WO2020222315A1 - 피부 또는 세포 투과능이 우수한 피부 주름 개선 또는 치료용 조성물 - Google Patents

피부 또는 세포 투과능이 우수한 피부 주름 개선 또는 치료용 조성물 Download PDF

Info

Publication number
WO2020222315A1
WO2020222315A1 PCT/KR2019/005128 KR2019005128W WO2020222315A1 WO 2020222315 A1 WO2020222315 A1 WO 2020222315A1 KR 2019005128 W KR2019005128 W KR 2019005128W WO 2020222315 A1 WO2020222315 A1 WO 2020222315A1
Authority
WO
WIPO (PCT)
Prior art keywords
test
bont
peptide
skin
seq
Prior art date
Application number
PCT/KR2019/005128
Other languages
English (en)
French (fr)
Inventor
장상호
이길환
박정란
김지안
황정순
박준호
Original Assignee
주식회사 바이오셀트란
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 바이오셀트란 filed Critical 주식회사 바이오셀트란
Publication of WO2020222315A1 publication Critical patent/WO2020222315A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/0012—Galenical forms characterised by the site of application
    • A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/0012—Galenical forms characterised by the site of application
    • A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • A61K9/0021—Intradermal administration, e.g. through microneedle arrays, needleless injectors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/06—Ointments; Bases therefor; Other semi-solid forms, e.g. creams, sticks, gels
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00—Preparations for care of the skin
    • A61Q19/08—Anti-ageing preparations

Definitions

  • the present invention relates to a composition for improving or treating skin wrinkles containing a fusion peptide formed by binding a peptide that promotes skin and cell penetration (PTD) to a neurotransmitter release control peptide, and more specifically, a skin wrinkle comprising the peptide
  • a cosmetic composition for preventing or improving and a pharmaceutical composition for preventing or treating skin diseases comprising the fusion peptide.
  • the skin surrounds the whole body and is largely composed of three layers of epidermis, dermis and subcutaneous fat. Among them, the stratum corneum is present in the epidermis located at the outermost shell, which serves as a skin barrier protecting the human body from various external irritants. Although it was able to effectively protect the human body from external stress or harmful stimuli, the active ingredients of cosmetics were also not easily absorbed.
  • PTD protein transduction domain
  • the release of the neurotransmitter is caused by the formation of a pathway between the two boundaries after the synaptic vesicle and the presynaptic membrane located at the nerve endings containing the neurotransmitter are fused.
  • the SNARE protein a complex of three proteins consisting of the vesicle protein VAMP (synaptobrevin), the plasma membrane-binding protein Syntaxin 1a, and SNAP-25, provides a fundamental force for the fusion of the synaptic vesicle and the presynaptic membrane.
  • the neurotransmitter release pathway is opened by the membrane fusion between the synaptic vesicle and the presynaptic membrane.
  • the t-SNARE and vesicle (a complex of two types of SNAP-25 proteins) and the syntaxin 1a protein attached to the target membrane ( vesicle) attached to the action of v-SNARE.
  • the present invention aims to develop and provide a fusion peptide that exhibits excellent anti-wrinkle effect by binding a neurotransmitter release-regulating peptide to a skin and cell penetration promoting peptide (PTD) to enhance skin permeability or cell permeability.
  • PTD skin and cell penetration promoting peptide
  • the present invention is the STeP-BoNT/A-LC peptide having the amino acid sequence of SEQ ID NO: 3, the STeP-Vialox peptide having the amino acid sequence of SEQ ID NO: 7, the STeP-SNAP8 peptide having the amino acid sequence of SEQ ID NO: 8, It provides a cosmetic composition for preventing or improving skin wrinkles, characterized in that it contains any one or more selected from the STeP-Leuphasyl peptide having an amino acid sequence.
  • the present invention is the STeP-BoNT/A-LC peptide having the amino acid sequence of SEQ ID NO: 3, the STeP-Vialox peptide having the amino acid sequence of SEQ ID NO: 7, the STeP-SNAP8 peptide having the amino acid sequence of SEQ ID NO: 8, It provides a pharmaceutical composition for preventing or treating skin wrinkles, characterized in that it contains any one or more selected from among STeP-Leuphasyl peptides having an amino acid sequence.
  • the pharmaceutical composition may be preferably an ointment, an injection, or a microneedle patch.
  • the cosmetic composition or pharmaceutical composition of the present invention promotes skin and cell penetration, and exhibits excellent anti-wrinkle prevention, prevention or improvement, and therapeutic efficacy.
  • 1 is a general expression vector map of BoNT/A-LC.
  • 2 is an expression vector map of the recombinant peptide STeP-BoNT/A-LC.
  • 11 is a result of measuring the activity of the Neuropeptide mixture of the present invention through a cell contraction assay.
  • the present invention is the STeP-BoNT/A-LC peptide having the amino acid sequence of SEQ ID NO: 3, the STeP-Vialox peptide having the amino acid sequence of SEQ ID NO: 7, the STeP-SNAP8 peptide having the amino acid sequence of SEQ ID NO: 8, It provides a cosmetic composition for preventing or improving skin wrinkles, characterized in that it contains any one or more selected from the STeP-Leuphasyl peptide having an amino acid sequence.
  • STeP-BoNT/A-LC peptide having the amino acid sequence of SEQ ID NO: 3 of the present invention STeP-Vialox peptide having the amino acid sequence of SEQ ID NO: 7, STeP-SNAP8 peptide having the amino acid sequence of SEQ ID NO: 8, of SEQ ID NO: 9
  • STeP-Leuphasy peptide having an amino acid sequence is BoNT/A-LC (SEQ ID NO: 1), Vialox (SEQ ID NO: 4), SNAP8 (SEQ ID NO: 5), wherein the STeP peptide described in SEQ ID NO: 2 is known as a neurotransmitter release-regulating peptide. ), Leuphasyl (SEQ ID NO: 6), respectively.
  • BoNT/A-LC SEQ ID NO: 1
  • Vialox SEQ ID NO: 4
  • SNAP8 SEQ ID NO: 5
  • Leuphasyl SEQ ID NO: 6
  • the cosmetic composition of the present invention is not limited to a specific form (formulation), and includes all formulations, for example, lotion, gel, water-soluble liquid, cream, essence, oil-in-water (O/W) type, and water-in-oil (W /O) type emulsion, basic cosmetic formulation consisting of ointment, water-in-water and water-in-oil makeup base, foundation, skin cover, lipstick, lip gloss, face powder, two-way cake, eye shadow, cheek color, and eyebrow pencil Any one selected from color cosmetic formulations is good.
  • formulations for example, lotion, gel, water-soluble liquid, cream, essence, oil-in-water (O/W) type, and water-in-oil (W /O) type emulsion
  • basic cosmetic formulation consisting of ointment, water-in-water and water-in-oil makeup base, foundation, skin cover, lipstick, lip gloss, face powder, two-way cake, eye shadow, cheek color, and eyebrow pencil Any one selected from color cosmetic formulations is good.
  • the cosmetic composition of the present invention may contain conventional adjuvants such as hydrophilic or lipophilic gelling agents, hydrophilic or lipophilic activators, preservatives, antioxidants, solvents, fragrances, fillers, blockers, pigments, deodorants and dyes in the cosmetic field. May be.
  • adjuvants such as hydrophilic or lipophilic gelling agents, hydrophilic or lipophilic activators, preservatives, antioxidants, solvents, fragrances, fillers, blockers, pigments, deodorants and dyes in the cosmetic field. May be.
  • the present invention is a STeP-BoNT/A-LC peptide having an amino acid sequence of SEQ ID NO: 3, a STeP-Vialox peptide having an amino acid sequence of SEQ ID NO: 7, a STeP-SNAP8 peptide having an amino acid sequence of SEQ ID NO: 8, SEQ ID NO: It provides a pharmaceutical composition for preventing or treating skin wrinkles, characterized in that it contains any one or more selected from the STeP-Leuphasyl peptide having the amino acid sequence of 9.
  • the pharmaceutical composition of the present invention includes all dosage forms that are not necessarily limited to a specific dosage form, and examples of specific dosage forms include warning agents (PLASTERS), granules (GRANULES), lotions (LOTIONS), liniment agents (LINIMENTS), LEMONADES, AROMATIC WATERS, POWDERS, SYRUPS, OPHTHALMIC OINTMENTS, LIQUIDS AND SOLUTIONS, AEROSOLS, EXTRACTS, ELIXIRS, OINTMENTS, FLUIDEXTRACTS, EMULSIONS, SUSPENSIONS, DECOCTIONS, INFUSIONS, TABLETS, SUPPOSITORIES, INJECTIONS (INJECTIONS), SPIRITS, CATAPLSMA, CAPSULES, CREAMS, TROCHES, TINCTURES, PASTES, PILLS , It may be any one selected from soft or hard gelatin capsules. Preferably, it may be an ointment or injection or microneedle patch.
  • the pharmaceutical composition of the present invention may further include a pharmaceutically acceptable carrier, diluent or excipient.
  • Carriers, excipients or diluents that can be used include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, There are microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, and mineral oil, and at least one selected from among them may be used.
  • the composition of the present invention is provided in the form of a pharmaceutical composition, and the content of the active ingredient peptide of the present invention contained in the pharmaceutical composition of the present invention is preferably adjusted according to the method of use and the condition of the user.
  • 0.000001 to 50% by weight may be added to the pharmaceutical composition based on dry weight, but is not limited thereto.
  • the dosage of the pharmaceutical composition of the present invention is preferably determined in consideration of the administration method, the age, sex, and weight of the user.
  • the composition of the present invention can be administered one or more times at 0.000001 to 1 g/kg (body weight) per day.
  • the above dosage is only an example for exemplification, and may be changed depending on the state of the user.
  • transdermal and cell impermeable general BoNT/A-LC Botulinum neurotoxin type A light chain
  • An expression vector for expression of a general BoNT/A-LC peptide (amino acid sequence number 425, SEQ ID NO: 1) could be constructed by binding to a protein expression vector pET15b vector based on the cDNA sequence of BoNT/A-LC. . XhoI and BamHI restriction sites were added to the synthesized BoNT/A-LC gene for vector insertion. Using this restriction enzyme cleavage site, it was ligated to the expression vector pET15b vector, transformed into E.coli DH5 alpha cells, and the bound vector was purified from the transformed bacteria.
  • a protein expression vector for expression of a fusion peptide in which BoNT/A-LC (SEQ ID NO: 1) and STeP (SEQ ID NO: 2) are conjugated is prepared by fusion synthesis of two initiators based on the cDNA sequence of BoNT/A-LC.
  • BoNT/A-LC SEQ ID NO: 1
  • STeP SEQ ID NO: 2
  • NdeI and BamHI restriction enzyme cleavage sites were added for vector insertion.
  • this restriction enzyme cleavage site it was ligated to the expression vector pET15b vector, transformed into E.coli DH5 alpha cells, and the bound vector was purified from the transformed bacteria.
  • STeP-a BoNT / A purified plasmid vector transformed on the conversion to produce a peptide E.Coli Rosetta-gami TM 2 (DE3 ) expression strain was obtained by transformation into the cell.
  • 2 is an expression vector map of the recombinant peptide STeP-BoNT/A-LC.
  • Table 1 is the amino acid sequence information of the peptides used and fused in Examples 1 and 2.
  • E.Coli Rosetta-gamiTM 2 (DE3) cells were OD using 1,000 ml of LB medium containing ampicillin. 600 Cultured at 37° C. until the value reached 0.6, 0.5 mM IPTG was introduced and further cultured at 37° C. for 8 hours to induce expression of BoNT/A-LC and STeP-BONT/A-LC peptides, respectively.
  • cultured cells before and after induction of the target peptide by the addition of IPTG were harvested, subjected to SDS-PAGE electrophoresis, and observed by staining the peptide with Coomassie brilliant blue.
  • BoNT/A-LC and STeP-BoNT/A-LC transformed cells obtained in Example 3 were destroyed using an ultrasonicator in 1X Native buffer (50mM NaPO4, 0.5M NaCl), and then centrifuged to aggregate ( inclusion body) and cytoplasm (supernatant).
  • pure target peptides BoNT/A-LC and STeP BoNT/A-LC using the Ni 2+ -NTA affinity column (GE Healthcare, USA) using His6 tagging properties of the target peptide (protein).
  • a stabilization buffer 50mM NaPO 4 , 0.4M NaCl, 2mM EDTA, 10% Glycerol, pH 7.5. 4 is a result of purification of BoNT/A-LC and the recombinant peptide STeP-BoNT/A-LC.
  • Example 5 Cell and skin permeable STeP-Neuropeptide (STeP-leuphasyl, STeP-Vialox, STeP-SNAP8) synthesis and purification]
  • SPPS solid phase peptide synthesis
  • SPPS solid phase peptide synthesis
  • Peptide synthesis is based on Fmoc and t-Boc to protect the alpha amino group, and this protecting group is alpha amino by piperidine for fmoc and TFA for t-Boc, which are deprotection agents. It is separated from the group, and the coupling process is performed with the amino acid of the next sequence according to the synthetic sequence, and the peptide bonding is repeatedly performed by various reagents. When the synthesis according to the sequence is completed in this way, it is separated from the synthetic resin and deprotected.
  • the obtained crude peptide (crude peteide) is mass is taken to confirm that the synthesis has been correctly performed, and when the desired peptide is identified, the HPLC purification process is performed.
  • the crude peptide (Crude peptide) is dissolved in distilled water, water is used as the stationary phase, and acetonitrile is used as the mobile phase, and then a gradient is applied differently ( Usually 20-40) peptides of the desired purity are separated and purified, and freeze-drying is performed to complete the synthesis of the peptides in the entire process.
  • the amino acid sequence of the peptide synthesized in this way is shown in Table 2 below.
  • ACN Water and acetonitrile
  • C18 a reversed-phase hydrophilic column
  • the solvent was prepared by adding 0.1% each of trifluoroacetic acid to water and acetonitrile (ACN) for acid stability, and used after removing air bubbles.
  • Samples were prepared by injecting each into a vial after filtering.
  • the pump was washed 2 to 3 times with 100% acetonitrile, and a C18 column was mounted, and acetonitrile was flowed until the pressure and temperature were stabilized.
  • a program was set, the wavelength (280 nm) for detection was determined with a UV/VIS detector, and the magnitude of the reaction was measured over time to determine the purity of the protein.
  • Example 7 Measurement of endotoxicity to the recombinant peptide analyzed in Example 6]
  • Example 6 a biological endotoxin test (Limulus Amebocyte Lysate (Lonza, Swiss)) was performed to measure the endotoxicity of the four types of recombinant peptides analyzed in Example 6.
  • the measurement method used the protocol described in the product instruction manual. Meanwhile, the average endotoxin level of products sold for research is 1 EU/ ⁇ g (1,000 EU/mg) (company name: Sigma, Genscript, Cell signaling).
  • BoNT/A-LC inhibits the secretion of acetylcholine and neurotransmitters through proteolysis (cleavage of the SNAP25 protein). When neurotransmitters are no longer secreted, nerve signals are no longer transmitted to the muscles, leading to relaxation paralysis of the muscles. Based on this mechanism, BoNT/A-LC and STeP-BoNT/A-LC activities were confirmed through the degree of SNAP25 cleavage.
  • the fluorescence values were measured in a kinetic mode (for 5 minutes at 1 minute intervals) at 37°C and 490 nm / 523 nm (excitation/emission wavelengths).
  • the degree of activity was calculated by substituting into the equation below, and the conversion factor was calculated using the standard curve of SNAP25.
  • Vialox The method according to the activation action of Vialox is similar to that of the poisonous frog from South America. By competitively blocking the transmission of information from the acetylcholine receptor, it inhibits the degree of contraction of the nervous tissue, thereby reducing muscle tension and preventing wrinkles produced by facial expressions. It is known to be. Based on this mechanism, the activity was measured with L6 cells using the Cell contraction assay (Cell BIOLABS, INC., CBA-5020).
  • the measurement method used the protocol described in the product instruction manual. As a result of the experiment, it was confirmed that the STeP-vialox treatment group significantly inhibited the contraction of cells compared to the positive control group that induced the contraction of cells by treatment with 10 mM acetylcholine. However, in the Vialox-treated group, the contraction of cells was not suppressed (FIG. 7). 7 is a result of measuring the activity of Vialox and STeP-Vialox.
  • SNAP8 is the latest version of Argireline, Argireline is a hexapeptide, and SNAP8 is an octapeptide. It is the first hexapeptide material to mimic the N-Terminal end of SNAP-25, which competes with the protein at the SNARE complex site. Unlike Botox, it does not cleave the SNAP25 protein, but competes to inhibit acetylcholine and neurotransmitter secretion functions. When neurotransmitters are no longer secreted, nerve signals are no longer transmitted to the muscles, leading to relaxation paralysis of the muscles. It replaces the efficacy of Botox and is known as a safer alternative.
  • the experiment method was as follows. PC12 cells derived from rat adrenal grand are cultured in RPMI media until reaching 70-80% confluency of the culture dish. After that, the nerve growth factor NGF (2.5S 50 ng/mL, sigma-aldrich) was treated and incubated for 5 days. 500 ⁇ l of high-K + solution (115 mM NaCl, 50 mM KCl, 1.2 mM KH 2 PO 4 , 2.5 mM CaCl 2 , 11 mM glucose, and 15 mM HEPES-Tris, pH 7.4) to NGF-treated PC12 cells Treated and incubated for 15 minutes in a 37°C, 5% CO 2 incubator.
  • high-K + solution 115 mM NaCl, 50 mM KCl, 1.2 mM KH 2 PO 4 , 2.5 mM CaCl 2 , 11 mM glucose, and 15 mM HEPES-Tris, pH 7.4
  • SNAP8 and STeP-SNAP8 showed an inhibitory effect on the release of neurotransmitters, but when the same concentration was compared, a higher inhibitory effect was shown in STeP-SNAP8, and more than 50% inhibition was shown in 40 ⁇ M (Fig. 8). ). 8 is a result of measuring the activity of SNAP8 and STeP-SNAP8.
  • Leuphasyl is a raw material developed to reduce wrinkles and closes calcium channels by binding to enkephalin receptors. Thus, it inhibits the secretion of acetylcholine, thereby interfering with muscle contraction and reducing wrinkle formation.
  • the experimental method is the same as that of the STeP-SNAP8.
  • FIG. 12 is a result of measuring the activity of a Neuropeptide mixture through Acelylcholine release measurement.
  • Example 13 Skin irritation test of STeP-BoNT/A-LC against SKINETHICTM human skin model
  • the test substance (STeP-BoNT/A-LC) was applied to the human skin model, washed, and incubated for 42 hours.
  • the reversible damage to the human skin model was evaluated as follows.
  • composition of this test consisted of a total of 3 groups, a negative control group, a positive control group, and a test substance group. Each group was set up as three replicate tissues, and was conducted as a single test.
  • the cell viability of the test substance (Group 3) was 86.3 ⁇ 2.9%, which was calculated to exceed 50% of the standard cell viability, and was judged as skin irritation.
  • STeP-BoNT/A-LC is a skin non-irritating substance that falls under'out of category' in the classification according to the Globally Harmonized System of Classification and Labeling of Chemicals (GHS). was determined.
  • the Stimulation index (SI) was evaluated as follows.
  • the group composition of this test consists of a solvent control group (test material solvent and positive control material solvent), 10% (v/v), 25% (v/v), and 50% (v/v) concentration of test material group and 25%. (v/v) A total of 6 groups of positive control groups were set, and 5 animals were set for each group.
  • test substance STeP-BoNT/A-LC in the skin sensitization test on mice is considered to be a non-sensitizing substance at a concentration of 50% (v/v) or less.
  • Example 15 Ocular mucosa irritation test using STeP-BoNT/A-LC small cornea (BCOP)]
  • BCOP test was performed to evaluate the presence or absence of eye irritation of STeP-BoNT/A-LC.
  • the test substance was used without separate dilution according to the Ministry of Food and Drug Safety and OECD guidelines. Changes in corneal turbidity and permeability were observed by the application of the test substance, and the ocular mucosa irritation index was calculated using the turbidity and permeability values.
  • this test is considered valid as it falls within the range of'mean of historical data ⁇ 2 standard deviation'.
  • test substance STeP-BoNT/A-LC induces microbial reversion mutation
  • four strains of TA98, TA100, TA1535 and TA1537 which are histidine-requiring strains of Salmonella typhimurium , and WP2uvr A, a tryptophan-requiring strain of Escherichia coli .
  • the test was carried out using. The test was carried out by pre-incubation in the metabolic activity system not applied (-S9 mix) and applied (+S9 mix).
  • the negative and positive control values of the main test were within the appropriate range of the test facility.
  • the number of mutant colonies induced in the positive control material increased by more than twice the negative control value for all test strains not applied to the metabolic activity system (-S9 mix) and applied (+S9 mix), and showed clear positive results.
  • Example 17 Chromosome abnormality test using STeP-BoNT/A-LC mammalian cultured cells
  • a chromosomal abnormality test was performed using lung cells (CHL) derived from Chinese hamster.
  • the concentration determination test is 625 in short-time treatment method S9 mix not applied (hereinafter referred to as -S9 mix), S9 mix application (hereinafter referred to as +S9 mix) and continuous treatment method 24-hour treatment (hereinafter referred to as 24-hour treatment), respectively. It was carried out by setting 1250, 2500 and 5000 ⁇ g/mL.
  • a short-time treatment method (-S9 mix, +S9 mix) and a continuous treatment method (24-hour treatment) were set to treatment concentrations of 1250, 2500, and 5000 ⁇ g/mL, respectively, and a chromosomal abnormality test was performed.
  • the frequency of occurrence of chromosomal abnormality cells and number of abnormal cells in the short-time treatment (-S9 mix, +S9 mix) and continuous treatment (24 hours treatment) was less than 5%, respectively.
  • test substance STeP-BoNT/A-LC does not induce chromosomal abnormalities on CHL/IU cells under this test condition (negative).
  • Example 18 Micronucleus test using mammalian bone marrow cells of STeP-BoNT/A-LC
  • the dose setting test was administered to 3 mice per group using female and male mice at doses of 0, 500, 1000, 1500 and 2000 mg/kg ⁇ B.W./day. As a result, no difference in sensitivity due to sex was confirmed, and no dead animals were confirmed. Based on these results, this test was performed using male mice, which are generally reported to have excellent sensitivity.
  • the highest concentration in this test was set to 2000 mg/kg ⁇ B.W./day, which is the highest concentration in the dose setting test.
  • 5 male mice per group were forcibly orally administered twice (24 hour intervals) at concentrations of 0, 500, 1000 and 2000 mg/kg ⁇ B.W./day.
  • the positive control substance (Cyclophosphamide monohydrate, CPA) was administered intraperitoneally at a concentration of 70mg/kg ⁇ B.W./day.
  • test substance STeP-BoNT/A-LC does not induce micronuclei in the bone marrow cells of male ICR mice under the main test conditions (negative).
  • Example 19 Skin irritation test of a mixture of STeP-SNAP8, STeP-Vialox, and STeP-leuphasyl against SKINETHICTM human skin model
  • test substance was applied to the human skin model, washed, and then cultured for 42 hours to transfer the test substance to the human skin model.
  • the reversible damage affected was evaluated as follows.
  • composition of this test consists of a total of 3 groups of negative control, positive control, and test substances (STeP-SNAP8, STeP-Vialox, STeP-leuphasyl mixture) group, and each group is set to three replicate tissues. And it was carried out as a single test.
  • test substance As a result of indirect identification of the test substance, direct staining and no specific reaction with the MTT solution were observed.
  • the cell viability of the test substance (Group 3) was 85.2 ⁇ 4.6%, exceeding the standard cell viability of 50%, and was judged as skin irritant.
  • Example 20 Ocular mucosa irritation test (BCOP) using small cornea of a mixture of STeP-SNAP8, STeP-Vialox, and STeP-leuphasyl]
  • BCOP test was performed to evaluate the presence or absence of eye irritation of the mixtures of STeP-SNAP8, STeP-Vialox, and STeP-leuphasyl.
  • Test substances (STeP-SNAP8, STeP-Vialox, STeP-leuphasyl mixture) were used in a liquid state, and an undiluted solution was used according to the guidelines of the Ministry of Food and Drug Safety. Changes in corneal turbidity and permeability due to the application of the test substance were observed, and the ocular mucosal irritation index (IVIS) was calculated using the turbidity and permeability values.
  • IVIS ocular mucosal irritation index
  • this test is considered to be valid as it falls within the range of'mean of historical data ⁇ 2 standard deviation'.
  • Example 21 Local lymph node test method of mixture of STeP-SNAP8, STeP-Vialox, and STeP-leuphasyl in mouse-Skin sensitization test using BrdU-ELISA]
  • STeP-SNAP8 To evaluate skin sensitization of STeP-SNAP8, STeP-Vialox, and STeP-leuphasyl mixture (test substance) in mice, mortality, general symptoms, weight change, ear thickness of experimental animals through local lymph node test-BrdU-ELISA Changes, skin reactions at the treatment site, and average stimulation index (SI) were evaluated as follows.
  • the group composition of this test is the solvent control group (test material solvent and positive control material solvent) 50% (v/v), 75% (v/v) and 100% concentration of test material group and 25% (v/v) concentration. There were a total of 6 groups of positive control groups, and 5 animals were set for each group.
  • the test substances STeP-SNAP8, STeP-Vialox, and STeP-leuphasyl mixture are considered to be non-inducing substances for skin sensitization.
  • STeP-SNAP8 In order to evaluate whether the test substance STeP-SNAP8, STeP-Vialox, and STeP-leuphasyl induces microbial reversion mutation, four strains of TA98, TA100, TA1535 and TA1537, which are histidine-requiring strains of Salmonella typhimurium , and tryptophan of Escherichia coli The test was performed using the constituent strain WP2uvr A. The test was carried out by pre-incubation in the metabolic activity system not applied (-S9 mix) and applied (+S9 mix).
  • Example 23 Chromosome abnormality test using mammalian cultured cells of a mixture of STeP-SNAP8, STeP-Vialox, and STeP-leuphasyl]
  • STeP-SNAP8 STeP-Vialox, and STeP-leuphasyl mixture (test substance) caused chromosomal abnormalities
  • a chromosomal abnormality test was performed using lung cells (CHL) derived from Chinese hamsters.
  • the concentration determination test is 625 in the short-time treatment method S9 mix not applied (hereinafter referred to as -S9 mix), S9 mix application (hereinafter referred to as +S9 mix) and continuous treatment method 24-hour treatment (hereinafter referred to as 24-hour treatment), respectively. It was carried out by setting 1250, 2500 and 5000 ⁇ g/mL.
  • a short-time treatment method (-S9 mix, +S9 mix) and a continuous treatment method (24-hour treatment) were set to treatment concentrations of 1250, 2500, and 5000 ⁇ g/mL, respectively, and a chromosomal abnormality test was performed.
  • the frequency of occurrence of chromosomal structural abnormalities and water droplet abnormalities in the short-term treatment (-S9 mix, +S9 mix) and continuous treatment (24 hours treatment) was less than 5%, respectively.
  • test substances STeP-SNAP8, STeP-Vialox, and STeP-leuphasyl mixture do not induce chromosomal abnormalities on CHL/IU cells under this test condition (negative).
  • Example 24 Micronucleus test using mammalian bone marrow cells of a mixture of STeP-SNAP8, STeP-Vialox, and STeP-leuphasyl
  • the dose setting test was administered to 3 mice per group using female and male mice at doses of 0, 500, 1000, 1500 and 2000 mg/kg ⁇ B.W./day. As a result, no difference in sensitivity due to sex was confirmed, and no dead animals were confirmed. Based on these results, the main test was performed using male mice, which are generally reported to have excellent sensitivity.
  • the highest concentration in this test was set to 2000 mg/kg ⁇ B.W./day, which is the highest concentration in the dose setting test.
  • 5 male mice per group were forcibly orally administered twice (24 hour intervals) at concentrations of 0, 500, 1000 and 2000 mg/kg ⁇ B.W./day.
  • the positive control substance (Cyclophosphamide monohydrate, CPA) was administered intraperitoneally at a concentration of 70 mg/kg ⁇ B.W./day.
  • test substances STeP-SNAP8, STeP-Vialox, and STeP-leuphasyl mixture do not induce micronuclei in the bone marrow cells of male ICR mice under the conditions of this test (negative).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Epidemiology (AREA)
  • Medicinal Chemistry (AREA)
  • Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Dermatology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Birds (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gerontology & Geriatric Medicine (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Cosmetics (AREA)

Abstract

본 발명은 피부 및 세포 투과 촉진 펩타이드(PTD)가 신경전달물질 방출 조절 펩타이드에 결합된 융합 펩타이드를 함유하는 피부 주름 개선 또는 치료용 조성물에 관한 것으로, 피부 및 세포 투과가 촉진되어, 우수한 피부 주름 방지, 예방 또는 개선, 치료 효능을 발휘한다.

Description

피부 또는 세포 투과능이 우수한 피부 주름 개선 또는 치료용 조성물
본 발명은 피부 및 세포 투과 촉진 펩타이드(PTD)가 신경전달물질 방출 조절 펩타이드에 결합되어 형성된 융합 펩타이드를 함유하는 피부 주름 개선 또는 치료용 조성물에 관한 것으로, 더욱 구체적으로는 상기 펩타이드를 포함하는 피부 주름 방지 또는 개선용 화장품 조성물, 상기 융합 펩타이드를 포함하는 피부 질환 예방 또는 치료용 약제학적 조성물에 관한 것이다.
피부는 전신을 둘러싸며 크게 표피, 진피, 피하지방의 3층 구조로 이루어져 있다. 이 중 최외각에 위치한 표피에는 각질층 (stratum corneum)이 존재함으로써 외부의 여러 자극원으로부터 인체를 보호하는 피부장벽의 역할을 한다. 외부의 스트레스나 해로운 자극으로부터 인체를 효과적으로 보호할 수 있게 되었지만 화장품의 유효성분 또한 쉽게 흡수되지 못하게 되었다.
현재 화장품 업계는 미백, 주름, 항산화, 항노화 등의 기능성 화장품의 신소재 개발과 더불어 실제적으로 피부에 적용 시 경피 흡수율을 높이는 기술이 중요한 과제이다. 피부라는 매우 뛰어난 장벽에 의해 유효성분이 흡수되지 못하기 때문에 아무리 뛰어난 효능을 가진 성분이라고 할지라도 피부에 적용 시 그 효 과를 발휘하지 못하는 것이다.
이러한 요구에 대한 연구의 결과로서 제시된 것으로 PTD (protein transduction domain) 가 있으며, PTD는 펩타이드 단백질 DNA 등의 전달에 유용한 펩타이드로써 5~30개의 아미노산 서열로 이루어져 있다. PTD는 투과시키고자 하는 생물학적 분자와의 융합이 간편하고, 생물학적 분자의 구조 또는 기능에 영향을 끼치지 않아 안정적이기 때문에 화장품, 의약품 등에서 최근 각광받고 있다.
한편 신경전달물질의 방출은, 신경전달물질을 함유하는 신경말단에 위치하는 시냅스 소포(synaptic vesicle)와 시냅스 전막(presynaptic membrane)이 융합된 후 두 경계 간의 통로가 형성됨에 의해 발생된다.
소포 단백질 VAMP(synaptobrevin)와 원형질막 결합단백질인 신택신(Syntaxin) 1a, SNAP-25로 이루어진 3종의 단백질 복합체인 SNARE 단백질이 시냅스 소포와 시냅스 전막의 융합에 근원적인 힘을 제공한다. 여기서 시냅스 소포와 시냅스 전막 간의 막 융합에 의해 신경전달물질 방출 통로가 열리는 것은, 표적 막(target membrane)에 부착되어 있는 신택신 1a 단백질과 SNAP-25 단백질 2종의 복합체인 t-SNARE 및 소포(vesicle)에 부착되어 있는 v-SNARE의 작용에 따른 결과이다.
상기 막 융합 시에는 지질 이중층(lipid bilayer)의 재배열이 일어나게 된다. 생체막들은 서로 강하게 밀어내므로, 이들 막은 자발적으로 융합되지 않고 외부에서 강한 힘이 주어져 막들 간의 반발력을 극복하여야 하는데, 이러한 힘을 제공하는 것이 SNARE 단백질인 것으로 알려졌다. 이와 같이 SNARE 복합체의 형성은 신경전달물질의 방출을 포함하는 세포외 방출작용(exocytosis)의 핵심 현상이다.
최근 들어 비마비성 방식으로 독소의 부작용 없이 근육의 수축을 감소시키는, 보톡스(botox)와 유사한 역할을 갖는 펩타이드에 대한 개발이 이루어지고 있다. 이러한 펩타이드는 근육 세포의 수축을 담당하는 아세틸콜린 등과 같은 신경전달 물질의 분비를 한시적으로 차단하여 주름 발생을 완화시키는 역할을 한다.
그러나, 상기 보톡스와 유사한 역할을 하는 펩타이드의 개발에도 불구하고, 크림 등의 제형으로 피부에 도포 시 그 효과가 미비하여 본래의 효능을 그대로 발휘하지 못하는 문제가 있었다. 경피 흡수 촉진법으로 고분자 수화젤, 고분자 마이셀, 나노에멀젼, 리포좀, 탄성 리포좀, 에토좀 등이 개발이 되었지만 실질적으로 피부각질층이나 세포내 투과성은 아주 낮다.
따라서, 상기와 같은 유용성이 있는 펩타이드를 피부각질층 또는 세포 내로 용이하게 투과시킬 수 있는 새로운 기술의 개발이 요구된다 할 것이다.
본 발명은 신경전달물질 방출 조절 펩타이드를 피부 및 세포 투과 촉진 펩타이드(PTD)에 결합시켜 피부 투과성 또는 세포 투과성을 증진시킴으로써 우수한 항주름 효과를 나타내는 융합 펩타이드를 개발하여 제공하고자 한다.
본 발명은 서열번호 3의 아미노산 서열을 갖는 STeP-BoNT/A-LC 펩타이드, 서열번호 7의 아미노산 서열을 갖는 STeP-Vialox 펩타이드, 서열번호 8의 아미노산 서열을 갖는 STeP-SNAP8 펩타이드, 서열번호 9의 아미노산 서열을 갖는 STeP-Leuphasyl 펩타이드 중 선택되는 어느 하나 이상을 함유하는 것을 특징으로 하는 피부주름 방지 또는 개선용 화장료 조성물을 제공한다.
본 발명은 서열번호 3의 아미노산 서열을 갖는 STeP-BoNT/A-LC 펩타이드, 서열번호 7의 아미노산 서열을 갖는 STeP-Vialox 펩타이드, 서열번호 8의 아미노산 서열을 갖는 STeP-SNAP8 펩타이드, 서열번호 9의 아미노산 서열을 갖는 STeP-Leuphasyl 펩타이드 중 선택되는 어느 하나 이상을 함유하는 것을 특징으로 하는 피부주름 예방 또는 치료용 약학 조성물을 제공한다.
상기 본 발명의 약학 조성물에 있어서, 상기 약학 조성물은, 바람직하게 연고제 또는 주사제 또는 마이크로니들패치일 수 있다.
본 발명의 화장료 조성물 또는 약학 조성물은 피부 및 세포 투과가 촉진되어, 우수한 피부 주름 방지, 예방 또는 개선, 치료 효능을 발휘한다.
도 1은 일반적인 BoNT/A-LC의 발현 벡터 맵이다.
도 2는 재조합 펩타이드 STeP-BoNT/A-LC의 발현 벡터 맵이다.
도 3은 BoNT/A-LC 및 재조합 펩타이드 STeP-BoNT/A-LC의 발현 결과이다.
도 4는 BoNT/A-LC 및 재조합 펩타이드 STeP-BoNT/A-LC의 정제 결과이다.
도 5는 재조합 펩타이드 STeP-BoNT/A-LC, STeP-SNAP8, STeP-Vialox, STeP-leuphasyl의 HPLC를 이용한 순도 분석 결과이다.
도 6은 BoNT/A-LC 및 STeP-BoNT/A-LC의 활성 측정 결과이다.
도 7은 Vialox 및 STeP-Vialox의 활성 측정 결과이다.
도 8은 SNAP8 및 STeP-SNAP8의 활성 측정 결과이다.
도 9는 Leuphasyl 및 STeP-leuphasyl의 활성 측정 결과이다.
도 10은 SNAP25 cleavage assay를 통한 본 발명 Neuropeptide 혼합물의 활성 측정 결과이다.
도 11은 Cell contraction assay를 통한 본 발명 Neuropeptide 혼합물의 활성 측정 결과이다.
도 12는 Acelylcholine release 측정을 통한 본 발명 Neuropeptide 혼합물의 활성 측정 결과이다.
본 발명은 서열번호 3의 아미노산 서열을 갖는 STeP-BoNT/A-LC 펩타이드, 서열번호 7의 아미노산 서열을 갖는 STeP-Vialox 펩타이드, 서열번호 8의 아미노산 서열을 갖는 STeP-SNAP8 펩타이드, 서열번호 9의 아미노산 서열을 갖는 STeP-Leuphasyl 펩타이드 중 선택되는 어느 하나 이상을 함유하는 것을 특징으로 하는 피부주름 방지 또는 개선용 화장료 조성물을 제공한다.
본 발명의 서열번호 3의 아미노산 서열을 갖는 STeP-BoNT/A-LC 펩타이드, 서열번호 7의 아미노산 서열을 갖는 STeP-Vialox 펩타이드, 서열번호 8의 아미노산 서열을 갖는 STeP-SNAP8 펩타이드, 서열번호 9의 아미노산 서열을 갖는 STeP-Leuphasy 펩타이드는, 서열번호 2에 기재된 STeP 펩타이드가 신경전달물질 방출 조절 펩타이드로 알려져 있는 BoNT/A-LC (서열번호 1), Vialox (서열번호 4), SNAP8 (서열번호 5), Leuphasyl (서열번호 6)에 각각 융합되어 있는 것이다.
BoNT/A-LC (서열번호 1), Vialox (서열번호 4), SNAP8 (서열번호 5), Leuphasyl (서열번호 6)는 신경전달물질 방출 조절 펩타이드로서 피부 주름의 개선 또는 치료를 위해 사용되어 오고 있으나, 기대하는 만큼의 효과를 발휘하지 못하고 있는 실정이다.
이에 본 발명에서는 이들 신경전달물질 방출 조절 펩타이드의 피부 또는 세포 투과성을 높여, 우수한 피부 주름 개선 또는 치료능을 발휘할 수 있도록 예의 노력하였고, 그 결과 서열번호 2에 기재된 STeP 펩타이드를 BoNT/A-LC (서열번호 1), Vialox (서열번호 4), SNAP8 (서열번호 5), Leuphasyl (서열번호 6)에 융합시킴으로써, 기존에 PTD로 알려진 pep 펩타이드나 tat 펩타이드를 융합시키는 것보다 우수한 피부 주름 개선 또는 치료능이 발휘됨을 확인할 수 있었다.
본 발명의 화장료 조성물은 특정의 형태(제형)에 국한되지 않고, 모든 제형을 다 포함하는데, 일 예로 화장수, 젤, 수용성 리퀴드, 크림, 에센스, 수중유(O/W)형 및 유중수(W/O)형의 에멀젼, 연고로 이루어진 기초화장료 제형, 수중유형 및 유중수형 메이크업베이스, 파운데이션, 스킨커버, 립스틱, 립그로스, 페이스파우더, 투웨이케익, 아이새도, 치크칼라 및 아이브로우 펜슬류로 이루어진 색조화장료 제형 중에서 선택되는 어느 하나인 것이 좋다.
또한, 본 발명의 화장료 조성물은 화장 분야에서 통상적인 보조제 예컨대 친수성 또는 친유성 겔화제, 친수성 또는 친유성 활성제, 보존제, 항산화제, 용매, 방향제, 충전제, 차단제, 안료, 흡취제 및 염료를 함유할 수도 있다.
한편, 본 발명은 서열번호 3의 아미노산 서열을 갖는 STeP-BoNT/A-LC 펩타이드, 서열번호 7의 아미노산 서열을 갖는 STeP-Vialox 펩타이드, 서열번호 8의 아미노산 서열을 갖는 STeP-SNAP8 펩타이드, 서열번호 9의 아미노산 서열을 갖는 STeP-Leuphasyl 펩타이드 중 선택되는 어느 하나 이상을 함유하는 것을 특징으로 하는 피부주름 예방 또는 치료용 약학 조성물을 제공한다.
본 발명의 약학 조성물은 특정의 제형으로 반드시 한정되는 것이 아닌 모든 제형을 포함하며, 구체적인 제형의 예로는 경고제(PLASTERS), 과립제(GRANULES), 로션제(LOTIONS), 리니멘트제(LINIMENTS), 리모나데제(LEMONADES), 방향수제(AROMATIC WATERS), 산제(POWDERS), 시럽제(SYRUPS), 안연고제(OPHTHALMIC OINTMENTS), 액제(LIQUIDS AND SOLUTIONS), 에어로솔제(AEROSOLS), 엑스제(EXTRACTS), 엘릭실제(ELIXIRS), 연고제(OINTMENTS), 유동엑스제(FLUIDEXTRACTS), 유제(EMULSIONS), 현탁제(SUSPENSIONS), 전제(DECOCTIONS), 침제(INFUSIONS), 정제(TABLETS), 좌제(SUPPOSITORIES), 주사제(INJECTIONS), 주정제(SPIRITS), 카타플라스마제(CATAPLSMA), 캅셀제(CAPSULES), 크림제(CREAMS), 트로키제(TROCHES), 틴크제(TINCTURES), 파스타제(PASTES), 환제(PILLS), 연질 또는 경질 젤라틴 캅셀 중 선택되는 어느 하나일 수 있다. 바람직하게는 연고제 또는 주사제 또는 마이크로니들패치일 수 있다.
또한, 본 발명의 약학 조성물은 바람직하게 약제학적으로 허용 가능한 담체, 희석제 또는 부형제를 더욱 포함할 수 있다. 사용가능한 담체, 부형제 또는 희석제로는, 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자이리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유가 있으며, 이중 선택되는 하나 이상을 사용할 수 있다.
한편, 본 발명의 조성물은 약학 조성물 형태로 제공되는데, 본 발명의 약학 조성물에 포함되는 본 발명 유효성분 펩타이드의 함량은, 사용방법, 복용자의 상태에 따라 바람직하게 조절하는 것이 좋다. 바람직하게는 약학 조성물에 건조 중량 기준으로 0.000001~50중량% 첨가될 수 있으나, 반드시 이에 한정되는 것은 아니다. 그러나 그 함량이 0.000001중량% 미만일 경우 약리 효과가 미미할 수 있으며, 50중량%를 초과하는 경우에는 사용량 대비 약리 효과 상승률이 낮아 비경제적일 수 있다. 다만, 본 발명 약학조성물의 투여량은 투여방법, 복용자의 연령, 성별 및 체중 등을 고려하여 결정하는 것이 좋다. 일 예로, 본 발명의 조성물은 1일 0.000001 내지 1g/kg (체중)으로 1회 이상 투여 가능하다. 그러나, 상기의 투여량은 예시하기 위한 일 예에 불과하며, 복용자의 상태에 의해 변화될 수 있다.
한편, 하기에서 사용하는 용어, '펩타이드' 및 '단백질'은 서로 동일한 의미로 정의하며, 필요에 의해 혼용해서 사용하기로 한다.
[실시예 1: 일반적인 BoNT/A-LC 발현 벡터 제조]
본 발명에서 개발하고자 하는 '경피 및 세포 투과성 STeP-BoNT/A-LC(STeP이 융합된 것)'과의 효능 및 효과 비교를 목적으로, 경피 및 세포 비투과성인 일반적 BoNT/A-LC(Botulinum neurotoxin type A light chain)를 단백질 발현 벡터에 클로닝하였다.
일반적인 BoNT/A-LC 펩타이드(아미노산 서열갯수 425, 서열번호 1)의 발현을 위한 발현벡터는, BoNT/A-LC의 cDNA 서열에 기초하여, 단백질 발현 벡터인 pET15b 벡터에 결합시킴으로써 제작될 수 있었다. 합성된 BoNT/A-LC 유전자에는 벡터 삽입을 위해 XhoⅠ과 BamHI 제한효소 절단부위가 추가되었다. 이 제한효소 절단 부위를 이용하여 발현 벡터인 pET15b 벡터에 연결하고, E.coli DH5 alpha 세포에 형질 전환시켰으며 형질 전환된 박테리아로부터 결합된 벡터를 정제하여 얻었다.
일반적인 BoNT/A 단백질을 생산하기 위하여 위에서 형질 전환된 정제 플라스미드 벡터를 E.Coli Rosetta-gami™ 2 (DE3)세포 내로 형질전환시킴으로써 발현 균주를 얻었다. 도 1은 일반적인 BoNT/A-LC 발현 벡터의 맵이다.
[실시예 2: 본 발명의 재조합 펩타이드 'STeP-BoNT/A-LC' 발현 벡터 제조]
서열번호 3에 기재된 본 발명의 경피 및 세포 투과성 STep-BoNT/A-LC을 제작하기 위하여, 하기와 같은 과정을 수행하였다.
BoNT/A-LC(서열번호 1)과 STeP(서열번호 2)가 결합된 융합 펩타이드 발현을 위한 단백질 발현벡터는, BoNT/A-LC의 cDNA 서열에 기초하여 두 개의 개시체를 융합 합성함으로써 제작할 수 있었다. 합성된 STeP-BoNT/A-LC 유전자에는 벡터 삽입을 위해 NdeⅠ과 BamHI 제한효소 절단부위가 추가되었다. 이 제한효소 절단 부위를 이용하여 발현 벡터인 pET15b 벡터에 연결하고, E.coli DH5 alpha 세포에 형질전환시켰으며 형질전환된 박테리아로부터 결합된 벡터를 정제하여 얻었다.
STeP-BoNT/A 펩타이드를 생산하기 위하여 위에서 형질전환된 정제 플라스미드 벡터를 E.Coli Rosetta-gami™ 2 (DE3) 세포 내로 형질전환시킴으로써 발현 균주를 얻었다. 도 2는 재조합 펩타이드 STeP-BoNT/A-LC의 발현 벡터 맵이다.
한편, 표 1은 상기 실시예 1 및 실시예 2에서 사용 및 융합한 펩타이드의 아미노산 서열 정보이다.
펩타이드 명칭 아미노산 서열 서열번호
BoNT/A-LC PFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNL VIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEFY 서열번호 1
STep KETWWETWWTEWSQPVGRKKRRQRRR 서열번호 2
STeP-BoNT/A-LC KETWWETWWTEWSQPYGRKKRRQRRRPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEFY 서열번호 3
[실시예 3: 'BoNT/A-LC'와 재조합 펩타이드 'STeP-BONT/A-LC'의 발현]
상기 실시예 1 및 실시예 2에서 각각 제작한 형질전환 E.Coli Rosetta-gami™ 2 (DE3) 세포를 엠피실린이 포함된 1,000ml의 LB배지를 이용하여 OD600 값이 0.6이 될 때까지 37℃에서 배양하였고, 0.5mM IPTG를 도입하여 8시간 동안 37℃에서 추가 배양하여 BoNT/A-LC 및 STeP-BONT/A-LC 펩타이드의 발현을 각각 유도하였다.
각각의 펩타이드 발현 유무 확인은 IPTG의 첨가에 의한 목적 펩타이드의 유도 발현 전과 후의 배양 세포들을 수확하여 SDS-PAGE 전기 영동을 한뒤, 쿠마시 브릴리언트 블루 (Coomassie brilliant blue)로 펩타이드를 염색하여 관찰하였다.
그 결과, 도 3에서 확인되는 바와 같이, BoNT/A-LC는 50.8 kDa, STeP- BoNT/A-LC 는 54.7kDa의 크기를 가지는 펩타이드가 각각 발현됨을 확인할 수 있었다. 도 3은 BoNT/A-LC 및 재조합 펩타이드 STeP- BoNT/A-LC의 발현 결과이다.
[실시예 4: BoNT/A-LC와 재조합 펩타이드 STeP-BONT/A-LC의 정제]
상기 실시예 3에서 수득한 BoNT/A-LC, STeP-BoNT/A-LC 형질전환 세포를 1X Native 완충액(50mM NaPO4, 0.5M NaCl)에서 초음파기를 이용하여 파괴한 후, 이것을 원심분리하여 응집체(inclusion body)와 세포질(상청액)로 분리하였다. 다음으로 목적 펩타이드(단백질)의 His6 tagging 특성을 이용하여 Ni2+-NTA 친화 컬럼 (Nitrilotriacetic acid Sepharose affinity column, GE Healthcare, USA)으로 순수 목적 펩타이드(BoNT/A-LC 및 STeP BoNT/A-LC)만을 정제하였으며, 안정화 버퍼(50mM NaPO4, 0.4M NaCl, 2mM EDTA, 10% Glycerol, pH 7.5)를 이용하여 투석을 실시하였다. 도 4는 BoNT/A-LC 및 재조합 펩타이드 STeP-BoNT/A-LC의 정제 결과이다.
[실시예 5: 세포 및 피부 투과성 STeP-Neuropeptide (STeP-leuphasyl, STeP-Vialox, STeP-SNAP8) 합성 및 정제]
펩타이드는 고체상 펩타이드 합성법 (SPPS, Solid Phase Peptide Synthesis)으로 합성되었으며, 다음과 같았다.
먼저 SPPS(solid phase peptide synthesis)는 반복인 'Deprotection-washing-coupling-wash' 단계로 이루어진다. 펩타이드 합성은 알파 아미노 그룹 (Alpha amino group)을 보호하기 위하여 Fmoc 와 t-Boc를 기반으로 이루어지며, 이 보호기는 디프로텍션 물질 (deprotection agent)인 piperidine for fmoc, TFA for t-Boc에 의해 알파 아미노 그룹에서 떨어지고, 합성 서열에 따른 다음 서열의 아미노산과 커플링 과정이 이루어지고 다양한 시약에 의해 반복적으로 펩타이드 결합이 진행된다. 이렇게 서열에 따른 합성이 완료되면 합성 레진으로부터 분리되고 디프로텍션(deprotection) 된다.
이렇게 얻어진 조 펩타이드 (crude peteide)는 합성이 정확히 이루어졌는지 확인하기 위해 Mass를 찍고, 원하는 펩타이드가 확인되면 HPLC 정제 과정이 진행된다. 먼저 HPLC 정제를 위해 조 펩타이드 (Crude peptide)를 증류수에 녹이고 정지상 (Stationary phase)으로 물을, 이동상 (mobile phase)로 아세토니트릴(Acetonitrile)을 이용하며, 다음으로 그래디언트(gradient)를 다르게 적용하여 (통상 20~40) 원하는 순도의 펩타이드를 분리정제하고 냉동 건조 과정을 거쳐 전과정의 펩타이드 합성이 완료된다. 이렇게 합성한 펩타이드의 아미노산 서열은 하기 표 2와 같았다.
합성 펩타이드 명칭 아미노산 서열 서열번호
Vialox GPRPA 서열번호 4
SNAP8 EEMQRRAD 서열번호 5
Leuphasyl YAGFL 서열번호 6
STeP-Vialox KETWWETWWTEWSQPYGRKKRRQRRRGGGGPRPA 서열번호 7
STeP-SNAP8 EEMQRRADKETWWETWWTEWSQPYGRKKRRQRRR 서열번호 8
STeP-Leuphasyl KETWWETWWTEWSQPYGRKKRRQRRRGGGYAGFL 서열번호 9
주) STeP-SNAP8만 STeP을 SNAP8 C-말단에 붙였는데, 그 이유는 합성시 앞에 붙은 것보다 뒤에 붙어 있는것이 좀더 안정적이기 때문임.
[실시예 6: 재조합 펩타이드(단백질)의 순도 분석]
본 실험에서는 상기 실시예 4에서 수득한 재조합 펩타이드 STeP-BoNT/A-LC 및 상기 실시예 5에서 수득한 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl에 대한 순도를 분석하고자 액체크로마토그래피(HPLC)를 실시하였다.
순도를 알고자 하는 샘플, 이동상에 해당하는 용매로는, 극성용매로 물과 아세토나이트릴(ACN), 컬럼으로는 역상 친수성 컬럼인 C18을 사용하였다. 용매는 물과 아세토나이트릴(ACN)에 산안정성을 위해 트리플루오르아세트산(Trifluoroacetic acid)을 각 0.1% 씩 첨가하여 준비하고 기포 제거 후 사용하고, 샘플은 필터 후 바이알에 각각 주입하여 준비하였다. 기기는 분리과정 전에 안정화를 시켜주기 위해 100% 아세토나이트릴로 펌프를 2~3회 세척(washing)하고 C18 컬럼을 장착시킨 후, 압력과 온도가 안정화 될때까지 아세토나이트릴을 흘려주었다. 압력이 안정화되면 프로그램을 설정하고 UV/VIS 디텍터(detector)에서 검출하기 위한 파장(280 nm)을 결정하여 시간대별 반응의 크기를 측정함으로 단백질의 순도를 파악하였다.
실험결과, STeP-BoNT/A-LC (95.09%), STeP-SNAP8(95.17%), STeP-Vialox(97.84%), STeP-leuphasyl(99.44%)의 고순도를 가짐을 확인할 수 있었다 (도 5). 이는 현재 화장품 원료 시장에 유통되는 동일한 성장인자 원료들의 순도보다 동등하거나 높은 순도라고 판단되었다. 도 5는 재조합 펩타이드(단백질) STeP-BoNT/A-LC, STeP-SNAP8, STeP-Vialox, STeP-leuphasyl의 HPLC를 이용한 순도 분석 결과이다.
[실시예 7: 상기 실시예 6에서 분석한 재조합 펩타이드에 대한 내독성 측정]
본 실험에서는 상기 실시예 6에서 분석한 4종의 재조합 펩타이드에 대한 내독성을 측정하기 위하여 생물학적내독소시험(Limulus Amebocyte Lysate (Lonza, Swiss))를 수행하였다.
측정 방법은 제품 사용 설명서에 기재된 프로토콜을 이용하였다. 한편, 연구용으로 판매되는 제품들의 평균 내독성 레벨(Endotoxin level)은 1 EU/μg(1,000EU/mg)이다 (회사명 : Sigma, Genscript, Cell signaling).
실험결과, 모두 1 μg 당 1EU 이하의 내독성이 측정됨을 확인할 수 있었다 (표 3).
원료명 농도(mg/ml) 시험결과 : ml 기준 (EU/ml) 시험결과 : ug 기준 (EU/μg) 비고
STeP-BoNT/A-LC 3.0 41.9 0.014
STeP-Vialox 5.0 27.1 0.005
STeP-SNAP8 5.0 86.2 0.014
STeP-leuphasyl 5.0 < 61.2 < 0.012
평균 54.1 0.011
상기와 같은 결과로부터, 4종의 재조합 펩타이드는 피부 독성 가능성이 적어 화장품 원료에 사용하기 적합할 것으로 판단되었다.
[실시예 8: BoNT/A-LC 및 재조합 펩타이드 STeP-BoNT/A-LC의 활성 측정]
BoNT/A-LC는 proteolysis 과정 (SNAP25 단백질 절단)을 통해 아세틸콜린 및 신경전달물질 분비 기능을 억제한다. 신경전달물질이 분비되지 않게 된 경우 신경신호는 더 이상 근육에 전달되지 못하여 근육의 이완마비를 유도하게 된다. 이러한 메카니즘을 바탕으로 BoNT/A-LC 및 STeP-BoNT/A-LC 활성을 SNAP25 cleavage 정도를 통해 확인하였다.
면역형광법을 이용하여 측정하였으며, 형광이 결합된 SNAP25(SNAPtide, List Biological Laboratories, Inc., Catalog # 521 )를 기질로 사용하여 BoNT와 반응시킨 후 형광을 측정하였다. BoNT가 존재하면 SNAPtide가 절단되어 quencher가 붙어 있는 펩타이드가 떨어져 나가고 형광이 결합된 펩타이드가 방출되어 BoNT의 활성을 측정할 수 있다. 자세한 방법은 다음과 같다. 시료를 10 μg/ml 로 Assay buffer (50 mM HEPES, 0.05% (v/v) Tween-20, pH7.5) 에 희석하고 SNAPtide는 10 μM 로 Assay buffer에 희석하였다. 시료 50 μl 와 SPAPtide 50 μl를 믹스한 뒤 곧바로 37℃, 490 nm / 523 nm (excitation/emission wavelengths)에서 kinetic mode (1분 간격 5분 동안)로 형광값을 측정하였다. 아래의 식에 대입하여 활성 정도를 계산하였으며, SNAP25의 표준 곡선 (Standard curve)을 이용해 전환 요소 (conversion factor)를 구하였다. 연구용으로 판매되는 BoNT/A-LC의 평균 activity level >1 pmol/min/μg [회사명 : R&D systems, Cat No. 4489-ZN] 이므로, 활성값이 >1 pmol/min/μg 이상이면 품질관리 기준 이상의 활성으로 판단할 수 있다.
[수학식 1]
Figure PCTKR2019005128-appb-I000001
실험 결과, BoNT/A-LC 및 STeP-BoNT/A-LC의 specific activity는 각 5.60 ± 0.53 pmol/min/μg, 19.58 ± 1.07 pmol/min/μg이었으며, STeP-BoNT/A-LC의 활성이 BoNT/A-LC 에 비해 유의적으로 높았다 (도 6). 도 6은 BoNT/A-LC 및 STeP-BoNT/A-LC 의 활성 측정 결과이다.
[실시예 9: Vialox 및 재조합 펩타이드 STeP-Vialox의 활성 측정]
Vialox의 활성화 작용에 따른 방식은 남미산 맹독 개구리와 유사한 것으로, 아세틸콜린 수용체에서 정보 전달을 경쟁적으로 차단하여 신경조직의 수축 정도를 저해함으로써 근육의 긴장감을 완화시키고 표정에 의해 생성되는 주름을 예방가능 하다고 알려져 있다. 이러한 메커니즘을 바탕으로 L6 세포를 가지고 Cell contraction assay (Cell BIOLABS,INC., CBA-5020) 방법을 이용하여 활성을 측정하였다.
측정 방법은 제품 사용 설명서에 기재된 프로토콜을 이용하였다. 실험결과, 아세틸콜린 10mM을 처치하여 세포의 수축을 유도한 양성대조군에 비해 STeP-vialox 처치군에서 세포의 수축을 유의적으로 억제함을 확인할 수 있었다. 그러나, Vialox 처치군에서는 세포의 수축을 억제하지 못했다 (도 7). 도 7은 Vialox 및 STeP-Vialox의 활성 측정 결과이다.
[실시예 10: SNAP8 및 재조합 펩타이드 STeP-SNAP8의 활성 측정]
SNAP8은 아르기렐린(Argireline)의 최신 버전이며, 아르기렐린(argireline)은 헥사펩타이드(hexapeptide) 이고, SNAP8은 옥타펩타이드(octapeptide)이다. SNARE 콤플렉스 위치에서 단백질과 경쟁하는 SNAP-25의 N-Terminal end를 모방한 최초의 헥사펩타이드 물질이다. 보톡스와 다른 점은 SNAP25 단백질을 절단하는 것이 아니라 경쟁하여 아세틸콜린 및 신경전달물질 분비 기능을 억제하는 것이다. 신경전달물질이 분비되지 않게 된 경우 신경신호는 더 이상 근육에 전달되지 못하여 근육의 이완마비를 유도하게 된다. 보톡스의 효능을 대체하며 보다 안전하게 사용할 수 있는 대안으로 알려져 있다.
실험방법은 다음과 같았다. Rat의 adrenal grand 유래의 PC12 세포를 배양접시의 70~80% 컨플루언시에 이를 때까지 RPMI 미디어에서 배양한다. 이후 신경생장인자 NGF (2.5S 50 ng/mL, sigma-aldrich)를 처리하여 5일 동안 배양한다. NGF가 처리된 PC12 세포에 high-K+ solution (115 mM NaCl, 50 mM KCl, 1.2 mM KH2PO4, 2.5 mM CaCl2, 11 mM glucose, and 15 mM HEPES-Tris, pH 7.4)을 500 μl 처리해 37℃, 5% CO2 인큐베이터에서 15분간 배양한다. 이후 펩타이드 및 대조 시약을 지시 농도로 함유한 RPMI 미디어 500 μl로 교체한다. 37℃, 5% CO2 인큐베이터에서 2시간 배양한 후, 신경전달물질 방출을 유도하기 전에 샘플을 취하여 배지 중으로 분비되어 있는 신경전달물질의 정량을 위해 보관한다. RPMI 미디어로 1분 동안 세척한다. 완전히 씻어낸 후, high-K+ solution 500 μl을 15분간 처리하여 신경전달물질을 분비되도록 한다. 샘플을 취하여 배지 중으로 분비된 신경전달물질의 정량을 위해 보관한다 (H2). 분비된 신경전달물질을 함유한 완충액은 아세틸콜린(acetylcholine) 어세이 키트를 이용하여 정량한다. 아세틸콜린 어세이 키트는 아세틸콜린 농도에 따른 스탠다드 용액과 준비된 샘플 50 μl를 각 well에 옮긴 후, 아세틸콜린 반응 용액을 각각 50 μl씩 넣어주고 잘 섞일 수 있도록 45분간 쉐이킹을 해준다. 그 후, Excitation을 530 nm, emission을 600 nm에서 측정한다. 아세틸콜린 농도에 따른 RFU 값의 스탠다드 커브를 통해 값을 측정한다. 이후, '% Release = (H2,sample)/(H2,control)*100'와 같이 계산한다.
실험결과, SNAP8과 STeP-SNAP8에서 신경전달물질 방출 저해 효과를 보였으나, 같은 농도를 비교했을 경우 STeP-SNAP8에서 더 높은 저해 효과를 보였으며, 40 μM에서 50% 이상의 저해도를 보였다 (도 8). 도 8은 SNAP8 및 STeP-SNAP8의 활성 측정 결과이다.
[실시예 11: Leuphasyl 및 재조합 펩타이드 STeP-Leuphasyl의 활성 측정]
leuphasyl은 주름감소를 위해 개발된 원료이며, enkephalin receptor과 결합하여 칼슘채널을 닫는다. 그리하여 아세틸콜린의 분비를 억제하고 이로 인해 근육 수축을 방해하게 되고 주름생성을 감소시킨다. 실험방법은 상기 STeP-SNAP8의 방법과 같다.
실험결과, leuphasyl 및 STeP-leuphasyl에서 신경전달물질 방출 저해 효과를 보였으나, 같은 농도를 비교했을 경우 STeP-Leuphasyl 에서 더 높은 저해 효과를 보였으며, 1 μM에서 약 20%의 저해도를 보였으며, 20 μM에서 50% 이상의 저해도를 보였다 (도 9). 도 9는 Leuphasyl 및 STeP-leuphasyl의 활성 측정 결과이다.
[실시예 12: 재조합 펩타이드 STeP-Neuropeptide 4종 혼합 후 활성 측정]
상기 4종의 재조합 펩타이드 STeP-neuropeptide 혼합시 단일 펩타이드에 비해 효과가 더 증가하는지 확인해 보았다. 먼저 4종의 Neuropeptide를 각 10 μg/ml 씩 혼합 후 SNAP25 cleavage assay의 활성이 증가하는지 시험해 보았다.
실험결과, STeP-BoNT/A-LC 단독 원료일 때에 비해 STeP-neuropeptide 혼합물에서 활성이 현저하게 높게 나온 것을 확인할 수 있었으며, Wild-neuropeptide 혼합물과 비교하여 3.5배 정도 활성이 높았다 (도 10). 도 10은 SNAP25 cleavage assay를 통한 Neuropeptide 혼합물의 활성 측정 결과이다.
Cell contraction assay를 통해서도 Wild-neuropeptide 혼합물에 비해 STeP-neuropeptide 혼합물에서 세포 수축 억제능이 더 높음을 확인할 수 있었다 (도 11). 도 11은 Cell contraction assay를 통한 Neuropeptide 혼합물의 활성 측정 결과이다.
아세틸콜린 분출 측정 실험을 통해서도 STeP-neuropeptide 혼합물에서 유의적으로 50% 정도 아세틸콜린의 방출을 억제하는 효과를 확인하였다 (도 12). 도 12는 Acelylcholine release 측정을 통한 Neuropeptide 혼합물의 활성 측정 결과이다.
[실시예 13: SKINETHICTM 인체피부모델에 대한 STeP-BoNT/A-LC의 피부자극시험]
SKINETHICTM 인체피부모델에 대한 STeP-BoNT/A-LC의 피부자극성을 평가하기 위하여, 시험물질(STeP-BoNT/A-LC)을 인체피부모델에 적용 및 세척한 후 42시간 동안 배양하여 시험물질이 인체피부모델에 미치는 가역적 손상을 아래와 같이 평가하였다.
본 시험의 구성은 음성대조군, 양성대조군 및 시험물질군 총 3군으로 각 군은 3개(tissue)의 반복시료(three replicate tissue)로 설정하였으며, 단회 시험으로 진행하였다.
시험물질의 간접 확인 결과, 직적적인 염색 및 MTT 용액과의 특이적인 반응이 관찰되지 않았다. 시험물질(Group 3)의 세포생존율은 86.3±2.9%으로 세포 생존율 기준치 50%를 초과하여 산출되어 피부 비자극성으로 판정되었다.
이상의 결과로부터, SKINETHICTM 인체피부모델에 대한 피부자극성시험에서 STeP-BoNT/A-LC은 Globally Harmonized System of Classification and Labelling of Chemicals (GHS) 에 따른 분류에서‘범주 외’에 해당하는 피부 비자극성 물질로 판정되었다.
[실시예 14: Mouse에 대한 STeP-BoNT/A-LC의 국소림프절시험법-BrdU-ELISA을 이용한 피부감작성시험]
Mouse에 대한 STeP-BoNT/A-LC의 피부감작성을 평가하기 위하여 국소림프절시험법-BrdU-ELISA을 통하여 실험동물의 사망률, 일반증상, 체중변화, 귀 두께 변화, 처리부위 피부반응 및 평균자극지수(Stimulation index, S.I.)를 아래와 같이 평가하였다.
본 시험의 군 구성은 용매대조군(시험물질 용매 및 양성대조물질 용매), 10%(v/v), 25%(v/v) 및 50%(v/v) 농도의 시험물질군과 25%(v/v) 농도의 양성대조군의 총 6군으로 각 군당 5마리 씩 설정하였다.
실험기간 중 모든 처리군에서 사망동물 및 이상증상은 관찰되지 않았다. 체중측정 결과, 모든 처리군에서 용매대조군과 비교하여 유의적인 체중변화가 관찰되지 않았다. 귀 두께를 측정한 결과, 모든 처리군에서 용매대조군과 비교하여 유의적인 변화는 관찰되지않았다. 시험물질 처리부위를 관찰한 결과, 모든 처리군에서 시험물질 영향으로 인한 국부적 피부자극이 관찰되지 않았다. 자극지수(Stimulation index, S.I.)를 산출한 결과, 10%(v/v), 25%(v/v) 및 50%(v/v) (Group 3, Group 4, Group 5)의 경우 1.2, 1.4 및 1.5 로 산출되었다. 양성대조군 (Group 6)의 경우, 2.4 로 산출되었다.
이상의 결과로부터 mouse에 대한 피부감작성시험에서 시험물질인 STeP-BoNT/A-LC은 50%(v/v) 이하의 농도에서 비감작 물질로 사료된다.
[실시예 15: STeP-BoNT/A-LC의 소각막을 이용한 안점막자극시험 (BCOP)]
STeP-BoNT/A-LC의 안점막자극유무 평가를 위해 BCOP 시험을 실시하였다. 시험물질은 식품의약품안전처 및 OECD 가이드라인에 따라 별도의 희석없이 사용하였다. 시험물질 적용에 의한 각막의 혼탁도 변화, 투과도 변화에 대해 관찰하였으며, 혼탁도와 투과도 값을 이용하여 안점막자극지수를 산출하였다.
실험기간 중 STeP-BoNT/A-LC의 적용에 의한 각막의 혼탁도 및 투과도 증가는 관찰되지 않았다. STeP-BoNT/A-LC의 경우 안점막자극지수가 평균 -0.2±0.9로 산출되어 ‘UN GHS Category : 미분류 (No Category)’에 해당함을 확인할 수 있었다. 또한, 음성대조물질인 water는 -1.0±0.4로 'UN GHS Category : 미분류 (No Category)’를 확인하였으며, 양성대조물질인 ethyl alcohol, Pure의 경우 30.7±0.8 로 산출되어 'UN GHS Category : 예측할 수 없음' 임을 확인할 수 있었다.
시험의 유효성을 판단하기 위해 양성대조물질의 IVIS값을 평가한 결과, 'mean of historical data ± 2 standard deviation' 범위에 해당하여 본 시험은 유효하다고 사료된다.
이상의 결과로부터 BCOP시험법을 이용한 STeP-BoNT/A-LC의 안점막자극을 평가시, 'UN GHS Category : 미분류 (No Category)' 에 해당되는 물질로 사료된다.
[실시예 16: STeP-BoNT/A-LC에 대한 박테리아를 이용하는 복귀돌연변이시험]
시험물질 STeP-BoNT/A-LC에 대한 미생물 복귀돌연변이 유발여부를 평가하기 위하여 Salmonella typhimurium의 histidine 요구성 균주인 TA98, TA100, TA1535 및 TA1537의 4개의 균주와 Escherichia coli의 tryptophan 요구성 균주인 WP2uvr A를 이용하여 시험을 실시하였다. 시험은 대사활성계 미적용(-S9 mix) 및 적용 (+S9 mix)에서 pre-incubation법으로 실시하였다.
농도결정시험을 50, 150, 500, 1500 및 5000 μg/plate로 실시한 결과, 대사활성계 미적용 (-S9 mix) 및 대사활성계 적용 (+S9 mix)에서 시험물질에 대한 균주의 생육저해는 확인되지 않았다. 시험물질의 석출은 대사활성계 적용 유무에 관계없이 모든 농도에서 확인되지 않았다.
이상의 결과를 토대로 본시험은 아래의 농도에서 실시하였다. 대사활성계 미적용 (-S9 mix) 및 적용 (+S9 mix): 313, 625, 1250, 2500, 5000 μg/plate (TA98, TA100, TA1535, TA1537, WP2uvr A) 본 시험의 결과, 대사활성계 미적용 (-S9 mix) 및 대사활성계 적용 (+S9 mix)에서 시험물질에 의한 균주의 생육저해는 확인되지 않았다. 시험물질의 석출은 대사활성계 적용 유무에 관계없이 모든 농도에서 확인되지 않았다. 시험물질 처리군에서 복귀돌연변이 콜로니 수는 음성대조군과 비교하였을 때 증가 양상을 나타내지 않았다.
본시험의 음성대조값 및 양성대조값은 시험시설의 적정 범위 내였다. 또한 양성 대조 물질에서 유발된복귀돌연변이 콜로니 수는 대사활성계 미적용 (-S9 mix) 및 적용 (+S9 mix)의 모든 시험 균주에 대하여 음성대조값의 2배를 넘어 증가하였고 분명한 양성 결과를 보였다.
이상의 결과로부터 시험물질 STeP-BoNT/A-LC은 본 시험조건에서 변이원성을 보유하지 않은 것으로 판단하였다 (음성).
[실시예 17: STeP-BoNT/A-LC의 포유류 배양세포를 이용하는 염색체이상시험]
STeP-BoNT/A-LC의 염색체 이상 유발여부를 평가하기 위하여 Chinese hamster 유래의 lung cell (CHL)을 이용하여 염색체이상시험을 실시하였다.
농도결정시험은 단시간처리법 S9 mix 미적용 (이하, -S9 mix으로 칭함), S9 mix 적용 (이하, +S9 mix으로 칭함) 및 연속처리법 24 시간처리 (이하, 24 시간처리로 칭함)에서 각각 625, 1250, 2500 및 5000 μg/mL를 설정하여 실시하였다.
농도결정시험 결과, 시험물질 STeP-BoNT/A-LC에 의한 세포독성은 확인되지 않았으며, pH의 변화도 확인되지 않았다. 최고농도인 5000 μg/mL에서 상대세포수 증가(RICC, Relative increase in cell counts) 값은 -S9 mix에서 117.92%, +S9 mix에서 97.19%, 24 시간처리에서는 108.17 μg/mL로 확인되었다. 따라서 본시험의 최고농도는 5000 μg/mL로 설정하였다.
농도결정시험 결과를 기초로 하여, 단시간 처리법 (-S9 mix, +S9 mix)과 연속처리법 (24 시간처리)을 처리농도 1250, 2500 및 5000 μg/mL로 각각 설정하여 염색체이상시험을 실시했다. 표본관찰의 결과, 단시간 처리법 (-S9 mix, +S9 mix)과 연속처리법 (24 시간처리)의 염색체구조이상세포 및 수적이상세포의 출현빈도는 각각 5 % 미만이었다.
따라서, 시험물질 STeP-BoNT/A-LC은 본 시험 조건 하에서 CHL/IU 세포에 대한 염색체이상을 유발하지 않는 것으로 사료된다 (음성).
[실시예 18: STeP-BoNT/A-LC의 포유류 골수세포를 이용하는 소핵시험]
마우스[ICR, 투여 시 7주령]를 이용하여 포유류 골수세포에 대한 STeP-BoNT/A-LC의 소핵 유발성의 유무를 평가하였다.
용량설정시험은 암컷 및 수컷 마우스를 이용하여 각 군당 3 마리의 마우스에 0, 500, 1000, 1500 및 2000 mg/kg·B.W./day의 용량으로 투여하였다. 그 결과, 성별로 인한 감수성의 차이는 확인되지 않았으며 사망동물도 확인되지 않았다. 이러한 결과를 토대로 하여 일반적으로 감수성이 뛰어나다고 보고된 수컷 마우스를 사용하여 본 시험을 수행하였다.
본 시험의 최고농도는 용량설정시험의 최고농도인 2000 mg/kg·B.W./day 로 설정하였다. 본시험은 각 군당 5마리의 수컷 마우스에 0, 500, 1000 및 2000 mg/kg·B.W./day의 농도로 2회 (24시간 간격) 강제 경구 투여하였다. 양성대조물질 (Cyclophosphamide monohydrate, CPA)은 70mg/kg·B.W./day의 농도로 단회 복강투여하였다.
시험물질 투여 결과, 사망동물은 확인되지 않았으므로, 음성 대조군, 시험물질투여군의 500, 1000, 2000mg/kg·B.W./day 군 및 양성 대조군의 동물에 대하여 소핵을 가지는 다염성적혈구 (Micronucleated polychromatic erythrocyte, MNPCE)의 출현 빈도를 계수하였다.
시험결과, 시험물질 투여군에서 음성 대조군과 비교하여 소핵을 가진 다염성 적혈구의 증가는 볼 수 없었으며 통계학적인 유의성도 나타나지 않았다. 음성 대조군의 MNPCE출현 빈도 및 PCE의 비율 평균치는 historical background data의 범위 내 있었다. 또한, 양성 대조군에서는 통계학적인 유의성이 나타났다. 따라서, 본 시험은 적절하게 실시됐다고 판단하였다 (p <0.05).
이상의 결과로부터, 시험물질 STeP-BoNT/A-LC은 본시험 조건하에서 수컷 ICR 마우스의 골수세포에 소핵을 유발하지 않는 것 (음성)으로 판단된다,
[실시예 19: SKINETHICTM 인체피부모델에 대한 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물의 피부자극시험]
SKINETHICTM 인체피부모델에 대한 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물의 피부자극성을 평가하기 위하여, 시험물질을 인체피부모델에 적용 및 세척한 후 42시간 동안 배양하여 시험물질이 인체피부모델에 미치는 가역적 손상을 아래와 같이 평가하였다.
본시험의 구성은 음성대조군, 양성대조군 및 시험물질(STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물)군 총 3군으로 각 군은 3개 (tissue)의 반복시료 (three replicate tissue)로 설정하였으며, 단회 시험으로 진행하였다.
시험물질의 간접 확인 결과, 직접적인 염색 및 MTT 용액과의 특이적인 반응이 관찰되지 않았다. 시험물질 (Group 3)의 세포생존율은 85.2±4.6%로 세포 생존율 기준치 50%를 초과하여 피부 비자극성으로 판정되었다.
이상의 결과로부터, SKINETHICTM 인체피부모델에 대한 피부자극성시험에서 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물은 Globally Harmonized System of Classification and Labelling of Chemicals (GHS) 에 따른 분류에서‘범주 외’에 해당하는 피부 비자극성 물질로 판정되었다.
[실시예 20: STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물의 소각막을 이용한 안점막 자극 시험 (BCOP)]
STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물의 안점막자극유무 평가를 위해 BCOP 시험을 실시하였다.
시험물질(STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물)은 액상 상태로 사용되었으며, 식품의약품안전처 가이드라인에 따라 원액을 사용하였다. 시험물질 적용에 의한 각막의 혼탁도 변화, 투과도 변화에 대해 관찰하였으며, 혼탁도와 투과도 값을 이용하여 안점막자극지수 (IVIS)를 산출하였다.
실험기간 중 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물의 적용에 의한 각막의 혼탁도 및 투과도 변화는 관찰되지 않았다. STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물의 경우 안점막자극지수 (IVIS)가 평균 0.8±0.2로 산출되어 ‘UN GHS Category : 미분류 (No Category)’에 해당함을 확인할 수 있었다. 또한, 음성대조물질인 water는 -0.9±0.2로 UN GHS Category : 미분류 (No Category)’를 확인하였으며, 양성대조물질인 ethyl alcohol (Pure)의 경우 43.4±1.8로 산출되어 'UN GHS Category : 예측할 수 없음' 임을 확인할 수 있었다.
시험의 유효성을 판단하기 위해 양성대조물질의 IVIS값을 평가한 결과 'mean of historical data ± 2 standard deviation' 범위에 해당하여 본 시험은 유효하다고 사료된다.
이상의 결과로부터 BCOP시험법을 이용한 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물의 안점막자극을 평가시 'UN GHS Category : 미분류 (No Category)' 에 해당되는 물질로 사료된다.
[실시예 21: Mouse에 대한 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물의 국소림프절시험법-BrdU-ELISA을 이용한 피부감작성시험]
Mouse에 대한 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물 (시험물질)의 피부감작성을 평가하기 위하여 국소림프절시험법-BrdU-ELISA을 통한 실험동물의 사망률, 일반증상, 체중변화, 귀 두께 변화, 처리부위 피부반응 및 평균 자극지수(Stimulation index, S.I.)를 아래와 같이 평가하였다.
본시험의 군구성은 용매대조군 (시험물질 용매 및 양성대조물질 용매) 50% (v/v), 75% (v/v) 및 100% 농도의 시험물질군과 25% (v/v) 농도의 양성대조군의 총 6군으로 각 군당 5마리 씩 설정하였다.
실험기간 중 모든 처리군에서 사망동물 및 이상증상은 관찰되지 않았다. 체중측정 결과, 모든 처리군에서 용매대조군과 비교하여 유의적인 체중변화가 관찰되지 않았다. 귀 두께를 측정한 결과, 모든 처리군에서 용매대조군과 비교하여 유의적인 변화는 관찰되지 않았다. 시험물질 처리부위를 관찰한 결과, 모든 처리군에서 시험물질 영향으로 인한 국부적 피부자극이 관찰되지 않았다. 자극지수 (Stimulation index, S.I.) 를 산출한 결과, 50%(v/v), 75%(v/v) 및 100% (Group 3, Group 4, Group 5) 의 경우, 0.8, 0.9 및 0.6 으로 산출되었으며, 자극지수가 1.6 미만(양성판정 기준)으로 산출되어 피부감작성 비유발물질로 판정되었다. 양성대조군 (Group 6)의 경우, 2.2 으로 산출되었다.
이상의 결과로부터 Mouse에 대한 피부감작성시험에서 시험물질인 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물은 피부감작성 비유발물질로 사료된다.
[실시예 22: STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물에 대한 박테리아를 이용하는 복귀돌연변이시험]
시험물질 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물에 대한 미생물 복귀돌연변이 유발여부를 평가하기 위하여 Salmonella typhimurium의 histidine 요구성 균주인 TA98, TA100, TA1535 및 TA1537의 4개의 균주와 Escherichia coli의 tryptophan 요구성 균주인 WP2uvr A를 이용하여 시험을 실시하였다. 시험은 대사활성계 미적용 (-S9 mix) 및 적용 (+S9 mix)에서 pre-incubation법으로 실시하였다.
농도결정시험을 50, 150, 500, 1500 및 5000 μg/plate로 실시한 결과, 대사활성계 미적용 (-S9 mix) 및 대사활성계 적용 (+S9 mix)에서 시험물질에 대한 균주의 생육저해는 확인되지 않았다. 시험물질의 석출은 대사활성계 적용 유무에 관계없이 모든 농도에서 확인되지 않았다.
이상의 결과를 토대로 본시험은 아래의 농도에서 실시하였다. 대사활성계 미적용 (-S9 mix) 및 적용 (+S9 mix): 313, 625, 1250, 2500, 5000 μg/plate (TA98, TA100, TA1535, TA1537, WP2uvr A). 본 시험의 결과, 대사활성계 미적용 (-S9 mix) 및 대사활성계 적용 (+S9 mix)에서 시험물질에 의한 균주의 생육저해는 확인되지 않았다. 시험물질의 석출은 대사활성계 적용 유무에 관계없이 모든 농도에서 확인되지 않았다. 시험물질 처리군에서 복귀돌연변이 콜로니 수는 음성대조군과 비교하였을 때 증가 양상을 나타내지 않았다.
본 시험의 음성대조값 및 양성대조값은 시험시설의 적정 범위 내였다. 또한, 양성 대조 물질에서 유발된 복귀돌연변이 콜로니 수는 대사활성계 미적용 (-S9 mix) 및 적용 (+S9 mix)의 모든 시험 균주에 대하여 음성대조값의 2배를 넘어 증가하였고 분명한 양성 결과를 보였다.
이상의 결과로부터 시험물질 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물은 본 시험조건에서 변이원성을 보유하지 않은 것으로 판단하였다 (음성).
[실시예 23: STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물의 포유류 배양세포를 이용하는 염색체이상시험]
STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물 (시험물질)에 대한 염색체 이상 유발여부를 평가하기 위하여 Chinese hamster 유래의 lung cell (CHL)을 이용하여 염색체이상시험을 실시하였다.
농도결정시험은 단시간처리법 S9 mix 미적용 (이하, -S9 mix으로 칭함), S9 mix 적용 (이하, +S9 mix 으로 칭함) 및 연속처리법 24시간 처리 (이하, 24 시간처리로 칭함)에서 각각 625, 1250, 2500 및 5000 μg/mL를 설정하여 실시하였다.
농도결정시험 결과, 시험물질에 의한 세포독성은 확인되지 않았으며, pH의 변화도 확인되지 않았다. 최고농도인 5000 μg/mL에서의 상대세포수 증가(RICC, Relative increase in cell counts) 값은 -S9 mix에서 91.49%, +S9 mix에서 98.84%, 24 시간처리에서는 109.53 μg/mL로 확인되었다. 따라서, 본 시험의 최고농도는 5000 μg/mL로 설정하였다.
농도결정시험 결과를 기초로 하여, 단시간 처리법 (-S9 mix, +S9 mix)과 연속처리법 (24 시간처리)을 처리농도 1250, 2500 및 5000 μg/mL로 각각 설정하여 염색체이상시험을 실시했다. 표본관찰의 결과, 단시간 처리법 (-S9 mix, +S9 mix)과 연속처리법 (24 시간처리)의 염색체구조이상세포 및 수적이상세포의 출현빈도는 각각 5% 미만이었다.
따라서, 시험물질 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물은 본 시험 조건 하에서 CHL/IU 세포에 대한 염색체이상을 유발하지 않는 것으로 사료된다 (음성).
[실시예 24: STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물의 포유류 골수세포를 이용하는 소핵시험]
마우스[ICR, 투여 시 7주령]를 이용하여 포유류 골수세포에 대한 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물 (시험물질)의 소핵 유발성의 유무를 평가하였다.
용량설정시험은 암컷 및 수컷 마우스를 이용하여 각 군당 3 마리의 마우스에 0, 500, 1000, 1500 및 2000 mg/kg·B.W./day의 용량으로 투여하였다. 그 결과, 성별로 인한 감수성의 차이는 확인되지 않았으며 사망동물도 확인되지 않았다. 이러한 결과를 토대로 하여 일반적으로 감수성이 뛰어나다고 보고된 수컷 마우스를 사용하여 본시험을 수행하였다.
본 시험의 최고농도는 용량설정시험의 최고농도인 2000 mg/kg·B.W./day 로 설정하였다. 본 시험은 각 군당 5마리의 수컷 마우스에 0, 500, 1000 및 2000 mg/kg·B.W./day의 농도로 2회 (24시간 간격) 강제 경구 투여하였다. 양성대조물질 (Cyclophosphamide monohydrate, CPA)은 70 mg/kg·B.W./day의 농도로 단회 복강투여 하였다.
시험물질 투여 결과, 사망동물은 확인되지 않았으므로 음성 대조군, 시험물질투여군의 500, 1000, 2000 mg/kg·B.W./day 군 및 양성 대조군의 동물에 대하여 소핵을 가지는 다염성적혈구 (Micronucleated polychromatic erythrocyte, MNPCE)의 출현 빈도를 계수하였다.
시험결과, 시험물질 투여군에서 음성 대조군과 비교하여 소핵을 가진 다염성 적혈구의 증가는 볼 수 없었으며 통계학적인 유의성도 나타나지 않았다. 음성 대조군의 MNPCE출현 빈도 및 PCE의 비율 평균치는 historical background data의 범위 내 있었다. 또한, 양성 대조군에서는 통계학적인 유의성이 나타났다. 따라서, 본 시험은 적절하게 실시됐다고 판단하였다 (p <0.05).
이상의 결과로부터, 시험물질 STeP-SNAP8, STeP-Vialox, STeP-leuphasyl 혼합물은 본시험 조건하에서 수컷 ICR 마우스의 골수세포에 소핵을 유발하지 않는 것 (음성)으로 판단된다.

Claims (3)

  1. 서열번호 3의 아미노산 서열을 갖는 STeP-BoNT/A-LC 펩타이드, 서열번호 7의 아미노산 서열을 갖는 STeP-Vialox 펩타이드, 서열번호 8의 아미노산 서열을 갖는 STeP-SNAP8 펩타이드, 서열번호 9의 아미노산 서열을 갖는 STeP-Leuphasyl 펩타이드 중 선택되는 어느 하나 이상을 함유하는 것을 특징으로 하는 피부주름 방지 또는 개선용 화장료 조성물.
  2. 서열번호 3의 아미노산 서열을 갖는 STeP-BoNT/A-LC 펩타이드, 서열번호 7의 아미노산 서열을 갖는 STeP-Vialox 펩타이드, 서열번호 8의 아미노산 서열을 갖는 STeP-SNAP8 펩타이드, 서열번호 9의 아미노산 서열을 갖는 STeP-Leuphasyl 펩타이드 중 선택되는 어느 하나 이상을 함유하는 것을 특징으로 하는 피부주름 예방 또는 치료용 약학 조성물.
  3. 제2항에 있어서,
    상기 약학 조성물은,
    연고제 또는 주사제 또는 마이크로니들패치인 것을 특징으로 하는 피부주름 예방 또는 치료용 약학 조성물.
PCT/KR2019/005128 2019-04-29 2019-04-29 피부 또는 세포 투과능이 우수한 피부 주름 개선 또는 치료용 조성물 WO2020222315A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020190049579A KR102246906B1 (ko) 2019-04-29 2019-04-29 피부 또는 세포 투과능이 우수한 피부주름 방지 또는 개선용 화장료 조성물
KR10-2019-0049579 2019-04-29

Publications (1)

Publication Number Publication Date
WO2020222315A1 true WO2020222315A1 (ko) 2020-11-05

Family

ID=73029421

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2019/005128 WO2020222315A1 (ko) 2019-04-29 2019-04-29 피부 또는 세포 투과능이 우수한 피부 주름 개선 또는 치료용 조성물

Country Status (2)

Country Link
KR (1) KR102246906B1 (ko)
WO (1) WO2020222315A1 (ko)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20240032203A (ko) * 2022-08-30 2024-03-12 주식회사 바이오셀트란 미백용 복합 펩타이드 및 이를 함유하는 화장료 조성물

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103083651A (zh) * 2013-01-22 2013-05-08 南京中医药大学 用于外用制剂的穿膜肽介导的肉毒毒素的组合物及其制备方法和应用
CN105030574A (zh) * 2015-06-19 2015-11-11 周南燕 一种用于脸部护理的组合物
KR20170002475A (ko) * 2014-05-29 2017-01-06 주식회사 프로셀테라퓨틱스 신규한 세포투과성 펩타이드 및 이와 보툴리눔 독소 결합체 및 이들의 용도
KR101797168B1 (ko) * 2016-11-10 2017-11-13 주식회사 바이오셀트란 신규의 프로테인 트랜스덕션 도메인을 함유하는 구형 구조체
KR101797167B1 (ko) * 2016-11-09 2017-11-13 주식회사 바이오셀트란 신규의 프로테인 트랜스덕션 도메인 및 이의 용도

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6841535B2 (en) * 2000-07-31 2005-01-11 Active Motif Peptide-mediated transfection agents and methods of use
GB2411062B (en) * 2004-02-11 2007-11-28 Nujira Ltd Resonance suppression for power amplifier output network
MXPA06012076A (es) * 2004-04-20 2007-01-25 Nastech Pharm Co Metodos y composiciones para mejorar el suministro de arn bicatenario o un acido nucleico hibrido bicatenario para regular la expresion genetica en celulas de mamifero.
KR20090122769A (ko) * 2008-05-26 2009-12-01 메디스커브 주식회사 세포내로 단백질을 전달하는 방법 및 이를 위한 펩타이드
CA2880897C (en) * 2012-11-21 2020-01-14 Syntaxin Limited Methods for the manufacture of proteolytically processed polypeptides

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103083651A (zh) * 2013-01-22 2013-05-08 南京中医药大学 用于外用制剂的穿膜肽介导的肉毒毒素的组合物及其制备方法和应用
KR20170002475A (ko) * 2014-05-29 2017-01-06 주식회사 프로셀테라퓨틱스 신규한 세포투과성 펩타이드 및 이와 보툴리눔 독소 결합체 및 이들의 용도
CN105030574A (zh) * 2015-06-19 2015-11-11 周南燕 一种用于脸部护理的组合物
KR101797167B1 (ko) * 2016-11-09 2017-11-13 주식회사 바이오셀트란 신규의 프로테인 트랜스덕션 도메인 및 이의 용도
KR101797168B1 (ko) * 2016-11-10 2017-11-13 주식회사 바이오셀트란 신규의 프로테인 트랜스덕션 도메인을 함유하는 구형 구조체

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
DATABASE Protein 21 December 2013 (2013-12-21), IMANI FOOLADI, A.A., PARVANEH,S., AMANI,J. AND NAJAR PIRAYEH,S.: "Tat-BoNT/A- light chain fusion protein, partial [synthetic construct", XP055757495, retrieved from NCBI Database accession no. AHC55383.1 *

Also Published As

Publication number Publication date
KR20200126069A (ko) 2020-11-06
KR102246906B1 (ko) 2021-04-30

Similar Documents

Publication Publication Date Title
WO2015183044A1 (ko) 신규한 세포투과성 펩타이드 및 이와 보툴리눔 독소 결합체 및 이들의 용도
WO2019103203A1 (ko) 신규 펩티드 및 이를 포함한 조성물
WO2016190660A1 (ko) 신규 펩티드 및 이를 포함한 조성물
WO2013137505A1 (ko) 신규한 ｔｒｐｖ１ 억제 펩티드 및 이를 함유하는 피부노화 방지 또는 주름 개선용 조성물
WO2019240430A1 (ko) 세포 투과 펩티드와 결합된 융합 단백질 및 융합 단백질 또는 세포 투과 펩티드와 상피세포성장인자를 유효성분으로 포함하는 조성물
WO2020060128A1 (ko) 세포 침투 효과가 우수한 보툴리늄 유래 펩타이드를 포함하는 화장료 조성물
WO2020076101A1 (ko) 시지지움 포르모슘 추출물을 유효성분으로 포함하는 피부 미백, 항균 또는 항아토피 조성물
WO2022065805A1 (ko) 홍합 접착 단백질 유래의 재조합 폴리펩티드 및 그의 용도
WO2020222315A1 (ko) 피부 또는 세포 투과능이 우수한 피부 주름 개선 또는 치료용 조성물
WO2021251789A1 (ko) 펜타펩타이드를 유효성분으로 포함하는 조성물
WO2021206328A1 (ko) 신규 재조합 엑소좀 및 그의 용도
WO2019088402A1 (ko) 뷔베리신 또는 뷔베리신 유도체를 유효성분으로 포함하는 피부 미백용 조성물
WO2017119756A1 (ko) 주름개선, 노화방지, 미백, 항염증 기능성 신규 펩티드 및 이를 포함하는 조성물
WO2018066914A1 (ko) 지방산이 결합된 트리펩타이드 및 이를 포함하는 주름 개선용 화장료 조성물
WO2023055007A1 (ko) 항노화 활성을 갖는 펩타이드 및 이의 용도
WO2020096379A1 (ko) 아우레오바시디움 풀루란스 균주의 배양물 또는 추출물을 포함하는 저자극 피부 재생 또는 피부 진정용 조성물
WO2022050634A1 (ko) 펩타이드 및 이를 포함하는 화장료 조성물 및 약학 조성물
WO2018088733A1 (ko) 신규의 프로테인 트랜스덕션 도메인 및 이의 용도
WO2023054817A1 (ko) 항노화 활성을 갖는 펩타이드 및 이의 용도
WO2020138674A1 (ko) 근육 이완용 조성물
WO2017018847A1 (ko) 미리세틴 유도체를 함유하는 snare 복합체 형성 억제용 조성물
WO2021251791A1 (ko) 보툴리눔 톡신 유사 활성을 갖는 펩타이드 및 이의 용도
WO2017074163A1 (ko) 초저분자 케라틴 펩타이드의 제조 방법 및 그의 이용
WO2019088648A1 (ko) 미도드린을 포함하는 조성물 및 이의 용도
WO2019231175A1 (ko) 멜라닌 생성 억제 활성을 갖는 카르복시 말단이 아미드화된 펩타이드와 이를 포함하는 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19927413

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 19927413

Country of ref document: EP

Kind code of ref document: A1