moiety, e.g., R c ⁇ (Xaa)z ⁇ is or comprises.
- a target binding moiety, e.g., R c ⁇ (Xaa)z ⁇ is or comprises .
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety, e.g., R c ⁇ (Xaa)z ⁇ is or comprises .
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety is or comprises some embodiments
- a target binding moiety, e.g., R c ⁇ (Xaa)z ⁇ is or comprises .
- a target binding moiety, e.g., R c ⁇ (Xaa)z ⁇ is or comprises .
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., R c ⁇ (Xa
- R c ⁇ (Xaa)z ⁇ is or comprises .
- ⁇ NH ⁇ is bonded to a R c group.
- R c is R ⁇ C(O) ⁇ .
- R c is CH 3 C(O) ⁇ .
- such target binding moieties are antibody binding moieties.
- a target binding moiety, e.g., or R c ⁇ (Xaa)z ⁇ is or comprises .
- a target binding moiety, e.g., or R c ⁇ (Xaa)z ⁇ is or comprises
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises In some embodiments, a target binding moiety, e.g.,
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇
- such target binding moieties are antibody binding moieties.
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety, e.g., R c ⁇ (Xaa)z ⁇ is or comprises ⁇ FNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDD ⁇ NH 2 or a fragment thereof.
- a target binding moiety e.g., R c ⁇ (Xaa)z ⁇
- a target binding moiety is or comprises FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC or a fragment thereof.
- a target binding moiety, e.g., or R c ⁇ (Xaa)z ⁇ is or comprises a moiety of a peptide such as FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC, RGNCAYHRGQLVWCTYH, RGNCAYHKGQLVWCTYH, RGNCKYHRGQLVWCTYH, RGNCAWHRGKLVWCTYH, RGNCKWHRGELVWCTYH, RGNCKWHRGQLVWCTYH, RGNCKYHLGELVWCTYH, RGNCKYHLGQLVWCTYH, DCKWHLGELVWCT, DCKYHLGELVWCT, DCKWHRGELVWCT, DCKWHLGQLVWCT, DC
- a peptide such as Z33, FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC, RGNCAYHRGQLVWCTYH, RGNCKYHRGQLVWCTYH, RGNCAYHKGQLVWCTYH, RGNCAWHRGKLVWCTYH, RGNCKWHRGQLVWCTYH, RGNCKWHRGELVWCTYH, RGNCKYHLGELVWCTYH, RGNCKYHLGQLVWCTYH, DCKWHLGELVWCT, DCKYHLGELVWCT, DCKWHRGELVWCT, DCKWHLGQLVWCT, DCKYHRGELVWCT, DCKYHRGELVWCT, DCKYHLGQLVWCT, DCKWHRGQLVWCT, DCKYHRGQLVWCT, FNKQCQRRFYEALHDPNLNEEQRNARIRSIRDDC, FNMQC
- one or more amino acid residues of a sequence may be independently and optionally replaced (e.g., 1-5), deleted (e.g., 1-5) and/or inserted (e.g., 1-5) as described herein.
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises ⁇ CXYHXXXLVWC ⁇ , ⁇ XCXYHXXXLVWC ⁇ , ⁇ CXYHXXXLVWCX ⁇ , ⁇ X 0-3 CXYHXXXLVWCX 0-3 ⁇ , ⁇ XCXYHXXXLVWCXXX ⁇ XXXCXYHXXLVWCXX ⁇ , wherein each X is independently an amino acid residue, and the two C residues optionally form a disulfide bond.
- X 8 (the X after H) is Orn. In some embodiments, X 8 is Dab. In some embodiments, X 8 is Lys(Ac). In some embodiments, X 8 is Orn(Ac). In some embodiments, X 8 is Dab(Ac). In some embodiments, X 8 is Arg. In some embodiments, X 8 is Nle. In some embodiments, X 8 is Nva. In some embodiments, X 8 is Val. In some embodiments, X 8 is Tle. In some embodiments, X 8 is Leu. In some embodiments, X 8 is Ala(tBu). In some embodiments, X 8 is Cha. In some embodiments, X 8 is Phe.
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises DCAWHLGELVWCT.
- a C-terminus and/or a N-terminus of a protein agent/peptide agent moiety are independently capped (e.g., RC(O) ⁇ such as CH 3 C(O) ⁇ for N-terminus, ⁇ N(R’) 2 such as ⁇ NH 2 for C- terminus, etc.).
- such target binding moieties are antibody binding moieties.
- a residue may be modified or replaced for connection with another moiety, e.g., in some embodiments, H may be replaced with an amino acid residue comprises a side chain that contain ⁇ COOH or a salt or activated form thereof (e.g., D).
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises (X 1-3 )-C-(X 2 )-H-(Xaa1)-G-(Xaa2)-L-V-W-C-(X 1-3 ), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
- Xaa1 is R, L, L, D, E, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is L, D, E, N, or Q.
- Xaa1 is a lysine residue, a cysteine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is a glutamic acid residue or an aspartic acid residue.
- Xaa1 is an arginine residue or a leucine residue.
- Xaa2 is a lysine residue, a glutamine residue, or an aspartic acid residue.
- target binding moieties are antibody binding moieties.
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises (X1-3)-C-(Xaa3)-(xaa4)-H-(Xaa1)-G-(Xaa2)-L-V-W-C-(Xaa5)-(Xaa6)-(Xaa7), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
- Xaa3 is an alanine residue or a lysine residue.
- Xaa4 is a tryptophan residue or a tyrosine residue.
- Xaa1 is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
- Xaa5 is a threonine residue or a lysine residue.
- Xaa6 is a tyrosine residue, a lysine residue, or absent.
- Xaa7 is a histidine residue, a lysine residue, or absent.
- target binding moieties are antibody binding moieties.
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises D-C-(Xaa3)-(Xaa4)-H-(Xaa1)-G-(Xaa2)-L-V-W-C-(Xaa5)-(Xaa6)-(Xaa7), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
- Xaa3 is an alanine residue or a lysine residue.
- Xaa4 is a tryptophan residue or a tyrosine residue.
- Xaa1 is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
- Xaa5 is a threonine residue or a lysine residue.
- Xaa6 is a tyrosine residue, a lysine residue, or absent.
- Xaa7 is a histidine residue, a lysine residue, or absent.
- target binding moieties are antibody binding moieties.
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises D-C-(Xaa3)-(Xaa4)-H-(Xaa1)-G-(Xaa2)-L-V-W-C-T, wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
- Xaa3 is an alanine residue or a lysine residue.
- Xaa4 is a tryptophan residue or a tyrosine residue.
- Xaa1 is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
- target binding moieties are antibody binding moieties.
- a target binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises R-G-N-C-(Xaa3)-(Xaa4)-H-(Xaa1)-G-(Xaa2)-L-V-W-C-(Xaa5)- (Xaa6)-(Xaa7), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
- Xaa3 is an alanine residue or a lysine residue.
- Xaa4 is a tryptophan residue or a tyrosine residue.
- Xaa1 is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
- Xaa5 is a threonine residue or a lysine residue.
- Xaa6 is a tyrosine residue, a lysine residue, or absent.
- Xaa7 is a histidine residue, a lysine residue, or absent.
- target binding moieties are antibody binding moieties.
- target binding moieties e.g., various target binding moieties described above, are protein binding moieties.
- target binding moieties are antibody binding moieties.
- LG is or comprises such a target binding moiety.
- LG is or comprises a protein binding moiety.
- LG is or comprises an antibody binding moiety.
- target binding moieties e.g., antibody binding moieties
- useful technologies for developing and/or assessing such moieties are described in, e.g., Alves, Langmuir 2012, 28, 9640 ⁇ 9648; Choe et al., Materials 2016, 9, 994; doi:10.3390/ma9120994; Gupta et al., Nature Biomedical Engineering, vol.3, 2019, 917–929; Muguruma, et al., ACS Omega 2019, 4, 14390 ⁇ 14397, doi: 10.1021/acsomega.9b01104; Yamada, et al., Angew Chem Int Ed Engl.2019 Apr 16;58(17):5592- 5597, doi: 10.1002/anie.201814215; Kruljec, et al., Bioconjug Chem.2017, 28(8): 2009-2030, doi: 10.1021/acs.bioconjchem.7b00335 (
- a target binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety)
- a target binding moiety is an affinity substance described in AU 2018259856 or WO 2018199337, the affinity substance of each of which is incorporated herein by reference.
- a target binding moiety e.g., an antibody binding moiety
- an adapter protein agent e.g., as described in Hui, et al., Bioconjugate Chem.2015, 26, 1456 ⁇ 1460, doi: 10.1021/acs.bioconjchem.5b00275.
- adapter proteins do not require reactive residues (e.g., BPA) to achieve one or more or all advantages.
- target binding moiety e.g., an antibody binding moiety is or comprises a triazine moiety, e.g., one described in US 2009/0286693.
- a target binding moiety e.g., an antibody binding moiety is of such a structure that its corresponding compound is a compound described in US 2009/0286693, the compounds of which are independently incorporated herein by reference.
- a target binding moiety e.g., an antibody binding moiety
- ABT is of such a structure that H ⁇ ABT is a compound described in US 2009/0286693, the compounds of which are independently incorporated herein by reference.
- such a compound can bind to an antibody.
- such a compound can bind to Fc region of an antibody.
- a target binding moiety e.g., an antibody binding moiety is or comprises a triazine moiety, e.g., one described in Teng, et al., A strategy for the generation of biomimetic ligands for affinity chromatography. Combinatorial synthesis and biological evaluation of an IgG binding ligand, J. Mol. Recognit.1999;12:67–75 (“Teng”).
- a target binding moiety, e.g., an antibody binding moiety is of such a structure that its corresponding compound is a compound described in Teng, the compounds of which are independently incorporated herein by reference.
- a target binding moiety e.g., an antibody binding moiety
- ABT is of such a structure that H ⁇ ABT is a compound described in Teng, the compounds of which are independently incorporated herein by reference.
- such a compound can bind to an antibody.
- such a compound can bind to Fc region of an antibody.
- v target binding moiety e.g., an antibody binding moiety is a triazine moiety, e.g., one described in Uttamchandani, et al., Microarrays of Tagged Combinatorial Triazine Libraries in the Discovery of Small-Molecule Ligands of Human IgG, J Comb Chem. 2004 Nov- Dec;6(6):862-8 (“Uttamchandani”).
- a target binding moiety, e.g., an antibody binding moiety is of such a structure that its corresponding compound is a compound described in Uttamchandani, the compounds of which are independently incorporated herein by reference.
- a target binding moiety e.g., an antibody binding moiety, ABT is of such a structure that H ⁇ ABT is a compound described in Uttamchandani, the compounds of which are independently incorporated herein by reference.
- such a compound can bind to an antibody.
- such a compound can bind to Fc region of an antibody.
- an antibody binding moiety binds to one or more binding sites of protein A.
- an antibody binding moiety binds to one or more binding sites of protein G.
- an antibody binding moiety binds to one or more binding sites of protein L.
- an antibody binding moiety binds to one or more binding sites of protein Z. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein LG. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein LA. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein AG. In some embodiments, an antibody binding moiety is described in Choe, W., Durgannavar, T. A., & Chung, S. J. (2016). Fc-binding ligands of immunoglobulin G: An overview of high affinity proteins and peptides. Materials, 9(12). https://doi.org/10.3390/ma9120994.
- a target binding moiety e.g., an antibody binding moiety can bind to a nucleotide-binding site.
- a target binding moiety e.g., an antibody binding moiety is a small molecule moiety that can bind to a nucleotide-binding site.
- a small molecule is tryptamine.
- a target binding moiety, e.g., an antibody binding moiety, ABT is of such a structure that H ⁇ ABT is tryptamine.
- an antibody binding moiety is a moiety (e.g., small molecule moiety, peptide moiety, nucleic acid moiety, etc.) that can selectively bind to IgG, and when used in provided technologies can provide and/or stimulate ADCC and/or ADCP.
- peptide display technologies e.g., phase display, non-cellular display, etc.
- an antibody binding moiety is a moiety (e.g., small molecule moiety, peptide moiety, nucleic acid moiety, etc.) that can bind to IgG and optionally can compete with known antibody binders, e.g., protein A, protein G, protein L, etc.
- antibodies of various properties and activities may be targeted by antibody binding moieties described in the present disclosure.
- such antibodies include antibodies administered to a subject, e.g., for therapeutic purposes.
- antibody binding moieties described herein may bind antibodies toward different antigens and are useful for conjugating moieties of interest with various antibodies.
- a target binding moiety e.g., an antibody binding moiety
- a meditope agent is described in, e.g., US 2019/0111149.
- a target binding moiety e.g., an antibody binding moiety
- a target binding moiety can bind to human IgG.
- a target binding moiety e.g., an antibody binding moiety
- rabbit IgG e.g., a target binding moiety, binds to IgG1.
- a target binding moiety e.g., an antibody binding moiety
- a target binding moiety, e.g., an antibody binding moiety binds to IgG3.
- a target binding moiety binds to IgG4.
- a target binding moiety e.g., an antibody binding moiety
- a target binding moiety e.g., an antibody binding moiety
- s utilized in a reference technology as a non-target binding moiety.
- CH 3 ⁇ is utilized in a reference technology a non-target binding moiety.
- CH 3 C(O) ⁇ is utilized in a reference technology a non-target binding moiety.
- CH 3 C(O)NH ⁇ is utilized in a reference technology a non-target binding moiety.
- CH 3 C(O)NHCH 2 ⁇ is utilized in a reference technology a non- target binding moiety.
- CH 3 CH 2 ⁇ is utilized in a reference technology a non-target binding moiety.
- CH 3 CH 2 NH ⁇ is utilized in a reference technology a non-target binding moiety.
- CH 3 CH 2 NHC(O) ⁇ is utilized in a reference technology a non- target binding moiety.
- target binding moieties bind to targets (e.g., antibody agents for antibody binding moieties) with a Kd that is about 1 mM-1 pM or less.
- a Kd is about 1 mM, 0.5 mM, 0.2 mM, 0.1 mM, 0.05 mM, 0.02 mM, 0.01 mM, 0.005 mM, 0.002 mM, 0.001 mM, 500 nM, 200 nM, 100 nM, 50 nM, 20 nM, 10 nM, 5 nM, 2 nM, 1 nM, 0.5 nM, 0.2 nM, 0.1 nM, or less.
- Kd is about 1 mM or less.
- Kd is about 0.5 mM or less.
- Kd is about 0.1 mM or less.
- Kd is about 0.05 mM or less. In some embodiments, Kd is about 0.01 mM or less. In some embodiments, Kd is about 0.005 mM or less. In some embodiments, Kd is about 0.001 mM or less. In some embodiments, Kd is about 500 nM or less. In some embodiments, Kd is about 200 nM or less. In some embodiments, Kd is about 100 nM or less. In some embodiments, Kd is about 50 nM or less. In some embodiments, Kd is about 20 nM or less. In some embodiments, Kd is about 10 nM or less. In some embodiments, Kd is about 5 nM or less.
- Kd is about 2 nM or less. In some embodiments, Kd is about 1 nM or less.
- antibody binding moieties bind to IgG antibody agents with Kd described herein.
- Amino Acids [0191]
- provided compounds and agents may comprise one or more amino acid moieties, e.g., in antibody binding moieties, linker moieties, etc. Amino acid moieties can either be those of natural amino acids or unnatural amino acids.
- an amino acid has the structure of formula A-I: or a salt thereof, wherein: each of R a1 , R a2 and R a3 is independently ⁇ L a ⁇ R’ or an amino acid side chain; each of L a1 and L a2 is independently L a ; each L a is independently a covalent bond, or an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’) ⁇ , ⁇
- an amino acid residue e.g., of an amino acid having the structure of formula A-I, has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ .
- each amino acid residue in a peptide independently has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ .
- the present disclosure provides a derivative of an amino acid of formula A-I or a salt thereof.
- a derivative is an ester.
- the present disclosure provides a compound of formula NH(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOR CT or salt thereof, wherein R CT is R’ and each other variable is independently as described herein.
- R CT is R.
- R CT is optionally substituted aliphatic.
- R CT is t-butyl.
- L a1 is a covalent bond.
- a compound of formula A-I is of the structure NH(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH.
- L a2 is ⁇ CH 2 SCH 2 ⁇ .
- L a2 is a covalent bond.
- a compound of formula A-I is of the structure NH(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ COOH.
- an amino acid residue has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ CO ⁇ .
- L a1 is ⁇ CH 2 CH 2 S ⁇ .
- L a1 is ⁇ CH 2 CH 2 S ⁇ , wherein the CH 2 is bonded to NH(R a1 ).
- L a1 is a covalent bond and L a2 is a covalent bond.
- a compound of formula A-I is of the structure NH(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ COOH.
- a compound of formula A-I is of the structure NH(R a1 ) ⁇ CH(R a2 ) ⁇ COOH.
- a compound of formula A-I is of the structure NH(R a1 ) ⁇ CH(R a3 ) ⁇ COOH.
- a compound of formula A-I is of the structure NH 2 ⁇ CH(R a2 ) ⁇ COOH. In some embodiments, a compound of formula A-I is of the structure NH 2 ⁇ CH(R a3 ) ⁇ COOH. In some embodiments, an amino acid residue has the structure of ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ CO ⁇ . In some embodiments, an amino acid residue has the structure of ⁇ N(R a1 ) ⁇ CH(R a2 ) ⁇ CO ⁇ . In some embodiments, an amino acid residue has the structure of ⁇ N(R a1 ) ⁇ CH(R a3 ) ⁇ CO ⁇ .
- an amino acid residue has the structure of ⁇ NH ⁇ CH(R a2 ) ⁇ CO ⁇ . In some embodiments, an amino acid residue has the structure of ⁇ NH ⁇ CH(R a3 ) ⁇ CO ⁇ .
- L a is a covalent bond. In some embodiments, L a is optionally substituted C 1-6 bivalent aliphatic. In some embodiments, L a is optionally substituted C 1-6 alkylene. In some embodiments, L a is ⁇ CH 2 ⁇ . In some embodiments, L a is ⁇ CH 2 CH 2 ⁇ . In some embodiments, L a is ⁇ CH 2 CH 2 CH 2 ⁇ .
- L a is bivalent optionally substituted C 1-20 aliphatic, wherein one or more methylene units are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ , and/or ⁇ O ⁇ . In some embodiments, L a is bivalent optionally substituted C 1-20 aliphatic, wherein one or more methylene units are independently replaced with ⁇ C(O)N(R’) ⁇ , ⁇ Cy ⁇ , and ⁇ O ⁇ .
- L a is bivalent optionally substituted C 1-20 aliphatic, wherein two or more methylene units are independently replaced with ⁇ C(O)N(R’) ⁇ , and ⁇ Cy ⁇ in addition to other optional replacements.
- ⁇ Cy ⁇ is optionally substituted.
- ⁇ Cy ⁇ is optionally substituted with an electron- withdrawing group as described herein.
- ⁇ Cy ⁇ is substituted with one or more ⁇ F.
- ⁇ Cy ⁇ is optionally substituted 1,3-phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,4-phenylene.
- L a is or comprises n some embodiments, L a is or comprises n some embodiments, L a is or comprises I n some embodiments, L a is or comprises In some embodiments, L a is or comprises a In some embodiments, L is or comprises In some embodiments, L a is or comprises . In some embodiments, L a is or comprises n some embodiments, L a is or comprises In some embodiments, L a is or comprises In some embodiments, L a is or comprises In some embodiments, L a is or comprises In some embodiments, L a is or comprises In some embodiments, L a is or comprises . In some embodiments, L a is or comprises . In some embodiments, L a is or comprises . In some embodiments, L a is or comprises a In some embodiments, L is or comprises a In some embodiments, L is or comprises .
- L a is or comprises . In some embodiments, L a is or comprises . In some embodiments, L a is or comprises . [0198] In some embodiments, R’ is R. In some embodiments, R a1 is R, wherein R is as described in the present disclosure. In some embodiments, R a1 is R, wherein R methyl. In some embodiments, R a2 is R, wherein R is as described in the present disclosure. In some embodiments, R a3 is R, wherein R is as described in the present disclosure. In some embodiments, each of R a1 , R a2 , and R a3 is independently R, wherein R is as described in the present disclosure.
- R a1 is hydrogen. In some embodiments, R a1 is a protective group. In some embodiments, R a1 is ⁇ Fmoc. In some embodiments, R a1 is ⁇ Dde. [0200] In some embodiments, each of R a1 , R a2 and R a3 is independently ⁇ L a ⁇ R’. [0201] In some embodiments, R a2 is hydrogen. In some embodiments, R a3 is hydrogen. In some embodiments, R a1 is hydrogen, and at least one of R a2 and R a3 is hydrogen. In some embodiments, R a1 is hydrogen, one of R a2 and R a3 is hydrogen, and the other is not hydrogen.
- R a2 is ⁇ L a ⁇ R and R a3 is ⁇ H. In some embodiments, R a3 is ⁇ L a ⁇ R and R a2 is ⁇ H. In some embodiments, R a2 is ⁇ CH 2 ⁇ R and R a3 is ⁇ H. In some embodiments, R a3 is ⁇ CH 2 ⁇ R and R a2 is ⁇ H. In some embodiments, R a2 is R and R a3 is ⁇ H. In some embodiments, R a3 is R and R a2 is ⁇ H. [0202] In some embodiments, R a2 is ⁇ L a ⁇ R, wherein R is as described in the present disclosure.
- R a2 is ⁇ L a ⁇ R, wherein R is an optionally substituted group selected from C 3-30 cycloaliphatic, C 5-30 aryl, 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-30 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R a2 is ⁇ L a ⁇ R, wherein R is an optionally substituted group selected from C 6-30 aryl and 5- 30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R a2 is a side chain of an amino acid. In some embodiments, R a2 is a side chain of a standard amino acid. [0203] In some embodiments, R a3 is ⁇ L a ⁇ R, wherein R is as described in the present disclosure. In some embodiments, R a3 is ⁇ L a ⁇ R, wherein R is an optionally substituted group selected from C 3-30 cycloaliphatic, C 5-30 aryl, 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-30 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R a3 is ⁇ L a ⁇ R, wherein R is an optionally substituted group selected from C 6-30 aryl and 5- 30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R a3 is a side chain of an amino acid.
- R a3 is a side chain of a standard amino acid.
- one or R a2 and R a3 is ⁇ H.
- one or R a2 and R a3 is ⁇ L a ⁇ R, wherein L a is as described herein. In some embodiments, L a is not a covalent bond.
- one or more methylene units of L a are independently and optionally replaced as described herein, e.g., with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ O ⁇ , ⁇ C(O) ⁇ N(R’) ⁇ and/or ⁇ Cy ⁇ , etc.
- L a is or comprises ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ and ⁇ Cy ⁇ .
- L a is or comprises ⁇ C(O)N(R’) ⁇ and ⁇ Cy ⁇ .
- ⁇ Cy ⁇ is substituted and one or more substituents are independently an electron-withdrawing group.
- an amino acid side chain is R a2 or R a3 .
- an amino acid side chain is or comprises ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H.
- an amino acid side chain is or comprises ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H.
- an amino acid side chain is or comprises ⁇ L LG3 ⁇ L LG4 ⁇ H.
- an amino acid side chain is or comprises ⁇ L LG4 ⁇ H.
- such a side chain is .
- such a side chain is some embodiments, such a side chain is some embodiments, such a side chain is .
- R is an optionally substituted C 1-6 aliphatic. In some embodiments, R is an optionally substituted C 1-6 alkyl. In some embodiments, R is ⁇ CH 3 . In some embodiments, R is optionally substituted pentyl. In some embodiments, R is n-pentyl. [0207] In some embodiments, R is a cyclic group. In some embodiments, R is an optionally substituted C 3-30 cycloaliphatic group. In some embodiments, R is cyclopropyl.
- R is an optionally substituted aromatic group, and an amino acid residue of an amino acid of formula A-I is a Xaa A .
- R a2 or R a3 is ⁇ CH 2 ⁇ R, wherein R is an optionally substituted aryl or heteroaryl group.
- R is optionally substituted phenyl.
- R is phenyl.
- R is optionally substituted phenyl.
- R is 4-trifluoromethylphenyl.
- R is 4-phenylphenyl.
- R is optionally substituted 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon. In some embodiments, R is optionally substituted 5-14 membered heteroaryl having 1-5 heteroatoms independently selected from oxygen, nitrogen, and sulfur. In some embodiments, R is . In some embodiments, R is optionally substituted pyridinyl. In some embodiments, R is 1- pyridinyl. In some embodiments, R is 2- pyridinyl. In some embodiments, R is 3- pyridinyl. In some embodiments, R is . [0209] In some embodiments, R’ is ⁇ COOH.
- a compound of and an amino acid residue of an amino acid of formula A-I is a Xaa N .
- R’ is ⁇ NH 2 .
- a compound of an amino acid residue of an amino acid of formula A-I is a Xaa P .
- R a2 or R a3 is R, wherein R is C 1-20 aliphatic as described in the present disclosure.
- a compound of an amino acid residue of an amino acid of formula A-I is a Xaa H .
- R is ⁇ CH 3 .
- R is ethyl.
- R is propyl.
- R is n-propyl. In some embodiments, R is butyl. In some embodiments, R is n-butyl. In some embodiments, R is pentyl. In some embodiments, R is n- pentyl. In some embodiments, R is cyclopropyl. [0212] In some embodiments, two or more of R a1 , R a2 , and R a3 are R and are taken together to form an optionally substituted ring as described in the present disclosure.
- R a1 and one of R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring having no additional ring heteroatom other than the nitrogen atom to which R a1 is bonded to.
- a formed ring is a 5-membered ring as in proline.
- R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring as described in the present disclosure.
- R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring having one or more nitrogen ring atom.
- R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring having one and no more than one ring heteroatom which is a nitrogen atom.
- a ring is a saturated ring.
- an amino acid is a natural amino acid.
- an amino acid is an unnatural amino acid.
- an amino acid is an alpha-amino acid.
- an amino acid is a beta-amino acid.
- a compound of formula A-I is a natural amino acid.
- a compound of formula A-I is an unnatural amino acid.
- an amino acid comprises a hydrophobic side chain.
- an amino acid with a hydrophobic side chain is A, V, I, L, M, F, Y or W.
- an amino acid with a hydrophobic side chain is A, V, I, L, M, or F.
- an amino acid with a hydrophobic side chain is A, V, I, L, or M.
- an amino acid with a hydrophobic side chain is A, V, I, or L.
- a hydrophobic side chain is R wherein R is C 1-10 aliphatic.
- R is C 1-10 alkyl.
- R is methyl.
- R is ethyl. In some embodiments, R is propyl. In some embodiments, R is butyl. In some embodiments, R is pentyl. In some embodiments, R is n-pentyl.
- an amino acid with a hydrophobic side chain is NH 2 CH(CH 2 CH 2 CH 2 CH 2 CH 3 )COOH. In some embodiments, an amino acid with a hydrophobic side chain is (S)-NH 2 CH(CH 2 CH 2 CH 2 CH 2 CH 3 )COOH. In some embodiments, an amino acid with a hydrophobic side chain is (R)- NH 2 CH(CH 2 CH 2 CH 2 CH 2 CH 3 )COOH.
- a hydrophobic side chain is ⁇ CH 2 R wherein R is optionally substituted phenyl. In some embodiments, R is phenyl. In some embodiments, R is phenyl substituted with one or more hydrocarbon group. In some embodiments, R is 4-phenylphenyl. In some embodiments, an amino acid with a hydrophobic side chain is NH 2 CH(CH 2 ⁇ 4- phenylphenyl)COOH. In some embodiments, an amino acid with a hydrophobic side chain is (S)- NH 2 CH(CH 2 ⁇ 4-phenylphenyl)COOH.
- an amino acid with a hydrophobic side chain is (R)-NH 2 CH(CH 2 ⁇ 4-phenylphenyl)COOH.
- an amino acid comprises a positively charged side chain (e.g., at physiological pH) as described herein.
- such an amino acid comprises a basic nitrogen in its side chain.
- such an amino acid is Arg, His or Lys.
- such an amino acid is Arg.
- such an amino acid is His.
- such an amino acid is Lys.
- an amino acid comprises a negatively charged side chain (e.g., at physiological pH) as described herein.
- such an amino acid comprises a ⁇ COOH in its side chain.
- such an amino acid is Asp.
- such an amino acid is Glu.
- an amino acid comprises a side chain comprising an aromatic group as described herein.
- such an amino acid is Phe, Tyr, Trp, or His.
- such an amino acid is Phe.
- such an amino acid is Tyr.
- such an amino acid is Trp.
- such an amino acid is His.
- such an amino acid is NH 2 ⁇ CH(CH 2 ⁇ 4-phenylphenyl) ⁇ COOH.
- such an amino acid is (S)-NH 2 ⁇ CH(CH 2 ⁇ 4-phenylphenyl) ⁇ COOH. In some embodiments, such an amino acid is (R)-NH 2 ⁇ CH(CH 2 ⁇ 4-phenylphenyl) ⁇ COOH. [0220] In some embodiments, an amino acid i thereof. In some embodiments, an amino acid i alt thereof. In some embodiments, an amino acid i alt thereof. In some embodiments, an amino acid i salt thereof. In some embodiments, an amino acid is or a salt thereof. In some embodiments, an amino acid is or a salt thereof. In some embodiments, an amino acid is or a salt thereof. In some embodiments, an amino acid is or a salt thereof. In some embodiments, an amino acid is or a salt thereof. In some embodiments, an amino acid is or a salt thereof. In some embodiments, an amino acid is or a salt thereof.
- a provided compound is In some embodiments, the present disclosure provides polypeptide agents comprising one or more amino acid residues described in the present disclosure.
- Reactive Group [0221]
- provided compounds e.g., those useful as reaction partners, comprise reactive groups (e.g., RG).
- reactive groups e.g., RG
- first groups e.g., LG
- moieties of interest e.g., MOI
- RG is a reaction group as described herein.
- reactive groups when utilized in compounds that comprise no target binding moieties react slowly and provide low level of, in some embodiments, substantially no conjugation of moieties of interest with target agents.
- combination of reactive groups with target binding moieties in the same compounds e.g., as in compounds of formula R-I or salts thereof, can, among other things, promote reactions between reactive groups and target agents, enhance reaction efficiency, reduce side reactions, and/or improve reaction selectivity (e.g., in terms of target sites wherein conjugation of moieties of interest with target agents occurs).
- Reactive groups in provided compounds can react with various types of groups in target agents.
- reactive groups in provided compounds selectively react with amino groups of target agents, e.g., ⁇ NH 2 groups on side chains of lysine residues of proteins.
- reactive groups when utilized in provided compounds e.g., those of formula R-I or salts thereof, selectively react with particular sites of target agents, e.g., as shown in examples herein, one or more of K246, K248, K288, K290, K317, etc. of IgG1, K251, K 253, etc. for IgG2, K239, K241 for IgG4, etc.
- a site is K246 or K248 of an antibody heavy chain.
- sites are K246 and/or K248 of an antibody heavy chain.
- a site is K246 of an antibody heavy chain.
- a site is K248 of an antibody heavy chain.
- a site is K288 or K290 of an antibody heavy chain.
- a site is K288 of an antibody heavy chain.
- a site is K290 of an antibody heavy chain.
- a site is K317.
- a site is K414 of an antibody heavy chain.
- a site is K185 of an antibody light chain.
- a site is K187 of an antibody light chain.
- sites are K251 and/or K253 of an IgG2 heavy chain. In some embodiments, a site is K251 of an IgG2 heavy chain. In some embodiments, a site is K253 of an IgG2 heavy chain. In some embodiments, sites are K239 and/or K241 of an IgG4 heavy chain. In some embodiments, a site is K239 of an IgG4 heavy chain. In some embodiments, a site is K241 of an IgG4 heavy chain. In some embodiments, conjugation selectively occurs at one or more heavy chain sites over light chain sites. In some embodiments, for technologies without target binding moieties, conjugation occurs at light chain sites more than heavy chain sites (e.g., see Figure 15).
- a reactive group e.g., RG
- a reactive group is or comprises an ester group.
- a reactive group e.g., RG
- an electrophilic group e.g., a Michael acceptor.
- a reactive group, e.g., RG is or comprises ⁇ L RG1 ⁇ L RG2 ⁇ , wherein each of L RG1 and L RG2 is independently L as described herein.
- a reactive group, e.g., RG is or comprises ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ , wherein each variable is as described herein.
- a reactive group e.g., RG
- a reactive group is or comprises ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ , wherein each variable is as described herein.
- a reactive group e.g., RG
- a reactive group is or comprises ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ , wherein each variable is as described herein.
- a reactive group, e.g., RG is or comprises ⁇ L LG4 ⁇ L RG2 ⁇ , wherein each variable is as described herein.
- a reactive group e.g., RG
- a reactive group is or comprises ⁇ L LG3 ⁇ L LG4 ⁇ L RG2 ⁇ , wherein each variable is as described herein.
- a reactive group e.g., RG
- L LG4 is ⁇ O ⁇ .
- L LG4 is ⁇ N(R) ⁇ .
- L LG4 is ⁇ NH ⁇ .
- L LG3 is or comprises an optionally substituted aryl ring.
- L LG3 is or comprises a phenyl ring. In some embodiments, an aryl or phenyl ring is substituted. In some embodiments, a substituent is a electron-withdrawing group as described herein, e.g., ⁇ NO 2 , ⁇ F, etc.
- L RG1 is a covalent bond. In some embodiments, L RG1 is not a covalent bond. In some embodiments, L RG1 is ⁇ S(O) 2 ⁇ . [0229] In some embodiments, L RG2 is ⁇ C(O) ⁇ .
- a reactive group is or comprises ⁇ L LG4 ⁇ C(O) ⁇ , wherein each variable is as described herein. In some embodiments, a reactive group is or comprises ⁇ L LG3 ⁇ L LG4 ⁇ C(O) ⁇ , wherein each variable is as described herein. In some embodiments, a reactive group is or comprises ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ C(O) ⁇ , wherein each variable is as described herein.
- each of R RG1 , R RG2 , R RG3 and R RG4 is independently R’. In some embodiments, one or more of R RG1 , R RG2 , R RG3 and R RG4 is independently ⁇ H. In some embodiments, L RG3 is ⁇ C(O) ⁇ . In some embodiments, L RG3 is ⁇ C(O)O ⁇ . In some embodiments, ⁇ O ⁇ , ⁇ N(R’) ⁇ , etc. of L RG3 is bonded to L PM . [0231] In some embodiments, R RG1 is ⁇ H. In some embodiments, R RG3 is ⁇ H.
- R RG2 and R RG4 are taken together with their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is an optionally substituted 3-10 membered monocyclic or bicyclic ring having 0-5 heteroatoms.
- a formed ring is an optionally substituted 3-10 membered cycloaliphatic ring.
- a formed ring is an optionally substituted 3-8 membered cycloaliphatic ring. In some embodiments, a formed ring is an optionally substituted 5-8 membered cycloaliphatic ring. In some embodiments, a formed ring is an optionally substituted 5-membered cycloaliphatic ring. In some embodiments, a formed ring is an optionally substituted 6-membered cycloaliphatic ring. In some embodiments, a formed ring is an optionally substituted 7-membered cycloaliphatic ring. In some embodiments, a formed ring is substituted. In some embodiments, a formed ring is not substituted.
- a reactive group is a structure selected from the Table below.
- ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ is a structure selected from the Table below.
- ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ RG ⁇ is a structure selected from the Table below. Table RG-1. Certain structures as examples.
- ⁇ L LG4 ⁇ L RG2 ⁇ is ⁇ O ⁇ C(O) ⁇ . In some embodiments, ⁇ L LG4 ⁇ L RG2 ⁇ is ⁇ S ⁇ C(O) ⁇ . In some embodiments, ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ is ⁇ S ⁇ C(O) ⁇ . [0237] In some embodiments, ⁇ L LG4 ⁇ L RG2 ⁇ is ⁇ N( ⁇ ) ⁇ C(O) ⁇ , wherein N is a ring atom of an optionally substituted heteroaryl ring.
- ⁇ L LG4 ⁇ L RG2 ⁇ is ⁇ N( ⁇ ) ⁇ C(O) ⁇ , wherein N is a ring atom of L LG4 which is or comprises an optionally substituted heteroaryl ring.
- ⁇ L LG4 ⁇ L RG2 ⁇ is ⁇ N( ⁇ ) ⁇ C(O) ⁇ O ⁇ , wherein N is a ring atom of L LG4 which is or comprises an optionally substituted heteroaryl ring.
- L RG2 is optionally substituted ⁇ CH 2 ⁇ C(O) ⁇ , wherein ⁇ CH 2 ⁇ is bonded to an electron-withdrawing group comprising or connected to a target binding moiety.
- L RG2 is optionally substituted ⁇ CH 2 ⁇ bonded to an electron-withdrawing group comprising or connected to a target binding moiety.
- L RG1 is an electron-withdrawing group.
- L RG1 is ⁇ C(O) ⁇ .
- L RG1 is ⁇ S(O) ⁇ .
- L RG1 is ⁇ S(O) 2 ⁇ .
- L RG1 is ⁇ P(O(OR) ⁇ .
- L RG1 is ⁇ P(O(SR) ⁇ .
- L RG1 is ⁇ P(O(N(R) 2 ) ⁇ .
- L RG1 is ⁇ OP(O(OR) ⁇ . In some embodiments, L RG1 is ⁇ OP(O(SR) ⁇ . In some embodiments, L RG1 is ⁇ OP(O(N(R) 2 ) ⁇ . [0239] In some embodiments, L RG2 is optionally substituted ⁇ CH 2 ⁇ C(O) ⁇ , wherein ⁇ CH 2 ⁇ is bonded to a leaving group comprising or connected to a target binding moiety. In some embodiments, L RG2 is optionally substituted ⁇ CH 2 ⁇ bonded to a leaving group comprising or connected to a target binding moiety. In some embodiments, L RG1 is ⁇ O ⁇ C(O) ⁇ .
- L RG1 is ⁇ OS(O) 2 ⁇ . In some embodiments, L RG1 is ⁇ OP(O(OR) ⁇ . In some embodiments, L RG1 is ⁇ OP(O(SR) ⁇ . In some embodiments, L RG1 is ⁇ OP(O(N(R) 2 ) ⁇ .
- a reactive group reacts with an amino group of a target agent. In some embodiments, an amino group is ⁇ NH 2 of the side chain of a lysine residue.
- a target agent is a protein agent. In some embodiments, a target agent is an antibody agent. In some embodiments, a reactive group reacts with an amino acid residue of such protein or antibody agent.
- an amino acid residue is a lysine residue.
- a reactive group reacts with ⁇ NH 2 of the side chain of a lysine residue.
- a reactive group is or comprises ⁇ C(O) ⁇ O ⁇ , it reacts with ⁇ NH 2 (e.g., of the side chain of a lysine residue), and forms an amide group ⁇ C(O) ⁇ O ⁇ with the ⁇ NH 2 .
- Linker Moieties [0242] In some embodiments, moieties are optionally connected to each other through linker moieties.
- a reactive group e.g., RG
- a moiety of interest e.g., MOI
- a linker e.g., L RM
- a moiety, e.g., LG may also comprise one or more linkers, e.g., L LG1 , L LG2 , L LG3 , L LG4 , etc., to link various portions.
- L LG is a linker moiety described herein.
- L LG1 is a linker moiety described herein.
- L LG2 is a linker moiety described herein.
- L LG3 is a linker moiety described herein.
- L LG4 is a linker moiety described herein.
- L RM is a linker moiety described herein.
- L PM is L as described herein.
- L PM is a linker moiety described herein.
- L PM is L as described herein.
- Linker moieties of various types and/or for various purposes, e.g., those utilized in antibody-drug conjugates, etc., may be utilized in accordance with the present disclosure.
- Linker moieties can be either bivalent or polyvalent depending on how they are used. In some embodiments, a linker moiety is bivalent.
- a linker is polyvalent and connecting more than two moieties.
- a linker moiety e.g., L z (wherein z represents superscript text; e.g., L PM , L RM , L LG , L LG1 , etc.), is or comprises L.
- L is a covalent bond, or a bivalent or polyvalent optionally substituted, linear or branched C 1-100 group comprising one or more aliphatic, aryl, heteroaliphatic having 1-20 heteroatoms, heteroaromatic having 1-20 heteroatoms, or any combinations thereof, wherein one or more methylene units of the group are optionally and independently replaced with C 1-6 alkylene, C 1-6 alkenylene, a bivalent C 1-6 heteroaliphatic group having 1-5 heteroatoms, , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ , ⁇ N(R’)
- each amino acid residue is independently a residue of an amino acid having the structure of formula A-I or a salt thereof. In some embodiments, each amino acid residue independently has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ or a salt form thereof. [0247] In some embodiments, L is bivalent. In some embodiments, L is a covalent bond.
- L is a bivalent or optionally substituted, linear or branched group selected from C 1-00 aliphatic and C 1-100 heteroaliphatic having 1-50 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with C 1-6 alkylene, C 1-6 alkenylene, a bivalent C 1-6 heteroaliphatic group having 1-5 heteroatoms, , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) 2 ⁇
- L is a bivalent or optionally substituted, linear or branched group selected from C 1-20 aliphatic and C 1-20 heteroaliphatic having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with C 1-6 alkylene, C 1-6 alkenylene, a bivalent C 1-6 heteroaliphatic group having 1-5 heteroatoms, , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) 2 ⁇
- L is a bivalent or optionally substituted, linear or branched group selected from C 1-20 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , ⁇ C(O)O ⁇ , ⁇ P(O)(OR’) ⁇ , ⁇ P(O)(OR’) ⁇ ,
- L is a bivalent or optionally substituted, linear or branched group selected from C 1-20 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , ⁇ C(O)O ⁇ , an amino acid residue or ⁇ [( ⁇ O ⁇ C(R’) 2 ⁇ , ⁇ O
- L is a bivalent or optionally substituted, linear or branched group selected from C 1-20 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , an amino acid residue or ⁇ [( ⁇ O ⁇ C(R’) 2 ⁇ C(R’) 2 ⁇ ) n ] ⁇ .
- a linker moiety e.g., L, L PM , L RM , etc., comprises an acidic group, e.g., ⁇ S(O) 2 OH.
- L is or comprises ⁇ [( ⁇ O ⁇ C(R’) 2 ⁇ C(R’) 2 ⁇ ) n ] ⁇ .
- L is or comprises ⁇ [( ⁇ O ⁇ CH 2 ⁇ CH 2 ⁇ ) n ] ⁇ .
- L is ⁇ [( ⁇ CH 2 ⁇ CH 2 ⁇ O) 6 ] ⁇ CH 2 ⁇ CH 2 ⁇ .
- L is ⁇ [( ⁇ CH 2 ⁇ CH 2 ⁇ O) 8 ] ⁇ CH 2 ⁇ CH 2 ⁇ .
- ⁇ CH 2 ⁇ CH 2 ⁇ O ⁇ is bonded to a target binding moiety at a ⁇ CH 2 ⁇ .
- ⁇ CH 2 ⁇ CH 2 ⁇ O ⁇ is bonded to a moiety of interest at a ⁇ CH 2 ⁇ .
- L PM is such L as described herein.
- L RM is such L as described herein.
- a linker moiety is trivalent or polyvalent.
- a linker moiety is L as described herein and L is trivalent or polyvalent.
- L is trivalent.
- L is ⁇ CH 2 ⁇ N( ⁇ CH 2 ⁇ ) ⁇ C(O) ⁇ .
- L is or comprises a bioorthogonal or enzymatic reaction product moiety.
- L is or comprise an optionally substituted triazole moiety (which is optionally part of a bi- or poly-cyclic ring system).
- L is or comprises LPXTG.
- L is or comprises LPETG.
- L is or comprises LPXT(G)n, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- L is or comprises LPET(G)n, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups (except one or more reactive groups and/or moieties therein) that could be cleaved under conditions that would not substantially damage or transform target agents and/or agents comprising target agent moieties (e.g., conjugation products comprising target agent moieties).
- provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups (except one or more reactive groups and/or moieties therein) that could be cleaved under conditions that would not render target agents and/or agents comprising target agent moieties (e.g., conjugation products comprising target agent moieties) for one or more uses (e.g., for use as diagnostic agents, therapeutic agents, etc.).
- provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups which can be cleaved under bioorthogonal conditions.
- provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups which can be cleaved without substantively damaging and/or transforming proteins.
- a cleavage group is a cleavable linker or a cleavable portion described in WO 2018199337A1 or AU 2018259856, the cleavable linkers and cleavable portions of each of which is incorporated herein by reference.
- a cleavage group is:
- R 2a , R 2b and R 2c are the same or different and each is independently: (i) a hydrogen atom or a halogen atom; (ii) a monovalent hydrocarbon group; (iii) aralkyl; (iv) a monovalent heterocyclic group; (v) R c ⁇ O ⁇ , R c ⁇ C(O) ⁇ , R c ⁇ O ⁇ C(O) ⁇ , or R c ⁇ C(O) ⁇ O ⁇ , wherein R c is hydrogen or a monovalent hydrocarbon group; (vi) ⁇ NR d R e , ⁇ NR d R e ⁇ C(O) ⁇ , ⁇ NR d R e ⁇ C(O)O ⁇ , ⁇ NR d ⁇ C(O) ⁇ , ⁇ NR d ⁇ C(O)O ⁇ , or R d ⁇ C(O) ⁇ NR e
- a linker moiety comprises no ⁇ S ⁇ . In some embodiments, a linker moiety comprises no ⁇ S ⁇ S ⁇ (optionally except a disulfide moiety formed by two amino acid residues, in some embodiments, optionally except a disulfide moiety formed by two cysteine residues). In some embodiments, a linker moiety comprises no ⁇ S ⁇ Cy ⁇ . In some embodiments, a linker moiety comprises no ⁇ S ⁇ CH 2 ⁇ Cy ⁇ . In some embodiments, a linker moiety comprises no ⁇ C(O) ⁇ O ⁇ . In some embodiments, a linker moiety comprises no ⁇ C(O) ⁇ S ⁇ .
- a linker moiety comprises no ⁇ C(O) ⁇ CH 2 ⁇ , wherein the ⁇ CH 2 ⁇ is bonded to a benzylic carbon, wherein the phenyl ring of the benzyl group is substituted with ⁇ NO 2 ⁇ at o- position.
- a linker moiety comprise no ⁇ C(O) ⁇ N( ⁇ ) ⁇ moiety, wherein N is a ring atom of a heteroaryl ring.
- a linker moiety does not contain any of these groups.
- L RM is such a linker moiety.
- L PM is such a linker moiety.
- L LG is such a linker moiety. In some embodiments, an agent of the present disclosure does not contain one or more or all of such moieties. [0259] In some embodiments, L is a covalent bond. In some embodiments, L is a bivalent optionally substituted, linear or branched C 1-100 aliphatic group wherein one or more methylene units of the group are optionally and independently replaced. In some embodiments, L is a bivalent optionally substituted, linear or branched C 6-100 arylaliphatic group wherein one or more methylene units of the group are optionally and independently replaced.
- L is a bivalent optionally substituted, linear or branched C 5-100 heteroarylaliphatic group having 1-20 hetereoatoms wherein one or more methylene units of the group are optionally and independently replaced.
- L is a bivalent optionally substituted, linear or branched C 1-100 heteroaliphatic group having 1-20 heteroatoms wherein one or more methylene units of the group are optionally and independently replaced.
- a linker moiety e.g., L
- L is or comprises one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more) polyethylene glycol units.
- a linker moiety is or comprises ⁇ (CH 2 CH 2 O) n ⁇ , wherein n is as described in the present disclosure.
- one or more methylene units of L are independently replaced with ⁇ (CH 2 CH 2 O) n ⁇ .
- n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, n is 6. In some embodiments, n is 7. In some embodiments, n is 8. In some embodiments, n is 9. In some embodiments, n is 10. In some embodiments, n is 11. In some embodiments, n is 12.
- n is 13. In some embodiments, n is 14. In some embodiments, n is 15. In some embodiments, n is 16. In some embodiments, n is 17. In some embodiments, n is 18. In some embodiments, n is 19. In some embodiments, n is 20.
- a linker moiety e.g., L
- one or more can be 1-100, 1-50, 1-40, 1-30, 1-20, 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or more.
- one or more methylene units of L are independently replaced with an amino acid residue.
- one or more methylene units of L are independently replaced with an amino acid residue, wherein the amino acid residue is of an amino acid of formula A-I or a salt thereof.
- one or more methylene units of L are independently replaced with an amino acid residue, wherein each amino acid residue independently has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ or a salt form thereof.
- a linker moiety comprises one or more moieties, e.g., amino, carbonyl, etc., that can be utilized for connection with other moieties.
- a linker moiety comprises one or more ⁇ NR’ ⁇ , wherein R’ is as described in the present disclosure.
- ⁇ NR’ ⁇ improves solubility.
- ⁇ NR’ ⁇ serves as connection points to another moiety.
- R’ is ⁇ H.
- one or more methylene units of L are independently replaced with ⁇ NR’ ⁇ , wherein R’ is as described in the present disclosure.
- a linker moiety e.g., L
- one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ .
- a linker moiety, e.g., L comprises a ⁇ NR’ ⁇ group, which can be utilized for connections with a moiety.
- one or more methylene units of L are independently replaced with ⁇ N(R’) ⁇ .
- a linker moiety e.g., L
- one or more methylene units of L are independently replaced with ⁇ C(O)N(R’) ⁇ .
- a linker moiety e.g., L
- one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ .
- ⁇ C(R’) 2 ⁇ is ⁇ CHR’ ⁇ .
- R’ is ⁇ (CH 2 ) 2 C(O)NH(CH 2 ) 11 COOH.
- R’ is ⁇ (CH 2 ) 2 COOH.
- R’ is ⁇ COOH.
- a linker moiety is or comprises one or more ring moieties, e.g., one or more methylene units of L are replaced with ⁇ Cy ⁇ .
- a linker moiety, e.g., L comprises an aryl ring.
- a linker moiety, e.g., L comprises an heteroaryl ring.
- a linker moiety comprises an aliphatic ring.
- a linker moiety, e.g., L comprises an heterocyclyl ring.
- a linker moiety, e.g., L comprises a polycyclic ring.
- a ring in a linker moiety, e.g., L is 3-20 membered.
- a ring is 5-membered.
- a ring is 6-membered.
- a ring in a linker is product of a cycloaddition reaction (e.g., click chemistry, and variants thereof) utilized to link different moieties together.
- a linker moiety e.g., L
- a linker moiety is or comprises .
- a methylene unit of L is replaced with .
- a methylene unit of L is replaced with ⁇ Cy ⁇ .
- ⁇ Cy ⁇ is [0270]
- a linker moiety (e.g., L) is or comprises ⁇ Cy ⁇ .
- a methylene unit of L is replaced with ⁇ Cy ⁇ .
- a linker moiety in a provided agent, e.g., a compound in Table 1, comprises In some embodiments, n the structure. In some embodiments, In some embodiments, [0272] In some embodiments, a linker moiety is as described in Table 1. In some embodiments, L is L 1 ad present disclosure. In some embodiments, L is L b as described in the present disclosure. [0273] In some embodiments, L RM is a covalent bond. In some embodiments, L RM is not a covalent bond.
- L RM is or comprises ⁇ (CH 2 CH 2 O)n ⁇ . In some embodiments, L RM is or comprises ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted. In some embodiments, L RM is ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted.
- L RM is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted. In some embodiments, L RM is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein. [0274] In some embodiments, L PM is a covalent bond. In some embodiments, L PM is not a covalent bond. In some embodiments, L PM is or comprises ⁇ (CH 2 CH 2 O)n ⁇ .
- L PM is or comprises ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted.
- L PM is ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted.
- L PM is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted.
- L PM is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein.
- L PM e.g., in a product of a first and a second agents
- L PM is or comprises a reaction product moiety formed a first reactive moiety and a second reactive moiety.
- a linker moiety e.g., L PM in a product of a first and a second agents
- L PM is or comprises .
- a methylene unit of a linker moiety e.g., L or a linker moiety that can be L (e.g., L RM , L PM , etc.) is replaced with ⁇ Cy ⁇ .
- ⁇ Cy ⁇ is optionally substituted
- ⁇ Cy ⁇ is In some embodiments, ⁇ Cy ⁇ is .
- ⁇ Cy ⁇ is some embodiments, ⁇ Cy ⁇ is Moieties of Interest [0277] Those skilled in the art reading the present disclosure will appreciate that various types of moieties of interest can be utilized for various purposes in accordance with the present disclosure.
- moieties of interest are or comprise detectable moieties.
- such moieties can be useful for detection, quantification, diagnosis, treatment, etc.
- a moiety of interest is or comprises a radioactive label.
- a moiety of interest is or comprises a label that can be detected through spectroscopy.
- a moiety of interest is or comprises a fluorophore such as FITC moiety.
- a moiety of interest is or comprises .
- a moiety of interest is or comprises .
- a moiety of interest is or comprise a moiety of an enzyme, e.g., peroxidase, alkaline phosphatase, luciferase, b- galactosidase, etc.
- a moiety of interest is or comprises an affinity substance, e.g., streptavidin, biotin, etc.
- moieties of interest are or comprise therapeutic agent moieties.
- a moiety of interest is or comprises a drug moiety, e.g., a drug moiety in an antibody- drug conjugate.
- a moiety of interest is or comprises a toxic agent.
- a moiety of interest is or comprises a cytotoxic agent. In some embodiments, a moiety of interest is or comprises an anti-cancer agent. In some embodiments, an anti-cancer agent is a chemotherapeutic agent. In some embodiments, an anti-cancer agent is selected from DNA injuring agents, antimetabolites, enzyme inhibitors, DNA intercalating agents, DNA cleaving agents, topoisomerase inhibitors, DNA binding inhibitors, tubulin binding inhibitors, cytotoxic nucleosides, and platinum compounds. In some embodiments, an anti-cancer agent is selected from toxins that include bacteriotoxins (e.g., diphtheria toxin) and phytotoxins (e.g., ricin).
- bacteriotoxins e.g., diphtheria toxin
- phytotoxins e.g., ricin
- a therapeutic agent is an antimitotic agent. In some embodiments, a therapeutic agent is a maytansinoid agent. In some embodiments, a moiety of interest is or comprises DM1 agent. In some embodiments, a moiety of interest is or comprises DM4 agent. In some embodiments, a therapeutic agent is an auristatin agent. In some embodiments, a moiety of interest is or comprises monomethyl auristatin-E agent. In some embodiments, a moiety of interest is or comprises monomethyl auristatin-F agent. In some embodiments, a moiety of interest is exatecan or a derivative thereof (e.g., DXd). In some embodiments, a therapeutic agent is a DNA interacting agent.
- a moiety of interest is or comprises a calicheamicin agent. In some embodiments, a moiety of interest is or comprises a CC-1065 agent or an analog thereof. In some embodiments, a moiety of interest is or comprises a duocarmycin agent. In some embodiments, a therapeutic agent is a transcription inhibitor agent. In some embodiments, a moiety of interest is or comprises a amatoxin agent. As appreciated by those skilled in the art, various therapeutic agents, e.g., anti-cancer agents including many approved drugs by FDA, EMA, etc., may be utilized in accordance with the present disclosure. In some embodiments, a therapeutic agent is a small molecule. In some embodiments, a therapeutic agent is or comprises a peptide.
- a therapeutic agent is or comprises a protein.
- a therapeutic agent is or comprises a nucleic acid agent (e.g., an oligonucleotide, RNA therapeutics etc.).
- a moiety of interest is or comprises a small molecule moiety.
- a moiety of interest is or comprises a polypeptide moiety.
- a moiety of interest is or comprises a nucleic acid moiety.
- a moiety of interest is or comprises an oligonucleotide moiety.
- a moiety of interest is or comprises a carbohydrate moiety.
- a moiety of interest is or comprises a lipid moiety.
- a provided compound or agent comprising a therapeutic agent moiety is useful for treating a condition, disorder or disease that may be treated by the therapeutic agent.
- moieties of interest are or comprise moieties that can interact and/or recruit other agents, such as proteins, nucleic acids, cells, etc.
- moieties of interest interact with proteins expressed by certain cell types, e.g., immune cells, disease cells, etc.
- moieties of interest are immune cell binders.
- moieties of interest recruit immune cells.
- moieties of interest trigger, promote and/or enhance one or more immune activities, e.g., for removing, killing, and/or inhibiting desired targets (e.g., cancer cells, antigens, etc.).
- moieties of interest interact, recruit and/or bind to disease cells, and trigger, promote and/or enhance removing, killing, and/or inhibiting disease cells.
- a moiety of interest is or comprises a small molecule agent (e.g., one can bind specifically to its protein targets, cells targets, etc.).
- a moiety of interest is or comprises a peptide or protein agent (e.g., scFv, a peptide binder to specific target, etc.).
- a moiety of interest is or comprises a nucleic acid agent (e.g., an oligonucleotide, mRNA, etc.).
- a moiety of interest is or comprises a carbohydrate agent.
- a moiety of interest is or comprises a lipid agent.
- a moiety of interest is or comprises a protein complex (e.g., Fab).
- a moiety of interest is or comprises a fluorophore.
- a moiety of interest is or comprises a cytotoxic small molecule agent. In some embodiments, a moiety of interest is or comprises a cytotoxic peptide agent. [0283] In some embodiments, a moiety of interest is an adjuvant. Those skilled in the art will appreciate various adjuvants can be utilized as moieties of interest in accordance with the present disclosure. In some embodiments, an adjuvant is one described in US20190015516. In some embodiments, a moiety of interest stimulates an immune system. [0284] In some embodiments, a moiety of interest is or comprises a particle. In some embodiments, a particle is or comprises a nanoparticle.
- a moiety of interest is or comprises a nanoparticle.
- a particle is or comprises a gold-nanoparticle.
- a particle is or comprises superparamagnetic iron oxide (SPIO) nanoparticles.
- SPIO superparamagnetic iron oxide
- a moiety of interest is or comprises a theranostic agent which comprises one or more gold- and superparamagnetic iron oxide nanoparticles.
- a moiety of interest is or comprises a nucleic acid moiety.
- a moiety of interest is or comprises an oligonucleotide.
- a moiety of interest is or comprises an aptamers.
- a moiety of interest is or comprises a DNA and/or RNA aptamers.
- an aptamers is or comprises double stranded or single stranded DNA sequence or RNA sequence. In some embodiments, such sequences are partially or completely defined.
- an aptamers is or comprises Pegaptanib.
- the present disclosure provides an agent having the structure of I-66, I-67, I-68, or I-69, or a salt thereof.
- a moiety of interest is an antibody agent. In some embodiments, a moiety of interest is or comprises an antibody fragment.
- a moiety of interest is an antibody agent moiety that does not contain a region to which a target binding moiety binds. In some embodiments, a moiety of interest is an antibody agent that contains no Fc region. In some embodiments, a moiety of interest is or comprises a scFv. In some embodiments, a scFv is for a different antigen than an antibody target agent. [0287] In some embodiments, moieties of interest are or comprise reactive moieties, particularly those reaction partners for bioorthogonal reactions. Suitable reactive moieties, including those for bioorthogonal reactions, are widely known in the art and can be utilized herein.
- a bioorthogonal reaction is a cycloaddition reaction, e.g., click chemistry.
- a moiety of interest is or comprises ⁇ N 3 .
- a moiety of interest is or comprises an alkyne.
- a moiety of interest is or comprises an alkyne suitable for metal-free click chemistry.
- a moiety of interest is or comprises optionally substituted .
- a moiety of interest is or comprises embodiments, a moiety of interest is or comprises some embodiments, a moiety of interest is or comprises optionally substituted some embodiments, a moiety of interest is or comprises .
- a moiety of interest is or comprises .
- a moiety of interest is or comprises an aldehyde, ketone, alkoxyamine, or hydrazide moiety.
- a moiety of interest improves one or more properties and/or activities of a target agent.
- a moiety of interest is or comprises a stability enhancer.
- a moiety of interest improves one or more pharmacodynamic and/or pharmacokinetic properties of a target agent.
- a moiety of interest is or comprises a peptide tag, e.g., for detection, transformation, etc.
- a peptide tag is or comprises GGGGG and can serve as substrate for Sortase A mediated reaction with, e.g., LPETG tagged protein.
- a peptide tag is or comprises LPXTG.
- a peptide tag is or comprises LPETG.
- a moiety of interest is or comprises (G)n, wherein n is 1-10.
- a first G is the N-terminal residue.
- a moiety of interest is or comprises LPXTG, wherein X is an amino acid residue.
- a moiety of interest is or comprises LPETG.
- a moiety of interest is or comprises LPXTG-(X)n, wherein each X is independently an amino acid residue, and n is 1-10.
- a moiety of interest is or comprises LPETG-(X)n, wherein each X is independently an amino acid residue, and n is 1-10.
- n is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- n is 2.
- n is 3.
- n is 4.
- n is 5.
- n is 2-10.
- n is 2-5.
- n is 3-10.
- n is 3-5.
- a provided method further comprises: reacting a first agent comprising a first reactive moiety, e.g., in a first moiety of interest, with a second agent comprising a second reactive moiety.
- a first reactive moiety is in a first moiety of interest, e.g., which can be incorporated through a method described herein (e.g., via contacting with a compound having the structure of formula R-I or a salt thereof).
- a first moiety of interest is in a compound which comprises no target binding moieties.
- a first moiety of interest is in a compound of formula P-I or P-II, or a salt thereof. In some embodiments, a first moiety of interest is in a compound of R-I or a salt thereof. In some embodiments, a first agent has the structure of formula P-I or P-II, or a sat thereof. [0293] In some embodiments, a second agent comprises a peptide moiety which is linked to a second reactive moiety optionally through a linker. In some embodiments, a second agent comprises a peptide moiety which is linked to a second reactive moiety optionally through a linker.
- a second agent comprises an antibody agent moiety which is linked to a second reactive moiety optionally through a linker.
- a second moiety of interest is in a compound which comprises no target binding moieties.
- a second moiety of interest is in a compound of formula P-I or P-II, or a salt thereof.
- a second moiety of interest is in a compound of R-I or a salt thereof.
- a second agent has the structure of formula P-I or P-II, or a sat thereof.
- a second reactive moiety is in a moiety of interest of a second agent.
- a second agent comprises a target agent moiety as described herein.
- a target agent moiety in a second agent is or comprises a peptide moiety.
- a target agent moiety in a second agent is or comprises an antibody agent moiety as described herein. In some embodiments, it comprises a scFv moiety.
- a target agent moiety in a second agent provides different specificity compared to that of a first agent. In some embodiments, such first and second agents react with each other to provide various product agents comprising moieties having different specificities as described herein.
- a reaction between a first reactive moiety and a second reactive moiety is a bioorthogonal reaction.
- a reaction is a cycloaddition reaction.
- a reaction is a [3+2] reaction. Suitable such reactions and corresponding first and second reactive moieties are widely known in the art and can be utilized in accordance with the present disclosure.
- a first reactive moiety is or comprises ⁇ N 3
- a second reactive moiety is or comprises ⁇ (e.g., an alkyne moiety suitable for click chemistry, including those suitable for metal- free click chemistry).
- a second reactive moiety is or comprises ⁇ N 3
- a first reactive moiety is or comprises ⁇ (e.g., an alkyne moiety suitable for click chemistry, including those suitable for metal-free click chemistry).
- a reaction between a first reactive moiety and a second reactive moiety is an enzymatic reaction.
- a reaction is a sortase-mediated reaction.
- each of the first and second reactive moiety independently is or comprises a substrate moiety for a reaction, e.g., an enzymatic reaction.
- a reactive moiety for a sortase-mediated conjugation, is or comprises (G)n (e.g., n is 3, 4, 5, etc.), and a reactive moiety is or comprises LPXTG (e.g., LPETG).
- a reactive moiety is or comprises LPXTG-(X)n (e.g., LPETG-(X)n, LPETG-XX, etc.).
- a compound comprising a first reactive moiety is I-53, I-54, I-55, I-56, I-57, or I-58, or a salt thereof.
- a compound comprising a second reactive moiety is or comprises fragment thereof, or a sequence that shares 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homology with SEQ ID NO: 1 or a fragment thereof, or a salt thereof.
- a compound comprising a second reactive moiety is compound II-I: salt thereof.
- a second agent is or comprises a second moiety of interest which is a moiety of interest as described herein.
- a second reactive moiety and a second moiety of interest is connected through a linker (e.g., a linker as described herein (e.g., L PM , L, etc. as described herein).
- a second moiety of interest is as described herein (e.g., a detection moiety, a therapeutic moiety, a moiety of interest which can interact, recognize and/or bind proteins, nucleic acids, immune cells, disease cells, etc.).
- a second moiety of interest is or comprises an antibody agent.
- a second moiety of interest is or comprises a scFv antibody agent. In some embodiments, such an antibody agent has different specificity compared to the initial target antibody agent.
- the present disclosure provides bispecific antibody agents, compositions, and methods thereof.
- a target agent is or comprises a first antibody agent, and it is conjugated with a moiety of interest comprising a first reactive moiety.
- an agent comprising a first antibody agent and a first reactive moiety is reacted with a second agent comprising a second reactive moiety and a second moiety of interest which is or comprises a second antibody agent to provide an agent comprising a first and a second antibody agents.
- a first and a second antibody agents are different. In some embodiments, they are the same.
- an agent comprises two or more antibody agent moieties. In some embodiments, antibody agent moieties in a single agent molecule have different target specificity. In some embodiments, some or all antibody agent moieties in a single agent molecule have the same target specificity. In some embodiments, an agent as described herein is or comprises moieties having different target specificity (e.g., antibody moieties having different target specificity). In some embodiments, an agent is a bispecific antibody agent.
- an agent comprises a first moiety (e.g., a first antibody agent moiety) and a second moiety (e.g., a second antibody agent moiety).
- a first moiety e.g., a first antibody agent moiety
- a second moiety e.g., a second antibody agent moiety
- a second moiety is or comprises an antibody agent moiety or a fragment thereof (e.g., Fc region or a fragment thereof) to which a target binding moiety may bind.
- an antibody agent moiety e.g., a second antibody agent moiety
- an antibody agent moiety e.g., a second antibody agent moiety
- an antibody agent moiety, e.g., a second antibody agent moiety is or comprises scFv.
- a first moiety is or comprises an agent moiety of a first agent.
- a second moiety is or comprises a moiety of interest of a second agent.
- a first agent e.g., one comprising a first antibody agent moiety
- a second agent e.g., one comprising a second antibody agent moiety
- a moiety e.g., a first moiety
- a target e.g., a protein, lipid, carbohydrate, object, etc.
- a moiety, e.g., a first moiety is or comprises a moiety of an antibody agent suitable for preventing or treating a condition, disorder or disease, e.g., cancer.
- a moiety, e.g., a first moiety is or comprises a moiety of an antibody agent which targets cancer cells, tissues, organs, etc.
- a first moiety is or comprises a moiety of an anti-CD20 antibody or a fragment thereof.
- a first moiety is or comprises rituximab or a fragment thereof.
- a moiety, e.g., a second moiety is a second moiety of interest.
- a moiety, e.g., a second moiety is or comprises an antibody agent moiety that can recruit and/or activate an immune activity, e.g. one or more immune cells.
- a moiety, e.g., a second moiety is or comprises an antibody agent moiety which can recruit and/or activate T cells.
- a moiety e.g., a second moiety is or comprises a moiety of an anti-CD3 antibody or fragment thereof.
- an atnti-CD3 antibody is a CD3-directed scFv.
- a moiety, e.g., a first moiety is a target agent moiety.
- a provided agent comprises an anti-CD20 moiety and an anti-CD3 moiety.
- a provided agent comprises an anti-CD20 moiety and an anti-CD3 moiety, wherein the two moieties are linked by a linker.
- a linker comprises moieties that are not amino acid residues.
- a linker comprises moieties that are not natural proteinogenic amino acid residues.
- a linker is a linker moiety as described herein.
- agents comprising two or more target-specific moieties e.g., antibody agent moieties
- a first and a second moiety is linked by a linker as described herein.
- a provided product agent comprises a linker moiety connecting a target agent moiety and a second moiety of interest (e.g., two antibody agent moieties).
- a linker is or comprises one or more of L RG2 , L PM or fragments thereof, and one or more moiety formed by a first and second reactive moieties (e.g., for click chemistry, a triazole moiety).
- a linker is or comprises a product linker moiety, e.g., one formed by a reaction between a first and a second reactive moiety.
- a product linker moiety is or comprise LPXTG.
- a product linker moiety is or comprise LPXT(G)n, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- a product linker moiety is or comprises a bioorthogonal reaction product moiety, e.g., a click chemistry reaction product moiety.
- an agent comprising a second reactive moiety and a second moiety of interest is prepared using a technology provided herein.
- a second moiety of interest is or comprises a protein agent moiety.
- a second moiety of interest is or comprises an antibody agent moiety.
- a second moiety of interest e.g., a protein agent (e.g., an antibody agent)
- a second reactive moiety can serve as a moiety of interest (e.g., MOI in a compound of formula R-I or a salt thereof), for utilization of certain provided methods (e.g., comprising reacting target agents (e.g., protein agents (e.g., antibody agents, etc.)) with reaction partners comprising moieties of interest (e.g., those that are or comprise second reactive moieties), reactive groups and target binding moieties that can bind to target agents to provide second agents).
- target agents e.g., protein agents (e.g., antibody agents, etc.
- reaction partners comprising moieties of interest (e.g., those that are or comprise second reactive moieties), reactive groups and target binding moieties that can bind to target agents to provide second agents).
- each of a first agent and a second agent is independently and optionally an agent of formula P-I or P-II, or a salt thereof. In some embodiments, each of a first agent and a second agent is independently an agent of formula P-I or P-II, or a salt thereof. In some embodiments, at least one of a first agent and a second agent is prepared using a method of the present disclosure. In some embodiments, each of a first agent and a second agent is independently prepared using a method of the present disclosure. In some embodiments, a target agent moiety of a first agent is an antibody agent. In some embodiments, a moiety of interest of a first agent is or comprises a first reactive moiety.
- a target agent moiety of a second agent is an antibody agent.
- a moiety of interest of a second agent is or comprises a second reactive moiety.
- a first reactive moiety and a second reactive moiety can react with each to provide a product agent.
- a reaction between a first and a second reactive moieties is or comprises a reaction compatible with target agents in the first and second agents, e.g., compatible with protein agents (e.g., antibody agents).
- a reaction is a bioorthogonal reaction.
- such a reaction is a cycloaddition reaction.
- such a reaction is a click reaction.
- a reaction is a metal free click reaction.
- a product agent is of formula P-I or P-II, or a salt thereof.
- a target agent moiety is a protein agent (e.g., an antibody agent), and in some embodiments, a target agent moiety of a first agent.
- a moiety of interest is a protein agent (e.g., an antibody agent), and in some embodiments, a target agent moiety of a second agent.
- a product agent comprises two or more antibody agents.
- the two or more antibody agents have different antigen specificity. In some embodiments, the two or more antibody agents are toward different antigens. In some embodiments, a provided method comprises: reacting a first agent which has the structure of formula P-I or P-II, or a salt thereof with a second agent which has the structure of formula P-I or P-II, or a salt thereof to provide a product agent.
- a first agent is an agent of formula P-I or P-II, or a salt thereof
- a first agent and a product agent share the same target agent (P or P-N)
- a different linker L PM and a different MOI e.g., in some embodiments, MOI of a first agent is or comprises a reactive group, which MOI of a product agent of a first and second agents is or comprises a target agent moiety (e.g., an antibody agent moiety) of a second agent.
- L PM of a product agent is or comprises a product moiety of a first reactive moiety and a second reactive moiety.
- L PM in a product agent is or comprises a triazole moiety
- provided technologies comprise contacting a target agent (e.g., to which a moiety of interest is to be attached) with a reaction partner.
- contact is performed under conditions and for a time so that a target agent react with a reaction partner to form an agent as a product.
- target agent e.g., to which a moiety of interest is to be attached
- contact is performed under conditions and for a time so that a target agent react with a reaction partner to form an agent as a product.
- Many reaction conditions/reaction times in the art may be assessed and utilized if suitable for desired purposes in accordance with the present disclosure; certain such conditions, reaction times, assessment, etc. are described in the Examples.
- an agent formed comprises a target agent moiety, a moiety of interest and optionally a linker moiety connecting a target agent moiety and a moiety of interest.
- a target agent moiety is derived from a target agent (e.g., by removing one or more ⁇ H from a target agent).
- a target agent moiety maintains one or more, most, or substantially all structural features and/or biological functions of a target agent.
- a target agent is an antibody agent
- a target agent moiety in a formed agent is a corresponding antibody agent moiety and maintains major functions of the antibody agent, e.g., interacting with various receptors (e.g., Fc receptors such as FcRn), recognizing antigen with specificity, triggering, promoting, and/or enhancing immunological activities toward diseased cells, etc., as the antibody agent.
- a formed agent provides one or more functions beyond those of a target agent, for example, from a moiety of interest and/or a formed agent as a whole.
- an agent formed has the structure of formula P-I or P-II, or a salt thereof.
- a moiety of interest in a formed agent is the same as a moiety of interest in a reaction partner (e.g., MOI of formula R-I or a salt thereof) utilized to prepare a formed agent.
- a reaction partner e.g., MOI of formula R-I or a salt thereof
- P is a protein moiety.
- P is an antibody moiety.
- linker moieties (or a part thereof) connected to moieties of interest may also be transferred from reaction partners (e.g., L RM of formula R-I or a salt thereof).
- a linker moiety in a formed agent is or comprises a linker moiety in a reaction partner (e.g., one between a reactive group and a moiety of interest, e.g., L RM ).
- L PM is or comprises L RM .
- L PM is ⁇ L RM ⁇ L RG2 ⁇ .
- L RG2 is ⁇ C(O) ⁇ .
- L RG2 is ⁇ C(O) ⁇ , and is bonded to ⁇ NH ⁇ of a target agent moiety, e.g., ⁇ NH ⁇ in a side chain of a lysine residue of a protein moiety, which in some embodiments, is an antibody moiety.
- Reaction partners e.g., compounds of formula R-I or salts thereof, typically do not contain moieties that can react with reactive groups under conditions under which reactive groups react with target agents. In some embodiments, to the extent that some moieties in reaction partners may react with reactive groups under conditions under which reactive groups react with target agents, reactions between such moieties and reactive groups are significantly slower and/or less efficient compared to reactions between reactive groups and target agents.
- reactions between such moieties and reactive groups do not significantly reduce (e.g., no more than about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, etc. of reduction) efficiencies, yields, rates, and/or conversions, etc., of reactions between reactive groups and target agents.
- reactive groups e.g., ester groups, activated carboxylic acid derivatives, etc.
- amino groups e.g., ⁇ NH 2 groups
- target agents e.g., protein agents such as antibody agents.
- reaction partners e.g., compounds of formula R-I or salts thereof, do not contain amine groups.
- compounds of formula R-I or salts thereof do not contain amine groups. In some embodiments, they do not contain primary amine groups ( ⁇ NH 2 ). In some embodiments, they do not contain ⁇ CH 2 NH 2 . In some embodiments, they do not contain ⁇ CH 2 CH 2 NH 2 . In some embodiments, they do not contain ⁇ CH 2 CH 2 CH 2 NH 2 . In some embodiments, they do not contain ⁇ CH 2 CH 2 CH 2 NH 2 . In some embodiments, they do not contain ⁇ CH 2 CH 2 CH 2 CH 2 NH 2 .
- amine groups e.g., primary amine groups
- acyl groups e.g., R ⁇ C(O) ⁇ (e.g., acetyl)
- reactions are performed in buffer systems.
- buffer systems of present disclosure maintains structures and/or functions of target agents, moiety of interest, etc.
- a buffer is a phosphate buffer.
- a buffer is a PBS buffer.
- a buffer is a borate buffer.
- buffers of the present disclosure provide and optionally maintain certain pH value or range.
- a useful pH is about 7-9, e.g., 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 9.0, etc.
- a pH is 7.4.
- a pH is 7.5.
- a pH is 7.8.
- a pH is 8.0.
- a pH is 8.2.
- a pH is 8.3.
- connection of a moiety of interest in a provided reaction partner e.g., a compound comprising a reactive group located between a first group and a moiety of interest (e.g., a compound of formula R-I or a salt thereof)
- a target agent e.g., a compound comprising a reactive group located between a first group and a moiety of interest (e.g., a compound of formula R-I or a salt thereof)
- a target agent e.g., a compound comprising a reactive group located between a first group and a moiety of interest (e.g., a compound of formula R-I or a salt thereof)
- a target agent e.g., a compound comprising a reactive group located between a first group and a moiety of interest (e.g., a compound of formula R-I or a salt thereof)
- no separate reactions/steps are performed to remove target binding moieties.
- target binding moiety removal can improve overall efficiency (e.g., by simplify operations, increasing overall yield, etc.), reduce manufacturing cost, improve product purity (e.g., by avoiding exposure to target binding moiety removal conditions, which typically involve one or more of reduction, oxidation, hydrolysis (e.g., of ester groups), etc., conditions and may damage target agent moieties (e.g., for protein agent moieties, protein amino acid residues, overall structures, and/or post-translational modifications (e.g., glycans of antibodies) thereof.
- target agent moieties e.g., for protein agent moieties, protein amino acid residues, overall structures, and/or post-translational modifications (e.g., glycans of antibodies) thereof.
- provided technologies among other things can provided improved efficiency (e.g., in terms of reaction rates and/or conversion percentages), increased yield, increased purity/homogeneity, and/or enhanced selectivity, particularly compared to reference technologies wherein a reaction partner containing no target binding moieties is used, without introducing step(s) for target binding moiety removal (e.g., target binding moiety is removed in the same step as moiety of interest conjugation).
- the present disclosure provides products of provided processes, which, among other things, contain low levels of damage to target agent moieties compared to processes comprising steps which are performed for target binding moiety removal but not for substantial moiety of interest conjugation.
- provided product compositions have high homogeneity compared to reference product compositions (e.g., those from technologies without using target binding moieties, or utilizing extra step(s) for target binding moiety removal (e.g., not utilizing reaction partners described herein which comprise a reactive group located between a target binding moiety and a moiety of interest).
- a product agent is an agent comprising: a target agent moiety; a moiety of interest; and optionally one or more linker moieties.
- a target agent moiety is a protein agent moiety.
- a target agent moiety is an antibody agent moiety.
- an antibody agent moiety comprises IgG Fc region.
- a target agent moiety is connected to a moiety of interest through an amino group optionally through a linker. In some embodiments, it is through a lysine residue wherein the amino group of the side chain is connected to a moiety of interest optionally through a linker (e.g., forming ⁇ NH ⁇ C(O) ⁇ as part of an amide group, a carbamate group, etc.).
- selected locations of target agents are utilized for conjugation. For example, in some embodiments, K246 or K248 of an antibody agent (EU numbering, or corresponding residues) are conjugation locations.
- a conjugation location is K246 of heavy chain (unless otherwise specified, locations herein include corresponding residues in, e.g., modified sequence (e.g., longer, shorter, rearranged, etc., sequences)).
- a location is K248 of heavy chain.
- a location is K288 or K290 of heavy chain.
- a location is K288 of heavy chain.
- a location is K290 of heavy chain.
- a location is K317.
- a ratio is about 0.5-6, e.g., 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, etc.).
- a ratio is about 0.5-2.5.
- a ratio is about 0.5-2.
- a ratio is about 1-2.
- a ratio is about 1.5-2. In some embodiments, a ratio is of moieties of interest conjugated to target agent moieties and target agent moieties conjugated to moieties of interest. In some embodiments, a ratio is of moieties of interest conjugated to target agent moieties and all target agent moieties in a composition. [0317] In some embodiments, in provided agents (e.g., agents of formula P-I or P-II, or a salt thereof) substantially all conjugation sites of target agent moieties have the same modifications (e.g., all share the same moieties of interest optionally connected through the same linker moieties).
- agents e.g., agents of formula P-I or P-II, or a salt thereof
- no conjugation sites bear different modifications (e.g., different moieties of interest and/or no moieties of interest and/or different linker moieties).
- substantially all conjugation sites of target agent moieties have the same modifications (e.g., all share the same moieties of interest optionally connected through the same linker moieties).
- no conjugation sites bear different modifications (e.g., different moieties of interest and/or no moieties of interest and/or different linker moieties).
- compositions do not contain agents that share the same (or substantially the same) target agent moieties but different modifications (e.g., different moieties of interest and/or no moieties of interest and/or different linker moieties).
- agents that share the same (or substantially the same) target agent moieties but different modifications e.g., different moieties of interest and/or no moieties of interest and/or different linker moieties
- are intermediates of multiple-step preparations e.g., comprising steps for removal of target binding moieties in addition to steps for moiety of interest conjugation
- the present disclosure provides a composition comprising a plurality of agents each of which independently comprising: a target agent moiety, a moiety of interest, and optionally a linker moiety linking a target agent moiety and a moiety of interest; wherein agents of the plurality share the same or substantially the same target agent moiety, and a common modification independently at at least one common location; and wherein about 1%-100% of all agents that comprise a target agent moiety and a moiety of interest are agents of the plurality.
- a target agent moiety is or comprises a protein moiety.
- agents of the plurality share common modifications (e.g., conjugations of moieties of interest optionally through linker moieties) independently at at least one amino acid residues.
- agents of the plurality are each independently of formula P-I or P-II, or a salt thereof.
- the present disclosure provides a composition comprising a plurality of agents each of which independently comprising: a protein agent moiety, a moiety of interest, and optionally a linker moiety linking a protein agent moiety and a moiety of interest; wherein protein agent moieties of agents of the plurality comprise a common amino acid sequence, and agents of the plurality share a common modification independently at at least one common amino acid residue of protein agent moieties; and wherein about 1%-100% of all agents that comprise a protein agent moiety that comprise the common amino acid sequence and a moiety of interest are agents of the plurality.
- agents of the plurality are each independently of formula P-I or P- II, or a salt thereof.
- each protein agent moiety is independently an antibody agent moiety.
- the present disclosure provides a composition comprising a plurality of agents each of which independently comprising: an antibody agent moiety, a moiety of interest, and optionally a linker moiety linking an antibody agent moiety and a moiety of interest; wherein antibody agent moieties of agents of the plurality comprise a common amino acid sequence or can bind to a common antigen, and agents of the plurality share a common modification independently at at least one common amino acid residue of protein agent moieties; and wherein about 1%-100% of all agents that comprise an antibody agent moiety that comprise the common amino acid sequence or can bind to the common antigen and a moiety of interest are agents of the plurality.
- agents of the plurality are each independently of formula P-I or P- II, or a salt thereof.
- antibody agent moieties of agents of the plurality comprise a common amino acid sequence.
- antibody agent moieties of agents of the plurality comprise a common amino acid sequence in a Fc region.
- antibody agent moieties of agents of the plurality comprise a common Fc region.
- antibody agent moieties of agents of the plurality can bind a common antigen specifically.
- antibody agent moieties are monoclonal antibody moieties.
- antibody agent moieties are polyclonal antibody moieties.
- antibody agent moieties bind to two or more different antigents. In some embodiments, antibody agent moieties bind to two or more different proteins. In some embodiments, antibody agent moieties are IVIG moieties. [0325] As used in the present disclosure, in some embodiments, “at least one” or “one or more” is 1-1000, 1-500, 1-200, 1-100, 1-90, 1-80, 1-70, 1-60, 1-50, 1-40, 1-30, 1-20, 1-10, 1-5, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more. In some embodiments, it is one. In some embodiments, it is two or more. In some embodiments, it is about 3. In some embodiments, it is about 4.
- it is about 5. In some embodiments, it is about 6. In some embodiments, it is about 7. In some embodiments, it is about 8. In some embodiments, it is about 9. In some embodiments, it is about 10. In some embodiments, it is about 10 or more.
- a common amino acid sequence comprises 1-1000, 1-500, 1-400, 1-300, 1-200, 1-100, 1-50, 10-1000, 10-500, 10-400, 10-300, 10-200, 10-100, 10-50, 20-1000, 20-500, 20-400, 20-300, 20-200, 20-100, 20-50, 50-1000, 50-500, 50-400, 50-300, 50-200, 50-100, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 200, 250, 300, 400, 500, 600 or more amino acid residues.
- a length is at least 5 amino acid residues.
- a length is at least 10 amino acid residues. In some embodiments, a length is at least 50 amino acid residues. In some embodiments, a length is at least 100 amino acid residues. In some embodiments, a length is at least 150 amino acid residues. In some embodiments, a length is at least 200 amino acid residues. In some embodiments, a length is at least 300 amino acid residues. In some embodiments, a length is at least 400 amino acid residues. In some embodiments, a length is at least 500 amino acid residues. In some embodiments, a length is at least 600 amino acid residues.
- a common amino acid sequence is at least 10%-100%, 50%-100%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%,, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of an amino acid sequence of a target agent moiety, a protein agent moiety, an antibody agent moiety, etc. In some embodiments, it is 100%.
- protein agent moieties share a high percentage of amino acid sequence homology. In some embodiments, it is 50%-100%. In some embodiments, it is 50%. In some embodiments, it is 60%. In some embodiments, it is 70%. In some embodiments, it is 80%.
- it is 90%. In some embodiments, it is 91%. In some embodiments, it is 50%. In some embodiments, it is 92%. In some embodiments, it is 93%. In some embodiments, it is 94%. In some embodiments, it is 95%. In some embodiments, it is 96%. In some embodiments, it is 97%. In some embodiments, it is 98%. In some embodiments, it is 99%. In some embodiments, it is 100%. In some embodiments, it is at least 50%. In some embodiments, it is at least 60%. In some embodiments, it is at least 70%. In some embodiments, it is at least 80%. In some embodiments, it is at least 90%. In some embodiments, it is at least 91%.
- a protein agent moiety or an antibody agent moiety is or comprises a protein complex. In some embodiments, at least one or each individual chain shares a common amino acid sequence and/or has a homology as described herein. [0330] In some embodiments, agents of a plurality share a common moiety of interest.
- each agent of a plurality is independently an agent of formula P-I or P-II, or a salt thereof. In some embodiments, each agent of a plurality is independently an agent of formula P-I or P-II, or a salt thereof, wherein MOI is the same for each agent of the plurality. In some embodiments, agents of a plurality are products of methods described herein. In some embodiments, compositions comprising agents of a plurality are products of methods described herein. [0331] In some embodiments, a modification is or comprises a moiety of interest and optionally a linker. In some embodiments, a modification is or comprises ⁇ L PM ⁇ MOI.
- agents of the plurality share a common modification independently at at least one location.
- a modification is or comprises a moiety of interest and optionally a linker connecting the moiety of interest.
- each location independently has its common modification.
- common modifications at two or more or all locations comprise a common moiety of interest.
- common modifications are the same.
- agents of the plurality share a common modification at each location which has a modification that is or comprises a moiety of interest and optionally a linker.
- agents of the plurality share a common modification at each location which has a modification that is or comprises ⁇ L PM ⁇ MOI.
- protein agents e.g., antibody agents
- a common modification at least one amino acid residue In some embodiments, agents of the plurality share a common modification at each location which has a modification that is or comprises a moiety of interest and optionally a linker. In some embodiments, agents of the plurality share a common modification at each location which has a modification that is or comprises ⁇ L PM ⁇ MOI.
- a location is selected from K246, K248, K288, K290, K317 of antibody agents and locations corresponding thereto. In some embodiments, a location is selected from K246 and K248, and locations corresponding thereto.
- a location is selected from K288 and K290, and locations corresponding thereto.
- a location is K246 or a location corresponding thereto.
- a location is K248 or a location corresponding thereto.
- a location is K288 or a location corresponding thereto.
- a location is K290 or a location corresponding thereto.
- a location is K317 or a location corresponding thereto.
- a location is K185 of light chain or a location corresponding thereto.
- a location is K187 of light chain or a location corresponding thereto.
- a location is K133 of heavy chain or a location corresponding thereto. In some embodiments, a location is K246 or K248 of heavy chain or a location corresponding thereto. In some embodiments, a location is K414 of heavy chain or a location corresponding thereto. [0335] In some embodiments, about 1%-100% of all agents that comprise a target agent moiety and a moiety of interest are agents of the plurality. In some embodiments, about 1%-100% of all agents that comprise a protein agent moiety that comprise the common amino acid sequence and a moiety of interest are agents of the plurality.
- about 1%-100% of all agents that comprise an antibody agent moiety that comprise the common amino acid sequence or can bind to the common antigen and a moiety of interest are agents of the plurality. In some embodiments, about 1%-100% of all agents that comprise a target agent moiety are agents of the plurality. In some embodiments, about 1%- 100% of all agents that comprise a protein agent moiety that comprise the common amino acid sequence are agents of the plurality. In some embodiments, about 1%-100% of all agents that comprise an antibody agent moiety that comprise the common amino acid sequence or can bind to the common antigen are agents of the plurality. In some embodiments, it is 50%-100%. In some embodiments, it is 50%. In some embodiments, it is 60%.
- it is 70%. In some embodiments, it is 80%. In some embodiments, it is 90%. In some embodiments, it is 91%. In some embodiments, it is 50%. In some embodiments, it is 92%. In some embodiments, it is 93%. In some embodiments, it is 94%. In some embodiments, it is 95%. In some embodiments, it is 96%. In some embodiments, it is 97%. In some embodiments, it is 98%. In some embodiments, it is 99%. In some embodiments, it is 100%. In some embodiments, it is at least 50%. In some embodiments, it is at least 60%. In some embodiments, it is at least 70%. In some embodiments, it is at least 80%. In some embodiments, it is at least 90%.
- it is at least 91%. In some embodiments, it is at least 50%. In some embodiments, it is at least 92%. In some embodiments, it is at least 93%. In some embodiments, it is at least 94%. In some embodiments, it is at least 95%. In some embodiments, it is at least 96%. In some embodiments, it is at least 97%. In some embodiments, it is at least 98%. In some embodiments, it is at least 99%. [0336] In some embodiments, provided agents, compounds, etc., e.g., those of formula R-I, P-I, P-II, etc. and salts thereof have high purity. In some embodiments, it is 50%-100%. In some embodiments, it is 50%.
- it is 60%. In some embodiments, it is 70%. In some embodiments, it is 80%. In some embodiments, it is 90%. In some embodiments, it is 91%. In some embodiments, it is 50%. In some embodiments, it is 92%. In some embodiments, it is 93%. In some embodiments, it is 94%. In some embodiments, it is 95%. In some embodiments, it is 96%. In some embodiments, it is 97%. In some embodiments, it is 98%. In some embodiments, it is 99%. In some embodiments, it is 100%. In some embodiments, it is at least 50%. In some embodiments, it is at least 60%. In some embodiments, it is at least 70%. In some embodiments, it is at least 80%.
- the present disclosure provides product agent compositions comprising product agents (e.g., agents of formula P-I or P-II, or a salt thereof).
- product agents e.g., agents of formula P-I or P-II, or a salt thereof.
- a product agent composition (e.g., a formed agent composition from certain methods) comprises a product agent comprising a target agent moiety and a moiety of interest and optionally a linker (e.g., an agent of formula P-I or P-II, or a salt thereof), a released target binding moiety (e.g., a compound comprising R LG ⁇ (L LG1 ) 0-1 ⁇ (L LG2 ) 0-1 ⁇ (L LG3 ) 0-1 ⁇ (L LG4 ) 0-1 ⁇ ) or a compound comprising a released target binding moiety (e.g., a compound having the structure of R LG ⁇ (L LG1 ) 0-1 ⁇ (L LG2 ) 0-1 ⁇ (L LG3 ) 0-1 ⁇ (L LG4 ) 0-1 ⁇ H or a salt thereof), and a reaction partner (e.g., a compound of formula R-I or a salt thereof).
- a linker e.
- released target binding moieties may bind to target agent moieties in target agents and/or formed product agents.
- Various technologies are available to separate released target binding moieties from target agent moieties in accordance with the present disclosure, for example, in some embodiments, contacting a composition with a composition comprising glycine at certain pH.
- Certain Embodiments of Variables [0338] As examples, exemplary embodiments of variables are described throughout the present disclosure. As appreciated by those skilled in the art, embodiments for different variables may be optionally combined.
- ABT is an antibody binding moiety as described herein.
- an ABT is an ABT of a compound selected from those depicted in Table 1.
- an ABT is a moiety selected from Table A-1. In some embodiments, an ABT is a moiety described in Table 1. [0340] In some embodiments, L is a linker moiety of a compound selected from those depicted in Table 1.
- each of R 1 , R 3 and R 5 is independently hydrogen or an optionally substituted group selected from C 1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur; or: R 1 and R 1’ are optionally taken together with their intervening carbon atom to form a 3-8 membered saturated or partially unsaturated spirocyclic carbocyclic ring or a 4-8 membered saturated or partially unsaturated spirocyclic heterocycl
- R 1 is hydrogen. In some embodiments, R 1 is optionally substituted group selected from C 1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 1 is an optionally substituted C 1-6 aliphatic group. In some embodiments, R 1 is an optionally substituted 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring. In some embodiments, R 1 is an optionally substituted phenyl. In some embodiments, R 1 is an optionally substituted 8-10 membered bicyclic aromatic carbocyclic ring. In some embodiments, R 1 is an optionally substituted 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 1 is an optionally substituted 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur. In some embodiments, R 1 is an optionally substituted 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur. [0343] In some embodiments, R some embodiments, R some embodiments, some embodiments, R some embodiments, some embodiments, R ome embodiments, R 1 is I 1 n some embodiments, R is In some embodiments, In some embodiments, R 1 i [0344] In some embodiments, R some embodiments, R some embodiments, R 1 is In some embodiments, R 1 is .
- R 1 is In some embodiments, R 1 is 1 In some embodiments, R is . In some embodiments, R 1 i [0345] In some embodiments, R 1 i I 1 n some embodiments, R is [0346] In some embodiments, R 1 and R 1’ are optionally taken together with their intervening carbon atom to form a 3-8 membered saturated or partially unsaturated spirocyclic carbocyclic ring. In some embodiments, R 1 and R 1’ are optionally taken together with their intervening carbon atom to form a 4-8 membered saturated or partially unsaturated spirocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 1 is selected from those depicted in Table 1. [0348] In some embodiments, R is R 1 as described in the present disclosure. In some embodiments, R a2 is R 1 as described in the present disclosure. In some embodiments, R a3 is R 1 as described in the present disclosure. [0349] In some embodiments, R 3 is hydrogen.
- R 3 is optionally substituted group selected from C 1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 3 is an optionally substituted C 1-6 aliphatic group.
- R 3 is an optionally substituted 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring. In some embodiments, R 3 is an optionally substituted phenyl. In some embodiments, R 3 is an optionally substituted 8-10 membered bicyclic aromatic carbocyclic ring. In some embodiments, R 3 is an optionally substituted 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur. In some embodiments, R 3 is an optionally substituted 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 3 is an optionally substituted 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur. [0350] In some embodiments, R 3 is methyl. In some embodiments, R 3 is In some embodiments, R 3 is [0351] In some embodiments, R 3 is 3 In some embodiments, R is In some embodiments, R is In some embodiments, R 3 i , wherein the site of attachment has (S) stereochemistry. In some embodiments, R 3 , wherein the site of attachment has (R) stereochemistry. In some embodiments, R 3 i wherein the site of attachment has (S) stereochemistry. In some embodiments, R 3 is wherein the site of attachment has (R) stereochemistry.
- R 3 is , wherein the site of attachment has (S) stereochemistry. In some embodiments, R 3 is wherein the site of attachment has (R) stereochemistry. [0353] In some embodiments, R 3 and R 3’ are optionally taken together with their intervening carbon atom to form a 3-8 membered saturated or partially unsaturated spirocyclic carbocyclic ring. In some embodiments, R 3 and R 3’ are optionally taken together with their intervening carbon atom to form a 4-8 membered saturated or partially unsaturated spirocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur. [0354] In some embodiments, R 3 is selected from those depicted in Table 1.
- R is R 2 as described in the present disclosure. In some embodiments, R a2 is R 2 as described in the present disclosure. In some embodiments, R a3 is R 2 as described in the present disclosure. [0356] In some embodiments, R 5 is hydrogen.
- R 5 is optionally substituted group selected from C 1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 5 is an optionally substituted C 1-6 aliphatic group.
- R 5 is an optionally substituted 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring. In some embodiments, R 5 is an optionally substituted phenyl. In some embodiments, R 5 is an optionally substituted 8-10 membered bicyclic aromatic carbocyclic ring. In some embodiments, R 5 is an optionally substituted 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur. In some embodiments, R 5 is an optionally substituted 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 5 is an optionally substituted 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur. [0357] In some embodiments, R 5 is methyl. In some embodiments, R 5 is In some embodiments, R 5 is In some embodiment 5 5 s, R is . In some embodiments, R is . In some embodiments, R 5 is . In some embodiments, R 5 is 5 In some embodiments, R is In some embodiments, R is wherein the site of attachment has (S) stereochemistry. In some embodiments, R 5 i wherein the site of attachment has (R) stereochemistry.
- R 5 is wherein the site of attachment has (S) stereochemistry. In some embodiments, R 5 is , wherein the site of attachment has (R) stereochemistry. In some embodiments, R 5 is In s 5 ome embodiments, R is In some embodiments, R 5 is In some embo 5 5 diments, R is In some embodiments, R is In some embodiments, R 5 is . [0358] In some embodiments, R 5 is . In some embodiments, R 5 is [0359] In some embodiments, R 5 is In some embodiments, R 5 is In some embodiments, R 5 is In 5 some embodiments, R [0360] In some embodiments, R 5 i s . n some embodiments, R 5 is .
- R 5 is 5 In some embodiments, R is [0361] In some embodiments, R some embodiments, R some embodiments, R 5 is In some embodiments, R 5 is . In some embodiments, R 5 is . In some embodiments, R 4 is5 In some embodiments, R some embodiments, some embodiments, R 5 is In some embodiments, R 4 is wherein the site of attachment has (S) stereochemistry. In some embodiments, R 4 is wherein the site of attachment has (R) stereochemistry.
- R 5 and the R 5’ group attached to the same carbon atom are optionally taken together with their intervening carbon atom to form a 3-8 membered saturated or partially unsaturated spirocyclic carbocyclic ring. In some embodiments, R 5 and the R 5’ group attached to the same carbon atom are optionally taken together with their intervening carbon atom to form a 4-8 membered saturated or partially unsaturated spirocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- two R 5 groups are taken together with their intervening atoms to form a C 1-10 bivalent straight or branched saturated or unsaturated hydrocarbon chain wherein 1-3 methylene units of the chain are independently and optionally replaced with –S–, –SS–, –N(R)–, –O–, – C(O)–, –OC(O)–, –C(O)O–, –C(O)N(R)–, –N(R)C(O)–, –S(O)–, –S(O) 2 —, or –Cy 1 —, wherein each –Cy 1 – is independently a 5-6 membered heteroarylenyl with 1-4 heteroatoms independently selected from nitrogen, oxygen or sulfur.
- two R 5 groups are taken together with their intervening atoms to form . In some embodiments, two R 5 groups are taken together with their intervening atoms to form . In some embodiments, two R 5 groups are taken together with their intervening atoms to form . In some embodiments, two R 5 groups are taken together with their intervening atoms to form . [0365] In some embodiments, R 5 is selected from those depicted in Table 1. [0366] In some embodiments, R is R 5 as described in the present disclosure. In some embodiments, R a2 is R 5 as described in the present disclosure. In some embodiments, R a3 is R 5 as described in the present disclosure.
- each of R 1’ , R 3’ and R 5’ is independently hydrogen or C 1-3 aliphatic.
- R 1’ is hydrogen. In some embodiments, R 1’ is C 1-3 aliphatic.
- R 1’ is methyl. In some embodiments, R 1’ is ethyl. In some embodiments, R 1’ is n-propyl. In some embodiments, R 1’ is isopropyl. In some embodiments, R 1’ is cyclopropyl.
- R 1’ is selected from those depicted in Table 1.
- R 3’ is hydrogen.
- R 3’ is C 1-3 aliphatic. [0372] In some embodiments, R 3’ is methyl. In some embodiments, R 3’ is ethyl. In some embodiments, R 3’ is n-propyl. In some embodiments, R 3’ is isopropyl. In some embodiments, R 3’ is cyclopropyl. [0373] In some embodiments, R 3’ is selected from those depicted in Table 1. [0374] In some embodiments, R 5’ is hydrogen. In some embodiments, R 5’ is C 1-3 aliphatic. [0375] In some embodiments, R 5’ is methyl. In some embodiments, R 5’ is ethyl.
- R 5’ is n-propyl. In some embodiments, R 5’ is isopropyl. In some embodiments, R 5’ is cyclopropyl. [0376] In some embodiments, R 5’ is selected from those depicted in Table 1.
- each of R 2 , R 4 and R 6 is independently hydrogen, or C 1-4 aliphatic, or: R 2 and R 1 are optionally taken together with their intervening atoms to form a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur; R 4 and R 3 are optionally taken together with their intervening atoms to form a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur; or an R 6 group and its adjacent R 5 group are optionally taken together with their intervening atoms to form a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 2 is hydrogen. In some embodiments, R 2 is C 1-4 aliphatic. In some embodiments, R 2 is methyl. In some embodiments, R 2 is ethyl. In some embodiments, R 2 is n- propyl. In some embodiments, R 2 is isopropyl. In some embodiments, R 2 is n-butyl. In some embodiments, R 2 is isobutyl. In some embodiments, R 2 is tert-butyl. [0379] In some embodiments, R 2 and R 1 are taken together with their intervening atoms to form a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 2 and R 1 are taken together with their intervening atoms to form . In some embodiments, R 2 and R 1 are taken together with their intervening atoms to form . [0381] In some embodiments, R 2 is selected from those depicted in Table 1. [0382] In some embodiments, R 4 is hydrogen. In some embodiments, R 4 is C 1-4 aliphatic. In some embodiments, R 4 is methyl. In some embodiments, R 4 is ethyl. In some embodiments, R 4 is n- propyl. In some embodiments, R 4 is is isopropyl. In some embodiments, R 4 is n-butyl. In some embodiments, R 4 is isobutyl.
- R 4 is tert-butyl.
- R 4 and R 3 are taken together with their intervening atoms to form a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 4 and R 3 are taken together with their intervening atoms to form .
- R 4 and R 3 are taken together with their intervening atoms to form .
- R 4 is selected from those depicted in Table 1.
- R 6 is hydrogen.
- R 6 is C 1-4 aliphatic.
- R 6 is methyl.
- R 6 is ethyl. In some embodiments, R 6 is n- propyl. In some embodiments, R 6 is isopropyl. In some embodiments, R 6 is n-butyl. In some embodiments, R 6 is isobutyl. In some embodiments, R 6 is tert-butyl. [0387] In some embodiments, an R 6 group and its adjacent R 5 group are taken together with their intervening atoms to form a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur. [0388] In some embodiments, an R 6 group and its adjacent R 5 group are taken together with their intervening atoms to form .
- R 6 is selected from those depicted in Table 1.
- R is R 1’ as described in the present disclosure.
- R a2 is R 1’ as described in the present disclosure.
- R a3 is R 1’ as described in the present disclosure.
- R is R 3’ as described in the present disclosure.
- R a2 is R 3’ as described in the present disclosure.
- R a3 is R 3’ as described in the present disclosure.
- R is R 2 as described in the present disclosure.
- R a2 is R 2 as described in the present disclosure. In some embodiments, R a3 is R 2 as described in the present disclosure. In some embodiments, R is R 4 as described in the present disclosure. In some embodiments, R a2 is R 4 as described in the present disclosure. In some embodiments, R a3 is R 4 as described in the present disclosure. In some embodiments, R is R 6 as described in the present disclosure. In some embodiments, R a2 is R 6 as described in the present disclosure. In some embodiments, R a3 is R 6 as described in the present disclosure. [0391] In some embodiments, L some embodiments, L 1 is
- L 1 is some embodiments, L 1 is . In some embodiments, L 1 is In some embodiments, L 1 is In some embodiments, L 1 is In some embodiments, L 1 is In some
- L 1 i In some embodiments, L 1 is In some
- L 1 is . In some embodiments, In some e 1 mbodiments, L is In some embodiments, L 1 is In some embodiments,
- L 1 is .
- L is a covalent bond or a C 1-10 bivalent straight or branched saturated or unsaturated hydrocarbon chain wherein 1-3 methylene units of the chain are independently and optionally replaced with –S–, –N(R)–, –O–, –C(O)–, –OC(O)–, –C(O)O–, –C(O)N(R)–, –N(R)C(O)–, –S(O)–, –S(O) 2 –, , , or –Cy 1 –, wherein each –Cy 1 – is independently a 5-6 membered heteroarylenyl with 1-4 heteroatoms independently selected from nitrogen, oxygen or sulfur.
- L is a covalent bond.
- L is a C 1-10 bivalent straight or branched saturated or unsaturated hydrocarbon chain wherein 1-3 methylene units of the chain are independently and optionally replaced with –S–, –N(R)–, –O–, –C(O)–, –OC(O)–, –C(O)O–, – C(O)N(R)–, –N(R)C(O)–, –S(O)–, –S(O) 2 –, or –Cy 1 —, wherein each –Cy 1 – is independently a 5-6 membered heteroarylenyl with 1-4 heteroatoms independently selected from nitrogen, oxygen or sulfur.
- L is . In some embodiments, L is In some embodiments, L is n some embodiments, L i s . In some embodiments, L is In some embodiments, L is [0396] In some embodiments, each of m and n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. [0397] In some embodiments, m is 1. In some embodiments, m is 2. In some embodiments, m is 3. In some embodiments, m is 4. In some embodiments, m is 5. In some embodiments, m is 6. In some embodiments, m is 7. In some embodiments, m is 8. In some embodiments, m is 9. In some embodiments, m is 10.
- n is selected from those depicted in Table 1.
- n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, n is 6. In some embodiments, n is 7. In some embodiments, n is 8. In some embodiments, n is 9. In some embodiments, n is 10. [0400] In some embodiments, n is selected from those depicted in Table 1.
- each of R 7 is independently hydrogen or an optionally substituted group selected from C 1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur; or: an R 7 group and the R 7’ group attached to the same carbon atom are optionally taken together with their intervening carbon atom to form a 3-8 membered saturated or partially unsaturated spirocyclic carbocyclic ring or a 4-8 membered saturated or partially unsaturated spiro
- R 7 is hydrogen. In some embodiments, R 7 is optionally substituted group selected from C 1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 7 is an optionally substituted C 1-6 aliphatic group. In some embodiments, R 7 is an optionally substituted 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring. In some embodiments, R 7 is an optionally substituted phenyl. In some embodiments, R 7 is an optionally substituted 8-10 membered bicyclic aromatic carbocyclic ring. In some embodiments, R 7 is an optionally substituted 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 7 is an optionally substituted 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur. In some embodiments, R 7 is an optionally substituted 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur. [0403] In some embodiments, R 7 is methyl.
- R 7 is In some embodiments, R 7 is In some embodiments, R 7 is In some embodiments, R 7 is In some embodimen 7 ts, R is [0404] In some embodiments, R 7 is In so 7 me embodiments, R is n some embodiments, R 7 is In 7 some embodiments, R is [0405] In some embodiments, R 7 is In some embodiments, R 7 is In some embodiments, R 7 is 7 In some embodiments, R is [0406] In some embodiments, R 7 is In some embodiments, R 7 is n some embodiments, R 7 is In some em 7 bodiments, R is . In some embodiments, R 7 is . In some embodiments, R 7 is . In some embodiments, R 7 is .
- R 7 is [0407] In some embodiments, an R 7 group and the R 7’ group attached to the same carbon atom are taken together with their intervening carbon atom to form a 3-8 membered saturated or partially unsaturated spirocyclic carbocyclic ring. In some embodiments, an R 7 group and the R 7’ group attached to the same carbon atom are taken together with their intervening carbon atom to form a 4-8 membered saturated or partially unsaturated spirocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur. [0408] In some embodiments, R 7 is selected from those depicted in Table 1.
- each of R 7’ is independently hydrogen or C 1-3 aliphatic.
- R 7’ is hydrogen. In some embodiments, R 7’ is methyl. In some embodiments, R 7’ is ethyl. In some embodiments, R 7’ is n-propyl. In some embodiments, R 7’ is isopropyl. [0411] In some embodiments, R 7’ is selected from those depicted in Table 1.
- each of R 8 is independently hydrogen, or C 1-4 aliphatic, or: an R 8 group and its adjacent R 7 group are optionally taken together with their intervening atoms to form a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
- R 8 is hydrogen.
- R 8 is C 1-4 aliphatic.
- R 8 is methyl.
- R 8 is ethyl.
- R 8 is n- propyl.
- R 8 is is isopropyl.
- R 8 is n-butyl.
- R 8 is isobutyl. In some embodiments, R 8 is tert-butyl. [0414] In some embodiments, an R 8 group and its adjacent R 7 group are taken together with their intervening atoms to form a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur. [0415] In some embodiments, an R 8 group and its adjacent R 7 group are taken together with their intervening atoms to form . In some embodiments, an R 8 group and its adjacent R 7 group are taken together with their intervening atoms to form . [0416] In some embodiments, R 8 is selected from those depicted in Table 1.
- R 9 is hydrogen, C 1-3 aliphatic, or –C(O)C 1-3 aliphatic. [0418] In some embodiments, R 9 is hydrogen. In some embodiments, R 9 is C 1-3 aliphatic. In some embodiments, R 9 is –C(O)C 1-3 aliphatic. [0419] In some embodiments, R 9 is methyl. In some embodiments, R 9 is ethyl. In some embodiments, R 9 is n-propyl. In some embodiments, R 9 is isopropyl. In some embodiments, R 9 is cyclopropyl. [0420] In some embodiments, R 9 is –C(O)Me.
- R 9 is –C(O)Et. In some embodiments, R 9 is –C(O)CH 2 CH 2 CH 3 . In some embodiments, R 9 is –C(O)CH(CH 3 ) 2 . In some embodiments, R 9 is –C(O)cyclopropyl. [0421] In some embodiments, R 9 is selected from those depicted in Table 1. [0422] In some embodiments, R is R 7 as described in the present disclosure. In some embodiments, R a2 is R 7 as described in the present disclosure. In some embodiments, R a3 is R 7 as described in the present disclosure. In some embodiments, R is R 7’ as described in the present disclosure.
- R a2 is R 7’ as described in the present disclosure. In some embodiments, R a3 is R 7’ as described in the present disclosure. In some embodiments, R is R 8 as described in the present disclosure. In some embodiments, R a2 is R 8 as described in the present disclosure. In some embodiments, R a3 is R 8 as described in the present disclosure. In some embodiments, R is R 8’ as described in the present disclosure. In some embodiments, R a2 is R 8’ as described in the present disclosure. In some embodiments, R a3 is R 8’ as described in the present disclosure. In some embodiments, R is R 9 as described in the present disclosure. In some embodiments, R a2 is R 9 as described in the present disclosure.
- R a3 is R 9 as described in the present disclosure.
- o is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- o is 1. In some embodiments, o is 2. In some embodiments, o is 3. In some embodiments, o is 4. In some embodiments, o is 5. In some embodiments, o is 6. In some embodiments, o is 7. In some embodiments, o is 8. In some embodiments, o is 9. In some embodiments, o is 10. [0425] In some embodiments, o is selected from those depicted in Table 1. [0426] In some embodiments, R a1 is R as described in the present disclosure.
- R a1 is optionally substituted C 1-4 aliphatic. In some embodiments, R a1 is optionally substituted C 1-4 alkyl. In some embodiments, R a1 is methyl.
- L a1 is L a as described in the present disclosure. In some embodiments, L a1 is a covalent bond.
- L a2 is L a as described in the present disclosure. In some embodiments, L a2 is a covalent bond.
- L T is L a as described herein. In some embodiments, L T is L as described herein. In some embodiments, L T is a covalent bond.
- L T is ⁇ CH 2 ⁇ C(O) ⁇ .
- L T links a ⁇ S ⁇ of a side chain (e.g., through ⁇ CH 2 ) with the amino group of an amino acid residue (e.g., through ⁇ C(O) ⁇ ).
- L a is a covalent bond.
- L a is an optionally substituted bivalent group selected from C 1 -C 10 aliphatic or C 1 -C 10 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L a is an optionally substituted bivalent group selected from C 1 -C 5 aliphatic or C 1 -C 5 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L a is an optionally substituted bivalent C 1 -C 5 aliphatic, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L a is an optionally substituted bivalent C 1 -C 5 aliphatic. In some embodiments, L a is an optionally substituted bivalent C 1 -C 5 heteroaliphatic having 1-3 heteroatoms independently selected from nitrogen, oxygen and sulfur.
- R a2 is R as described in the present disclosure. In some embodiments, R a2 is a side chain of a natural amino acid. In some embodiments, R a3 is R as described in the present disclosure. In some embodiments, R a3 is a side chain of a natural amino acid. In some embodiments, one of R a2 and R a3 is hydrogen.
- R a2 and/or R a3 are R, wherein R is optionally substituted C 1-8 alphatic or aryl. In some embodiments, R is optionally substituted linear C 2-8 alkyl. In some embodiments, R is linear C 2-8 alkyl. In some embodiments, R is optionally substituted branched C 2-8 alkyl. In some embodiments, R is branched C 2-8 alkyl. In some embodiments, R is n-pentyl. In some embodiments, R is optionally substituted phenyl. In some embodiments, R is optionally substituted ⁇ CH 2 ⁇ phenyl. In some embodiments, R is 4-phenylphenyl ⁇ CH 2 ⁇ .
- each ⁇ Cy ⁇ is independently an optionally substituted bivalent monocyclic, bicyclic or polycyclic group wherein each monocyclic ring is independently selected from a C 3-20 cycloaliphatic ring, a C 6-20 aryl ring, a 5-20 membered heteroaryl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and a 3-20 membered heterocyclyl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- each ⁇ Cy ⁇ is independently an optionally substituted bivalent group selected from a C 3-20 cycloaliphatic ring, a C 6-20 aryl ring, a 5-20 membered heteroaryl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and a 3-20 membered heterocyclyl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- ⁇ Cy ⁇ is an optionally substituted ring as described in the present disclosure, for example, for R and Cy L , but is bivalent. [0433] In some embodiments, ⁇ Cy ⁇ is monocyclic. In some embodiments, ⁇ Cy ⁇ is bicyclic.
- ⁇ Cy ⁇ is polycyclic. In some embodiments, ⁇ Cy ⁇ is saturated. In some embodiments, ⁇ Cy ⁇ is partially unsaturated. In some embodiments, ⁇ Cy ⁇ is aromatic. In some embodiments, ⁇ Cy ⁇ comprises a saturated monocyclic moiety. In some embodiments, ⁇ Cy ⁇ comprises a partially unsaturated monocyclic moiety. In some embodiments, ⁇ Cy ⁇ comprises an aromatic monocyclic moiety. In some embodiments, ⁇ Cy ⁇ comprises a combination of a saturated, a partially unsaturated, and/or an aromatic cyclic moiety. In some embodiments, ⁇ Cy ⁇ is or comprises 3-membered ring.
- ⁇ Cy ⁇ is or comprises 4-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 5-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 6-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 7-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 8- membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 9-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 10-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 11-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 12-membered ring.
- ⁇ Cy ⁇ is or comprises 13-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 14-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 15-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 16- membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 17-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 18-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 19-membered ring. In some embodiments, ⁇ Cy ⁇ is or comprises 20-membered ring.
- ⁇ Cy ⁇ is or comprises an optionally substituted bivalent C 3-20 cycloaliphatic ring. In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted bivalent, saturated C 3-20 cycloaliphatic ring. In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted bivalent, partially unsaturated C 3-20 cycloaliphatic ring. In some embodiments, ⁇ Cy ⁇ H is optionally substituted cycloaliphatic as described in the present disclosure, for example, cycloaliphatic embodiments for R. [0435] In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted C 6-20 aryl ring.
- ⁇ Cy ⁇ is or comprises optionally substituted phenylene. In some embodiments, ⁇ Cy ⁇ is or comprises optionally substituted 1,2-phenylene. In some embodiments, ⁇ Cy ⁇ is or comprises optionally substituted 1,3-phenylene. In some embodiments, ⁇ Cy ⁇ is or comprises optionally substituted 1,4-phenylene. In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted bivalent naphthalene ring. In some embodiments, ⁇ Cy ⁇ H is optionally substituted aryl as described in the present disclosure, for example, aryl embodiments for R.
- ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 5-20 membered heteroaryl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 5- 20 membered heteroaryl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, and sulfur.
- ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 5-6 membered heteroaryl ring having 1-4 heteroatoms independently selected from oxygen, nitrogen, sulfur.
- ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 5-6 membered heteroaryl ring having 1-3 heteroatoms independently selected from oxygen, nitrogen, sulfur.
- ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 5-6 membered heteroaryl ring having 1-2 heteroatoms independently selected from oxygen, nitrogen, sulfur. In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 5-6 membered heteroaryl ring having one heteroatom independently selected from oxygen, nitrogen, sulfur. In some embodiments, ⁇ Cy ⁇ H is optionally substituted heteroaryl as described in the present disclosure, for example, heteroaryl embodiments for R. In some embodiments, ⁇ [0437] In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 3-20 membered heterocyclyl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 3-20 membered heterocyclyl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, and sulfur. In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 3-6 membered heterocyclyl ring having 1-4 heteroatoms independently selected from oxygen, nitrogen, sulfur. In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 5-6 membered heterocyclyl ring having 1-4 heteroatoms independently selected from oxygen, nitrogen, sulfur. In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 5-6 membered heterocyclyl ring having 1-3 heteroatoms independently selected from oxygen, nitrogen, sulfur.
- ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 5-6 membered heterocyclyl ring having 1-2 heteroatoms independently selected from oxygen, nitrogen, sulfur. In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted bivalent 5-6 membered heterocyclyl ring having one heteroatom independently selected from oxygen, nitrogen, sulfur. In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted saturated bivalent heterocyclyl group. In some embodiments, ⁇ Cy ⁇ is or comprises an optionally substituted partially unsaturated bivalent heterocyclyl group. In some embodiments, ⁇ Cy ⁇ H is optionally substituted heterocyclyl as described in the present disclosure, for example, heterocyclyl embodiments for R.
- ⁇ Cy ⁇ is . In some embodiments, ⁇ Cy ⁇ is . In some embodiments, ⁇ Cy ⁇ is . In some embodiments, ⁇ Cy ⁇ is . In some embodiments, ⁇ Cy ⁇ [0439] In some embodiments, each Xaa is independently an amino acid residue. In some embodiments, each Xaa is independently an amino acid residue of an amino acid of formula A-I. [0440] In some embodiments, t is 0. In some embodiments, t is 1-50. In some embodiments, t is z as described in the present disclosure. [0441] In some embodiments, y is 1. In some embodiments, y is 2. In some embodiments, y is 3.
- y is 4. In some embodiments, y is 5. In some embodiments, y is 6. In some embodiments, y is 7. In some embodiments, y is 8. In some embodiments, y is 9. In some embodiments, y is 10. In some embodiments, y is 11. In some embodiments, y is 12. In some embodiments, y is 13. In some embodiments, y is 14. In some embodiments, y is 15. In some embodiments, y is 16. In some embodiments, y is 17. In some embodiments, y is 18. In some embodiments, y is 19. In some embodiments, y is 20. In some embodiments, y is greater than 20. [0442] In some embodiments, z is 1. In some embodiments, z is 2.
- z is 3. In some embodiments, z is 4. In some embodiments, z is 5. In some embodiments, z is 6. In some embodiments, z is 7. In some embodiments, z is 8. In some embodiments, z is 9. In some embodiments, z is 10. In some embodiments, z is 11. In some embodiments, z is 12. In some embodiments, z is 13. In some embodiments, z is 14. In some embodiments, z is 15. In some embodiments, z is 16. In some embodiments, z is 17. In some embodiments, z is 18. In some embodiments, z is 19. In some embodiments, z is 20. In some embodiments, z is greater than 20.
- R c is R’ as described in the present disclosure. In some embodiments, R c is R as described in the present disclosure. In some embodiments, R c is ⁇ N(R’) 2 , wherein each R’ is independently as described in the present disclosure. In some embodiments, R c is ⁇ NH 2 . In some embodiments, R c is R ⁇ C(O) ⁇ , wherein R is as described in the present disclosure. In some embodiments, R c is ⁇ H. [0444] In some embodiments, L b is L a as described in the present disclosure. In some embodiments, L b comprises ⁇ Cy ⁇ . In some embodiments, L b comprises a double bond.
- L b comprises ⁇ S ⁇ . In some embodiments, L b comprises ⁇ S ⁇ S ⁇ . In some embodiments, L b comprises ⁇ C(O) ⁇ N(R’) ⁇ . [0445] In some embodiments, R’ is ⁇ R, ⁇ C(O)R, ⁇ C(O)OR, or ⁇ S(O) 2 R, wherein R is as described in the present disclosure. In some embodiments, R’ is R, wherein R is as described in the present disclosure. In some embodiments, R’ is ⁇ C(O)R, wherein R is as described in the present disclosure. In some embodiments, R’ is ⁇ C(O)OR, wherein R is as described in the present disclosure.
- R’ is ⁇ S(O) 2 R, wherein R is as described in the present disclosure. In some embodiments, R’ is hydrogen. In some embodiments, R’ is not hydrogen. In some embodiments, R’ is R, wherein R is optionally substituted C 1-20 aliphatic as described in the present disclosure. In some embodiments, R’ is R, wherein R is optionally substituted C 1-20 heteroaliphatic as described in the present disclosure. In some embodiments, R’ is R, wherein R is optionally substituted C 6-20 aryl as described in the present disclosure. In some embodiments, R’ is R, wherein R is optionally substituted C 6-20 arylaliphatic as described in the present disclosure.
- R’ is R, wherein R is optionally substituted C 6-20 arylheteroaliphatic as described in the present disclosure. In some embodiments, R’ is R, wherein R is optionally substituted 5-20 membered heteroaryl as described in the present disclosure. In some embodiments, R’ is R, wherein R is optionally substituted 3-20 membered heterocyclyl as described in the present disclosure. In some embodiments, two or more R’ are R, and are optionally and independently taken together to form an optionally substituted ring as described in the present disclosure.
- each R is independently ⁇ H, or an optionally substituted group selected from C 1-30 aliphatic, C 1-30 heteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, C 6-30 aryl, C 6-30 arylaliphatic, C 6-30 arylheteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, 5- 30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-30 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, or two R groups are optionally and independently taken together to form a covalent bond, or: two or more R groups on the same atom are optionally and independently taken together with the atom to form an optionally substituted, 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the atom, 0-10 heteroatom
- each R is independently ⁇ H, or an optionally substituted group selected from C 1-30 aliphatic, C 1-30 heteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, C 6-30 aryl, C 6-30 arylaliphatic, C 6-30 arylheteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, 5- 30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-30 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, or two R groups are optionally and independently taken together to form a covalent bond, or: two or more R groups on the same atom are optionally and independently taken together with the atom to form an optionally substituted, 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the atom, 0-10 heteroatom
- two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms, 0-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- each R is independently ⁇ H, or an optionally substituted group selected from C 1-20 aliphatic, C 1-20 heteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, C 6-20 aryl, C 6-20 arylaliphatic, C 6-20 arylheteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, 5- 20 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-20 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, or two R groups are optionally and independently taken together to form a covalent bond, or: two or more R groups on the same atom are optionally and independently taken together with the atom to form an optionally substituted, 3-20 membered monocyclic, bicyclic or polycyclic ring having, in addition to the atom, 0-10 heteroatoms
- two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-20 membered monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms, 0-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- each R is independently ⁇ H, or an optionally substituted group selected from C 1-30 aliphatic, C 1-30 heteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, C 6-30 aryl, C 6-30 arylaliphatic, C 6-30 arylheteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, 5- 30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-30 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- each R is independently ⁇ H, or an optionally substituted group selected from C 1-20 aliphatic, C 1-20 heteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, C 6-20 aryl, C 6-20 arylaliphatic, C 6-20 arylheteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, 5- 20 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-20 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R is hydrogen.
- R is not hydrogen.
- R is an optionally substituted group selected from C 1-30 aliphatic, C 1-30 heteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, C 6-30 aryl, a 5-30 membered heteroaryl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and a 3-30 membered heterocyclic ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R is hydrogen or an optionally substituted group selected from C 1- 20 aliphatic, phenyl, a 3-7 membered saturated or partially unsaturated carbocyclic ring, an 8-10 membered bicyclic saturated, partially unsaturated or aryl ring, a 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 4-7 membered saturated or partially unsaturated heterocyclic ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 7-10 membered bicyclic saturated or partially unsaturated heterocyclic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an 8-10 membered bicyclic heteroaryl ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is optionally substituted C 1-30 aliphatic. In some embodiments, R is optionally substituted C 1-20 aliphatic. In some embodiments, R is optionally substituted C 1-15 aliphatic. In some embodiments, R is optionally substituted C 1-10 aliphatic. In some embodiments, R is optionally substituted C 1-6 aliphatic. In some embodiments, R is optionally substituted C 1-6 alkyl. In some embodiments, R is optionally substituted hexyl, pentyl, butyl, propyl, ethyl or methyl. In some embodiments, R is optionally substituted hexyl. In some embodiments, R is optionally substituted pentyl.
- R is optionally substituted butyl. In some embodiments, R is optionally substituted propyl. In some embodiments, R is optionally substituted ethyl. In some embodiments, R is optionally substituted methyl. In some embodiments, R is hexyl. In some embodiments, R is pentyl. In some embodiments, R is butyl. In some embodiments, R is propyl. In some embodiments, R is ethyl. In some embodiments, R is methyl. In some embodiments, R is isopropyl. In some embodiments, R is n- propyl. In some embodiments, R is tert-butyl. In some embodiments, R is sec-butyl.
- R is n-butyl. In some embodiments, R is ⁇ (CH 2 ) 2 CN. [0454] In some embodiments, R is optionally substituted C 3-30 cycloaliphatic. In some embodiments, R is optionally substituted C 3-20 cycloaliphatic. In some embodiments, R is optionally substituted C 3-10 cycloaliphatic. In some embodiments, R is optionally substituted cyclohexyl. In some embodiments, R is cyclohexyl. In some embodiments, R is optionally substituted cyclopentyl. In some embodiments, R is cyclopentyl. In some embodiments, R is optionally substituted cyclobutyl.
- R is cyclobutyl. In some embodiments, R is optionally substituted cyclopropyl. In some embodiments, R is cyclopropyl. [0455] In some embodiments, R is an optionally substituted 3-30 membered saturated or partially unsaturated carbocyclic ring. In some embodiments, R is an optionally substituted 3-7 membered saturated or partially unsaturated carbocyclic ring. In some embodiments, R is an optionally substituted 3-membered saturated or partially unsaturated carbocyclic ring. In some embodiments, R is an optionally substituted 4-membered saturated or partially unsaturated carbocyclic ring.
- R is an optionally substituted 5-membered saturated or partially unsaturated carbocyclic ring. In some embodiments, R is an optionally substituted 6-membered saturated or partially unsaturated carbocyclic ring. In some embodiments, R is an optionally substituted 7-membered saturated or partially unsaturated carbocyclic ring. In some embodiments, R is optionally substituted cycloheptyl. In some embodiments, R is cycloheptyl. In some embodiments, R is optionally substituted cyclohexyl. In some embodiments, R is cyclohexyl. In some embodiments, R is optionally substituted cyclopentyl. In some embodiments, R is cyclopentyl.
- R is optionally substituted cyclobutyl. In some embodiments, R is cyclobutyl. In some embodiments, R is optionally substituted cyclopropyl. In some embodiments, R is cyclopropyl. [0456] In some embodiments, when R is or comprises a ring structure, e.g., cycloaliphatic, cycloheteroaliphatic, aryl, heteroaryl, etc., the ring structure can be monocyclic, bicyclic or polycyclic. In some embodiments, R is or comprises a monocyclic structure. In some embodiments, R is or comprises a bicyclic structure. In some embodiments, R is or comprises a polycyclic structure.
- R is optionally substituted C 1-30 heteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon. In some embodiments, R is optionally substituted C 1-20 heteroaliphatic having 1-10 heteroatoms. In some embodiments, R is optionally substituted C 1-20 heteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus or silicon, optionally including one or more oxidized forms of nitrogen, sulfur, phosphorus or selenium.
- R is an optionally substituted 8-10 membered bicyclic partially unsaturated ring. In some embodiments, R is an optionally substituted 8-10 membered bicyclic aryl ring. In some embodiments, R is optionally substituted naphthyl. [0460] In some embodiments, R is optionally substituted 5-30 membered heteroaryl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon. In some embodiments, R is optionally substituted 5-30 membered heteroaryl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, and sulfur.
- R is optionally substituted 5-30 membered heteroaryl ring having 1-5 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon. In some embodiments, R is optionally substituted 5-30 membered heteroaryl ring having 1-5 heteroatoms independently selected from oxygen, nitrogen, and sulfur. [0461] In some embodiments, R is an optionally substituted 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur. In some embodiments, R is a substituted 5-6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is an unsubstituted 5- 6 membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur. In some embodiments, R is an optionally substituted 5-6 membered monocyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, sulfur, and oxygen. In some embodiments, R is a substituted 5-6 membered monocyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, and sulfur. In some embodiments, R is an unsubstituted 5- 6 membered monocyclic heteroaryl ring having 1-3 heteroatoms independently selected from nitrogen, sulfur, and oxygen.
- R is an optionally substituted 5-membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen or sulfur. In some embodiments, R is an optionally substituted 6-membered monocyclic heteroaryl ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur. [0463] In some embodiments, R is an optionally substituted 5-membered monocyclic heteroaryl ring having one heteroatom selected from nitrogen, oxygen, and sulfur. In some embodiments, R is optionally substituted pyrrolyl, furanyl, or thienyl. [0464] In some embodiments, R is an optionally substituted 5-membered heteroaryl ring having two heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is an optionally substituted 5-membered heteroaryl ring having one nitrogen atom, and an additional heteroatom selected from sulfur or oxygen. In some embodiments, R is an optionally substituted 5- membered heteroaryl ring having three heteroatoms independently selected from nitrogen, oxygen, and sulfur. In some embodiments, R is an optionally substituted 5-membered heteroaryl ring having four heteroatoms independently selected from nitrogen, oxygen, and sulfur. [0465] In some embodiments, R is an optionally substituted 6-membered heteroaryl ring having 1–4 nitrogen atoms. In some embodiments, R is an optionally substituted 6-membered heteroaryl ring having 1–3 nitrogen atoms.
- R is an optionally substituted 6-membered heteroaryl ring having 1–2 nitrogen atoms. In some embodiments, R is an optionally substituted 6-membered heteroaryl ring having four nitrogen atoms. In some embodiments, R is an optionally substituted 6- membered heteroaryl ring having three nitrogen atoms. In some embodiments, R is an optionally substituted 6-membered heteroaryl ring having two nitrogen atoms. In certain embodiments, R is an optionally substituted 6-membered heteroaryl ring having one nitrogen atom. [0466] In certain embodiments, R is an optionally substituted 8–10 membered bicyclic heteroaryl ring having 1–4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is an optionally substituted 5,6–fused heteroaryl ring having 1–4 heteroatoms independently selected from nitrogen, oxygen, and sulfur. In certain embodiments, R is an optionally substituted 6,6–fused heteroaryl ring having 1–4 heteroatoms independently selected from nitrogen, oxygen, and sulfur. [0467] In some embodiments, R is 3-30 membered heterocyclic ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon. In some embodiments, R is 3-30 membered heterocyclic ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, and sulfur. In some embodiments, R is 3-30 membered heterocyclic ring having 1-5 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R is 3-30 membered heterocyclic ring having 1-5 heteroatoms independently selected from oxygen, nitrogen, and sulfur.
- R is an optionally substituted 3-7 membered saturated or partially unsaturated heterocyclic ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is a substituted 3-7 membered saturated or partially unsaturated heterocyclic ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is an unsubstituted 3-7 membered saturated or partially unsaturated heterocyclic ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is an optionally substituted 5–7 membered partially unsaturated monocyclic ring having 1–3 heteroatoms independently selected from nitrogen, oxygen, and sulfur. In certain embodiments, R is an optionally substituted 5–6 membered partially unsaturated monocyclic ring having 1–3 heteroatoms independently selected from nitrogen, oxygen, and sulfur. In certain embodiments, R is an optionally substituted 5-membered partially unsaturated monocyclic ring having 1–3 heteroatoms independently selected from nitrogen, oxygen, and sulfur. In certain embodiments, R is an optionally substituted 6- membered partially unsaturated monocyclic ring having 1–3 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is an optionally substituted 7-membered partially unsaturated monocyclic ring having 1–3 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is optionally substituted 3-membered heterocyclic ring having one heteroatom selected from nitrogen, oxygen or sulfur.
- R is optionally substituted 4-membered heterocyclic ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is optionally substituted 5-membered heterocyclic ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is optionally substituted 6-membered heterocyclic ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is optionally substituted 7-membered heterocyclic ring having 1-3 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is an optionally substituted 3-membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is an optionally substituted 4-membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is an optionally substituted 5-membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is an optionally substituted 6-membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur. In some embodiments, R is an optionally substituted 7-membered saturated or partially unsaturated heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, and sulfur. [0470] In certain embodiments, R is an optionally substituted 5–6 membered partially unsaturated monocyclic ring having 1–2 heteroatoms independently selected from nitrogen, oxygen, and sulfur. In certain embodiments, R is an optionally substituted tetrahydropyridinyl, dihydrothiazolyl, dihydrooxazolyl, or oxazolinyl group.
- R is an optionally substituted 7-10 membered bicyclic saturated or partially unsaturated heterocyclic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- R is optionally substituted indolinyl.
- R is optionally substituted isoindolinyl.
- R is optionally substituted 1, 2, 3, 4- tetrahydroquinolinyl.
- R is optionally substituted 1, 2, 3, 4-tetrahydroisoquinolinyl.
- R is an optionally substituted azabicyclo[3.2.1]octanyl.
- R is an optionally substituted 8-10 membered bicyclic heteroaryl ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, and sulfur. In some embodiments, R is an optionally substituted 5,6–fused heteroaryl ring having 1–5 heteroatoms independently selected from nitrogen, oxygen, and sulfur. [0473] In some embodiments, R is optionally substituted C 6-30 arylaliphatic. In some embodiments, R is optionally substituted C 6-20 arylaliphatic. In some embodiments, R is optionally substituted C 6-10 arylaliphatic. In some embodiments, an aryl moiety of the arylaliphatic has 6, 10, or 14 aryl carbon atoms.
- an aryl moiety of the arylaliphatic has 6 aryl carbon atoms. In some embodiments, an aryl moiety of the arylaliphatic has 10 aryl carbon atoms. In some embodiments, an aryl moiety of the arylaliphatic has 14 aryl carbon atoms. In some embodiments, an aryl moiety is optionally substituted phenyl. [0474] In some embodiments, R is optionally substituted C 6-30 arylheteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R is optionally substituted C 6-30 arylheteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, and sulfur. In some embodiments, R is optionally substituted C 6-20 arylheteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon. In some embodiments, R is optionally substituted C 6-20 arylheteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, and sulfur. In some embodiments, R is optionally substituted C 6-10 arylheteroaliphatic having 1-5 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R is optionally substituted C 6-10 arylheteroaliphatic having 1-5 heteroatoms independently selected from oxygen, nitrogen, and sulfur.
- two R groups are optionally and independently taken together to form a covalent bond.
- two or more R groups on the same atom are optionally and independently taken together with the atom to form an optionally substituted, 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the atom, 0-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- two or more R groups on the same atom are optionally and independently taken together with the atom to form an optionally substituted, 3-20 membered monocyclic, bicyclic or polycyclic ring having, in addition to the atom, 0-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- two or more R groups on the same atom are optionally and independently taken together with the atom to form an optionally substituted, 3-10 membered monocyclic, bicyclic or polycyclic ring having, in addition to the atom, 0-5 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- two or more R groups on the same atom are optionally and independently taken together with the atom to form an optionally substituted, 3-6 membered monocyclic, bicyclic or polycyclic ring having, in addition to the atom, 0-3 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- two or more R groups on the same atom are optionally and independently taken together with the atom to form an optionally substituted, 3-5 membered monocyclic, bicyclic or polycyclic ring having, in addition to the atom, 0-3 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms, 0-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-20 membered monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms, 0-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-10 membered monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms, 0-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-10 membered monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms, 0-5 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-6 membered monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms, 0-3 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-5 membered monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms, 0-3 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- heteroatoms in R groups, or in the structures formed by two or more R groups taken together, are selected from oxygen, nitrogen, and sulfur.
- a formed ring is 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20-membered.
- a formed ring is saturated.
- a formed ring is partially saturated.
- a formed ring is aromatic.
- a formed ring comprises a saturated, partially saturated, or aromatic ring moiety.
- a formed ring comprises 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 aromatic ring atoms.
- a formed contains no more than 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 aromatic ring atoms.
- aromatic ring atoms are selected from carbon, nitrogen, oxygen and sulfur.
- a ring formed by two or more R groups (or two or more groups selected from R and variables that can be R) taken together is a C 3-30 cycloaliphatic, C 6-30 aryl, 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, or 3-30 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, ring as described for R, but bivalent or multivalent.
- a reaction partner is a compound of Table 1a or Table 1b.
- a reaction partner comprising a target binding moiety and a moiety of interest e.g., a compound of formula R-I or a salt thereof, is a compound in Table 1a.
- a compound comprising an antibody binding moiety and a moiety of interest is a compound of Table 1a.
- compound of Table 1b does not contain antibody binding moiety and may be utilized as reference for corresponding reaction partner compounds.
- the present disclosure provides technologies for assessing properties and/or activities of reactive groups.
- compounds of Table 1c are useful for assessing properties and/or activities of reactive groups thereon, e.g., ⁇ C(O)N(CH 3 )O(CH 3 ), etc.
- the present disclosure provides a compound set forth in Table 1, above, or a pharmaceutically acceptable salt thereof.
- the present disclosure provides a composition which comprises or delivers a compound set forth in Table 1, above, or a pharmaceutically acceptable salt thereof.
- the present disclosure provides an antibody-antibody conjugate as described herein.
- the present disclosure provides an antibody-antibody conjugate comprising a linker as described herein (e.g., a linker lack of ⁇ S ⁇ S ⁇ ).
- the present disclosure provides a composition which comprises or delivers a provided antibody-antibody conjugate.
- a provided composition is a pharmaceutical composition.
- the present disclosure provides technologies (e.g., compounds, methods, etc.) useful for preparing compounds, agents, compositions, etc. as described herein.
- provided compounds are useful for preparing compounds of formula R-I or a salt thereof.
- a compound has the structure of LG ⁇ R LG ⁇ H or a salt thereof.
- a compound has the structure of LG ⁇ L LG1 ⁇ H or a salt thereof.
- a compound has the structure of LG ⁇ L LG1 ⁇ L LG2 ⁇ H or a salt thereof.
- a compound has the structure of LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ H or a salt thereof. In some embodiments, a compound has the structure of LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof. In some embodiments, a compound has the structure of LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ RG ⁇ H or a salt thereof. In some embodiments, a compound has the structure of LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ H or a salt thereof.
- a compound has the structure of LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ H or a salt thereof. In some embodiments, a compound has the structure of LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ L RM ⁇ H or a salt thereof. In some embodiments, a compound has the structure of LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ L PM ⁇ H or a salt thereof. For example, in some embodiments, a compound is salt thereof.
- a compound is salt thereof. In some embodiments, a compound is or a salt thereof. In some embodiments, a compound is or a salt thereof. In some embodiments, a compound is one described in an Example as described herein.
- General Methods, Reagents and Conditions [0484] Various technologies may be utilized to provide compounds and agents herein in accordance with the present disclosure. [0485] In some embodiments, where a particular protecting group (“PG”), leaving group (“LG”), or transformation condition is depicted, one of ordinary skill in the art will appreciate that other protecting groups, leaving groups, and transformation conditions are also suitable and are contemplated. Such groups and transformations are described in detail in March's Advanced Organic Chemistry: Reactions, Mechanisms, and Structure, M. B.
- leaving groups include but are not limited to, halogens (e.g. fluoride, chloride, bromide, iodide), sulfonates (e.g.
- an oxygen protecting group includes, for example, carbonyl protecting groups, hydroxyl protecting groups, etc. Hydroxyl protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, the entirety of which is incorporated herein by reference.
- Suitable hydroxyl protecting groups include, but are not limited to, esters, allyl ethers, ethers, silyl ethers, alkyl ethers, arylalkyl ethers, and alkoxyalkyl ethers.
- esters include formates, acetates, carbonates, and sulfonates.
- Specific examples include formate, benzoyl formate, chloroacetate, trifluoroacetate, methoxyacetate, triphenylmethoxyacetate, p-chlorophenoxyacetate, 3- phenylpropionate, 4-oxopentanoate, 4,4-(ethylenedithio)pentanoate, pivaloate (trimethylacetyl), crotonate, 4-methoxy-crotonate, benzoate, p-benylbenzoate, 2,4,6-trimethylbenzoate, carbonates such as methyl, 9- fluorenylmethyl, ethyl, 2,2,2-trichloroethyl, 2-(trimethylsilyl)ethyl, 2-(phenylsulfonyl)ethyl, vinyl, allyl, and p-nitrobenzyl.
- silyl ethers examples include trimethylsilyl, triethylsilyl, t-butyldimethylsilyl, t-butyldiphenylsilyl, triisopropylsilyl, and other trialkylsilyl ethers.
- Alkyl ethers include methyl, benzyl, p-methoxybenzyl, 3,4-dimethoxybenzyl, trityl, t-butyl, allyl, and allyloxycarbonyl ethers or derivatives.
- Alkoxyalkyl ethers include acetals such as methoxymethyl, methylthiomethyl, (2-methoxyethoxy)methyl, benzyloxymethyl, beta-(trimethylsilyl)ethoxymethyl, and tetrahydropyranyl ethers.
- arylalkyl ethers include benzyl, p-methoxybenzyl (MPM), 3,4-dimethoxybenzyl, O-nitrobenzyl, p- nitrobenzyl, p-halobenzyl, 2,6-dichlorobenzyl, p-cyanobenzyl, and 2- and 4-picolyl.
- Amino protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, the entirety of which is incorporated herein by reference.
- Suitable amino protecting groups include, but are not limited to, aralkylamines, carbamates, cyclic imides, allyl amines, amides, and the like.
- Examples of such groups include t-butyloxycarbonyl (BOC), ethyloxycarbonyl, methyloxycarbonyl, trichloroethyloxycarbonyl, allyloxycarbonyl (Alloc), benzyloxocarbonyl (CBZ), allyl, phthalimide, benzyl (Bn), fluorenylmethylcarbonyl (Fmoc), formyl, acetyl, chloroacetyl, dichloroacetyl, trichloroacetyl, phenylacetyl, trifluoroacetyl, benzoyl, and the like.
- compounds/agents may contain one or more stereocenters, and may be present as a racemic or diastereomeric mixture.
- One of skill in the art will also appreciate that there are many methods known in the art for the separation of isomers to obtain stereoenriched or stereopure isomers of those compounds, including but not limited to HPLC, chiral HPLC, fractional crystallization of diastereomeric salts, kinetic enzymatic resolution (e.g. by fungal-, bacterial-, or animal-derived lipases or esterases), and formation of covalent diastereomeric derivatives using an enantioenriched reagent.
- compositions may be provided as in various forms according to desired uses. In some embodiments, they are provided as pharmaceutical compositions. As appreciated by those skilled in the art, in many instances, pharmaceutical compositions comprise controlled amounts and are manufactured for administration to subjects such as human patients. In some embodiments, the present disclosure provides a composition comprising a compound, an agent, and/or a composition described herein or a pharmaceutically acceptable derivative thereof and a pharmaceutically acceptable carrier.
- the present disclosure provides a pharmaceutical composition comprising a compound, agent or composition of the present disclosure and a pharmaceutically acceptable carrier.
- the present disclosure provides a pharmaceutical composition comprising a therapeutically effective amount of a compound, an agent or a composition of the present disclosure and a pharmaceutically acceptable carrier.
- a pharmaceutical composition is packaged for storage, transportation, administration, etc.
- a pharmaceutical composition does not contain a significant amount of organic solvents (e.g., total amount of organic solvents no more than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, or 1% of weight and/or volume of a pharmaceutical composition).
- a pharmaceutically acceptable carrier is or comprises a non-toxic carrier, adjuvant, or vehicle that does not destroy the pharmacological activity of the compound with which it is formulated.
- Pharmaceutically acceptable carriers, adjuvants or vehicles that may be include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat
- a pharmaceutically acceptable derivative is a non-toxic salt, ester, salt of an ester or other derivative of a compound that, upon administration to a recipient, is capable of providing, either directly or indirectly, a compound or an active metabolite or residue thereof.
- Compositions may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir.
- parenteral administration includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques.
- compositions are administered orally, intraperitoneally or intravenously.
- Sterile injectable forms of compositions may be aqueous or oleaginous suspension. These suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3- butanediol.
- acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- a bland fixed oil may be employed including synthetic mono- or di-glycerides.
- Fatty acids such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions.
- These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions.
- compositions may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions.
- carriers commonly used include lactose and corn starch.
- Lubricating agents such as magnesium stearate, are also typically added.
- useful diluents include lactose and dried cornstarch.
- compositions may be administered in the form of suppositories for rectal administration.
- these can be prepared by mixing the agent with a suitable non-irritating excipient that is solid at room temperature but liquid at rectal temperature and therefore will melt in the rectum to release the drug.
- suitable non-irritating excipient include cocoa butter, beeswax and polyethylene glycols.
- compositions may be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, including diseases of the eye, the skin, or the lower intestinal tract. Suitable topical formulations are readily prepared for each of these areas or organs.
- Topical application for the lower intestinal tract can be effected in a rectal suppository formulation (see above) or in a suitable enema formulation. Topically-transdermal patches may also be used.
- pharmaceutically acceptable compositions may be formulated in a suitable ointment containing the active component suspended or dissolved in one or more carriers.
- Carriers for topical administration of compounds of this disclosure include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water.
- provided pharmaceutically acceptable compositions can be formulated in a suitable lotion or cream containing the active components suspended or dissolved in one or more pharmaceutically acceptable carriers.
- Suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
- compositions may be formulated as micronized suspensions in isotonic, pH adjusted sterile saline, or, preferably, as solutions in isotonic, pH adjusted sterile saline, either with or without a preservative such as benzylalkonium chloride.
- the pharmaceutically acceptable compositions may be formulated in an ointment such as petrolatum.
- Pharmaceutically acceptable compositions may also be administered by nasal aerosol or inhalation.
- compositions are prepared according to techniques well-known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other conventional solubilizing or dispersing agents.
- pharmaceutically acceptable compositions are formulated for oral administration. Such formulations may be administered with or without food. In some embodiments, pharmaceutically acceptable compositions are administered without food. In other embodiments, pharmaceutically acceptable compositions are administered with food. [0504] Amounts of compounds that may be combined with the carrier materials to produce a composition in a single dosage form will vary depending upon the host treated, the particular mode of administration.
- compositions are formulated so that a dosage of between 0.01 - 100 mg/kg body weight/day of the inhibitor can be administered to a patient receiving these compositions.
- a specific dosage and treatment regimen for any particular patient will depend upon a variety of factors, including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, rate of excretion, drug combination, and the judgment of the treating physician and the severity of the particular disease being treated.
- the amount of a compound of the present disclosure in the composition will also depend upon the particular compound in the composition.
- Technologies e.g., compounds, agents, compositions
- provided technologies are useful for treating conditions, disorders or diseases, e.g., various cancers.
- provided technologies comprise target binding moieties, e.g., antibody agent moieties, that can bind antigens of cancer cells.
- a target binding moiety is an antibody agent moiety.
- an antibody agent is a therapeutic agent.
- various antibody agents including many developed and/or approved (e.g., by FDA, EMA, etc.) as therapeutics can be utilized in accordance with the present disclosure to provide therapeutics for various diseases.
- LG is or comprises a target binding moiety that binds to a target agent, wherein a target agent is a protein agent. 4. The compound of any one of the preceding embodiments, wherein LG is or comprises a target binding moiety that binds to a target agent, wherein a target agent is an antibody agent. 5. The compound of any one of the preceding embodiments, wherein LG is or comprises a target binding moiety that binds to a Fc region. 6.
- each L is independently a covalent bond, or a bivalent optionally substituted, linear or branched aliphatic group or heteroaliphatic group having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , ⁇ C(O)S ⁇ , ⁇ C(O) 2
- LG is R LG ⁇ L LG ⁇ , wherein R LG is or comprises a target binding moiety, wherein L LG is L LG1 , wherein L LG1 is L.
- RG is or comprises ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ , wherein each of L LG2 , L LG3 , L LG4 , L RG1 , L RG2 is independently L.
- LG is R LG ⁇ L LG ⁇ , wherein R LG is or comprises a target binding moiety, wherein L LG is L LG1 ⁇ L LG2 ⁇ .
- RG is or comprises ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ .
- LG is R LG ⁇ L LG ⁇ , wherein R LG is or comprises a target binding moiety, wherein L LG is L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ .
- R LG is or comprises WXL, wherein X is an amino acid residue.
- R LG is or comprises AWXLGELVW, wherein X is an amino acid residue.
- R LG is or comprises DpLpAWXLGELVW, wherein X is an amino acid residue.
- R LG is or comprises DCAWXLGELVWCT, wherein the two cysteine residues optionally form a disulfide bond, and X is an amino acid residue.
- R LG is or comprises DpLpDCAWXLGELVWCT, wherein the two cysteine residues optionally form a disulfide bond, and X is an amino acid residue.
- R LG is or comprises CDCAWXLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, are each independently and optionally form a disulfide bond, and X is an amino acid residue.
- 22. The compound of any one of embodiments 16-21, wherein R LG is or comprises WXL, wherein X is an amino acid residue.
- 23. The compound of embodiment 15, wherein R LG is selected from Table A-1.
- L LG1 is or comprises ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently 1-10, and each ⁇ CH 2 ⁇ is independently optionally substituted.
- L LG2 is or comprises ⁇ NR’ ⁇ .
- L LG2 is or comprises ⁇ C(O) ⁇ .
- L LG2 is or comprises ⁇ NR’C(O) ⁇ . 64.
- L LG2 is or comprises ⁇ (CH 2 )n ⁇ OC(O)N(R’) ⁇ , wherein ⁇ (CH 2 )n ⁇ is optionally substituted.
- L LG2 is a covalent bond.
- L LG2 is ⁇ CH 2 N(CH 2 CH 2 CH 2 S(O) 2 OH) ⁇ C(O) ⁇ .
- L LG2 is ⁇ C(O) ⁇ NHCH 2 ⁇ . 68.
- R RG2 and R RG4 are taken together with their intervening atoms to form an optionally substituted 3-10 membered monocyclic or bicyclic ring having 0- 5 heteroatoms.
- a moiety of interest is or comprises a detectable moiety.
- a moiety of interest is or comprises a fluorophore.
- a moiety of interest is or c 104.
- the compound of any one of the preceding embodiments, wherein a moiety of interest is or comprises a therapeutic agent.
- a moiety of interest is or comprises a cytotoxic agent.
- a moiety of interest is or comprises a moiety that can bind to a protein, nucleic acid or a cell.
- a moiety of interest is or comprises a moiety that can bind to immune cells.
- a moiety of interest is or comprises a small molecule moiety.
- a moiety of interest is or comprises a peptide moiety.
- a moiety of interest is or comprises a reactive moiety.
- a moiety of interest is or comprises a reactive moiety suitable for a bioorthogonal reaction.
- the compound of any one of embodiments 110-111, wherein a reactive moiety is or comprises optionally substituted .
- 115. The compound of any one of embodiments 110-111, wherein a reactive moiety is or comprises optionally substituted . 116.
- a compound, wherein the compound is I-39 or a salt thereof.
- a compound, wherein the compound is I-40 or a salt thereof. 135.
- a compound, wherein the compound is I-40 or a salt thereof.
- 136. A compound, wherein the compound is I-44 or a salt thereof.
- 137. A compound, wherein the compound is I-49 or a salt thereof.
- 138. A compound selected from Table 1b or a salt thereof.
- a compound comprising: a first group comprising a target binding moiety that binds to a target agent, a reactive group; a moiety of interest; and optionally one or more linker moieties; wherein a reaction group is located between a first group and a moiety of interest, and is connected to a first group and a moiety of interest independently and optionally through a linker moiety.
- a reaction group is located between a first group and a moiety of interest, and is connected to a first group and a moiety of interest independently and optionally through a linker moiety.
- 142 The compound of any one of embodiments 140-141, wherein a first group is LG in any one of embodiments 1-139. 143.
- a method comprising steps of: 1) contacting a target agent with a reaction partner comprising: a first group comprising a target binding moiety that binds to a target agent, a reactive group; a moiety of interest; and optionally one or more linker moieties; 2) forming an agent comprising: a target agent moiety; a moiety of interest; and optionally one or more linker moieties.
- a reaction group is located between a first group and a moiety of interest, and is connected to a first group and a moiety of interest independently and optionally through a linker moiety.
- a method of preparing an agent having the structure of P-I: P ⁇ L PM ⁇ MOI, (P-I) or a salt thereof, wherein: P is a target agent moiety; L PM is a linker; and MOI is a moiety of interest. comprising steps of: 1) contacting a target agent with a reaction partner having the structure of formula R-I: LG ⁇ RG ⁇ L RM ⁇ MOI, (R-I) or a salt thereof, wherein: LG is a group comprising a target binding moiety that binds to a target agent, RG is a reactive group; L RM is a linker; and MOI is a moiety of interest; and 2) forming an agent having the structure of formula P-I. 150.
- LG is a group comprising a protein-binding moiety that binds to P-N, RG is a reactive group
- L RM is a linker
- MOI is a moiety of interest.
- a target agent is or comprises a protein agent.
- a target agent is or comprises an antibody agent.
- a moiety of interest is selectively attached to the antibody agent at K246 or K248 or a corresponding location.
- the method of embodiment 152, wherein a moiety of interest is selectively attached to the antibody agent at K288 or K290 or a corresponding location.
- 155. The method of embodiment 152, wherein a moiety of interest is selectively attached to the antibody agent at K251 or K253 of an IgG2 heavy chain or a corresponding location.
- a moiety of interest is selectively attached to the antibody agent at K239 or K241 of an IgG4 heavy chain or a corresponding location.
- a moiety of interest is selectively attached to the antibody agent at K317 or a corresponding location.
- a moiety of interest is selectively attached to the antibody agent at heavy chain residue(s) over light chain residue(s).
- a target agent is or comprise an IgG antibody agent.
- a target agent is or comprises an Fc region. 161.
- a reaction partner is a compound of any one embodiments 1-146. 162.
- the method of any one of the preceding embodiments, wherein the contacting and forming steps are performed in one pot. 163.
- the method of any one of the preceding embodiments, wherein the contacting and forming steps are performed in one chemical reaction.
- the method comprises no reactions which are directed primarily to cleavage of a functional group in an agent comprising a target agent moiety.
- the method comprises no reactions which are directed primarily to cleavage of a functional group in L RM or L PM .
- the method comprises no reactions which are directed primarily to reduction of a functional group in an agent comprising target agent moiety. 167. The method of any one of the preceding embodiments, wherein the method comprises no reactions which are directed primarily to reduction of a functional group in L RM or L PM . 168. The method of any one of the preceding embodiments, wherein the method comprises no reactions which are directed primarily to oxidation of a functional group in an agent comprising a target agent moiety. 169. The method of any one of the preceding embodiments, wherein the method comprises no reactions which are directed primarily to oxidation of a functional group in L RM or L PM . 170.
- the method comprises no reactions which are directed primarily to hydrolysis of a functional group in an agent comprising a target agent moiety. 171.
- the method of any one of the preceding embodiments, wherein the method comprises no reactions which are directed primarily to hydrolysis of a functional group in L RM or L PM .
- the method of any one of the preceding embodiments, wherein the method comprises no reactions which are directed primarily to hydrolysis of an ester group in L RM or L PM . 173.
- a target agent moiety is a protein agent moiety.
- a target agent moiety is an antibody agent moiety. 175.
- contacting is performed under conditions and for a time sufficient for a lysine residue of a target agent to react with a reactive group of a reaction partner.
- contacting is performed under conditions and for a time sufficient for a lysine residue of a target agent to react and form a bond with an atom of RG and release LG.
- the agent and the reaction partner share the same moiety of interest. 178.
- any one of the preceding embodiments comprising reacting a first agent comprising a first reactive moiety in a first moiety of interest with a second agent comprising a second reactive moiety.
- a second agent comprises a second reactive moiety and a peptide moiety.
- a second agent comprises a second reactive moiety and a protein moiety.
- a second agent comprises a second reactive moiety and an antibody agent moiety.
- any one of the preceding embodiments comprising reacting a first agent comprising a first reactive moiety in a first moiety of interest with a second agent comprising a second reactive moiety in a second moiety of interest.
- first agent is a product of a method of any one of embodiments 147-183.
- second agent is a product of a method of any one of embodiments 147-183. 191.
- each of the first and the second agent is independently a product of a method of any one of embodiments 147-183. 192.
- a method comprising reacting a first agent comprising a first reactive moiety in a first moiety of interest with a second agent comprising a second reactive moiety in a second moiety of interest, wherein the first agent is prepared by a method of any one of embodiments 147-183. 193.
- a method comprising reacting a first agent comprising a first reactive moiety in a first moiety of interest with a second agent comprising a second reactive moiety in a second moiety of interest, wherein the second agents is prepared by a method of any one of embodiments 147-183. 194.
- a method comprising reacting a first agent comprising a first reactive moiety in a first moiety of interest with a second agent comprising a second reactive moiety in a second moiety of interest, wherein each of the first and the second agents is independently prepared by a method of any one of embodiments 147-183.
- 195 The method of any one of embodiments 184-194, wherein each of the first and the second agents independently has the structure of formula P-I or P-II, or a salt thereof.
- 196 The method of any one of embodiments 184-195, wherein the target agent moiety of the first agent is an antibody agent moiety.
- 197 The method of any one of embodiments 184-196, wherein the target agent moiety of the second agent is an antibody agent moiety.
- n is 2. 211.
- the method of any one of embodiments 207-209, wherein n is 3. 212.
- the method of any one of embodiments 207-209, wherein n is 4. 213.
- the method of any one of embodiments 207-209, wherein n is 5.
- the method of embodiment 214, wherein n in (X)n is 1. 216.
- the method of embodiment 214, wherein n in (X)n is 2. 217.
- n in (X)n is 3. 218.
- n in (X)n is 4. 219.
- the method of embodiment 214, wherein n in (X)n is 5. 220.
- the method of any one of embodiments 184-206, wherein one of the first reactive and the second moieties is or comprises ⁇ N 3 , and the other is or comprises an alkyne. 222.
- one of the first reactive and the second moieties is or comprises ⁇ N 3 , and the other is or comprises 223.
- a product formed by a reaction of a first and a second agents is an agent of formula P-I or P-II, or a salt thereof, wherein the target agent moiety is or is derived from the target agent moiety of the first or the second agents, while the moiety of interest is derived from the target agent moiety of the other of the first or the second agents.
- the product of embodiment 224 wherein the product is a composition comprising an agent of formula P-I or P-II, or a salt thereof.
- a composition provides a plurality of agents each of which independently comprising: a target agent moiety, a moiety of interest, and optionally a linker moiety linking a target agent moiety and a moiety of interest; wherein agents of the plurality share the same or substantially the same target agent moiety, and a common modification independently at at least one common location; and wherein about 1%-100% of all agents that comprise a target agent moiety and a moiety of interest are agents of the plurality.
- a composition provides a plurality of agents each of which independently comprising: a protein agent moiety, a moiety of interest, and optionally a linker moiety linking a protein agent moiety and a moiety of interest; wherein protein agent moieties of agents of the plurality comprise a common amino acid sequence, and agents of the plurality share a common modification independently at at least one common amino acid residue of protein agent moieties; and wherein about 1%-100% of all agents that comprise a protein agent moiety that comprise the common amino acid sequence and a moiety of interest are agents of the plurality. 231.
- a composition provides a plurality of agents each of which independently comprising: an antibody agent moiety, a moiety of interest, and optionally a linker moiety linking an antibody agent moiety and a moiety of interest; wherein antibody agent moieties of agents of the plurality comprise a common amino acid sequence or can bind to a common antigen, and agents of the plurality share a common modification independently at at least one common amino acid residue of protein agent moieties; and wherein about 1%-100% of all agents that comprise an antibody agent moiety that comprise the common amino acid sequence or can bind to the common antigen and a moiety of interest are agents of the plurality.
- composition of embodiment 231, wherein antibody agent moieties of agents of the plurality can bind to two or more different antigens. 234.
- the composition of any one of embodiments 231-233, wherein antibody agent moieties of agents of the plurality comprise a common amino acid sequence.
- the composition of any one of embodiments 231-233, wherein antibody agent moieties of agents of the plurality comprise a common amino acid sequence in a Fc region. 236.
- the composition of any one of embodiments 231-233, wherein antibody agent moieties of agents of the plurality comprise a common Fc region. 237.
- the composition of any one of the preceding embodiments, wherein a target, protein or antibody agent moiety is or comprises an anti-CD20 agent moiety. 238.
- composition of any one of the preceding embodiments, wherein a target, protein or antibody agent moiety is or comprises an anti-CD20 agent moiety. 239.
- the composition of any one of the preceding embodiments, wherein a target, protein or antibody agent moiety is or comprises rituximab.
- 240. The composition of any one of embodiments 229-234, wherein a target, protein or antibody agent moiety is or comprises trastuzumab. 241.
- the composition of any one of embodiments 233-236, wherein antibody agent moieties of agents of the plurality are IVIG moieties. 242.
- the composition of any one of the preceding embodiments, wherein agents of the plurality comprises a common moiety of interest. 243.
- the composition of any one of embodiments 229-243, wherein a moiety of interest is or comprises a reactive moiety which does not react with a target agent moiety, a protein agent moiety or an antibody moiety agent. 247.
- composition of any one of embodiments 229-243, wherein a moiety of interest is or comprises a reactive moiety which does not react with an antibody moiety agent. 248.
- the composition of embodiment 245, wherein the reactive moiety is ⁇ N 3 . 249.
- the composition of embodiment 245, wherein the reactive moiety is ⁇ . 250.
- the composition of embodiment 245, wherein the reactive moiety is . 251.
- the composition of any one of embodiments 229-243, wherein a moiety of interest is or comprises a therapeutic agent moiety. 252.
- the composition of any one of embodiments 229-243, wherein a moiety of interest is or comprises a drug moiety. 253.
- composition of any one of embodiments 229-243, wherein a moiety of interest is or comprises a cytotoxic moiety. 254.
- the composition of any one of embodiments 229-243, wherein a moiety of interest is or comprises a peptide moiety.
- a moiety of interest is or comprises a protein moiety.
- a moiety of interest is or comprises an antibody agent. 257.
- the composition of any one of embodiments 229-243, wherein a moiety of interest is or comprises a scFv agent. 258.
- composition of any one of embodiments 229-243, wherein a moiety of interest is or comprises an anti-CD3 agent. 259.
- the composition of any one of embodiments 229-243, wherein a moiety of interest is or comprises a peptide whose sequence is SEQ ID NO: 1 or a fragment thereof.
- 260. The composition of any one of embodiments 229-243, wherein a moiety of interest is or comprises cetuximab. 261.
- the composition of any one of embodiments 229-260, wherein the linker is not a natural amino acid peptide linker. 262.
- the composition of any one of embodiments 229-261, wherein the linker is or comprises LPXT(G)n, wherein n is 1-10. 263.
- 270 The composition of embodiment 262 or 263, wherein n is 3. 267.
- the composition of embodiment 262 or 263, wherein n is 5. 269.
- the composition of any one of embodiments 229-268, wherein a linker comprise one or more ⁇ CH 2 ⁇ CH 2 ⁇ O ⁇ . 270.
- the composition of any one of embodiments 230-270, wherein the common amino acid sequence comprises about 1-500 or more amino acid residues. 272.
- the composition of any one of embodiments 230-270, wherein the common amino acid sequence comprises 10 or more amino acid residues. 273.
- the composition of any one of embodiments 230-270, wherein the common amino acid sequence comprises 20 or more amino acid residues. 274.
- the composition of any one of embodiments 230-270, wherein the common amino acid sequence comprises 50 or more amino acid residues. 275.
- composition of any one of embodiments 230-274, wherein the common amino acid sequence comprises one or more amino acid residues selected from K246 and K248 of an IgG1 heavy chain and amino acid residues corresponding thereto, K251 and K253 of an IgG2 heavy chain and amino acid residues corresponding thereto, and K239 and K241 of an IgG4 heavy chain and amino acid residues corresponding thereto.
- the composition of any one of embodiments 230-275, wherein the common amino acid sequence is at least 50%-100% of that of the protein or antibody agent moiety. 278.
- composition of any one of the preceding embodiments, wherein all common modifications comprises a common moiety of interest and optionally a common linker. 283.
- composition of any one of the preceding embodiments wherein about 1%-100% of all agents that comprise a target agent moiety are agents of the plurality, or at least about 1%-100% of all agents that comprise a protein agent moiety that comprise the common amino acid sequence are agents of the plurality, or about 1%-100% of all agents that comprise an antibody agent moiety that comprise the common amino acid sequence or can bind to the common antigen are agents of the plurality. 299.
- the composition of any one of embodiments 297-298, wherein the percentage is at least about 5%. 300.
- the composition of any one of embodiments 297-298, wherein the percentage is at least about 10%.
- 301. The composition of any one of embodiments 297-298, wherein the percentage is at least about 20%. 302.
- the composition of any one of the preceding embodiments, wherein the composition is a product of a method of any one of the preceding embodiments. 310.
- the composition of any one of the preceding embodiments, wherein the composition is a pharmaceutical composition. 311.
- An agent wherein the agent is an agent of the plurality of any one of embodiments 229-309. 312.
- a pharmaceutical composition comprising an agent of embodiment 311 and a pharmaceutically acceptable carrier. 313.
- the method, product, composition or agent of any one of the preceding embodiments, wherein the ratio of moieties of interest conjugated to target agent moieties and target agent moieties, or the ratio of moieties of interest conjugated to protein agent moieties and protein agent moieties, or the ratio of moieties of interest conjugated to antibody agent moieties and antibody agent moieties, is about 0.5-6. 316.
- the method, product, composition or agent of any embodiment 315 wherein the ratio is about 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.5 or 3. 318.
- a compound, wherein the compound is or a salt thereof.
- 320 A compound, wherein the compound i alt thereof. 321. A compound, wherein the compound i alt thereof. 322.
- a compound, wherein the compound is or a salt thereof. 324.
- the agent of embodiment 331, wherein the agent has the structure of formula R-I or a salt thereof. 333.
- a polypeptide agent comprising an amino acid residue of a compound of any one of embodiments 319-329. 334.
- a method for preparing a compound comprising providing a compound of any one of embodiments 319-329. 335. The method of embodiment 334, wherein the compound is an agent of any one of embodiments 331-333. EXEMPLIFICATION [0508] As depicted in the Examples below, in certain exemplary embodiments, compounds, agents, compositions, etc. are prepared and/or assessed according to the following procedures as examples.
- Solution 1 To a solution of Azido-PEG6-acid (300 mg, 790.71 umol, 1 eq) in DCM (3 mL) was added SOCl2 (282.21 mg, 2.37 mmol, 172.08 uL, 3 eq) at 0 °C for 5 min. The mixture was concentrated to dryness. The crude product was dissolved with DCM (1 mL).
- Solution 2 To a solution of compound 4 (429.78 mg, 790.71 umol, 1 eq) in DCM (3 mL) was added DIEA (306.58 mg, 2.37 mmol, 413.18 uL, 3 eq) at 0°C.
- Solution 1 To a solution of Azido-PEG6-acid (280 mg, 738.00 umol, 1 eq) in DCM (3 mL) was added SOCl 2 (263.40 mg, 2.21 mmol, 160.61 uL, 3 eq) at 0°C for 5 min. The mixture was concentrated to dryness. The crude product was dissolved with DCM (1 mL).
- Solution 2 To a solution of compound 3 (436.62 mg, 738.00 umol, 1 eq) in DCM (3 mL) was added DIEA (286.14 mg, 2.21 mmol, 385.64 uL, 3 eq) at 0°C.
- Solution 1 To a solution of Azido-PEG6-acid (340 mg, 896.14 umol, 1 eq) in DCM (5 mL) was added SOCl2 (319.84 mg, 2.69 mmol, 195.03 uL, 3 eq) at 0°C for 5 min. The mixture was concentrated to dryness. The crude product was dissolved with DCM (1 mL).
- Solution 2 To a solution of compound 3 (504.16 mg, 896.14 umol, 1 eq) in DCM (5 mL) was added DIEA (347.45 mg, 2.69 mmol, 468.26 uL, 3 eq) at 0°C.
- Example 7 Exemplary Synthesis of Compound I-7.
- General procedure for preparation of compound 3 [0603] To a solution of compound 2 (433.23 mg, 2.13 mmol, 1 eq) in DMF (23 mL) was added HATU (891.57 mg,2.34 mmol, 1.1 eq) and DIEA (826.50 mg, 6.39 mmol, 1.11 mL, 3 eq). The mixture was stirred at 0 °C for 0.5 hr. Then compound 1 (2.9 g, 2.13 mmol, 1 eq, HCl) was added to the reaction mixture. The mixture was stirred at 25 °C for 0.5 hr.
- LCMS showed formation of desired product.
- the reaction mixture was filtered and the filtrate was purified directly by prep-HPLC (column: Nano-micro Kromasil C1880*25mm*3um; mobile phase: [water (0.1%TFA)-ACN]; B%: 18%-52%, 7 min) to give compound 7 (45 mg, 66.20 umol, 35.94% yield) as a colorless oil.
- Example 20 Exemplary Synthesis of Compound I-20.
- a mixture of compound 1 (163.2 mg, 419.3 umol), FITC (0.10 g, 381.2 umol), DIEA (98.5 mg, 762.4 umol, 132.8 uL) in DMF (0.5 mL) was stirred at 15 °C for 2 hrs.
- the mixture was purified by flash C18 (ISCO®; 120 g SepaFlash® C18 Flash Column, Eluent of 0 ⁇ 90% MeCN/H 2 O ethergradient @ 75 mL/min) to get compound 2 (300 mg, 1.43 mmol, 90.0% purity, 52.2% yield) as a yellow solid.
- peptides were purified using conditions below as an example”
- I-22 and I-23 were prepared using a similar process, and the materials used in cycle 5 were Fmoc-PEG4-CH 2 CH 2 COOH and Fmoc-PEG2-CH 2 CH 2 COOH respectively. In one preparation, purity for I-22 was about 96%, MS: m/z 555.9 [M+3H] 3+ . In one preparation, purity for I-23 was about 93%, MS: m/z 526.6 [M+3H] 3+ . [0773] Example 22. Exemplary Synthesis of Compounds I-24 and I-25.
- peptide was prepared using the procedure below: 1) Add DCM to the vessel containing CTC Resin (0.10 mmol, 0.10 g, 1.0 mmol/g) and Fmoc-Thr(tBu)- OH (39.7 mg, 0.10 mmol, 1.0 eq) with N 2 bubbling. 2) Add DIEA (6.0 eq) dropwise and mix for 2 hrs.
- peptide was handled in dark.
- cleavage cocktail (92.5%TFA/2.5%3-mercaptopropanoic acid/2.5%H 2 O/2.5%TIS) to the flask containing the side chain protected peptide at room temperature and the mixture was stirred for 1 hr.
- Peptide was synthesized using standard Fmoc chemistry. A procedure is described below as an example: 1) Add DCM to the vessel containing CTC Resin (0.20 mmol, 0.20 g, 1.0 mmol/g) and Fmoc-Trp(Boc)- OH (0.085 g, 0.16 mmol, 0.8 eq) with N 2 bubbling. 2) Add DIEA (6.0 eq) dropwise and mix for 2 hrs. 3) Add MeOH (0.50 mL) and mix for 30 mins. 4) Drain and wash with DMF for 5 times. 5) Add 20% piperidine/DMF and mix for 30 mins. 6) Drain and then DMF wash 30 seconds with 5 times.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Cell Biology (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Steroid Compounds (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/769,924 US20230128688A1 (en) | 2019-11-18 | 2020-11-18 | Directed conjugation technologies |
| CA3160681A CA3160681A1 (en) | 2019-11-18 | 2020-11-18 | Directed conjugation technologies |
| IL293095A IL293095B1 (en) | 2019-11-18 | 2020-11-18 | Directed conjugation technologies |
| KR1020227019529A KR20220103986A (ko) | 2019-11-18 | 2020-11-18 | 지정 접합 기술 |
| CN202080093195.2A CN115066263A (zh) | 2019-11-18 | 2020-11-18 | 定向缀合技术 |
| JP2022528256A JP2023501720A (ja) | 2019-11-18 | 2020-11-18 | 指向性コンジュゲーション技術 |
| PH1/2022/551000A PH12022551000A1 (en) | 2019-11-18 | 2020-11-18 | Directed conjugation technologies |
| BR112022009398A BR112022009398A2 (pt) | 2019-11-18 | 2020-11-18 | Tecnologias de conjugação direcionadas |
| AU2020388383A AU2020388383A1 (en) | 2019-11-18 | 2020-11-18 | Directed conjugation technologies |
| MX2022005884A MX2022005884A (es) | 2019-11-18 | 2020-11-18 | Tecnologías de conjugación dirigida. |
| EP20891185.9A EP4061425A4 (en) | 2019-11-18 | 2020-11-18 | DIRECTED CONJUGATION TECHNOLOGIES |
| IL325588A IL325588A (en) | 2019-11-18 | 2025-12-24 | Methods for coupling an institute |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962937131P | 2019-11-18 | 2019-11-18 | |
| US62/937,131 | 2019-11-18 | ||
| US202063063902P | 2020-08-10 | 2020-08-10 | |
| US63/063,902 | 2020-08-10 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021102052A1 true WO2021102052A1 (en) | 2021-05-27 |
Family
ID=75981011
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/061127 Ceased WO2021102052A1 (en) | 2019-11-18 | 2020-11-18 | Directed conjugation technologies |
Country Status (12)
| Country | Link |
|---|---|
| US (1) | US20230128688A1 (https=) |
| EP (1) | EP4061425A4 (https=) |
| JP (1) | JP2023501720A (https=) |
| KR (1) | KR20220103986A (https=) |
| CN (1) | CN115066263A (https=) |
| AU (1) | AU2020388383A1 (https=) |
| BR (1) | BR112022009398A2 (https=) |
| CA (1) | CA3160681A1 (https=) |
| IL (2) | IL293095B1 (https=) |
| MX (1) | MX2022005884A (https=) |
| PH (1) | PH12022551000A1 (https=) |
| WO (1) | WO2021102052A1 (https=) |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113636960A (zh) * | 2021-08-24 | 2021-11-12 | 上海皓元医药股份有限公司 | 一种2-(氯磺酰基)环己烷-1-烯甲酸乙酯衍生物的制备方法 |
| CN114085376A (zh) * | 2021-12-02 | 2022-02-25 | 中国科学院长春应用化学研究所 | 一种多肽及其制备方法、双特异性抗体及其应用 |
| WO2022079031A1 (en) * | 2020-10-12 | 2022-04-21 | Debiopharm Research & Manufacturing S.A. | Reactive conjugates |
| WO2022246086A1 (en) * | 2021-05-19 | 2022-11-24 | Biohaven Therapeutics Ltd. | Antibody drug conjugates using mates technology for delivering cytotoxic agents |
| WO2025158412A1 (en) | 2024-01-26 | 2025-07-31 | Biohaven Therapeutics Ltd. | BIFUNCTIONAL DEGRADERS OF IgG4 IMMUNOGLOBULINS |
| WO2025181697A1 (en) | 2024-02-26 | 2025-09-04 | Biohaven Therapeutics Ltd. | Bifunctional degraders of anti-pla2r antibody |
| WO2025210538A1 (en) | 2024-04-02 | 2025-10-09 | Biohaven Therapeutics Ltd. | Bifunctional degraders |
| WO2026028159A1 (en) | 2024-07-31 | 2026-02-05 | Biohaven Therapeutics Ltd. | Bifunctional degraders for the treatment of graves' disease |
| WO2026028158A1 (en) | 2024-07-31 | 2026-02-05 | Biohaven Therapeutics Ltd. | Targeted degradation of anti-aav antibodies to enable aav-based gene therapy |
| EP4351658A4 (en) * | 2021-05-17 | 2026-04-15 | Biohaven Therapeutics Ltd | COMPOSITIONS COMPRISING COMBINED THERAPY AMPLIFIERS |
| WO2026083257A1 (en) | 2024-10-14 | 2026-04-23 | Biohaven Therapeutics Ltd. | Antigen-specific degraders of immunoglobulin a and their uses |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2861261A2 (en) * | 2012-06-19 | 2015-04-22 | Polytherics Limited | Process for preparation of antibody conjugates and antibody conjugates |
| GB201506407D0 (en) * | 2015-04-15 | 2015-05-27 | Berkel Patricius H C Van And Howard Philip W | Site-specific antibody-drug conjugates |
| WO2017139329A1 (en) * | 2016-02-09 | 2017-08-17 | Alexander Krantz | Site-selective functionalization of proteins using traceless affinity lables |
| US11135307B2 (en) * | 2016-11-23 | 2021-10-05 | Mersana Therapeutics, Inc. | Peptide-containing linkers for antibody-drug conjugates |
| AU2018259856B2 (en) * | 2017-04-28 | 2025-05-01 | Ajinomoto Co., Inc. | Compound having substance that has affinity for soluble protein, cleavable moiety, and reactive group, or salt thereof |
| CA3069986A1 (en) * | 2017-07-26 | 2019-01-31 | Kleo Pharmaceuticals, Inc. | Universal abt compounds and uses thereof |
-
2020
- 2020-11-18 JP JP2022528256A patent/JP2023501720A/ja active Pending
- 2020-11-18 IL IL293095A patent/IL293095B1/en unknown
- 2020-11-18 MX MX2022005884A patent/MX2022005884A/es unknown
- 2020-11-18 BR BR112022009398A patent/BR112022009398A2/pt unknown
- 2020-11-18 AU AU2020388383A patent/AU2020388383A1/en active Pending
- 2020-11-18 KR KR1020227019529A patent/KR20220103986A/ko active Pending
- 2020-11-18 PH PH1/2022/551000A patent/PH12022551000A1/en unknown
- 2020-11-18 EP EP20891185.9A patent/EP4061425A4/en active Pending
- 2020-11-18 CA CA3160681A patent/CA3160681A1/en active Pending
- 2020-11-18 WO PCT/US2020/061127 patent/WO2021102052A1/en not_active Ceased
- 2020-11-18 US US17/769,924 patent/US20230128688A1/en active Pending
- 2020-11-18 CN CN202080093195.2A patent/CN115066263A/zh active Pending
-
2025
- 2025-12-24 IL IL325588A patent/IL325588A/en unknown
Non-Patent Citations (5)
| Title |
|---|
| METALLO ET AL.: "Using Bifunctional Polymers Presenting Vancomycin and Fluorescein Groups To Direct Anti-Fluorescein Antibodies to Self-Assembled Monolayers Presenting D-Alanine-D- Alanine Groups", J. AM. CHEM. SOC., vol. 125, 2003, pages 4534 - 4540, XP002353047, DOI: 10.1021/ja030045a * |
| See also references of EP4061425A4 * |
| SUMRANJIT ET AL.: "Recent Advances in Target Characterization and Identification by Photoaffinity Probes", MOLECULES, vol. 18, 2013, pages 10425 - 10451, XP055677816, DOI: 10.3390/molecules180910425 * |
| VANCE ET AL.: "Development, optimization and structural characterization of an efficient peptide- based photoaffinity crosslinking reaction for generation of homogeneous conjugates from wild- type antibodies", BIOCONJUGATE CHEM, vol. 30, no. 1, 19 December 2018 (2018-12-19), pages 148 - 160, XP055674161, DOI: 10.1021/acs.bioconjchem.8b00809 * |
| WALSH ET AL.: "Site-selective modification strategies in antibody drug conjugates", CHEM. SOC. REV, vol. 50, 2021, pages 1305 - 1353, XP055815046, DOI: 10.1039/D0CS00310G * |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022079031A1 (en) * | 2020-10-12 | 2022-04-21 | Debiopharm Research & Manufacturing S.A. | Reactive conjugates |
| JP2023545871A (ja) * | 2020-10-12 | 2023-10-31 | デバイオファーム リサーチ アンド マニュファクチュアリング エス.エー. | 反応性共役体 |
| EP4351658A4 (en) * | 2021-05-17 | 2026-04-15 | Biohaven Therapeutics Ltd | COMPOSITIONS COMPRISING COMBINED THERAPY AMPLIFIERS |
| WO2022246086A1 (en) * | 2021-05-19 | 2022-11-24 | Biohaven Therapeutics Ltd. | Antibody drug conjugates using mates technology for delivering cytotoxic agents |
| CN113636960A (zh) * | 2021-08-24 | 2021-11-12 | 上海皓元医药股份有限公司 | 一种2-(氯磺酰基)环己烷-1-烯甲酸乙酯衍生物的制备方法 |
| CN114085376A (zh) * | 2021-12-02 | 2022-02-25 | 中国科学院长春应用化学研究所 | 一种多肽及其制备方法、双特异性抗体及其应用 |
| CN114085376B (zh) * | 2021-12-02 | 2022-12-20 | 中国科学院长春应用化学研究所 | 一种多肽及其制备方法、双特异性抗体及其应用 |
| WO2025158412A1 (en) | 2024-01-26 | 2025-07-31 | Biohaven Therapeutics Ltd. | BIFUNCTIONAL DEGRADERS OF IgG4 IMMUNOGLOBULINS |
| WO2025181697A1 (en) | 2024-02-26 | 2025-09-04 | Biohaven Therapeutics Ltd. | Bifunctional degraders of anti-pla2r antibody |
| WO2025210538A1 (en) | 2024-04-02 | 2025-10-09 | Biohaven Therapeutics Ltd. | Bifunctional degraders |
| WO2026028159A1 (en) | 2024-07-31 | 2026-02-05 | Biohaven Therapeutics Ltd. | Bifunctional degraders for the treatment of graves' disease |
| WO2026028158A1 (en) | 2024-07-31 | 2026-02-05 | Biohaven Therapeutics Ltd. | Targeted degradation of anti-aav antibodies to enable aav-based gene therapy |
| WO2026083257A1 (en) | 2024-10-14 | 2026-04-23 | Biohaven Therapeutics Ltd. | Antigen-specific degraders of immunoglobulin a and their uses |
Also Published As
| Publication number | Publication date |
|---|---|
| IL293095B1 (en) | 2026-01-01 |
| JP2023501720A (ja) | 2023-01-18 |
| CA3160681A1 (en) | 2021-05-27 |
| BR112022009398A2 (pt) | 2022-08-09 |
| IL325588A (en) | 2026-02-01 |
| EP4061425A4 (en) | 2024-06-05 |
| IL293095A (en) | 2022-07-01 |
| CN115066263A (zh) | 2022-09-16 |
| KR20220103986A (ko) | 2022-07-25 |
| PH12022551000A1 (en) | 2023-10-02 |
| AU2020388383A1 (en) | 2022-03-31 |
| EP4061425A1 (en) | 2022-09-28 |
| US20230128688A1 (en) | 2023-04-27 |
| MX2022005884A (es) | 2022-08-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2021102052A1 (en) | Directed conjugation technologies | |
| JP7133079B2 (ja) | 抗体-ピロロベンゾジアゼピン誘導体コンジュゲート | |
| JP2023100903A (ja) | 多価メディトープ、メディトープ結合性抗体およびそれらの使用 | |
| JP2021088582A (ja) | グルココルチコイド受容体アゴニスト及びこのイムノコンジュゲート | |
| TW202102225A (zh) | 抗her2抗體-吡咯并苯二氮呯衍生物結合物 | |
| CN116323638A (zh) | 订书钉化肽及其方法 | |
| CA3261857A1 (en) | ANTIBODY-DRUG CONJUGATE, ITS PREPARATION PROCESS AND ITS USE | |
| EP4125893A1 (en) | Technologies for preventing or treating infections | |
| CA3219550A1 (en) | Antibody drug conjugates using mates technology for delivering cytotoxic agents | |
| CN120529912A (zh) | 订书钉化肽及其方法 | |
| WO2022170155A2 (en) | Technologies for preventing or treating infections | |
| HK40129655A (zh) | 订书钉化肽及其方法 | |
| HK40128981A (zh) | 订书钉化肽及其方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20891185 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2020388383 Country of ref document: AU Date of ref document: 20201118 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3160681 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022528256 Country of ref document: JP Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022009398 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20227019529 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020891185 Country of ref document: EP Effective date: 20220620 |
|
| ENP | Entry into the national phase |
Ref document number: 112022009398 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220513 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522432577 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523452014 Country of ref document: SA |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 827320 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523452014 Country of ref document: SA |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 325588 Country of ref document: IL |
|
| WWP | Wipo information: published in national office |
Ref document number: 325588 Country of ref document: IL |