WO2020080672A1 - Pd-l1과 pd-1 간 상호작용 분석 방법, pd-l1과 pd-1 간 상호작용 저해제 및 상기 저해제의 스크리닝 방법 - Google Patents

Pd-l1과 pd-1 간 상호작용 분석 방법, pd-l1과 pd-1 간 상호작용 저해제 및 상기 저해제의 스크리닝 방법 Download PDF

Info

Publication number
WO2020080672A1
WO2020080672A1 PCT/KR2019/011265 KR2019011265W WO2020080672A1 WO 2020080672 A1 WO2020080672 A1 WO 2020080672A1 KR 2019011265 W KR2019011265 W KR 2019011265W WO 2020080672 A1 WO2020080672 A1 WO 2020080672A1
Authority
WO
WIPO (PCT)
Prior art keywords
interaction
formula
protein
carbons
compound
Prior art date
Application number
PCT/KR2019/011265
Other languages
English (en)
French (fr)
Inventor
이대희
최병산
권예지
Original Assignee
주식회사 프로티나
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020190076647A external-priority patent/KR20210001095A/ko
Application filed by 주식회사 프로티나 filed Critical 주식회사 프로티나
Publication of WO2020080672A1 publication Critical patent/WO2020080672A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/506—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D403/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
    • C07D403/04—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D405/00—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
    • C07D405/14—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing three or more hetero rings
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids

Definitions

  • Anticancer drugs are being developed as first-generation chemotherapeutic agents, second-generation targeted anti-cancer drugs, and third-generation immunocancer drugs.
  • Immunogenic anti-cancer agents that have recently emerged are methods of treating cancer by adjusting the immune system in the human body, such as immune checkpoint inhibitors, CAR-T cell therapy agents, and anti-cancer viruses.
  • the immune checkpoint inhibitor restores the function of immune cells by inhibiting the immune checkpoint that suppresses the activity of immune cells, and the currently approved immune checkpoint targets are CTLA-4, PD-1, and PD-L1.
  • PD-L1 Programmed death-ligand 1 is a protein mainly present on the surface of cancer cells, also referred to as CD274 (cluster of differentiation 274) or B7-H1 (B7 homolog 1), a 40kDa type 1 transmembrane protein (type 1) transmembrane protein).
  • CD274 cluster of differentiation 274
  • B7-H1 B7 homolog 1
  • type 1 transmembrane protein type 1 transmembrane protein
  • PD-L1 is present in subtypes of immune cells (Macrophage, etc.) in addition to cancer cells.
  • PD-L1 is known to play a major role in suppressing the immune system in various diseases such as tissue transplantation, immune disease, and hepatitis.
  • PD-1 Programmed cell death protein 1
  • CD279 cluster of differentiation 279
  • CD279 Cluster of differentiation 279
  • PD-L1 When PD-L1 binds to the PD-1 protein on the surface of the T cell, the T cell loses its ability to attack cancer cells.
  • PD-L1 and / or PD-1 may be important targets in the development of anticancer agents.
  • FDA-approved drugs include PD-1 targeting drugs, Opdivo and Keytruda, and PD-L1 targeting drugs such as Tecentriq, Bavencio, and Im.
  • PD-L1 targeting drugs such as Tecentriq, Bavencio, and Im.
  • Finfin (Imfinzi) and Libtayo are indispensable limitations of antibody pharmaceuticals, which is why it is necessary to develop immunoanticancer drugs, not antibodies. Therefore, it is necessary to develop a small molecule, a representative form of a therapeutic agent, that is easy to manufacture and has a relatively low production cost as an immuno-cancer agent, and actively utilize it in the treatment of patients.
  • One example provides a compound having the structure of Formula I or Formula II: or a pharmaceutically acceptable salt thereof:
  • R 1 is hydrogen or alkyl having 1 to 3 carbons (eg, hydrogen),
  • R2 is hydrogen or alkyl having 1 to 3 carbons (such as methyl),
  • R3 is hydrogen or alkyl having 1 to 3 carbons (such as hydrogen),
  • R4 is hydrogen or alkyl having 1 to 3 carbons (such as methyl),
  • R5 is hydrogen, alkyl having 1 to 3 carbons, or alkoxy having 1 to 3 carbons (eg, -O-CH 3 ).
  • the compound having the structure of Formula I or II or a pharmaceutically acceptable salt thereof may be a compound having the structure of Formula 1 or Formula 2 or a pharmaceutically acceptable salt thereof:
  • Another example is the use of a compound having the structure of Formula I or II (for example, Formula 1 or Formula 2) or a pharmaceutically acceptable salt thereof to inhibit the interaction (binding) of PD-L1 with PD-1 and / or related thereto.
  • a compound having the structure of Formula I or II for example, Formula 1 or Formula 2
  • a pharmaceutically acceptable salt thereof to inhibit the interaction (binding) of PD-L1 with PD-1 and / or related thereto.
  • an example is selected from the group consisting of a compound having the structure of Formula I (eg, Formula 1), a compound having the structure of Formula II (eg, Formula 2), and pharmaceutically acceptable salts thereof. It provides a pharmaceutical composition for inhibiting the interaction of PD-L1 and PD-1, comprising at least one.
  • Suitable examples include one or more selected from the group consisting of compounds having the structure of Formula I (eg, Formula 1), compounds having the structure of Formula II (eg, Formula 2), and pharmaceutically acceptable salts thereof.
  • a method for inhibiting the interaction of PD-L1 and PD-1 comprising administering to a subject in need of inhibiting the interaction of PD-L1 and PD-1.
  • Another example is one or more PDs selected from the group consisting of compounds having the structure of Formula I (eg, Formula 1), compounds having the structure of Formula II (eg, Formula 2), and pharmaceutically acceptable salts thereof.
  • PDs selected from the group consisting of compounds having the structure of Formula I (eg, Formula 1), compounds having the structure of Formula II (eg, Formula 2), and pharmaceutically acceptable salts thereof.
  • compositions for the prevention and / or treatment of diseases associated with the interaction of PD-L1 and PD-1, comprising.
  • kits include one or more selected from the group consisting of compounds having the structure of Formula I (eg, Formula 1), compounds having the structure of Formula II (eg, Formula 2), and pharmaceutically acceptable salts thereof.
  • Preventing and / or preventing a disease associated with the interaction of PD-L1 and PD-1 comprising administering to a subject in need thereof a prevention and / or treatment of a disease associated with PD-L1 interaction with PD-1.
  • Another example is one or more PDs selected from the group consisting of compounds having the structure of Formula I (eg, Formula 1), compounds having the structure of Formula II (eg, Formula 2), and pharmaceutically acceptable salts thereof.
  • -Use for use in the prevention and / or treatment of diseases associated with the interaction of L1 and PD-1, or in the production of pharmaceutical compositions for the prevention and / or treatment of diseases associated with the interaction of PD-L1 and PD-1 Provides use for use.
  • the pharmaceutical composition provided herein, and / or the subject of the inhibition, prevention and / or treatment method is a subject having an interaction between PD-L1 and PD-1 higher than normal (eg, a mammal such as a human) or from the individual. It may be an isolated cell, tissue, or culture thereof.
  • Another example provides a kit for measuring the interaction between PD-L1 and PD-1, and a method for measuring the interaction between PD-L1 and PD-1.
  • the interaction between PD-L1 and PD-1 may mean a cluster ratio between PD-L1 and PD-1 or may be measured through it.
  • the interaction between PD-L1 and PD-1 may be an interaction in a single spot.
  • the kit for measuring the interaction between PD-L1 and PD-1 may include (a) any one selected from PD-L1 and PD-1 (first protein) or a substance specifically binding to the first protein (eg, An antibody), and (b) a label that generates a detectable signal (e.g., a fluorescence signal) on the other one (second protein) different from the first protein selected in (a) among PD-L1 and PD-1. It may include a labeled second protein to which a substance (labeling substance: for example, a protein, a small molecule compound, etc.) is bound.
  • labeling substance for example, a protein, a small molecule compound, etc.
  • the kit for measuring the interaction between PD-L1 and PD-1 comprises (a) PD-L1 (first protein) or a substance (eg, antibody) specifically binding to PD-L1.
  • the substrate, and (b) PD-1 (second protein) is a detectable signal-generating substance (labeling substance: selected from the group consisting of, for example, fluorescent proteins, fluorescent dyes, etc.). You can.
  • the kit may be capable of measuring the interaction in the form of a cluster formed between PD-L1 and PD-1.
  • the kit for measuring the interaction between PD-L1 and PD-1 comprises: (a) PD-1 (first protein) or a substance specifically binding to PD-1 (e.g., antibody). And (b) labeled PD-L1 binding to PD-L1 (second protein) and a detectable signal generating material (labeling material: selected from the group consisting of fluorescent proteins, fluorescent dyes, etc.) You can.
  • the kit may be capable of measuring the interaction at a single spot between PD-L1 and PD-1.
  • the first protein (eg, PD-L1) may be a detectable signal (eg, fluorescence signal) generating material (eg, protein, small molecule compound, etc.) coupled or unbound.
  • the substrate is one of PD-L1 and PD-1 (a first protein, for example, PD-L1) is bound to the first protein
  • the first protein may or may not pass through a substance (eg, an antibody) capable of binding thereto. It can be directly coupled to the substrate without.
  • the first protein directly bound to or without a substance (e.g., an antibody) to which any one selected from PD-L1 and PD-1 (first protein) is specifically bindable to the first protein is immobilized Reacting by adding a labeled second protein (a protein different from the first protein selected from (1) among PD-L1 and PD-1) to the substrate;
  • the method measures the interaction between PD-L1 and PD-1 in the form of clusters between PD-L1 and PD-1. It can be a way to do.
  • the method may be a method of measuring the interaction at a single spot between PD-L1 and PD-1.
  • amino acid residues involved in the interaction (binding) between PD-L1 and PD-1 may be a binding site between PD-L1 and PD-1 or one or more amino acid residues around it.
  • the amino acid residues involved in the interaction (binding) between PD-L1 and PD-1 means T20 of PD-L1 (SEQ ID NO: 5) (amino acid residue T (threonine; Thr) at position 20).
  • amino acid residues involved in the interaction (binding) between PD-L1 and PD-1 are one or more selected from the group consisting of D25, Y56, E58, R113, and R125 of PD-L1 (SEQ ID NO: 5).
  • amino acid residues involved in the interaction (binding) between PD-L1 and PD-1 are inhibitors of interaction between PD-L1 and PD-1 (e.g., Compound 1, Compound 2, or pharmaceutically acceptable thereof) Possible salts), for example, one or more (e.g., 1, 2, or 3) selected from the group consisting of E58, R113, and R125 of PD-L1 (SEQ ID NO: 5), and PD-1 E136 of (SEQ ID NO: 1) may be included.
  • Another example provides a method of screening for the inhibitors of the interaction between PD-L1 and PD-1 and / or for the prevention or treatment of diseases associated with the interaction between PD-L1 and PD-1.
  • the screening method
  • the first protein may be PD-L1 and the second protein may be PD-1.
  • the substrate used in step (1) is PD-L1 directly bound to the surface or indirectly through a substance (eg, antibody) that specifically binds to PD-L1, or specifically binds to PD-L1.
  • the substance (eg, antibody) may be bound.
  • the step of measuring the protein-protein interaction in step (2) is to measure the interaction between PD-L1 and PD-1 at amino acid residues involved in the interaction (binding) between PD-L1 and PD-1 described above. May be
  • the screening method is a disease related to the interaction between PD-L1 and PD-1 through inhibition of the interaction between PD-L1 and PD-1 or inhibition of interaction between PD-L1 and PD-1 developed by other screening methods (e.g. , Cancer, immune disease, etc.) can be usefully applied to the efficacy test (or confirmation or test) of a candidate drug for treatment.
  • other screening methods e.g. , Cancer, immune disease, etc.
  • Another example provides a composition for preventing or treating a disease related to an interaction inhibitor between PD-L1 and PD-1 and / or a disease associated with interaction between PD-L1 and PD-1, including a candidate drug selected by the screening method. .
  • Another example provides a method of identifying a functional site or functional amino acid on PD-L1 and / or PD-1 on which an interaction inhibitor between PD-L1 and PD-1 acts.
  • step (b) the mutant PD-1 prepared in step (a) and wild-type PD-L1, or mutant PD-L1 and wild-type PD-1 are injected with an interaction inhibitor between PD-L1 and PD-1 to react, and PD- Measuring the level of interaction between L1 and PD-1;
  • the action site of the interaction inhibitor between PD-L1 and PD-1 identified by the above method may be one or more selected from amino acid residues involved in the interaction (binding) between PD-L1 and PD-1 described above. .
  • Another example includes measuring a protein-protein interaction between a first protein and a second protein, wherein the first protein is one of PD-L1 and PD-1, and the second protein is PD-L1 and PD
  • Another example includes measuring a protein-protein interaction between a first protein and a second protein, wherein the first protein is one of PD-L1 and PD-1, and the second protein is PD-L1 and PD
  • Provided is a method for predicting reactivity to a drug targeting a first protein of a cell or tissue, or an individual from which the cell or tissue is derived, which is another one of -1, or a method for providing information to the prediction.
  • Another example includes measuring a protein-protein interaction between a first protein and a second protein, wherein the first protein is one of PD-L1 and PD-1, and the second protein is PD-L1 and PD It provides a method for selecting an individual suitable for treatment targeting the first protein, which is another one of -1, or a method for providing information on the selection.
  • Another example includes measuring a protein-protein interaction between a first protein and a second protein, wherein the first protein is one of PD-L1 and PD-1, and the second protein is PD-L1 and PD
  • the first protein is one of PD-L1 and PD-1
  • the second protein is the other of PD-L1 and PD-1, the first protein of the cell or tissue, or the individual. It provides a method of monitoring responsiveness to a targeted drug or a method of providing information for monitoring.
  • a protein-protein interaction between a first protein and a second protein is performed in an isolated cell or tissue treated with a candidate substance targeting the first protein, or in a cell or tissue isolated from an individual administered the drug.
  • the first protein is one of PD-L1 and PD-1
  • the second protein is the other of PD-L1 and PD-1, the first protein and / or the second protein.
  • Another example provides an apparatus for use in the methods described above.
  • protein-protein interaction may mean physical and / or chemical bonding or complex formation between a first protein and a second protein, eg, It may be measured by one or more of factors such as binding frequency, bonding strength (strength), and bonding time.
  • the interaction (binding) between the first protein and the second protein means not only direct interaction (binding) between them, but also other proteins (proteins located between the first and second proteins in the signal transduction pathway). Intermediate interactions (binding) can also be included.
  • the protein-protein interaction herein can be a single molecule reaction (a reaction between a first protein in one molecule and a second protein in one molecule).
  • interaction of PD-L1 and PD-1 may mean physical and / or chemical bonding or complex formation between PD-L1 and PD-1.
  • interaction (binding) may include direct interaction (binding) as well as interaction through other proteins (binding) in the middle.
  • the protein-protein interaction herein can be a single molecule reaction.
  • the programmed cell death 1 ligand 1 (PD-L1) described herein may be derived from mammals such as humans, for example, human PD-L1 (eg, GenBank Accession No. NP_001254635.1 (gene: NM_001267706.1) , NP_001300958.1 (gene: NM_001314029.1), NP_054862.1 (gene: NM_014143.4, etc.).
  • human PD-L1 eg, GenBank Accession No. NP_001254635.1 (gene: NM_001267706.1)
  • NP_001300958.1 gene: NM_001314029.1
  • NP_054862.1 gene: NM_014143.4, etc.
  • the programmed cell death protein 1 (PD-1) described herein may be derived from mammals such as humans, for example, human PD-1 (eg, GenBank Accession No. NP_005009.2 (gene: NM_005018.3), etc. ).
  • the PD-L1 protein and / or PD-1 protein described herein are each independently, in the form contained in cells, tissues, or lysates or extracts thereof (eg, isolated from mammals), or purified proteins, or It may be in the form of a chemically or recombinantly synthesized protein.
  • the step of measuring the protein-protein interaction between PD-L1 and PD-1 performed in the methods provided herein can be isolated cells or tissues, or lysates or extracts thereof, or purified proteins or chemically or recombinantly Proteins synthesized with (PD-L1 and PD-1) may be performed in vitro or in vitro.
  • the interaction inhibitor between PD-L1 and PD-1 is a compound having the structure of Formula I (eg, Formula 1), a compound having the structure of Formula II (eg, Formula 2), or a pharmaceutical thereof. It can be an acceptable salt:
  • R 1 is hydrogen or alkyl having 1 to 3 carbons (eg, hydrogen),
  • R2 is hydrogen or alkyl having 1 to 3 carbons (such as methyl),
  • R3 is hydrogen or alkyl having 1 to 3 carbons (such as hydrogen),
  • R4 is hydrogen or alkyl having 1 to 3 carbons (such as methyl),
  • R5 is hydrogen, alkyl having 1 to 3 carbons, or alkoxy having 1 to 3 carbons (eg, -O-CH 3 ).
  • pharmaceutically acceptable salt means a salt compound form generally used in the pharmaceutical or pharmaceutical field, and may be, for example, an acid addition salt or a base addition salt.
  • examples of pharmaceutically acceptable salts of the compounds according to Formula 1 or 2 include salts with inorganic acids such as hydrochloric acid, bromic acid, phosphoric acid or sulfuric acid; Salts with organic carboxylic acids such as acetic acid, trifluoroacetic acid, citric acid, maleic acid, oxalic acid, succinic acid, benzoic acid, tartaric acid, fumaric acid, mandelic acid, ascorbic acid or malic acid, or sulfonic acids such as methanesulfonic acid or para-toluenesulfonic acid ; Salts with alkali metals such as sodium, potassium or lithium; Or other salts with various acids known to form pharmaceutically acceptable salts, but are not limited thereto.
  • the interaction (binding) inhibition of PD-L1 and PD-1 means the degree of interaction (binding) between PD-L1 and PD-1 by the treatment of the interaction inhibitor between PD-L1 and PD-1. It may mean that the interaction between the PD-L1 and PD-1 is reduced compared to before the treatment with the inhibitor, or the interaction (binding) between PD-L1 and PD-1 does not occur.
  • a disease related to the interaction of PD-L1 and PD-1 may be an immune disease, for example, cancer, but is not limited thereto.
  • the method for measuring the interaction between PD-L1 and PD-1 may include the following steps:
  • the first protein directly bound to or without a substance (e.g., an antibody) to which any one selected from PD-L1 and PD-1 (first protein) is specifically bindable to the first protein is immobilized Reacting by adding a labeled second protein (a protein different from the first protein selected from (1) among PD-L1 and PD-1) to the substrate;
  • step (2) Measuring the signal from the reactant obtained in step (1) to measure the interaction between PD-L1 and PD-1 (measurement of protein-protein interaction).
  • a screening method for preventing or treating a disease related to an interaction inhibitor between PD-L1 and PD-1 or an interaction between PD-L1 and PD-1 provided herein may include the following steps.
  • the first protein may be PD-L1 and the second protein may be PD-1.
  • steps (1), (2), and (3) may be performed in vitro or in cells isolated from a living body.
  • step (1) of each method corresponds to each other
  • step (2) of each method corresponds to each other.
  • Step (1) supplying the first protein, the second protein to which the marker is attached, and the candidate compound to the substrate
  • the first protein may be any one selected from PD-L1 and PD-1, and the second protein may be other proteins except the protein selected as the first protein from PD-L1 and PD-1.
  • the first protein may be PD-L1 and the second protein may be PD-1.
  • PD-L1 and PD-1 may be supplied sequentially (1-a) or simultaneously (1-b).
  • PD-L1 is supplied to the substrate coated with the PD-L1 binding material, and then combined, and then supplied with the labeled PD-1 and the candidate compound, or the PD-1 binding material After the PD-1 is supplied and bound to the coated substrate, PD-L1 with a marker attached and a candidate compound can be supplied.
  • a mixture of PD-L1 and a labeled PD-1 and a candidate compound is simultaneously supplied to a substrate coated with a PD-L1 binding substance, or PD-1 and
  • the mixture of the labeled PD-L1 and the candidate compound can be simultaneously supplied to the substrate coated with the PD-1 binding substance.
  • PD-L1 or PD-1 used as a first protein is a cell isolated (purified) from a cell or used in the form of a chemically or recombinantly synthesized protein, or a cell in which the first protein is overexpressed and / or activated.
  • a cell isolated (purified) from a cell or used in the form of a chemically or recombinantly synthesized protein, or a cell in which the first protein is overexpressed and / or activated for example, cancer cells) or cell lysates.
  • the interaction between the two proteins may be formed in a clustered form of PD-1, so that qualitative and / or Alternatively, an advantageous effect can be obtained for quantitative analysis.
  • the substance that specifically binds to PD-L1 or PD-1 may be selected from all substances capable of specifically binding to PD-L1 or PD-1, for example, an antibody that specifically binds or an antigen thereof Binding fragments (e.g., scFv, (scFv) 2, scFv-Fc, Fab, Fab 'and F (ab') 2, etc. of antibodies), aptamers (protein or nucleic acid molecules), small molecule compounds, etc. 1 It may be more than a species.
  • the binding material may be a site that does not interfere with the interaction of PD-L1 and PD-1, that is, the PD-L1 and PD-1 interact (combined) at a site other than the site.
  • the substance that specifically binds to PD-L1 may be an antibody that specifically binds PD-L1 or an antigen-binding fragment thereof.
  • the antibody or antigen-binding fragment that specifically binds to PD-L1 (excluding the binding site of PD-L1 and PD-1)
  • Non-overlapping sites, such as PD-L1 may specifically bind to the C-terminal site.
  • the PD-L1 binding site of PD-1 is generally the N-terminal region of PD-L1 (extracellular domain region), specifically, 15th to 200th, 15th to 150th, and 15th From 130th, 15th to 125th, 20th to 200th, 20th to 150th, 20th to 130th, 20th to 125th, 25th to 200th, and 25th to
  • the 150th, 25th to 130th, 20th to 125th or 25th to 125th amino acid residues may include a region comprising one or more amino acid residues, for example, PD-L1 T20, D25, D26, Y56, E58, R113, M115, A121, D122, Y123, K124, R125, and the like.
  • the non-binding site excluding the binding site of PD-L1 with PD-1 may be a PD-L1 part that does not overlap with the PD-L1 binding site of PD-L1 at the N-terminal side of PD-L1 described above. And (for example, one or more selected from the group consisting of PD-L1 T20, D25, D26, Y56, E58, R113, M115, A121, D122, Y123, K124, R125, etc.
  • A) does not contain an amino acid residue
  • the antibody or antigen-binding fragment thereof that specifically binds to PD-L1 is a PD-L1 protein, in the N-terminal to C-terminal direction, after the 150th, after the 200th, after the 250th, and 260 After the second, after the 270th, or after the 280th amino acid portion, for example, the 250th to 290th, 260th to 290th, 270th to 290th, or 280th to 290th amino acid portion selected from It may be a specific binding to one or more amino acids, such as 1 to 30, 1 to 25, 1 to 20, 1 to 15, or 1 to 10 (eg, contiguous) amino acids.
  • the substance that specifically binds to PD-1 may be an antibody that specifically binds PD-1 or an antigen-binding fragment thereof.
  • the antibody or antigen-binding fragment that specifically binds PD-1 (excluding the binding site of PD-1 with PD-L1)
  • Non-overlapping sites may specifically bind to the C-terminal site of PD-1.
  • the region where PD-1 binds to PD-L1 is generally the N-terminal region (extracellular domain region) of PD-1, specifically, from the 60th to the 200th, from the 60th to the 150th, and the 60th To 140th, 65th to 200th, 65th to 150th, 65th to 140th, or 68th to 136th amino acid residues.
  • N-terminal region extracellular domain region
  • PD-1 specifically, from the 60th to the 200th, from the 60th to the 150th, and the 60th To 140th, 65th to 200th, 65th to 150th, 65th to 140th, or 68th to 136th amino acid residues.
  • amino acid residues selected from the group consisting of Y68, Q75, K78, T76, I126, L128, A132, I134, E136, etc. of PD-1 It can be a site.
  • the non-binding site excluding the binding site of PD-1 with PD-L1, for example, the C-terminal site of PD-1, the PD-1 of the N-terminal side of PD-1 described above binds PD-L1 It may be a portion of PD-1 that does not overlap with the site, and an antibody or antigen-binding fragment thereof that specifically binds to PD-1 is a non-binding site (e.g., a binding site of PD-1 with PD-L1).
  • Antibody or antigen-binding fragment that binds to one or more amino acids in the C-terminal region of PD-1), such as 1 to 30, 1 to 25, 1 to 20, 1 to 15, or 1 to 10 amino acids can be
  • the substrate is appropriately surface-modified to include (immobilize) a biological substance (eg, antibody, etc.) that specifically binds to the PD-L1 or PD-1, or the protein (PD) is directly attached to the surface.
  • a material that specifically binds to -L1 or PD-1) may be immobilized.
  • the substrate is treated with any compound having a functional group capable of immobilizing a biological substance (eg, antibody, etc.) to which the protein (PD-L1 or PD-1) specifically binds to one surface. (Eg, applied), for example, can be treated with a compound containing a functional group selected from the group consisting of aldehyde groups, carboxyl groups and amine groups.
  • the compound containing a functional group selected from the group consisting of the aldehyde group, carboxyl group and amine group is biotin, bovine serum albumin (BSA), biotin-bound bovine serum albumin, polyethylene glycol (polyethyleneglycol) PEG), biotin-bound PEG (polyethylene glycol-biotin; PEG-biotin), polysorbate (eg, Tween20), or the like, but may be one or more selected from the group.
  • the surface-treated substrate may be further treated (eg, applied) by one or more selected from the group consisting of neutravidin, streptavidin, avidin, and the like.
  • the substrate may be a material having a refractive index of light (approximately 1.3) or more in which the refractive index of light occupies a large portion of the biological material in consideration of the ease of detection of the label signal.
  • the substrate may have a thickness of about 0.1 to about 1 mm, about 0.1 to about 0.5 mm, 0.1 to about 0.25 mm, or about 0.13 to about 0.21 mm, and a refractive index of about 1.3 to about 2, about 1.3 To about 1.8, about 1.3 to about 1.6, or about 1.5 to about 1.54.
  • the substrate may be any material that satisfies the refractive index range, and may be obtained from a material selected from the group consisting of glass (refractive index: about 1.52), quartz, etc., but is not limited thereto.
  • the substrate may have any form that is commonly used for observation of biological samples, and may be, for example, a well type, a slide type, a channel type, an array form, a microfluidic chip, a microtube (capillary), etc., but is not limited thereto. It does not work.
  • the cover glass When observing the fluorescent microscope, it can be observed by mounting the cover glass on the substrate to which the sample is applied, and the material of the cover glass is as described above for the substrate, and the thickness may be less than or equal to the range described for the substrate (for example, refractive index 1.52, It may be 0.17 mm thick, but is not limited to this).
  • the labeled PD-1 protein or PD-L1 protein may be labeled with a labeling substance that these proteins generate a detectable signal
  • the labeling substance may be, for example, chemically (e.g., covalent or non-covalent), recombinant, or physical. As, it may be combined), it may mean a form in which a tag to which a labeling material can be attached is attached.
  • the detectable signal can be selected from all signals (eg, light, radiation, etc.) that can be measured through conventional enzyme reaction, fluorescence, luminescence, and / or radiation detection.
  • the labeling material may be at least one selected from the group consisting of all small molecule compounds, proteins, peptides, nucleic acid molecules, etc.
  • fluorescent dyes small molecule compounds; Cyanine, Alex, Dylight, Fluoprobes, etc.
  • Fluorescent proteins e.g., green fluorescent protein (GFP, enhanced GFP), yellow fluorescent protein (YFP), turquoise fluorescent protein (CFP), blue fluorescent protein (BPF), red fluorescent protein (RPF), mcherry, etc.
  • GFP green fluorescent protein
  • YFP yellow fluorescent protein
  • CFP turquoise fluorescent protein
  • BPF blue fluorescent protein
  • RPF red fluorescent protein
  • mcherry mcherry, etc.
  • the tag may be at least one selected from all commonly used types such as His-tag / Ni-NTA.
  • the concentration of use of the labeling material can be appropriately determined within a range of about 1 uM or less in order to enable accurate and easy detection without generating noise, for example, 1 nM to 1000 nM, 1 nM to 500 nM, 1 nM to 100 nM, It may be about 10nM to 1000nM, 10nM to 500nM, or 10nM to 100nM, but is not limited thereto.
  • the signal generated from the labeling material is measured and / or quantified by all signal detection means (e.g., conventional fluorescence microscope, fluorescence camera, fluorescence intensity measurement (quantitative) device, etc.) commonly used to detect or measure it. (Numerical).
  • all signal detection means e.g., conventional fluorescence microscope, fluorescence camera, fluorescence intensity measurement (quantitative) device, etc.
  • Candidate compounds of the inhibitor or prophylactic / therapeutic agent may be selected from all biocompatible materials that can be used as target drugs for PD-L1 and / or PD-1 proteins, such as small molecular chemicals, proteins (eg , Antibodies, antibody fragments, or analogs thereof), peptides, nucleic acid molecules (eg, DNA, RNA (eg, siRNA, microRNA, shRNA, etc.), PNA (peptide nucleic acid), aptamer, etc.), plant extracts, animals One or more types may be selected from the group consisting of extracts, cell extracts, and the like, but is not limited thereto.
  • Step (2) measuring the interaction between PD-L1 and PD-1
  • step (2) may include the step of detecting the signal generated by the interaction between PD-L1 and PD-1 in step (1) and measuring the interaction level of PD-L1 and PD-1.
  • the signal measurement is any means capable of detecting (or measuring or confirming) the label signal used in step (1) (for example, a signal measurable through conventional methods such as enzyme reaction, fluorescence, luminescence, or radiation detection). It can be performed using.
  • the protein-protein interaction measurement in step (2) may be by real-time analysis.
  • the label signal is a fluorescence signal
  • the signal detection is performed by supplying a light source absorbed by a label material that generates the fluorescence signal, for example, a fluorescence microscope, a fluorescence camera, and / or fluorescence
  • a label material that generates the fluorescence signal for example, a fluorescence microscope, a fluorescence camera, and / or fluorescence
  • an intensity measurement (quantitative) device or the like imaging and / or quantification (eg, fluorescence intensity digitization, fluorescence spot counting, etc.) can be performed.
  • the fluorescent signal when the signal is a fluorescent signal, the fluorescent signal may be imaged and / or quantified using a fluorescent camera.
  • step (2) protein-protein interaction measurement step
  • the step of supplying the light source of step (i) is a step of supplying a light source to the reactants of the PD-L1 protein and the PD-1 protein obtained in step (1). If such a goal can be achieved, supply of the light source There is no particular limit to the timing.
  • the light source may be any light source having a wavelength corresponding to a fluorescent signal, and may be, for example, a laser or a halogen lamp.
  • the wavelength of the light source can be adjusted according to the fluorescence signal used, for example, it can be selected from about 300nm to about 600nm or about 350nm to about 560nm. More specifically, the green fluorescent protein absorbs about 480 nm, the yellow fluorescent protein absorbs about 540 nm, the blue fluorescent protein absorbs about 375 nm, and the turquoise fluorescent protein absorbs about 425 nm, so the green fluorescent light is used as a fluorescent signal.
  • the wavelength of the light source is about 460 to about 500 nm, when using yellow fluorescence as the fluorescent signal, the wavelength of the light source is about 520 to about 560 nm, when using the blue fluorescence as the fluorescent signal, the wavelength of the light source is about 350 ⁇ About 400nm, when using a blue-green fluorescence as a fluorescent signal, the wavelength of the light source may be selected from about 400 to about 450nm.
  • the protein-protein interaction measurement step of step (2) is performed by supplying a light source using a total internal reflection fluorescence microscope (TIRF) microscope or a confocal microscope, and fluorescence signal in a conventional manner. It can be performed by observing.
  • a light source is supplied and a fluorescent signal is imaged by using a fluorescent camera for signal imaging, such as an EMCCD (Electron-multiplying charge-coupled device) camera or a Complementary metal oxide semiconductor (CMOS) camera. And / or quantitation.
  • EMCCD Electro-multiplying charge-coupled device
  • CMOS Complementary metal oxide semiconductor
  • step (2) is performed using a total reflection microscope and a fluorescence camera.
  • the substrate prepared in step (1) is mounted on a total reflection microscope.
  • the supply position of the light source is usually downward, and depending on the type of the total reflection microscope, the fluorescent signal is placed on the substrate (in this case, from bottom to top, the light source supply, the substrate, the lens, or the substrate, the light source supply, the lens Can be in order) or from below (in this case, from bottom to top, the lens, the light source supply, the substrate, or the light source supply, the lens, the substrate, or the lens, the substrate, the light source supply) Can be observed.
  • the light source may be a laser, and the intensity of the light source is about 0.5 mW to about 5 mW, about 0.5 mW to about 4.5 mW, about 0.5 mW to about 4 mW, about 0.5 mW to about 3.5 mW, about 0.5 mW to about 3 mW, about 0.5 mW to about 2.5 mW, about 0.5 mW to about 2 mW, about 1 mW to about 5 mW, about 1 mW to about 4.5 mW, about 1 mW to about 4 mW, about 1 mW to about 3.5 mW , About 1 mW to about 3 mW, about 1 mW to about 2.5 mW, about 1 mW to about 2 mW, about 1.5 mW to about 5 mW, about 1.5 mW to about 4.5 mW, about 1.5 mW to about 4 mW, about It may be from 1.5 mW to about 3.5 mW, from about
  • the fluorescence signal generated by the supply of the light source can be imaged and / or quantified by shooting with a fluorescence camera.
  • the photographing (or imaging) of the fluorescence signal may be performed simultaneously with the supply of the light source or within the signal generation maintenance time in consideration of the fluorescence signal generation maintenance time (light emission time, lifetime) of the labeling substance.
  • the exposure time per frame, laser power, camera gain value, and total shooting frame can be appropriately adjusted.
  • the exposure time per frame is about 0.001 seconds to about 5 seconds, about 0.001 seconds to about 3 seconds, about 0.001 seconds to about 2 seconds, about 0.001 seconds to about 1 second, about 0.001 seconds to about 0.5 seconds, About 0.001 seconds to about 0.3 seconds, about 0.001 seconds to about 0.1 seconds, about 0.01 seconds to about 5 seconds, about 0.01 seconds to about 3 seconds, about 0.01 seconds to about 2 seconds, about 0.01 seconds to about 1 second, about 0.01 Seconds to about 0.5 seconds, about 0.01 seconds to about 0.3 seconds, about 0.01 seconds to about 0.1 seconds, about 0.05 seconds to about 5 seconds, about 0.05 seconds to about 3 seconds, about 0.05 seconds to about 2 seconds, about 0.05 seconds to About 1 second, about 0.05 seconds to about 0.5 seconds, about 0.05 seconds to about 0.3 seconds, about 0.05 seconds to about 0.1 seconds, about 0.07 seconds to about 5 seconds, about 0.
  • 07 seconds to about 3 seconds about 0. 07 Seconds to about 2 seconds, about 0.07 seconds to about 1 second, about 0. 07 seconds to about 0.5 seconds, about 0. 07 seconds to about 0.3 seconds, about 0.07 seconds to about 0.1 seconds, about 0.1 seconds to about 5 seconds, About 0.1 second to about 3 seconds, about 0.1 second to about 2 seconds, about 0.1 second to about 1 second, about 0.1 second to about 0.5 second, or about 0.1 second to about 0.3 second, such as about 0.1 second, but is not limited thereto.
  • a labeling material eg, eGFP
  • photons generated from a labeling material eg, eGFP
  • eGFP labeling material
  • the number of electrons generated per photon can be changed through a gain value.
  • the set gain value increases, the number of electrons generated per photon increases, so the sensitivity of the EMCCD increases and the background noise increases, so the signal-to-noise ratio is important.
  • the gain value is about 10 to about 100, about 10 to about 80, about 10 to about 60, about 10 to about 50, about 20 to about 100, about 20 to about 80, about 20 to about 60, about 20 to about 50, about 30 to about 100, about 30 to about 80, about 30 to about 60, or about 30 to about 50, such as about 40 , It is not limited to this, and may be appropriately selected in consideration of camera sensitivity, life, equipment construction status, noise, test conditions, and the like.
  • one or more of the imaging such as two or more, three or more, four or more, five or more, seven or more, or ten or more (the upper limit is the Performed on a substrate of one or more channels (determined according to the size and the imageable area) or one or more channels including each (each channel includes two or more substrates), to obtain the number of spots (also referred to as PPI complexes) on which a signal appears, And / or the obtained fluorescence signal can be quantified, which can be viewed as quantifying protein-protein interactions.
  • the measured fluorescence intensity can be quantified using conventional equipment to quantify protein-protein interactions.
  • Step (3) selecting an interaction inhibitor between PD-L1 and PD-1 (corresponds to the screening method)
  • interaction measurement values of PD-L1 and PD-1 obtained by performing steps (1) and (2) are less than or equal to a preset reference value
  • PD-L1 and It is selected as an inhibitor of interaction between PD-1, and if it exceeds the reference value, it is excluded from the selection.
  • the reference value may be a PD-1 and PD-L1 interaction measurement value (eg, the number of PPI complexes) measured in a control group not treated with a candidate compound. That is, in step (3), when the candidate compound is treated, the interaction level of PD-L1 and PD-1 in the treatment of the candidate compound measured in step (2) is determined by the PD-L1 and PD of the control group not administered with the candidate compound. Compared to the interaction level of -1, when the interaction level of PD-L1 and PD-1 in the treatment of the candidate compound is lower than the interaction level of PD-L1 and PD-1 in the control group, the candidate compound is PD- And selecting an interaction inhibitor between L1 and PD-1.
  • the interaction level of PD-L1 and PD-1 in the treatment of the candidate compound measured in step (2) is determined by the PD-L1 and PD of the control group not administered with the candidate compound.
  • the candidate compound is PD- And selecting an interaction inhibitor between L1 and PD-1.
  • step (3) (1 ') supplying PD-L1 and PD-1 with a label attached to the substrate; And (2 ') detecting a signal by the interaction between PD-L1 and PD-1 to measure the level of interaction between PD-L1 and PD-1 (PD-L1 in the control group). And measuring the level of interaction of PD-1).
  • the reference value is a case where a previously known inhibitor (positive control; reference substance) is injected, and a measurement value of PD-1 and PD-L1 interaction (eg, the number of PPI complexes) and an inhibitor are not added.
  • Ranges between PD-1 and PD-L1 interaction measurement values e.g., number of PPI complexes
  • the reference value is less than the level of PD-1 and PD-L1 interaction when the reference compound is not administered with the candidate compound
  • a level above the interaction level of PD-1 and PD-L1 when the reference material is administered for example, more than the measured value when an inhibitor (positive control; reference material) is added from the above range. It may be a value selected in the near range.
  • the measured value can be performed by normalizing to a specific value (relative value of the interaction signal (e.g., fluorescent signal) of PD-1 and PD-L1).
  • the interaction measurement value of PD-1 and PD-L1 when no inhibitor is added is normalized to 1, and the interaction between PD-1 and PD-L1 when a known inhibitor (reference material) is added
  • the action measurement value is normalized to 0, and a range closer to 0, which is an interaction measurement value of PD-1 and PD-L1 when an inhibitor is added, is 0 to 0.5, 0 to 0.45, 0 to 0.4 , 0.1 to 0.5, 0.1 to 0.45, 0.1 to 0.4, 0.2 to 0.5, 0.2 to 0.45, 0.2 to 0.4, 0.3 to 0.5, 0.3 to 0.45, or a value selected from 0.3 to 0.4, for example, 0.4 can be set as a reference value However (see the red solid line in FIG.
  • the previously known inhibitor may be selected from substances (eg, antibodies, small molecule compounds, etc.) having an inhibitory effect on the interaction of PD-1 and PD-L1, for example, BMS-202 (CAS No .: 1675203- 84-5), J105 (anti-PD-1 monoclonal antibody; human PD-1 target), J116 (anti-PD-1 monoclonal antibody; human PD-1 target), M1H4 (anti-PD-1 Monoclonal antibody; human PD-1 target), RMP1-14 (anti-PD-1 monoclonal antibody; mouse PD-1 target), NAT105 (anti-PD-1 monoclonal antibody; human PD-1 target ), And the like, but is not limited thereto.
  • substances eg, antibodies, small molecule compounds, etc.
  • a method of identifying a functional site or functional amino acid of a PD-L1 and PD-1 interaction inhibitor provided herein may include the following steps.
  • PD-L1 and PD-1 interaction inhibitors are added to the obtained mutant PD-1 and wild-type PD-L1, or mutant PD-L1 and wild-type PD-1, and the protein between PD-L1 and PD-1- Measuring the level of protein interaction;
  • the variation of the amino acid residue can be performed by various methods such as loss or replacement of charge, adjustment of length, and substitution of amino acid sequences.
  • the mutated amino acid residue is an essential or critical site for the interaction between PD-1 and PD-L1
  • the mutation itself can cause inhibition of the interaction between PD-1 and PD-L1, thus PD-1 and PD It may be a disorder to identify the site of action of the L1 liver interaction inhibitor. Therefore, in order to more accurately identify the action site of the interaction inhibitor between PD-1 and PD-L1, the mutated amino acid residue may be an amino acid residue that does not affect or has little effect on the interaction between PD-1 and PD-L1. have.
  • the amino acid residues that are mutated in step (a) are between the mutated PD-L1 and wild-type PD-1.
  • the level of interaction between the mutant PD-1 and the wild-type PD-L1 may be higher than a reference value.
  • the 'reference value' is the 'protein-protein interaction level (signal value) between the mutant PD-L1 and the wild-type PD-1, or the mutant PD-1 and the wild-type PD-L1' (hereinafter, the 'mutation PD-L1 and PD-').
  • the level of interaction (and / or signal value) between 1 ' is the protein-protein interaction level (signal value) between wild-type PD-L1 and wild-type PD-1 (hereinafter,' wild-type PD-L1 and PD-1 ').
  • a value converted to a relative value to the interaction level (and / or signal value) of the liver eg, the interaction level between the variants PD-L1 and PD-1 is the interaction between wild-type PD-L1 and PD-1) It can be judged based on the value divided by the action level).
  • the level of interaction between the mutant PD-L1 and PD-1 and / or the level of interaction between wild-type PD-L1 and PD-1 is measured by the protein-protein interaction measurement method described above (step (2)). can do. If the measured relative value of the level of interaction between PD-L1 and PD-1 relative to the level of interaction between wild-type PD-L1 and PD-1 is less than the reference value, the mutated amino acid residue or site derives an interaction inhibitor site (Confirmation) Excluded. This is because, as described above, it is not easy to distinguish interaction inhibition by mutation from inhibition of interaction by inhibitor.
  • the 'reference value' is when the level of interaction (signal value) between wild-type PD-L1 and PD-1 is normalized to 1, in the range of 0 (no signal is generated) to less than 1, such as 0.1 to 0.9. It may be a selected value, in embodiments, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8 or 0.9, but is not limited thereto.
  • the 'above the reference value' is a relative value of the interaction level between the wild-type PD-L1 and PD-1 of the interaction level between the mutation PD-L1 and PD-1 (e.g., the interaction between the mutation PD-L1 and PD-1)
  • Level (signal value) divided by the interaction level (signal value) between wild type PD-L1 and PD-1 is 0.1 or more, 0.2 or more, 0.3 or more, 0.4 or more, 0.5 or more, 0.6 or more, 0.7 or more, 0.8 or more , Or 0.9 or more (eg, 0.2 or more) (the upper limit may be 1).
  • the step (a) is relative to the interaction level between the wild-type PD-L1 and PD-1 of the level of interaction between the mutations PD-L1 and PD-1 as described above is 0.1 or more, 0.2 or more, It may be to perform a variation of amino acid residues such that 0.3 or more, 0.4 or more, 0.5 or more, 0.6 or more, 0.7 or more, 0.8 or more, or 0.9 or more (for example, 0.2 or more) (the upper limit value may be 1).
  • step (b) the mutant PD-1 and the wild-type PD-L1 prepared in the step (a) are reacted with the mutant PD-L1 and the wild-type PD-1, and a signal value by interaction is measured.
  • the normalized value of the signal value to the interaction signal value between wild-type PD-L1 and PD-1 is 0.1 or more, 0.2 or more
  • Samples of 0.3 or more, 0.4 or more, 0.5 or more, 0.6 or more, 0.7 or more, 0.8 or more, or 0.9 or more are selected, and an interaction inhibitor between PD-L1 and PD-1 is selected for the selected sample. It may be to perform the step of input.
  • step (a) is one or more (e.g., one) selected from the group consisting of Y68, Q75, K78, T76, I126, L128, A132, I134, and E136 of PD-1 (e.g., SEQ ID NO: 1).
  • the amino acid residue of (e.g., any one selected from the group consisting of Y68, Q75, T76, I134, and E136) with another amino acid to generate a variant PD-1, and / or PD-L1 (e.g., SEQ ID NO: 5) one or more (e.g., one) amino acid residues (e.g., D25, Y56, E58) selected from the group consisting of T20, D25, D26, Y56, E58, R113, M115, A121, D122, Y123, K124, and R125 , R113, and any one selected from the group consisting of R125) may be substituted with another amino acid to generate a variant PD-L1.
  • amino acid residue of e.g., any one selected from the group consisting of Y68, Q75, T76, I134, and E136
  • PD-L1 e.g., SEQ ID NO: 5
  • one or more amino acid residues e.g.
  • the above criteria are applicable to variations other than amino acid residue substitution.
  • mutations other than amino acid residue substitution are performed on the same site (a binding site or a surrounding amino acid residue) of PD-L1 or PD-1, measurement is performed in the same manner as described above when the charge is changed. If the interaction level is less than the reference value and the interaction level when the length is changed is more than the reference value, mutations that change the charge are excluded from the derivation target, and mutations that change the length are included in the derivation target, and finally the length Variation mutation
  • the relevant site can be included in the target site of the inhibitor action.
  • the mutation performed in step (a) is to change the length of the site, or the following steps (b) and (c) include mutations in which the length of the reactants obtained in step (a) is changed. It may be carried out on the reactants.
  • Variants PD-1 and wild-type PD-L1 prepared in step (a) or selected as described above, or interaction inhibitors between PD-L1 and PD-1 are introduced into mutations PD-L1 and wild-type PD-1. And the level of protein-protein interaction between variant PD-1 and wild-type PD-L1 or variant PD-L1 and wild-type PD-1 (abbreviated as the level of protein-protein interaction between variants PD-L1 and PD-1). And measuring.
  • the interaction inhibitor between PD-L1 and PD-1 may be at least one selected from substances (eg, small molecule compounds, antibodies, etc.) that are already known or expected to have interaction inhibitory activity between PD-L1 and PD-1.
  • the interaction inhibitor between PD-L1 and PD-1 is a compound having a structure of Formula I (eg, Formula 1), a compound having a structure of Formula II (eg, Formula 2), and pharmaceutically It may be selected from acceptable salts.
  • the protein-protein interaction level between the mutant PD-L1 and PD-1 can be measured by the protein-protein interaction measurement method (step (2)) described above.
  • the protein-protein interaction level between the mutated PD-L1 and PD-1 measured after treatment with the interaction inhibitor between PD-L1 and PD-1 in step (b) above is a protein-protein interaction between wild-type PD-L1 and PD-1.
  • the method is characterized in that the protein-protein interaction level (signal value) between wild-type PD-L1 and PD-1 is administered after the inhibitor is administered to wild-type PD-L1 and wild-type PD-1 prior to the comparing step. ) May be further included.
  • the protein-protein interaction level can be measured by the protein-protein interaction measurement method described above (step (2)).
  • the mutated amino acid residue or amino acid region is not a functional amino acid residue or functional region of the inhibitor.
  • the measured protein-protein interaction level between the inhibitor-treated variant PD-L1 and PD-1 is higher than the protein-protein interaction level between the inhibitor-treated wild-type PD-L1 and PD-1 (increased compared to the wild type), Since the inhibitor does not exert a protein-protein interaction inhibitory effect due to the mutation, it can be determined (confirmed) that the mutated amino acid residue or amino acid site is a functional amino acid residue or functional site of the inhibitor.
  • the interaction inhibitor action site derived by the method of the present specification may have an excellent effect in deriving a site where the interaction inhibitor acts indirectly rather than acting on the direct PD-1 and / or PD-L1 binding site.
  • the PPI inhibitor drug not only directly inhibits the site where the two proteins bind, but also includes binding or acting on other sites nearby to inhibit the binding of the direct binding site. Since the action of PPI is not a simple amino acid sequence, it works in a complex manner across a wide interface, so the site where the PPI drug works and the way it works can be designed in a variety of ways. Therefore, the method for deriving an action site according to the present specification may have an excellent effect as a method performed in consideration of an action method and a function of a PPI drug.
  • PD-L1 e.g., SEQ ID NO: 5
  • L1 and PD-1 interaction inhibitors may be included in the action amino acid
  • PD-1 eg, SEQ ID NO: 1
  • R136 may be included in the inhibitor action amino acid.
  • the identified action site or functional amino acid residue of the interaction inhibitor of PD-L1 and PD-1 confirms (identifies) the mechanism of inhibitory action of the interaction inhibitor between PD-L1 and PD-1, and / or new PD -L1 and PD-1 interaction inhibitors, targets of the inhibitors (e.g., immune anti-cancer agents), biomarkers, etc. can provide useful information for exploring (developing).
  • compositions or inhibition, treatment / prevention methods described herein are active ingredients of compounds having the structure of Formula I (eg, Formula 1), Compounds having the structure of Formula II (eg, Formula 2), and pharmaceuticals thereof It may be to include or administer one or more selected from the group consisting of acceptable salts in a "pharmaceutically effective amount".
  • the "pharmaceutical effective amount” may mean a content or dosage in the pharmaceutical composition of an active ingredient capable of exhibiting a desired pharmacological effect, the method of formulation, the mode of administration, the patient's age, weight, sex, morbidity, food , Dosing time, dosing interval, route of administration, rate of excretion and response susceptibility.
  • the daily or single dose of the active ingredient is 0.0001 to 1000 mg / kg (weight), 0.001 to 500 mg / kg, 0.01 to 100 mg / kg, 0.1 to 50 mg / kg, or 0.5 to 20 mg / kg range, but is not limited thereto.
  • the daily or single dose may be formulated as a single dosage form in unit dose form, or appropriately divided into dosage forms, or may be prepared by incorporating into a multi-dose container.
  • the content of the active ingredient in the pharmaceutical composition can be appropriately adjusted according to the use form of the pharmaceutical composition, the patient's condition, the desired effect, for example, 0.0001 to 99.9% by weight, 0.001 to 99.9% by weight, 0.01 to 99.9% by weight, 0.1 To 99.9 wt%, 0.5 to 99.9 wt%, 1 to 99.9 wt%, 5 to 99.9 wt%, 10 to 99.9 wt%, 15 to 99.9 wt%, 20 to 99.9 wt%, 25 to 99.9 wt%, 30 to 99.9 wt% Weight percent, 35 to 99.9 weight percent, 40 to 99.9 weight percent, 45 to 99.9 weight percent, 50 to 99.9 weight percent, 55 to 99.9 weight percent, 0.0001 to 90 weight percent, 0.001 to 90 weight percent, 0.01 to 90 weight percent , 0.1 to 90 wt%, 0.5 to 90 wt%, 1 to 90 wt%, 5 to 90
  • the pharmaceutical composition may be in the form of a solution, suspension, syrup or emulsion in an aqueous or oily medium, or may be formulated in the form of a powder, granule, tablet or capsule, and additionally a dispersant or stabilizer for formulation. It can contain.
  • administration may be performed by oral or parenteral routes.
  • parenteral administration intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection, endothelial administration, local administration of the lesion site, intranasal administration, intrapulmonary administration, or rectal administration may be performed.
  • an individual, patient, or subject to whom the active agent is administered is any mammal, such as a primate such as a human, monkey, rodent such as a mouse, rat, or cells, tissue, or isolated therefrom.
  • a culture thereof, and the like for example, a patient having a disease related to the interaction between PD-L1 and PD-1.
  • the disease related to the interaction between PD-L1 and PD-1 may be a disease related to an increase in the interaction between PD-L1 and PD-1 (eg, increased than normal), such as cancer, inflammation, and other immunity Disease, and the like.
  • the subject, patient or subject can be a cancer patient.
  • normal as a comparison criterion may refer to an individual or cell in a non-pathological condition, wherein the “non-pathological condition” is not a disease state, or mutation, tumorigenesis, functional and / or Or it may mean that it is not a condition that can cause a disease with morphological abnormalities.
  • normal cells may be individuals or cells that do not have a disease related to the interaction between PD-L1 and PD-1, and may be of the same or homologous origin as the administration target, cell, or tissue.
  • the cancer can be selected from all solid and blood cancers, for example, cancer associated with the interaction between PD-L1 and PD-1.
  • the cancer is squamous cell carcinoma, small cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous cell carcinoma of the lung, peritoneal cancer, skin cancer, melanoma of the skin or eye, rectal cancer, proximal cancer, esophageal cancer, small intestine cancer, endocrine Adenocarcinoma, parathyroid cancer, adrenal cancer, soft tissue sarcoma, urethral cancer, chronic or acute leukemia, lymphocytic lymphoma, stomach cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, bladder cancer, breast cancer, colon cancer, colon cancer, endometrial or uterine cancer, salivary gland cancer , Kidney cancer, prostate cancer, vulva cancer, thyroid cancer, head and neck cancer, brain cancer, and the like,
  • the term “effect” refers to a medical and / or pharmaceutical effect that a drug or treatment seeks to achieve in a treatment subject, the prevention and / or treatment of a disease possessed by the treatment subject, and / or It may mean relief and / or improvement of symptoms.
  • the effect may be an anti-cancer effect (prevention and / or treatment effect of cancer), and the anti-cancer effect inhibits the growth of cancer cells.
  • it may include an effect of inhibiting migration, invasion, and / or metastasis, and / or suppressing exacerbation of cancer, and / or reducing or eliminating resistance, and the like. have.
  • an apparatus for measuring protein-protein interaction for use in a method comprising a protein-protein interaction measurement step provided herein is provided.
  • the device for measuring protein-protein interaction is a device for measuring activation of a signal transduction pathway in a tissue, a device for predicting and / or monitoring responsiveness to a drug targeting a first protein, and a device suitable for treatment targeting a first protein It is applicable as a device for screening an individual and / or a device for confirming the efficacy of a drug targeting a first protein.
  • the first protein is PD-L1 or PD-1.
  • the device for measuring protein-protein interaction includes measuring the activation of a signal transduction pathway in cells or tissues described above, a method for predicting reactivity to a drug targeting a first protein, and a method for monitoring reactivity to a drug targeting a first protein , Applied to a method for selecting an individual suitable for treatment targeting a first protein, and / or a method for screening a drug, the interaction between biomolecules in a small sample is accurately and efficiently observed, analyzed, detected, and And / or has the advantage of being measurable.
  • An apparatus for measuring protein-protein interaction or an analytical method using the same can be usefully and effectively applied to a very small amount of a sample, such as a biopsy (eg, needle biopsy) sample.
  • the apparatus for measuring protein-protein interactions or an analysis method using the same accurately and efficiently observes, analyzes, detects, and / or interacts with various biomolecules (eg, proteins, nucleic acids, etc.) using a small sample. Or you can measure.
  • biomolecules eg, proteins, nucleic acids, etc.
  • the protein-protein interaction measuring device The protein-protein interaction measuring device
  • reaction portion containing a substance for capturing a first protein that specifically binds to the first protein
  • signal detection means may be further included.
  • the first protein is PD-L1 or PD-1.
  • the apparatus for measuring protein-protein interaction may be used to measure the degree and / or the degree of interaction (binding) between PD-L1 and PD-1.
  • the reaction unit may include a substrate on which the first protein capture material is immobilized on the surface, and the first protein capture material specifically binds to the first protein described in the preparation step of the substrate in which the first protein is immobilized.
  • It can be a substance, for example, an antibody or an antigen-binding fragment thereof.
  • the antibody or antigen-binding fragment thereof, as described above binds to a non-binding site (eg, C-terminal site) except for the N-terminal site of PD-L1, which is a binding site between PD-L1 and PD-1.
  • the reaction unit may be a well (eg, multi-well) type, slide type, channel type, array type, microfluidic chip, microtubule (capillary), but is not limited thereto.
  • the device for measuring protein-protein interaction may further include a second protein that interacts with the first protein.
  • the second protein is labeled with a labeling substance that generates a detectable signal (the labeling substance is, for example, chemically (e.g., covalently or non-covalently), recombinantly, or physically, bound), or labeled. It may be in the form of a tag to which the substance can be attached.
  • the first protein is any one selected from PD-L1 and PD-1, and the second protein is the other.
  • the first protein is PD-L1
  • the second protein is PD-1
  • the first protein is PD-1
  • the second protein is PD-L1.
  • the apparatus for measuring protein-protein interaction to normalize (normalize) the signal value measured by the signal detection means to the level of the first protein, a detection substance binding to the first protein and a binding substance to the detection substance It may further include a labeling material.
  • the detection material binding to the first protein may be a biomolecule (eg, antibody) that binds to the first protein at a site different from the capture material of the first protein included in the multi-well described above, and the labeling material Is a biomolecule (e.g., antibody) that is labeled with a labeling substance that generates a detectable signal (the labeling substance is, e.g., chemically (e.g., covalently or non-covalently bound) and is capable of binding to a detection substance that binds the first protein ).
  • the labeling substance is, e.g., chemically (e.g., covalently or non-covalently bound) and is capable of binding to a detection substance that binds the first protein ).
  • the signal detection means may be any signal detection means commonly used depending on the signal generated from the labeling substance used.
  • the signal detection means may include a signal stimulation unit and a signal detection unit, and in addition, may further include a signal analysis unit for analyzing (eg, quantitative or imaging) the measured signal.
  • signal stimulation, signal detection, and signal analysis can each be performed at different sites, or at least two or more of them may be performed simultaneously or sequentially at one site.
  • the signal detection means may be selected from all means capable of generating and detecting a fluorescence signal, for example, a fluorescence signal stimulator (eg, light source), and a fluorescence signal It may include a detection unit, and / or a fluorescent signal analysis unit.
  • a fluorescence signal stimulator eg, light source
  • a fluorescence signal It may include a detection unit, and / or a fluorescent signal analysis unit.
  • the signal detection means includes a total internal fluorescence microscope (Total Internal Reflection Fluorescence (TIRF) microscope) or a confocal microscope (for detecting light sources and fluorescence signals), or in addition, a fluorescence camera, such as EMCCD (Electron A multiplying charge-coupled device (CMOS) camera or a complementary metal oxide semiconductor (CMOS) camera may be additionally included to perform light source supply and imaging and / or quantification of fluorescent signals.
  • EMCCD Electro A multiplying charge-coupled device
  • CMOS complementary metal oxide semiconductor
  • a kit for measuring protein-protein interaction includes a reaction moiety that includes a substance for capturing a first protein that specifically binds to a first protein as described above.
  • the protein-protein interaction measurement kit may be used to determine whether and / or the degree of interaction (binding) between PD-L1 and PD-1.
  • the protein-protein interaction measurement kit includes a kit for measuring activation of a signaling pathway involving PD-L1 and PD-1 in tissues, a kit for predicting and / or monitoring responsiveness to drugs targeting the first protein, It is applicable as a kit for selecting an individual suitable for treatment targeting the first protein, and / or as a kit for confirming the efficacy of a drug targeting the first protein.
  • the kit for measuring protein-protein interaction has the advantage of being able to accurately, efficiently observe, analyze, detect, and / or measure the interaction between PD-L1 and PD-1 in small samples. Therefore, the multi-well or analytical method using the same can be usefully and effectively applied to a very small amount of a sample, such as a biopsy (eg, needle biopsy) sample.
  • a biopsy eg, needle biopsy
  • the interaction inhibitor between PD-L1 and PD-1 provided in the present specification is a small-molecule compound, which is easy to manufacture and can be mass-produced, and can be actively utilized in the treatment of immuno-cancer cancer because the cost is cheaper than that of antibody drugs.
  • the interaction inhibitor screening method between PD-L1 and PD-1 may additionally screen inhibitors having superior efficacy other than the compounds presented herein using protein interaction single molecule measurement technology.
  • the method for deriving an action site of an inhibitor of a PD-L1 and PD-1 interaction provided in the present specification can derive an action mechanism of the inhibitor, and can also be used to discover targets and biomarkers of immunocancer drugs.
  • the site of action of the PD-L1 and PD-1 interaction inhibitors provided herein can be utilized as targets of immuno-cancer agents in addition to the small molecule compounds provided herein.
  • 1A is a schematic diagram showing a process of screening a protein-protein interaction inhibitor using a cell lysate expressing GFP-PD-1 and mcherry PD-L1, respectively.
  • Figure 1b is a fluorescent image of the protein-protein interaction obtained by proceeding using 10nM GFP-PD-1 and mcherry PD-L1
  • Figure 1c is the result of quantitation (PPI complex number; Fluorescence-counts; F-counts It is a graph showing).
  • FIG. 2 is a graph showing the number of PPI complexes (F-counts) between PD-1 / PD-L1 obtained using a compound of the PPI drug library (Total 10434 compounds, among them, 8540 from ASINEX library & Rest from FDA approved library ).
  • 3A shows F-counts (left) and fluorescence images (right) when PD-L1 is immobilized on a substrate and when PD-1 is immobilized.
  • 3B shows the cluster ratio (%) (left) and fluorescence images (right) of F-counts when PD-L1 is fixed to a substrate and when PD-1 is fixed.
  • 4A and 4B are structural diagrams of a protein interaction inhibitor between PD-1 and PD-L1.
  • Figure 4c is a protein interaction value between the concentration (concentration) PD-1 and PD-L1 after each injection of Figure 4a (compound 1), Figure 4b (compound 2) and BMS-202 (normalized PPI (%): compound
  • the signal shown in the well (DMSO treatment) without treatment was normalized to 100%, and the number of PPI complexes (both in cluster or single form) were counted and treated relative to each concentration. Shows the degree of change (x-axis: compound concentration).
  • FIG. 5A shows F-counts values (left) by interaction of PD-1 and PD-L1 after mutation of some residues of PD-L1, and PD-1 and PD- after mutation of some residues of PD-1. This is the F-counts value (right) due to the interaction of L1.
  • 5B is a graph showing resistance of some regions to compound 1 after mutation among regions derived from FIG. 5A.
  • WT shows the change value of F-counts before / after adding compound 1 to non-mutated PD-1 and PD-L1.
  • 5C is a graph showing resistance of some regions to compound 2 after mutation among the regions derived from FIG. 5A.
  • WT shows the change value of F-counts before / after adding compound 2 to non-mutated PD-1 and PD-L1.
  • FIG. 6 is a graph showing the results (cell viability,%) of confirming the anti-cancer effect of compound 1 and compound 2 through a tumor / immune cell co-culture experiment (X-axis: compound treatment concentration).
  • FIG. 7 is a graph showing the number of PPI complexes (F-counts) between PD-1 / PD-L1 obtained by fixing various antibodies in Example 1.7 to a substrate and using GFP-PD-1 and mcherry PD-L1. .
  • 8A schematically shows the inhibitor candidate drug screening process.
  • 8B is a graph showing test results for optimizing the reaction conditions (reaction time) of a one-step reaction in a tube for drug screening.
  • 8C shows the number of PPI complexes (F-counts) between PD-1 / PD-L1 obtained using two commercially available PD-1 / PD-L1 inhibitors BMS202 and S7911 (above, purchased from Selleck Chem). It is a graph.
  • FIG. 9A schematically shows a design process of a PD-L1 mutant construct for epitope mapping.
  • 9B shows the degree of binding of PD-L1 antibody (9A11) to PD-L1 WT (wild type), d280, or d270 variants.
  • 9C shows the degree of protein-protein interaction between PD-1 and PD-L1 WT, d280, or d270 variants.
  • Example 1 Measurement of the interaction between PD-1 and PD-L1
  • PD-1 was labeled with GFP and GFP labeled PD-1
  • PD-L1 was labeled with mcherry to prepare mcherry labeled PD-L1.
  • PD-1-GFP is human PD-1 (GenBank Accession No: NP_005009.2 encoded by NM_005018.3) protein sequence from 1 to 288, including the unique signal sequence (SEQ ID NO: 1) and GFP (amino acid) linked to the carboxy terminus (C-terminal) of the amino acid sequence
  • MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK (SEQ ID NO: 2)) consists of the two proteins were prepared to be connected by a peptide linker consisting of 19 amino acids [N '- (PD-l) - (peptide linker) - (GFP) -C'] .
  • amino acid sequence of the linker used between the PD-1 and GFP and the nucleic acid sequence encoding the same are as follows:
  • the linker may include one or more G (glycine) and / or one or more S (serine), but is not limited thereto. Since glycine and serine are relatively flexible compared to other amino acids, they can be advantageous for protein folding and PPI measurement.
  • PD-L1-mCherry is a human PD-L1 (GenBank Accession No: NP_054862.1 encoded by NM_014143.4) protein sequences 1 to 290, including the unique signal sequence (SEQ ID NO: 5) and the protein carboxy-terminal sequence (amino acid sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK (SEQ ID NO: 6)) mCherry connected to the (C-terminal) of the is composed of the two proteins were prepared to
  • amino acid sequence of the linker used between the PD-L1-mCherry and the nucleic acid sequence encoding the same are as follows:
  • the linker used has a structure composed of 16 amino acids, and connects PD-L1 of the N terminal and mCherry of the C terminal.
  • the linker may include one or more G (glycine) and / or one or more S (serine), but is not limited thereto.
  • glycine and serine are relatively flexible compared to other amino acids, they can be advantageous for protein folding and PPI measurement.
  • linker becomes too short, binding with PD_L1 antibody (e.g., 9A11 (Cell Signaling Technology, # 29122S)) using C-terminus as an epitope is severely inhibited and pull-down efficiency This can drop a lot, which can affect the PPI measurement.
  • PD_L1 antibody e.g., 9A11 (Cell Signaling Technology, # 29122S)
  • the label (ie, mcherry in this example) bound to PD-L1 fixed to the substrate (ie, used as the first protein) is not essential for PPI measurement, and PD-1 / PD without mCherry attachment to PD-L1 -L1 interaction can be measured.
  • a label eg, mCherry
  • PD-L1 attached to the substrate can be quantified.
  • fluorescence can be quantified using a spectrophotometer
  • PD-L1 having a desired concentration can be coated on the substrate, and conversely, the number of PD-L1 coated on the substrate under the corresponding conditions can also be quantitatively tracked.
  • Tracking the number of PD-L1 coated on a substrate can help negative selection of inhibitors when drug screening.
  • a PD-1 * (* is a fluorescent label) / PD-L1 / inhibitor mixture is incubated on a substrate through a tube reaction and PD-1 * is counted, drugs that inhibit the interaction between PD-1 and PD-L1 are selected.
  • drugs that inhibit the binding of PD-L1 and anti-PD-L1 antibodies may also be incorrectly screened.
  • by observing the number of PD-L1 bound to the substrate it is possible to select the wrongly selected drugs again.
  • the two genes encoding [(PD-1)-(peptide linker)-(GFP)] and [(PD-L1)-(peptide linker)-(mCherry)] prepared above were inserted into pCDNA 3.1 backbone (Addgene), respectively. Then, it was introduced into HEK293T cells and expressed as a protein.
  • any conventionally available means for example, transduction using PEI (polyethyleneimine), lipofection using lipofectamine, or the like, may be used.
  • PEI is a material with a highly positive charge. It contains DNA, penetrates into cells, and expresses it as a protein.
  • the specific process of transfection with PEI is as follows:
  • 500,000 HEK293T cells (ATCC [293T (ATCC® CRL-3216TM)]) were prepared based on a 100 mm dish. Prepare 2 ml of Opti-MEM buffer (Thermo Fisher Scientific), 1 ml of DNA (prepared [(PD-1)-(peptide linker)-(GFP)] and [(PD-L1)-(peptide linker)-) mCherry)], each vector containing a gene encoding 20ug, and the remaining 1ml was mixed with 50ug of PEI, respectively. After 5 minutes, DNA and PEI were mixed with each other and incubated for an additional 20 minutes. The DNA and PEI mixture was treated with the prepared HEK293T cells, and after 48 hours of culture, the cells were collected.
  • Opti-MEM buffer Thermo Fisher Scientific
  • DNA prepared [(PD-1)-(peptide linker)-(GFP)] and [(PD-L1)-(peptide linker)-) mCherry)
  • protease inhibitor Sigma-Aldrich (11836170001)
  • phosphatase inhibitor Sigma-Aldrich (P5726)
  • a channel-type substrate made of quartz or a well-shaped substrate made of acrylic was prepared.
  • washing and PEG coating were performed with reference to the coverslip treatment procedure described above.
  • the prepared coverslip and acrylic substrate were used. Before the test, the coverslip and acrylic substrate were thawed or assembled, or pre-assembled after the PEG coating was finished, and stored in -20 °C in assembled form. Used before thawing.
  • Example 1.2 In the substrate prepared in Example 1.2, Avidin-based protein Neutravidin (Thermo, A2666) was added at a concentration of 0.1 mg / ml. After reacting for 5 minutes at room temperature, the substrate was washed twice with 30 ul of PBS buffer.
  • the prepared substrate was treated with an antibody against the first protein.
  • the antibody used was prepared as a biotin conjugated form.
  • the concentration of the antibody can be appropriately adjusted according to the affinity (dissociation constant, KD) of the antibody-antigen, and in this example, about 2 ug / ml was used, and the reaction time was about 5 minutes.
  • KD affinity (dissociation constant
  • the substrate treated with the anti-PD-L1 antibody (9A11 or # D8T4X) illustrated in Table 2 was washed twice using 30 ul of PBS buffer.
  • PD-L1 protein lysate prepared in Example 1 Prior to the prepared substrate, PD-L1 protein lysate prepared in Example 1 (supernatant after centrifugation of mCherry-PD-L1 expressing cell lysate; used as the first protein) was added to immobilize PD-L1 on the substrate. .
  • an antigen-antibody reaction it may continue to increase up to 15 minutes, and the antigen-antibody reaction efficiency may be lowered over time while exceeding 15 minutes, so the reaction time is set to about 15 minutes.
  • the substrate was washed with PBS containing tween 20 0.05% (v / v) buffer. Tween 20 0.05% reduces nonspecific binding and helps prevent the hydrophobic region of the membrane protein from being damaged.
  • the PD-1 protein lysate obtained in Example 1.1 was added to the substrate on which the PD-L1 protein was immobilized on the obtained surface.
  • PD-L1 protein was used at a concentration of 10nM
  • PD-1 protein was used at a concentration of 10nM, 30nM, or 50nM.
  • the test procedure is schematically shown in FIG. 1A.
  • the protein complex (PPI complex) imaging process is as follows:
  • the prepared substrate (either a well type or a quartz slide can be used) was fixed on a Total Internal Reflection Fluorescence (TIRF) microscope.
  • TIRF Total Internal Reflection Fluorescence
  • a wavelength of 488 nm was used, but it is not limited thereto, and any wavelength laser capable of emitting eGFP may be used (laser wavelength range: 460 to 500 nm).
  • Fluorescence images were obtained using an EMCCD (Electron-multiplying charge-coupled device; Andor iXon Ultra 897 EX2 (DU-897U-CS0-EXF)) camera.
  • the laser power range is a range in which the eGFP lifetime is maintained for about 11 seconds.
  • the photon generated in eGFP is converted into electrons through the device of the EMCCD and measured (photoelectric effect).
  • the number of electrons generated per photon can be changed through a gain value.
  • the higher the set gain the greater the number of electrons generated per photon, the higher the sensitivity of the EMCCD.
  • the background noise also increases, so the signal-to-noise ratio is important. Therefore, in the present embodiment, the gain of the EMCCD is adjusted to 40, but the present invention is not limited thereto, and may be appropriately changed based on the contents described above.
  • one condition one well or one channel
  • at least 10 images are obtained from different locations while moving positions.
  • the average and standard deviation are the representative values of each condition.
  • was set to Chapter 10 is the minimum standard, and the higher the number, the higher the statistical accuracy.
  • the PPI signal may form a cluster.
  • the laser power is reduced or the number of gains is reduced, the intensity of the fluorescence signal of the spot is reduced, so that the single GFP spot is almost invisible, only the signal of the cluster can be left, only the analysis of the cluster is performed, or only a single molecule is analyzed. It is thought that the corresponding step may be additionally performed when performing analysis or correlation analysis.
  • the protein complex was analyzed based on the toolkit provided by the Matlab program (provided by MathWorks).
  • the obtained fluorescence image was stored in 16-bit unsigned integer format.
  • the following procedure was performed using a total of 3 frames of 5-7 frames. As described above, since the washing process is included, the signal strength and stability seen in imaging are very good, and 1-3 frames are analyzed out of 10 frames and 8-10 frames are analyzed, and 1-10 frames are analyzed. Even when comparing the results of analyzing all of them, there was no significant difference. This section may vary depending on imaging conditions / equipment building conditions.
  • the initial start started at the top left.
  • One frame consists of 512x512 pixels.
  • the median value was obtained from 11 x 11 pixels to the right and 11 to the bottom, and the median value was subtracted from the value of the reference pixel [(Intensity_pixel)-(medianIntensity_11x11neighborhood)].
  • the above procedure was performed for all 512x512 pixels. Pepper & salt noise was removed through median filtering.
  • Threshold is a threshold value for all pixel values whose pixel intensity is below the threshold in the entire image. Through this, it is possible to remove the local maximum not generated by the fluorescent signal from the image.
  • the threshold value used in the imaging condition in this embodiment is 70.
  • PSF localized point spread function
  • the location of the local maximum was obtained (eg, i-th row, j-th column pixel).
  • a discrimination process was performed to determine whether the local maximum obtained above was actually generated from the PSF.
  • the minimum value of local maximum was defined (minimum intensity value), and only the case of greater than this minimum value among the obtained local maximum was used for analysis.
  • the minimum value is defined as 75, which may vary depending on the laser power / exposure time / equipment construction situation.
  • Information about 5x5 pixels was retrieved based on the finally obtained local maximum coordinates, and the center of brightness was obtained from these 5x5 pixels (centroid of intensity). At this time, if the obtained center of brightness deviates by more than 0.5 pixels from the existing local maximum coordinates (when 2D symmetry for the PSF shape disappears), it is determined as an abnormal fluorescent signal and removed from the analysis.
  • the number of PPI complexes was obtained by performing the process of a-c for all files. The information of each file photographed under the same conditions was collected to obtain the average and standard deviation. This value finally becomes the value representing the number of PPI complexes under specific conditions.
  • the number of PPI complexes obtained is a count of the PPI signal, but in addition, the intensity of the PPI signal may be obtained, or the ratio of a spot in the measurement area may be measured and analyzed.
  • the size of the cluster signal is reduced, that is, the spot where the intensity of fluorescence is too dark is reduced, and it is more advantageous for accurate calculation of the PSF. (There may be cases where the local maximum is reduced, and overlapping spots may be distinguished).
  • cluster intensity the characteristics of the drug can be grasped more closely.
  • intensity of only a single molecule can be derived.
  • a cluster When a cluster is approached by specifying, it can be analyzed by count or sum of signals having cluster intensity above a certain threshold, or by analyzing the cluster ratio. The same applies to the analysis of a single molecule.
  • the fluorescence signal b value was analyzed for the fluorescence signal a value.
  • the fluorescence signal value may be PPI count, sum, or ratio.
  • the fluorescence signal b value for the fluorescence signal a value By analyzing the fluorescence signal b value for the fluorescence signal a value, more qualitative data can be confirmed than in the case where only the fluorescence signal b value is analyzed.
  • the fluorescence signal a value When the fluorescence signal a value is measured, the effect on PD-L1 * which is injected with a specific concentration of mcherry-PD-L1 into the substrate but is not attached to the substrate can be considered. Therefore, the accuracy can be improved by quantifying the interaction between PD-L1 and PD-1 *.
  • a PD-1 variant comprising K78A, a PD-1 mutant that inhibits the binding of PD-1 and PD-L1, or a PD-L1 mutant D122A + that inhibits the binding of PD-1 to PD-L1 The same test was performed as above, using a PD-L1 variant comprising K124A, or a PD-1 variant comprising A132L, a PD-1 mutation that enhances the binding of PD-1 to PD-L1.
  • the fluorescence image obtained by using the anti-PD-L1 antibody 9A11 (# CST-29122; Cell Signaling Technology) on the substrate is shown in FIG. 1B, and the result of quantification (PPI complex number; F-counts) is shown in FIG. 1C.
  • PPI complex number; F-counts PPI complex number; F-counts
  • an antibody used to immobilize PD-L1 on the substrate can be appropriately selected in order to expose a specific domain of PD-L1 (a site binding to PD-1). have.
  • 9A11 (# CST-29122; Cell Signaling Technology) is an antibody that binds to the C-terminus of PD-L1
  • # D8T4X Cell Signaling Technology
  • PD-L1 Is an antibody that binds to the N-terminal of, and among the anti-PD-1 antibodies
  • D4W2J Cell Signaling Technology
  • NAT105 (Abcam) is the N-terminal of PD-1 It is an antibody that binds to.
  • the number of PPI complexes (F-counts) obtained as a result of performing the above-described test by fixing these anti-PD-L1 antibodies to the substrate is shown in FIG. 7.
  • the concentration of PD-L1 when tested using an anti-PD-L1 antibody, the concentration of PD-L1 was fixed at 5 nM, and the PD-1 concentration was tested while increasing to 0 nM, 5 nM, and 15 nM, and anti-
  • the concentration of PD-1 was fixed at 5 nM, and the PD-L1 concentration was tested while increasing to 0 nM, 5 nM, and 15 nM.
  • the interaction inhibitor was screened using the interaction measurement method of Example 1.
  • the average value of the signal observed when the inhibitor was not treated (Example 1.4, the number of PPI complexes measured according to PPI complex analysis (count of PPI signals)) is converted to 1, and BMS-202 (CAS used as a control) No .: 1675203-84-5), the average value of the observed signal was converted to zero.
  • Drugs showing a signal value below the reference value were selected as an inhibitor by setting an arbitrary reference value to 0.4.
  • the set reference value is an arbitrary reference value, and may be set to a smaller value according to the distribution of candidate drugs. That is, the setting of the reference value may be changed by repeated implementation.
  • the BMS-202 is a compound that inhibits the interaction between PD-1 and PD-L1 and is a compound commonly used in experiments.
  • FIG. 4C the results of the same test using the control compound BMS-202 are also shown.
  • the BMS-202 is a compound that inhibits the interaction between PD-1 and PD-L1 and is a compound commonly used in experiments.
  • the Y-axis normalizes the signal seen in the well (DMSO treatment) that is not treated with the compound to 100%, and the PPI complex (cluster or single form) when the compound is processed by concentration Number)), and the X-axis represents the compound treatment concentration.
  • Compound 1 or 2 was found to have a significantly higher degree of inhibiting the interaction of PD-1 and PD-L1 than BMS-202, which is known as an interaction inhibitor of PD-1 and PD-L1. You can.
  • PD-L1 and PD-1 interaction sites or peripheral residues were derived as inhibitor inhibitor sites.
  • PD-L1 (SEQ ID NO: 5) binding site or surrounding residues: T20, D25, Y56, E58, R113, M115, A121, D122, Y123, K124, R125;
  • PD-1 (SEQ ID NO: 1) binding site or surrounding residues: Y68, Q75, T76, K78, I126, L128, A132, I134, E136.
  • variation of amino acid residues derived from the candidate group was reacted with variation PD-L1 or variation PD-1 and wild-type PD-1 or wild-type PD-L1, respectively, and PPI signals due to interaction between them were measured (see Example 1). ).
  • the variation of the amino acid residue means that the amino acid residue is different from the wild-type amino acid residue, and the specific variation is described in the x-axis of FIGS. 5A to 5C.
  • the PPI signal by the interaction of PD-L1 and wild-type PD-1 which is a variant of D25 of PD-L1 (SEQ ID NO: 1), was measured.
  • the PPI signal by the interaction of PD-1 and wild-type PD-L1 mutated Y68 was measured.
  • the PPI signal by the interaction of PD-1 and wild-type PD-L1 mutated Y68 was measured.
  • the binding sites of PD-L1 or PD-1 or peripheral residues are individually mutated to measure the PPI signal by the interaction of PD-1 and PD-L1, and the results are shown in FIG. 5A.
  • the binding site or surrounding residues in which the PPI signal after Mutation is equal to or lower than the PPI signal before mutation, but has a relative value to the PPI signal 1 before Mutation of 0.2 or more was selected.
  • the obtained functional site (binding site or surrounding residues) is divided into two groups, mutated and non-mutated, and after compound 1 or 2 is added, between the mutant or wild-type PD-L1 and the wild-type or mutant PD-1.
  • PPI values were measured, and the results are shown in FIGS. 5B (Compound 1 treatment) and 5C (Compound 2 treatment), respectively. If the PPI value when the compound is processed after the mutation is equal to or lower than the PPI value when the compound is processed without mutation, except for derivation, and when the compound is processed after the mutation, the PPI value is compounded without mutation When the PPI value increased (ie, the PPI inhibitory activity of the compound decreased), it was included in the derivation target.
  • the amino acid residues at or near the binding site between PD-L1 and PD-1 acting on the finally derived compounds 1 or 2 are E58, R113, R125, and PD-1 (SEQ ID NO: 5) of PD-L1 (SEQ ID NO: 5).
  • No. 1) is E136. That is, it is shown that the compound 1 or 2 acts on E58, R113, R125, and E136 of PD-1 or PD-L1 to inhibit the interaction of PD-1 and PD-L1 and attenuate the PPI signal.
  • FIG. 3A Total GFP-labeled count and fluorescence images are shown in Figure 3A (PSF cut off> 150). As shown in FIG. 3A, it can be confirmed that the PD-L1 was fixed to the substrate and the PD-1 was fixed, showing similar results.
  • the cluster ratio (%) of GFP PD-L1 and GFP PD-1 (calculated by [Count @ PSF cut off> 350 / Count @ PSF cut off> 150]) is shown in FIG. 3B.
  • the cluster ratio (%) is a value obtained by dividing the cluster population defined as PSF (point spread function) cut off 350 or higher by the total count of cut off 150 or higher as a percentage.
  • PSF point spread function
  • the subsequent analysis process is performed in the same manner as the imaging and PPI complex analysis of the PPI complex of Example 1.
  • AEGFR Jurkat cells (Effector Cell Line: PD-1; ATCC; TIB-152) with immune activity against cells expressing EGFR and 293T cells overexpressing EGFR (Target Cell Line: EGFR / PD-L1; KCLB; CRL -3216) was co-cultured, and then treated with a control drug (BMS-202), a compound of Formula 1, or a compound of Formula 2 in an amount of 0.01 to 10 uM, respectively, and the cell viability was measured.
  • the tumor / immune cell co-culture model mimics the expression of PD-L1 and PD-1 by tumor cells and immune cells, respectively, and is designed to reduce cell viability when interaction between them is inhibited.
  • the prepared substrate was treated with anti-PD-L1 antibody 9A11 (CST # 29122) in an amount of about 2 ug / ml for about 5 minutes to prepare a substrate coated with anti-PD-L1 antibody (9A11) on the surface. .
  • the prepared substrate was washed twice using 30 ul of PBS buffer, and then used in the test.
  • GFP-PD-1 (10 nM) and mcherry-PD-L1 (30 nM) prepared in Example 1 is a PD-1 / PD-L1 interaction inhibitor
  • the reactant reacted for 30 minutes in the tube with the candidate substance was added to the prepared substrate in an amount of 20 ul to react for 15 minutes.
  • the inhibitor When the inhibitor inhibits the interaction of PD-L1 / PD-1 *, it can be divided into three categories: 1) When the inhibitor binds to the binding interface of PD-L1 and PD-1 with strong intensity; 2) when the inhibitor (PD-1 independently) binds to a specific site of PD-L1 to induce structural changes of PD-L1; And 3) when the inhibitor (PD-L1 independently) binds to a specific region of PD-1 to induce structural changes of PD-1.
  • FIG 8A schematically shows the screening process of the inhibitor candidate drug of the present embodiment.
  • Figure 8b shows the test results for optimizing the reaction conditions of the one-step reaction in the tube, 30 minutes or 2 hours after mixing the GFP-PD-1 and mcherry-PD-L1 prepared in Example 1 in the tube It is a graph showing the results of incubation and tracking fluorescence counts (F-counts).
  • 'Negative' refers to a reactant without mch-PDL1 added to the tube
  • 'Negative' refers to a reactant without GFP-PD1 added to the tube.
  • the number of PPI complexes did not show a significant difference in the case of incubation for 30 minutes and incubation for 2 hours.
  • a PD-L1 mutant construct For epitope mapping of an anti-PD-L1 antibody suitable for immobilizing PD-L1 on a substrate, a PD-L1 mutant construct was designed (see FIG. 9A). Specifically, in order to confirm the epitope of the PD-L1 cytosolic domain targeting antibody, a PD-L1 cytosolic domain deletion mutant construct was designed, wherein the mutant is a cytosolic part corresponding to amino acids 260-290 of the PD-L1 amino acid sequence. Divided into 10 units, a protein containing a variation of d280 (deletion of amino acid site after 281st) or d270 (deletion of amino acid site after 271), respectively, was produced.
  • Example 1 through PD-L1 pull-down assay, PD of PD-L1 antibody (9A11) previously shown to be effective in measuring PD-L1 / PD-1 interaction (see Example 1.7 and FIG. 7) -L1 WT (wild type), d280, or d270, the degree of binding to the variant (the number of fluorescent complexes by binding between the antibody and PD-L1: F-counts) was measured and is shown in FIG. 9B. As shown in Figure 9b, in the case of the d280 or d270 variant of PD-L1, it does not bind to the antibody at all, but in the case of WT, it can be confirmed that it binds to the antibody sensitively.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Urology & Nephrology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Investigating Or Analysing Biological Materials (AREA)

Abstract

PD-L1과 PD-1 간 단백질-단백질 상호작용 저해제, PD-L1과 PD-1 간 단백질-단백질 상호작용 저해제를 스크리닝 하는 방법, PD-L1 및 PD-1 간 단백질-단백질 상호작용 분석을 통하여 세포 또는 조직 내의 PD-L1 및 PD-1가 관련된 신호전달경로(signaling pathway)의 활성화 상태를 분석하는 방법 및 이를 이용하여 개인 맞춤형 치료제를 선정 및/또는 치료제의 효능을 모니터링하는 방법이 제공된다.

Description

PD-L1과 PD-1 간 상호작용 분석 방법, PD-L1과 PD-1 간 상호작용 저해제 및 상기 저해제의 스크리닝 방법
PD-L1과 PD-1 간 단백질-단백질 상호작용 저해제, PD-L1과 PD-1 간 단백질-단백질 상호작용 저해제를 스크리닝 하는 방법, PD-L1 및 PD-1 간 단백질-단백질 상호작용 분석을 통하여 세포 또는 조직 내의 PD-L1 및 PD-1가 관련된 신호전달경로(signaling pathway)의 활성화 상태를 분석하는 방법 및 이를 이용하여 개인 맞춤형 치료제를 선정 및/또는 치료제의 효능을 모니터링하는 방법에 관한 것이다.
항암제는 1세대 화학항암제, 2세대 표적항암제, 3세대 면역항암제로 그 개발이 전개되고 있다.
최근 대두되고 있는 면역항암제는, 인체 내의 면역시스템을 조정하여 암을 치료하는 방법으로 면역관문억제제, CAR-T 세포치료제, 항암바이러스 등이 있다.
면역관문 억제제는 면역세포의 활성을 억제하는 면역관문을 억제함으로써 면역 세포의 기능을 회복시키는 것으로, 현재까지 허가된 면역관문 타겟은 CTLA-4, PD-1, PD-L1이 있다.
PD-L1 (Programmed death-ligand 1)은 주로 암세포 표면에 존재하는 단백질로, CD274 (cluster of differentiation 274) 또는 B7-H1(B7 homolog 1)라고도 칭해지며, 40kDa의 타입 1 막 통과 단백질 (type 1 transmembrane protein)이다. PD-L1은 암세포 이외에도 면역세포(Macrophage 등)의 subtype에도 존재한다. PD-L1은 조직 이식, 면역 질환, 간염 등과 같은 다양한 질병에서 면역계를 억제하는데 주된 역할을 하는 것으로 알려져 있다.
PD-1 (Programmed cell death protein 1)은 CD279 (cluster of differentiation 279)라고도 칭해지며, 활성화된 T세포(면역세포)의 표면에 주로 존재하는 단백질로, 면역 체크포인트 중 하나이며, 림프절에서의 항원 특이적 T 세포(antigen-specific T-cell)의 아팝토시스 (apoptosis)를 촉진하고, 조절 T 세포 (regulatory T cells)의 아팝토시스는 감소시키는 역할을 한다. 또한, 암세포 표면에서 발현되어 mTOR 등의 신호전달(signaling pathway)을 통하여 암 증식(tumor proliferation)을 촉진하기도 한다.
PD-L1이 T 세포 표면에 있는 PD-1 단백질과 결합하면, T 세포는 암세포에 대한 공격능력을 상실한다. PD-L1 및/또는 PD-1는 항암제 개발에 있어서 중요한 표적이 될 수 있다.
현재까지 FDA 허가된 치료제는 PD-1을 표적하는 치료제인 옵디보(Opdivo), 키트루다(Keytruda)가 있고, PD-L1을 표적하는 치료제인 티센트릭(Tecentriq), 바벤시오(Bavencio), 임핀지(Imfinzi), 리브타요(Libtayo)가 있다. 허가된 치료제들은 항체로서 표적에 대한 affinity가 우수하여 약으로서 효능은 좋으나, 제조가 어렵고, 생산단가가 높은 단점을 갖는다. 이는 항체의약품이 갖는 필수불가결한 한계로서, 항체가 아닌 면역항암제의 개발이 필요한 이유이다. 따라서, 제조가 용이하고 생산단가가 상대적으로 낮은, 치료제의 대표적인 형태인 소분자화합물(small molecule)을 면역항암제로 개발하여, 환자의 치료에 적극적으로 활용할 필요가 있다.
일 예는 다음의 화학식 I 또는 화학식 II의 구조를 갖는 화합물 또는 이의 약학적으로 허용 가능한 염을 제공한다:
[화학식 I]
Figure PCTKR2019011265-appb-I000001
[화학식 II]
Figure PCTKR2019011265-appb-I000002
상기 화학식 I 및 II에 있어서,
R1은 수소 또는 탄소수 1 내지 3의 알킬 (예컨대, 수소)이고,
R2는 수소 또는 탄소수 1 내지 3의 알킬 (예컨대, 메틸)이고,
R3는 수소 또는 탄소수 1 내지 3의 알킬 (예컨대, 수소)이고,
R4는 수소 또는 탄소수 1 내지 3의 알킬 (예컨대, 메틸)이고,
R5는 수소, 탄소수 1 내지 3의 알킬, 또는 탄소수 1 내지 3의 알콕시 (예컨대, -O-CH3)임.
일 예에서, 상기 화학식 I 또는 II의 구조를 갖는 화합물 또는 이의 약학적으로 허용 가능한 염은 다음의 화학식 1 또는 화학식 2의 구조를 갖는 화합물 또는 이의 약학적으로 허용 가능한 염일 수 있다:
[화학식 1]
Figure PCTKR2019011265-appb-I000003
[화학식 2]
Figure PCTKR2019011265-appb-I000004
다른 예는 상기 화학식 I 또는 II (예컨대, 화학식 1 또는 화학식 2)의 구조를 갖는 화합물 또는 이의 약학적으로 허용가능한 염의 PD-L1과 PD-1의 상호작용(결합) 저해 용도 및/또는 이와 관련된 질병의 예방 및/또는 치료 용도를 제공한다.
보다 구체적으로, 일 예는 상기 화학식 I (예컨대, 화학식 1)의 구조를 갖는 화합물, 화학식 II (예컨대, 화학식 2)의 구조를 갖는 화합물, 및 이들의 약학적으로 허용가능한 염으로 이루어진 군에서 선택된 1종 이상을 포함하는, PD-L1과 PD-1의 상호작용 저해용 약학 조성물을 제공한다.
다른 예는 상기 화학식 I (예컨대, 화학식 1)의 구조를 갖는 화합물, 화학식 II (예컨대, 화학식 2)의 구조를 갖는 화합물, 및 이들의 약학적으로 허용가능한 염으로 이루어진 군에서 선택된 1종 이상을 PD-L1과 PD-1의 상호작용 저해를 필요로 하는 대상에게 투여하는 단계를 포함하는, PD-L1과 PD-1의 상호작용 저해 방법을 제공한다.
다른 예는 상기 화학식 I (예컨대, 화학식 1)의 구조를 갖는 화합물, 화학식 II (예컨대, 화학식 2)의 구조를 갖는 화합물, 및 이들의 약학적으로 허용가능한 염으로 이루어진 군에서 선택된 1종 이상의 PD-L1과 PD-1의 상호작용 저해에 사용하기 위한 용도, 또는 PD-L1과 PD-1의 상호작용 저해제 생산에 사용하기 위한 용도를 제공한다.
다른 예는 상기 화학식 I (예컨대, 화학식 1)의 구조를 갖는 화합물, 화학식 II (예컨대, 화학식 2)의 구조를 갖는 화합물, 및 이들의 약학적으로 허용가능한 염으로 이루어진 군에서 선택된 1종 이상을 포함하는, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 및/또는 치료용 약학 조성물을 제공한다.
다른 예는 상기 화학식 I (예컨대, 화학식 1)의 구조를 갖는 화합물, 화학식 II (예컨대, 화학식 2)의 구조를 갖는 화합물, 및 이들의 약학적으로 허용가능한 염으로 이루어진 군에서 선택된 1종 이상을 PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 및/또는 치료를 필요로 하는 대상에게 투여하는 단계를 포함하는, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 및/또는 치료 방법을 제공한다.
다른 예는 상기 화학식 I (예컨대, 화학식 1)의 구조를 갖는 화합물, 화학식 II (예컨대, 화학식 2)의 구조를 갖는 화합물, 및 이들의 약학적으로 허용가능한 염으로 이루어진 군에서 선택된 1종 이상의 PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 및/또는 치료에 사용하기 위한 용도, 또는 PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 및/또는 치료용 약학 조성물의 생산에 사용하기 위한 용도를 제공한다.
본 명세서에 제공된 약학 조성물, 및/또는 저해, 예방 및/또는 치료방법의 적용 대상은 PD-L1과 PD-1의 상호작용이 정상보다 높은 개체(예컨대, 인간 등의 포유 동물) 또는 상기 개체로부터 분리된 세포, 조직, 또는 이의 배양물일 수 있다.
다른 예는 PD-L1과 PD-1 간의 상호작용 측정을 위한 키트, 및 PD-L1과 PD-1 간의 상호작용 측정 방법을 제공한다. 일 예에서, 상기 PD-L1과 PD-1 간의 상호작용은 PD-L1과 PD-1 간의 클러스터 형성 비율 (cluster ratio)을 의미하거나 이를 통하여 측정되는 것일 수 있다. 다른 예에서, 상기 PD-L1과 PD-1 간의 상호작용은 단일 스팟(spot)에서의 상호작용일 수 있다.
상기 PD-L1과 PD-1 간의 상호작용 측정을 위한 키트는 (a) PD-L1 및 PD-1 중에서 선택된 어느 하나 (제1 단백질) 또는 상기 제1 단백질과 특이적으로 결합 가능한 물질 (예컨대, 항체)이 결합된 기판, 및 (b) PD-L1 및 PD-1 중에서 상기 (a)에서 선택된 제1 단백질과 다른 하나(제2 단백질)에 탐지 가능한 신호 (예컨대, 형광신호)를 발생하는 표지 물질 (표지물질: 예컨대, 단백질, 소분자 화합물 등)을 결합시킨 표지된 제2 단백질을 포함하는 것일 수 있다.
일 예에서, 상기 PD-L1과 PD-1 간의 상호작용 측정을 위한 키트는 (a) PD-L1 (제1 단백질) 또는 PD-L1과 특이적으로 결합 가능한 물질 (예컨대, 항체)이 결합된 기판, 및 (b) PD-1 (제2 단백질)에 탐지 가능한 신호 발생 물질 (표지물질: 예컨대, 형광 단백질, 형광 염료 등으로 이루어진 군에서 선택)을 결합시킨 표지된 PD-1을 포함하는 것일 수 있다. 이 경우, 상기 키트는 PD-L1과 PD-1 간의 클러스터가 형성된 형태로 상호작용을 측정할 수 있는 것일 수 있다.
다른 예에서, 상기 PD-L1과 PD-1 간의 상호작용 측정을 위한 키트는 (a) PD-1 (제1 단백질) 또는 PD-1과 특이적으로 결합 가능한 물질 (예컨대, 항체)이 결합된 기판, 및 (b) PD-L1 (제2 단백질)에 탐지 가능한 신호 발생 물질 (표지 물질: 예컨대, 형광 단백질, 형광 염료 등으로 이루어진 군에서 선택)을 결합시킨 표지된 PD-L1을 포함하는 것일 수 있다. 이 경우, 상기 키트는 PD-L1과 PD-1 간의 단일 스팟에서의 상호작용을 측정할 수 있는 것일 수 있다.
이 때, 상기 제1 단백질 (예컨대, PD-L1)은 탐지 가능한 신호 (예컨대, 형광신호) 발생 물질 (예컨대, 단백질, 소분자 화합물 등)이 결합되거나 결합되지 않은 것일 수 있다. 상기 기판이 PD-L1 및 PD-1 중에서 선택된 어느 하나 (제1 단백질, 예컨대, PD-L1)이 결합된 것인 경우, 상기 제1 단백질은 이와 결합 가능한 물질 (예컨대, 항체)를 통하거나 통하지 않고 직접 기판에 결합된 것일 수 있다.
PD-L1과 PD-1 간의 상호작용 측정 방법은,
(1) PD-L1 및 PD-1 중에서 선택된 어느 하나 (제1 단백질)이 상기 제1 단백질과 특이적으로 결합 가능한 물질 (예컨대, 항체)을 통하거나 통하지 않고 직접 결합된 제1 단백질이 고정화된 기판에 표지된 (표지 물질이 결합된) 제2 단백질 (PD-L1 및 PD-1 중에서 상기 (1)에서 선택된 제1 단백질과 상이한 단백질)을 첨가하여 반응시키는 단계; 및
(2) 단계 (1)에서 얻어진 반응물로부터 신호를 측정하여 PD-L1과 PD-1 간의 상호작용을 측정하는 단계 (단백질-단백질 상호작용 측정)
를 포함할 수 있다.
이 때, 상기 방법은 단계 1에서 사용되는 기판에 고정화된 제1 단백질이 PD-L1인 경우, PD-L1과 PD-1 간의 클러스터가 형성된 형태로 PD-L1과 PD-1 간의 상호작용을 측정하는 방법일 수 있다. 또는, 상기 방법은 단계 1에서 사용되는 기판에 고정화된 제1 단백질이 PD-1인 경우, PD-L1과 PD-1 간의 단일 스팟에서의 상호작용을 측정하는 방법일 수 있다.
다른 예는, PD-L1과 PD-1 간의 상호작용(결합)에 관여하는 아미노산 잔기를 제공한다. 상기 아미노산 잔기는 PD-L1과 PD-1 간의 결합 부위 또는 그 주변의 아미노산 잔기들 중에서 하나 이상 선택된 것일 수 있다. 일 구체예에서, 상기 PD-L1과 PD-1 간의 상호작용(결합)에 관여하는 아미노산 잔기는 PD-L1 (서열번호 5)의 T20 (20번째 위치의 아미노산 잔기 T (트레오닌; Thr)를 의미함, 이하 동일), D25, Y56, E58, R113, M115, A121, D122, Y123, K124, 및 R125로 이루어진 군에서 선택된 하나 이상, 및 PD-1 (서열번호 1)의 Y68, Q75, T76, K78, I126, L128, A132, I134, 및 E136로 이루어진 군에서 선택된 하나 이상을 포함할 수 있다. 예컨대, 상기 PD-L1과 PD-1 간의 상호작용(결합)에 관여하는 아미노산 잔기는 PD-L1 (서열번호 5)의 D25, Y56, E58, R113, 및 R125로 이루어진 군에서 선택된 하나 이상 (예컨대, 1, 2, 3, 4, 또는 5 개), 및 PD-1 (서열번호 1)의 Y68, Q75, T76, I134, 및 E136로 이루어진 군에서 선택된 하나 이상 (예컨대, 1, 2, 3, 4, 또는 5 개)을 포함할 수 있다. 다른 예에서, 상기 PD-L1과 PD-1 간의 상호작용(결합)에 관여하는 아미노산 잔기는 PD-L1과 PD-1 간의 상호작용 저해제 (예컨대, 화합물 1, 화합물 2, 또는 이이 약학적으로 허용 가능한 염)의 작용 부위일 수 있으며, 예컨대, PD-L1 (서열번호 5)의 E58, R113, 및 R125로 이루어진 군에서 선택된 하나 이상 (예컨대, 1, 2, 또는 3개), 및 PD-1 (서열번호 1)의 E136을 포함할 수 있다.
다른 예는 PD-L1과 PD-1 간 상호작용 저해제 및/또는 PD-L1과 PD-1 간 상호작용과 관련된 질병의 예방 또는 치료제의 스크리닝 방법을 제공한다. 상기 스크리닝 방법은,
(1) PD-L1 및 PD-1 중에서 선택된 어느 하나 (제1 단백질) 표지 물질이 결합된 제2 단백질 (PD-L1 및 PD-1 중에서 상기 (1)에서 선택된 제1 단백질과 상이한 단백질), 및 후보 화합물을 기판에 공급하는 단계;
(2) 상기 단계 (1)에서 발생하는 신호를 측정하여 PD-L1 및 PD-1 간의 상호작용을 측정하는 단계 (단백질-단백질 상호작용 측정); 및
(3) 상기 측정 값을 분석하여 PD-L1과 PD-1 간 상호작용 저해 및/또는 PD-L1과 PD-1 간 상호작용과 관련된 질병의 예방 또는 치료를 위한 후보 약물로 선정하는 단계
를 포함할 수 있다.
일 예에서, 클러스터 형성에 유리하도록, 제1 단백질은 PD-L1이고, 제2 단백질은 PD-1일 수 있다.
상기 단계 (1)에 사용된 기판은 표면에 PD-L1이 직접 또는 PD-L1에 특이적으로 결합하는 물질 (예컨대, 항체)을 통하여 간접적으로 결합되어 있거나, PD-L1에 특이적으로 결합하는 물질 (예컨대, 항체)가 결합되어 있는 것일 수 있다. 상기 단계 (2)에서의 단백질-단백질 상호작용 측정 단계는 앞서 설명한 PD-L1과 PD-1 간의 상호작용(결합)에 관여하는 아미노산 잔기에서의 PD-L1과 PD-1 간의 상호작용을 측정하는 것일 수 있다.
상기 스크리닝 방법은 다른 스크리닝 방법으로 개발된 PD-L1과 PD-1 간 상호작용 억제제 또는 PD-L1과 PD-1 간 상호작용 억제를 통하여 PD-L1과 PD-1 간 상호작용과 관련된 질병 (예컨대, 암, 면역질환 등)을 치료하는 치료제 후보 약물의 효능 검정 (또는 확인 또는 시험)에 유용하게 적용될 수 있다.
다른 예는 상기 스크리닝 방법에 의하여 선정된 후보 약물을 포함하는 PD-L1과 PD-1 간 상호작용 저해제 및/또는 PD-L1과 PD-1 간 상호작용과 관련된 질병의 예방 또는 치료제 조성물을 제공한다.
다른 예는 PD-L1 및 PD-1 간의 상호작용 저해제가 작용하는 PD-L1 및/또는 PD-1 상의 작용부위 또는 작용 아미노산의 확인 방법을 제공한다. 상기 PD-L1 및 PD-1 간의 상호작용 저해제가 작용하는 PD-L1 및/또는 PD-1 상의 작용부위 또는 작용 아미노산의 확인 방법은,
(a) PD-1 또는 PD-L1의 이들 간 결합부위 또는 주변 아미노산 잔기가 개별적으로 변이된 변이 PD-1 또는 변이 PD-L1를 준비하는 단계, 보다 구체적으로, PD-1 및 PD-L1 간 결합 부위 또는 그 주변의 아미노산 잔기들 중에서 PD-1 상에 위치하는 하나 이상(e.g., 하나)의 아미노산 잔기 또는 PD-L1 상에 위치하는 하나 이상(e.g., 하나)의 아미노산 잔기가 변이(예컨대, 전하(charge)를 상실 또는 교체, 길이(length)를 조절, 또는 원래와 다른 아미노산으로 치환 등)된 변이 PD-1와 야생형 PD-L1, 또는 변이 PD-L1과 야생형 PD-1을 준비하는 단계;
(b) 상기 단계 (a)에서 준비된 변이 PD-1와 야생형 PD-L1, 또는 변이 PD-L1와 야생형 PD-1에 PD-L1 및 PD-1 간의 상호작용 저해제를 투입하여 반응시키고, PD-L1 및 PD-1 간 상호작용 수준을 측정하는 단계; 및
(c) 상기 (b)에서 측정된 PD-L1 및 PD-1 간 상호작용 수준을 상기 저해제가 처리된 야생형 PD-L1 및 야생형 PD-1 간 상호작용 수준과 비교하여, PD-L1 및 PD-1 간의 상호작용 저해제의 작용부위를 확인하는 단계
를 포함할 수 있다.
상기와 같은 방법에 의하여 확인된 PD-L1 및 PD-1 간의 상호작용 저해제의 작용부위는 앞서 설명한 PD-L1과 PD-1 간의 상호작용(결합)에 관여하는 아미노산 잔기들 중에서 선택된 하나 이상일 수 있다.
다른 예는 제1 단백질과 제2 단백질 간 단백질-단백질 상호작용을 측정하는 단계를 포함하고, 상기 제1 단백질은 PD-L1 및 PD-1 중 어느 하나이고, 제2 단백질은 PD-L1 및 PD-1 중 다른 하나인, 세포 또는 조직내의 PD-L1 및 PD-1가 관여하거나 PD-L1와 PD-1 간의 상호작용과 관련된 신호전달경로의 활성화 측정 (또는 확인 또는 결정 또는 분석) 방법을 제공한다.
다른 예는 제1 단백질과 제2 단백질 간 단백질-단백질 상호작용을 측정하는 단계를 포함하고, 상기 제1 단백질은 PD-L1 및 PD-1 중 어느 하나이고, 제2 단백질은 PD-L1 및 PD-1 중 다른 하나인, 세포 또는 조직, 또는 상기 세포 또는 조직이 유래하는 개체의 제1 단백질을 표적으로 하는 약물에 대한 반응성을 예측하는 방법 또는 예측에 정보를 제공하는 방법을 제공한다.
다른 예는 제1 단백질과 제2 단백질 간 단백질-단백질 상호작용을 측정하는 단계를 포함하고, 상기 제1 단백질은 PD-L1 및 PD-1 중 어느 하나이고, 제2 단백질은 PD-L1 및 PD-1 중 다른 하나인, 제1 단백질을 표적으로 하는 치료에 적합한 개체를 선별하는 방법 또는 선별에 정보를 제공하는 방법을 제공한다.
다른 예는 제1 단백질과 제2 단백질 간 단백질-단백질 상호작용을 측정하는 단계를 포함하고, 상기 제1 단백질은 PD-L1 및 PD-1 중 어느 하나이고, 제2 단백질은 PD-L1 및 PD-1 중 다른 하나인, 세포 또는 조직, 또는 상기 세포 또는 조직이 유래하는 개체(개별 환자)에 적용하기에 적합한 제1 단백질을 표적으로 하는 약물을 선별하는 방법 또는 선별에 정보를 제공하는 방법을 제공한다.
다른 예는, 제1 단백질을 표적으로 하는 약물이 처리된 세포 또는 조직, 또는 상기 약물을 투여한 개체로부터 분리된 세포 또는 조직에서 제1 단백질과 제2 단백질 간 단백질-단백질 상호작용을 측정하는 단계를 포함하고, 상기 제1 단백질은 PD-L1 및 PD-1 중 어느 하나이고, 제2 단백질은 PD-L1 및 PD-1 중 다른 하나인, 상기 세포 또는 조직, 또는 상기 개체의 제1 단백질을 표적으로 하는 약물에 대한 반응성을 모니터링하는 방법 또는 모니터링에 정보를 제공하는 방법을 제공한다.
다른 예는, 제1 단백질을 표적으로 하는 후보 물질이 처리된 분리된 세포 또는 조직, 또는 상기 약물을 투여한 개체로부터 분리된 세포 또는 조직에서 제1 단백질과 제2 단백질 간 단백질-단백질 상호작용을 측정하는 단계를 포함하고, 상기 제1 단백질은 PD-L1 및 PD-1 중 어느 하나이고, 제2 단백질은 PD-L1 및 PD-1 중 다른 하나인, 제1 단백질 및/또는 제2단백질을 표적으로 하는 약물의 스크리닝 방법을 제공한다.
다른 예는 상기 기재된 방법에 사용하기 위한 장치를 제공한다.
이하, 본 발명을 보다 상세히 설명한다;
본 명세서에서 사용된 바로서, 용어 "단백질-단백질 상호작용 (protein-protein interaction: PPI)"은 제1 단백질과 제2 단백질 간의 물리적 및/또는 화학적 결합 또는 복합체 형성을 의미할 수 있으며, 예컨대, 결합 빈도, 결합 세기(강도), 및 결합 시간 등의 인자들 중에서 하나 이상으로 측정될 수 있다. 또한, 상기 제1 단백질과 제2 단백질 간의 상호작용 (결합)은 이들 간의 직접적인 상호작용 (결합)뿐 아니라 중간에 다른 단백질 (신호전달경로 중에서 제1 단백질 및 제2 단백질 사이에 위치하는 단백질)을 매개로 한 상호작용 (결합)도 포함할 수 있다. 본 명세서에서의 단백질-단백질 상호작용은 단분자 (single molecule) 반응 (1 분자의 제1 단백질과 1 분자의 제2 단백질 간의 반응)일 수 있다.
또한, 용어 "PD-L1과 PD-1의 상호작용"은 PD-L1과 PD-1 간의 물리적 및/또는 화학적 결합 또는 복합체 형성을 의미할 수 있다. 또한, 상기 상호작용 (결합)은 직접적인 상호작용(결합)뿐 아니라 중간에 다른 단백질을 매개로 한 상호작용(결합)도 포함할 수 있다. 본 명세서에서의 단백질-단백질 상호작용은 단분자 (single molecule) 반응일 수 있다.
본 명세서에 기재된 PD-L1(programmed cell death 1 ligand 1)은 인간 등의 포유 동물 유래의 것일 수 있으며, 예컨대, 인간 PD-L1 (e.g., GenBank Accession No. NP_001254635.1 (유전자: NM_001267706.1), NP_001300958.1 (유전자: NM_001314029.1), NP_054862.1 (유전자: NM_014143.4) 등)일 수 있다.
본 명세서에 기재된 PD-1(programmed cell death protein 1)은 인간 등의 포유 동물 유래의 것일 수 있으며, 예컨대, 인간 PD-1 (e.g., GenBank Accession No. NP_005009.2 (유전자: NM_005018.3) 등)일 수 있다.
본 명세서에 기재된 PD-L1 단백질 및/또는 PD-1 단백질은, 각각 독립적으로, (예컨대, 포유류에서 분리된) 세포, 조직, 또는 이들의 용해물 또는 추출물에 포함된 형태이거나, 정제된 단백질 또는 화학적 또는 재조합적으로 합성된 단백질 형태일 수 있다.
본 명세서에서 제공되는 방법에서 수행되는 PD-L1과 PD-1 간 단백질-단백질 상호작용을 측정하는 단계는 분리된 세포 또는 조직, 또는 이들의 용해물 또는 추출물, 또는 정제된 단백질 또는 화학적 또는 재조합적으로 합성된 단백질(PD-L1과 PD-1)에 대하여 생체 외 또는 세포 외 (in vitro)에서 수행되는 것일 수 있다.
본 명세서에서 제공되는 PD-L1과 PD-1 간 상호작용 저해제는 하기의 화학식 I (예컨대, 화학식 1)의 구조를 갖는 화합물, 화학식 II (예컨대, 화학식 2)의 구조를 갖는 화합물, 또는 이의 약학적으로 허용 가능한 염일 수 있다:
[화학식 I]
Figure PCTKR2019011265-appb-I000005
[화학식 II]
Figure PCTKR2019011265-appb-I000006
상기 화학식 I, 및 II에 있어서,
R1은 수소 또는 탄소수 1 내지 3의 알킬 (예컨대, 수소)이고,
R2는 수소 또는 탄소수 1 내지 3의 알킬 (예컨대, 메틸)이고,
R3는 수소 또는 탄소수 1 내지 3의 알킬 (예컨대, 수소)이고,
R4는 수소 또는 탄소수 1 내지 3의 알킬 (예컨대, 메틸)이고,
R5는 수소, 탄소수 1 내지 3의 알킬, 또는 탄소수 1 내지 3의 알콕시 (예컨대, -O-CH3)임.
[화학식 1]
Figure PCTKR2019011265-appb-I000007
[화학식 2]
Figure PCTKR2019011265-appb-I000008
본 명세서에서, "약학적으로 허용가능한 염"이란 의약 또는 제약 분야에서 일반적으로 사용되고 있는 염 화합물 형태를 의미하며, 예컨대, 산 부가염 또는 염기 부가염일 수 있다. 구체적으로, 상기 화학식 1 또는 2에 따른 화합물의 약학적으로 허용가능한 염의 예로는, 염산, 브롬산, 인산 또는 황산과 같은 무기산과의 염; 아세트산, 트리플루오로아세트산, 구연산, 말레인산, 수산, 호박산, 벤조산, 주석산, 푸마르산, 만델산, 아스코르브산 또는 말산과 같은 유기 카르복실산이나, 메탄설폰산 또는 파라-톨루엔설폰산과 같은 설폰산과의 염; 나트륨, 칼륨 또는 리튬과 같은 알카리 금속과의 염; 혹은 기타 약제학적으로 허용 가능한 염을 형성할 수 있는 것으로 알려진 다양한 산과의 염 등을 들 수 있으나 이에 제한되는 것은 아니다.
본 명세서에서, "PD-L1과 PD-1의 상호작용(결합) 저해"란 상기 PD-L1과 PD-1 간 상호작용 저해제 처리에 의하여 PD-L1과 PD-1의 상호작용(결합) 정도가 상기 PD-L1과 PD-1 간 상호작용 저해제 처리 전과 비교하여 감소되거나 PD-L1과 PD-1의 상호작용(결합)이 일어나지 않게 된 것을 의미할 수 있다.
본 명세서에서, "PD-L1과 PD-1의 상호작용과 관련된 질병"은 면역질환일 수 있으며, 예컨대, 암일 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서 제공되는 PD-L1과 PD-1 간의 상호작용 측정 방법은 다음의 단계를 포함할 수 있다:
(1) PD-L1 및 PD-1 중에서 선택된 어느 하나 (제1 단백질)이 상기 제1 단백질과 특이적으로 결합 가능한 물질 (예컨대, 항체)을 통하거나 통하지 않고 직접 결합된 제1 단백질이 고정화된 기판에 표지된 (표지 물질이 결합된) 제2 단백질 (PD-L1 및 PD-1 중에서 상기 (1)에서 선택된 제1 단백질과 상이한 단백질)을 첨가하여 반응시키는 단계; 및
(2) 단계 (1)에서 얻어진 반응물로부터 신호를 측정하여 PD-L1과 PD-1 간의 상호작용을 측정하는 단계 (단백질-단백질 상호작용 측정).
또한, 본 명세서에서 제공되는 PD-L1과 PD-1 간 상호작용 저해제 또는 PD-L1과 PD-1 간 상호작용과 관련된 질병의 예방 또는 치료제의 스크리닝 방법은 다음의 단계를 포함할 수 있다.
(1) PD-L1 및 PD-1 중에서 선택된 어느 하나 (제1 단백질) 표지 물질이 결합된 제2 단백질 (PD-L1 및 PD-1 중에서 상기 (1)에서 선택된 제1 단백질과 상이한 단백질), 및 저해제 후보 화합물을 기판에 공급하는 단계;
(2) PD-L1 및 PD-1의 상호작용을 측정하는 단계 (단백질-단백질 상호작용 측정); 및
(3) 상기 측정 값을 분석하여 PD-L1과 PD-1 간 상호작용 저해제를 선정하는 단계.
일 예에서, 클러스터 형성에 유리하도록, 제1 단백질은 PD-L1이고, 제2 단백질은 PD-1일 수 있다.
상기 단계 (1), (2), 및 (3)은 생체에서 분리된 세포 또는 세포 외(in vitro)에서 수행될 수 있다.
상기 상호작용 측정 방법 및 스크리닝 방법에 있어서, 각각의 방법의 단계 (1)이 서로 대응되며, 각각의 방법의 단계 (2)가 서로 대응된다.
이하, 이들 방법에 있어서 단계 (1)과 단계 (2)를 함께 설명한다:
단계 (1): 제1 단백질, 표지자가 부착된 제2 단백질, 및 후보 화합물을 기판에 공급하는 단계
상기 제1 단백질은 PD-L1과 PD-1 중에서 선택된 어느 하나이고, 제2 단백질은 PD-L1과 PD-1 중에서 상기 제1 단백질로 선택된 단백질을 제외한 나머지 단백질일 수 있다. 일 예에서, 상기 제1 단백질은 PD-L1이고 제2 단백질은 PD-1일 수 있다.
상기 단계 (1)은 PD-L1과 PD-1을 순차적(1-a)으로 또는 동시에(1-b) 공급할 수 있다.
순차적(1-a)으로 공급하는 경우는, PD-L1 결합물질이 도포된 기판에 PD-L1을 공급하여 결합시킨 뒤 표지자가 부착된 PD-1과 후보 화합물을 공급하거나, PD-1 결합물질이 도포된 기판에 PD-1을 공급하여 결합시킨 뒤 표지자가 부착된 PD-L1과 후보 화합물을 공급할 수 있다.
다른 예로, 동시에(1-b)로 공급하는 경우는, PD-L1과 표지자가 부착된 PD-1 및 후보 화합물의 혼합물을 PD-L1 결합 물질이 도포된 기판에 동시에 공급하거나, PD-1과 표지자가 부착된 PD-L1 및 후보 화합물의 혼합물을 PD-1 결합 물질이 도포된 기판에 동시에 공급할 수 있다.
제1 단백질로 사용되는 PD-L1 또는 PD-1는 세포에서 분리(정제)되거나 화학적 또는 재조합적으로 합성된 단백질 형태로 사용되거나, 상기 제1 단백질이 과발현 및/또는 (과)활성화된 세포 (예컨대, 암세포) 또는 세포 용해액 형태로 사용될 수 있다.
PD-L1과 PD-1 중에서 PD-L1를 기판에 고정화시켜 상호작용을 측정하는 경우, PD-1이 클러스터화(clustering)된 형태로 두 단백질 간의 상호작용이 형성될 수 있어, 정성적 및/또는 정량적 분석에 유리한 효과를 얻을 수 있다.
다른 예로 PD-1 결합물질이 도포된 기판에 PD-1을 고정시켜 단백질-단백질 상호작용을 측정하는 경우 상대적으로 단일 형상으로 관찰되어, 단일 스팟(spot) 검출이 필요한 분석에 유리한 효과를 얻을 수 있다.
상기 PD-L1 또는 PD-1과 특이적으로 결합하는 물질은 PD-L1 또는 PD-1과 특이적으로 결합할 수 있는 모든 물질로부터 선택된 것일 수 있으며, 예컨대, 특이적으로 결합하는 항체 또는 이의 항원결합단편 (예컨대, 항체의 scFv, (scFv)2, scFv-Fc, Fab, Fab' 및 F(ab')2 등), 압타머(단백질 또는 핵산분자), 소분자 화합물 등으로 이루어진 군에서 선택된 1종 이상일 수 있다. 이 때, 상기 결합물질은 PD-L1과 PD-1의 상호작용을 방해하지 않는 부위, 즉, PD-L1과 PD-1이 상호작용(결합)하는 부위가 아닌 부위에서 결합하는 것일 수 있다.
일 예에서, PD-L1을 기판에 부착하는 경우, 상기 PD-L1에 특이적으로 결합하는 물질은 PD-L1에 특이적으로 결합하는 항체 또는 이의 항원결합단편일 수 있다. PD-L1와 PD-1 간의 상호결합에 영향이 없도록 하기 위하여, 상기 PD-L1에 특이적으로 결합하는 항체 또는 항원결합단편은 PD-L1의 PD-1과의 결합 부위를 제외한 (결합 부위와 중복하지 않는) 비결합 부위, 예컨대, PD-L1의 C-말단 부위에 특이적으로 결합하는 것일 수 있다. PD-L1이 PD-1과 결합하는 부위는 대체적으로 PD-L1의 N-말단쪽 부위(세포외 도메인 부위)이며, 구체적으로, 15번째부터 200번째까지, 15번째부터 150번째까지, 15번째부터 130번째까지, 15번째부터 125번째까지, 20번째부터 200번째까지, 20번째부터 150번째까지, 20번째부터 130번째까지, 20번째부터 125번째까지, 25번째부터 200번째까지, 25번째부터 150번째까지, 25번째부터 130번째까지, 20번째부터 125번째 또는 25번째부터 125번째까지의 아미노산 부위에서 선택된 하나 이상의 아미노산 잔기를 포함하는 부위일 수 있으며, 예컨대, PD-L1의 T20, D25, D26, Y56, E58, R113, M115, A121, D122, Y123, K124, R125 등으로 이루어진 군에서 선택된 하나 이상의 아미노산 잔기를 포함하는 부위일 수 있다. 상기 PD-L1의 PD-1과의 결합 부위를 제외한 비결합 부위는, 앞서 설명한 PD-L1의 N 말단쪽의 PD-L1가 PD-1과 결합하는 부위와 중복되지 않는 PD-L1 부분일 수 있으며 (예컨대, PD-L1의 T20, D25, D26, Y56, E58, R113, M115, A121, D122, Y123, K124, R125 등으로 이루어진 군에서 선택된 하나 이상 (예컨대, 하나 이상, 2 이상, 또는 3 이상)의 아미노산 잔기를 포함하지 않는 부위), 상기 PD-L1에 특이적으로 결합하는 항체 또는 이의 항원결합단편은 상기 PD-L1의 PD-1과의 결합 부위를 제외한 비결합 부위 (예컨대, PD-L1의 C-말단 부위) 중의 1개 이상, 예컨대, 1 내지 30개, 1 내지 25개, 1 내지 20개, 1 내지 15개, 또는 1 내지 10개의 아미노산에 결합하는 항체 또는 항원결합단편일 수 있다. 일 예에서, 상기 PD-L1에 특이적으로 결합하는 항체 또는 이의 항원결합단편은 PD-L1 단백질의, N-말단에서 C-말단 방향으로, 150번째 이후, 200번째 이후, 250번째 이후, 260번째 이후, 270번째 이후, 또는 280번째 이후의 아미노산 부위, 예컨대, 250번째부터 290번째까지, 260번째부터 290번째까지, 270번째부터 290번째까지, 또는 280번째부터 290번째까지의 아미노산 부위 중 선택된 하나 이상의 아미노산, 예컨대, 1 내지 30개, 1 내지 25개, 1 내지 20개, 1 내지 15개, 또는 1 내지 10개의 (예컨대, 연속하는) 아미노산에 특이적으로 결합하는 것일 수 있다.
다른 예에서, PD-1을 기판에 부착하는 경우, 상기 PD-1에 특이적으로 결합하는 물질은 PD-1에 특이적으로 결합하는 항체 또는 이의 항원결합단편일 수 있다. PD-1와 PD-L1 간의 상호결합에 영향이 없도록 하기 위하여, 상기 PD-1에 특이적으로 결합하는 항체 또는 항원결합단편은 PD-1의 PD-L1과의 결합 부위를 제외한 (결합 부위와 중복하지 않는) 비결합 부위, 예컨대, PD-1의 C-말단 부위에 특이적으로 결합하는 것일 수 있다. 상기 PD-1이 PD-L1과 결합하는 부위는 대체적으로 PD-1의 N-말단쪽 부위(세포외 도메인 부위)이며, 구체적으로 60번째부터 200번째까지, 60번째부터 150번째까지, 60번째부터 140번째까지, 65번째부터 200번째까지, 65번째부터 150번째까지, 65번째부터 140번째까지, 또는 68번째부터 136번째까지의 아미노산 부위에서 선택된 하나 이상의 아미노산 잔기를 포함하는 부위일 수 있으며, 예컨대, PD-1의 Y68, Q75, K78, T76, I126, L128, A132, I134, E136 등으로 이루어진 군에서 선택된 하나 이상 (예컨대, 하나 이상, 2 이상, 또는 3 이상)의 아미노산 잔기를 포함하는 부위일 수 있다. 상기 PD-1의 PD-L1과의 결합 부위를 제외한 비결합 부위, 예컨대, PD-1의 C-말단 부위는, 앞서 설명한 PD-1의 N 말단쪽의 PD-1가 PD-L1과 결합하는 부위와 중복되지 않는 PD-1 부분일 수 있으며, 상기 PD-1에 특이적으로 결합하는 항체 또는 이의 항원결합단편은 상기 PD-1의 PD-L1과의 결합 부위를 제외한 비결합 부위 (예컨대, PD-1의 C-말단 부위) 중의 1개 이상, 예컨대, 1 내지 30개, 1 내지 25개, 1 내지 20개, 1 내지 15개, 또는 1 내지 10개의 아미노산에 결합하는 항체 또는 항원결합단편일 수 있다.
일 예에서, 상기 기판은 상기 PD-L1 또는 PD-1에 특이적으로 결합하는 생물학적 물질 (예컨대, 항체 등)을 표면에 포함(고정)하기 위하여 적절히 표면개질되거나, 표면에 직접 상기 단백질(PD-L1 또는 PD-1)에 특이적으로 결합하는 물질이 고정된 것일 수 있다. 상기 기판이 표면 개질된 경우, 상기 기판은 일면에 상기 단백질(PD-L1 또는 PD-1)이 특이적으로 결합하는 생물학적 물질 (예컨대, 항체 등)을 고정화시킬 수 있는 작용기를 갖는 모든 화합물로 처리(예컨대, 도포)될 수 있으며, 예컨대, 알데히드기, 카르복실기 및 아민기로 이루어진 군에서 선택된 작용기를 포함하는 화합물로 처리될 수 있다. 일 구체예에서, 상기 알데히드기, 카르복실기 및 아민기로 이루어진 군에서 선택된 작용기를 포함하는 화합물은 바이오틴(biotin), 소혈청알부민 (Bovine serum albumin; BSA), 바이오틴이 결합된 소혈청알부민, 폴리에틸렌글리콜(polyethyleneglycol; PEG), 바이오틴이 결합된 PEG (폴리에틸렌글리콜-바이오틴; PEG-biotin), 폴리소베이트 (e.g., Tween20) 등으로 이루어진 군에서 선택된 1종 이상일 수 있으나 이에 제한되는 것은 아니다. 상기 표면 처리된 기판은 뉴트라비딘(neutravidin), 스트렙타비딘(streptavidin), 아비딘(avidin) 등으로 이루어진 군에서 선택된 1종 이상이 추가로 처리(예컨대, 도포)될 수 있다.
상기 기판은, 표지 신호의 검출 용이성을 고려하여, 빛의 굴절률이 생체 물질의 많은 부분을 차지하는 물의 굴절률 (약 1.3) 이상인 재질일 수 있다. 일 예에서, 상기 기판은 두께가 약 0.1 내지 약 1 mm, 약 0.1 내지 약 0.5 mm, 0.1 내지 약 0.25 mm, 또는 약 0.13 내지 약 0.21 mm 정도일 수 있으며, 굴절률이 약 1.3 내지 약 2, 약 1.3 내지 약 1.8, 약 1.3 내지 약 1.6, 또는 약 1.5 내지 약 1.54 정도인 것일 수 있다. 상기 기판은 상기 굴절률 범위를 만족시키는 모든 재질일 수 있으며, 예컨대 유리 (굴절률: 약 1.52), 석영 등으로 이루어진 군에서 선택된 재질로부터 얻어진 것일 수 있으나, 이에 제한되는 것은 아니다. 상기 기판은 생물 시료 관찰에 통상적으로 사용되는 모든 형태를 갖는 것일 수 있으며, 예컨대, 웰 타입, 슬라이드 타입, 채널 타입, 어레이 형태, 미세유체칩, 미세관 (캐필러리) 등일 수 있으나, 이에 제한되는 것은 아니다. 형광현미경 관찰시, 상기 시료가 적용된 기판 위에 커버글라스를 장착하여 관찰할 수 있으며, 커버글라스의 재질은 앞서 기판에서 설명한 바와 같고, 두께는 기판에서 설명한 범위 또는 이보다 얇을 수 있다 (예컨대, 굴절률 1.52, 두께 0.17mm일 수 있으나 이에 제한되는 것은 아님).
상기 기판에 고정화 되는
상기 표지된 PD-1 단백질 또는 PD-L1 단백질은 이들 단백질이 검출 가능한 신호를 발생시키는 표지 물질로 표지되거나 (표지 물질이, 예컨대, 화학적 (예컨대, 공유적 또는 비공유적), 재조합적, 또는 물리적으로, 결합되거나), 표지물질이 결합될 수 있는 tag이 부착된 형태를 의미할 수 있다. 상기 검출 가능한 신호는 통상적인 효소 반응, 형광, 발광, 및/또는 방사선 검출을 통하여 측정될 수 있는 모든 신호 (예컨대, 빛, 방사선 등)들 중에서 선택될 수 있다. 상기 표지 물질은 상기 표지 신호를 발생시킬 수 있는 모든 소분자 화합물, 단백질, 펩타이드, 핵산분자 등으로 이루어진 군에서 선택된 1종 이상일 수 있으며, 예컨대, 형광 염료 (소분자 화합물; Cyanine, Alex, Dylight, Fluoprobes 등), 형광 단백질 (예컨대, 녹색형광단백질 (GFP, enhanced GFP), 황색형광단백질 (YFP), 청록색형광단백질(CFP), 청색형광단백질(BPF), 적색형광단백질(RPF), mcherry 등) 등으로 이루어진 군에서 선택된 1종 이상일 수 있다. 상기 tag은 His-tag / Ni-NTA 등과 같이 통상적으로 사용되는 모든 종류에서 선택된 1종 이상일 수 있다. 상기 표지 물질의 사용 농도는, 노이즈를 발생시키지 않고 정확하고 용이한 검출이 가능하도록 하기 위하여, 약 1uM 이하의 범위에서 적절하게 정할 수 있으며, 예컨대, 1nM 내지 1000nM, 1nM 내지 500nM, 1nM 내지 100nM, 10nM 내지 1000nM, 10nM 내지 500nM, 또는 10nM 내지 100nM 정도일 수 있으나, 이에 제한되는 것은 아니다.
상기와 같은 표지물질로부터 발생하는 신호는 이를 검출 또는 측정하는데 통상적으로 사용되는 모든 신호 검출 수단 (예컨대, 통상의 형광 현미경, 형광 카메라, 형광세기 측정 (정량) 장치 등)에 의하여 측정 및/또는 정량화 (수치화)될 수 있다.
상기 저해제 또는 예방/치료제의 후보 화합물은 PD-L1 및/또는 PD-1 단백질의 표적 약물로 사용 가능한 모든 생체적합성 물질 중에서 선택될 수 있으며, 예컨대, 소분자 화학 약물 (small molecular chemicals), 단백질 (예컨대, 항체, 항체 단편, 또는 이의 유사체 등), 펩타이드, 핵산 분자 (예컨대, DNA, RNA (예컨대, siRNA, microRNA, shRNA 등), PNA (peptide nucleic acid), 앱타머, 등), 식물 추출물, 동물 추출물, 세포 추출물 등으로 이루어진 군에서 1종 이상 선택될 수 있으나, 이에 제한되는 것은 아니다.
단계 (2): PD-L1 및 PD-1 간 상호작용 측정 단계
상기 단계 (1)에서 얻어진 반응물로부터 신호를 측정하는 단계이다. 예컨대, 단계 (2)는 단계 (1)에서 PD-L1 및 PD-1 간의 상호작용에 의하여 발생한 신호를 검출하여 PD-L1 및 PD-1의 상호작용 수준을 측정하는 단계를 포함할 수 있다. 상기 신호 측정은 단계 (1)에서 사용된 표지 신호(예컨대, 효소 반응, 형광, 발광, 또는 방사선 검출 등의 통상적인 방법을 통하여 측정 가능한 신호)를 검출 (또는 측정 또는 확인)할 수 있는 모든 수단을 사용하여 수행될 수 있다.
일 예에서, 단계 (2)에서의 단백질-단백질 상호작용 측정은 실시간 분석에 의한 것일 수 있다.
일 예에서, 상기 표지 신호가 형광 신호인 경우, 상기 신호 검출은 상기 형광 신호를 발생시키는 표지 물질이 흡수하는 광원을 공급하여 발생하는 형광 신호를, 예컨대, 형광 현미경, 형광 카메라, 및/또는 형광 세기 측정 (정량) 장치 등을 사용하여, 영상화하거나 및/또는 정량 (예컨대, 형광세기 수치화, 형광 스팟 카운팅 등)할 수 있다.
일 구체 예에서, 상기 신호는 형광 신호인 경우, 상기 형광 신호는 형광 카메라를 이용하여 영상화 및/또는 정량화 할 수 있다.
상기 신호가 형광 신호인 경우, 단계 (2) (단백질-단백질 상호작용 측정 단계)은
(i) 상기 단계 (1)의 반응물에 광원을 공급하는 단계; 및
(ii) 상기 공급된 광원에 의하여 발생한 형광 신호를 검출하는 단계
를 포함할 수 있다.
상기 단계 (i)의 광원을 공급하는 단계는 상기 단계 (1)에서 얻어진 PD-L1 단백질과 PD-1 단백질의 반응물에 광원을 공급하는 단계로서, 이와 같은 목적을 달성할 수 있다면, 광원의 공급 시기는 특별한 제한이 없다. 상기 광원은 형광 신호에 해당하는 파장을 갖는 모든 광원일 수 있으며, 예컨대, 레이저, 할로겐 램프 등 일 수 있다.
상기 광원의 파장은 사용된 형광 신호에 따라서 조절될 수 있으며, 예컨대, 약 300nm 내지 약 600nm 또는 약 350nm 내지 약 560nm 범위에서 선택될 수 있다. 보다 구체적으로, 녹색형광단백질은 약 480nm를 흡수하고, 황색형광단백질은 약 540nm를 흡수하고, 청색형광단백질은 약 375nm를 흡수하고, 청록색형광단백질은 약 425nm을 흡수하므로, 형광 신호로 녹색형광을 사용하는 경우 상기 광원의 파장은 약 460 내지 약 500nm, 형광 신호로 황색 형광을 사용하는 경우 상기 광원의 파장은 약 520 내지 약 560nm, 형광 신호로 청색 형광을 사용하는 경우 상기 광원의 파장은 약 350 내지 약 400nm, 형광 신호로 청록색 형광을 사용하는 경우 상기 광원의 파장은 약 400 내지 약 450nm 범위에서 선택될 수 있다.
일 구체예에서, 단계 (2)의 단백질-단백질 상호작용 측정 단계는 전반사 형광 현미경(Total Internal Reflection Fluorescence (TIRF) microscope) 또는 공초점 현미경 등을 사용하여 광원을 공급하고, 통상적인 방법으로 형광 신호를 관찰하여 수행될 수 있다. 다른 예에서, 상기 전반사 형광 현미경에 신호 영상화를 위한 형광 카메라, 예컨대 EMCCD (Electron-multiplying charge-coupled device) 카메라 또는 CMOS (Complementary metal oxide semiconductor) 카메라를 장착하여 사용함으로써, 광원 공급 및 형광 신호의 영상화 및/또는 정량을 수행할 수 있다.
다음에서는 단계 (2)의 단백질-단백질 상호작용 측정 단계를 전반사 현미경 및 형광 카메라를 사용하여 수행하는 경우를 예를 들어 보다 상세히 설명한다:
가) 상기 단계 (1)에서 준비된 기판을 전반사 현미경에 장착시킨다. 전반사 현미경에서 광원의 공급 위치는 통상적으로 아래쪽이며, 전반사 현미경 종류에 따라서, 형광 신호를 기판의 위 (이 경우, 아래에서 위 방향으로, 광원 공급부, 기판, 렌즈, 또는 기판, 광원 공급부, 렌즈의 순서로 위치할 수 있음) 또는 아래에서 (이 경우, 아래에서 위 방향으로, 렌즈, 광원 공급부, 기판, 또는 광원 공급부, 렌즈, 기판, 또는 렌즈, 기판, 광원 공급부의 순서로 위치할 수 있음) 관찰할 수 있다.
나) 광원은 레이저일 수 있으며, 광원의 세기는 약 0.5 mW 내지 약 5 mW, 약 0.5 mW 내지 약 4.5 mW, 약 0.5 mW 내지 약 4 mW, 약 0.5 mW 내지 약 3.5 mW, 약 0.5 mW 내지 약 3 mW, 약 0.5 mW 내지 약 2.5 mW, 약 0.5 mW 내지 약 2 mW, 약 1 mW 내지 약 5 mW, 약 1 mW 내지 약 4.5 mW, 약 1 mW 내지 약 4 mW, 약 1 mW 내지 약 3.5 mW, 약 1 mW 내지 약 3 mW, 약 1 mW 내지 약 2.5 mW, 약 1 mW 내지 약 2 mW, 약 1.5 mW 내지 약 5 mW, 약 1.5 mW 내지 약 4.5 mW, 약 1.5 mW 내지 약 4 mW, 약 1.5 mW 내지 약 3.5 mW, 약 1.5 mW 내지 약 3 mW, 약 1.5 mW 내지 약 2.5 mW, 또는 약 1.5 mW 내지 약 2 mW, 예컨대, 약 2 mW일 수 있으며, 광원의 파장은 앞서 설명한 바와 같이 형광 신호 또는 사용된 표지 물질, 및/또는 장비의 구성 (예컨대 감쇄필터를 사용하는 경우 세기가 센 광원을 사용할 수 있음)에 따라서 적절하게 선택할 수 있다.
다) 상기 광원 공급에 의하여 발생한 형광 신호를 형광 카메라로 촬영하여 영상화 및/또는 정량할 수 있다.
상기 형광신호의 촬영 (또는 영상화)은, 표지 물질의 형광 신호 발생 유지 시간 (발광시간, lifetime)을 고려하여, 광원 공급과 동시 또는 상기 신호 발생 유지 시간 이내에 수행할 수 있다.
형광 카메라 (예컨대, EMCCD 카메라)로 형광 신호를 촬영(또는 영상화)함에 있어서, 1 프레임당 노출시간, 레이저 파워, 카메라 gain값, 총 촬영 프레임 등을 적절하게 조절할 수 있다. 예컨대, 1 프레임 당 노출시간이 짧을수록 1 프레임에 누적되는 신호가 줄어들게 되며, 이를 상쇄하기 위하여 레이저 파워를 높이거나, 형광 카메라의 감도를 높일 수 있다. 일 예에서, 1 프레임 당 노출시간을 약 0.001초 내지 약 5초, 약 0.001초 내지 약 3초, 약 0.001초 내지 약 2초, 약 0.001초 내지 약 1초, 약 0.001초 내지 약 0.5초, 약 0.001초 내지 약 0.3초, 약 0.001초 내지 약 0.1초, 약 0.01초 내지 약 5초, 약 0.01초 내지 약 3초, 약 0.01초 내지 약 2초, 약 0.01초 내지 약 1초, 약 0.01초 내지 약 0.5초, 약 0.01초 내지 약 0.3초, 약 0.01초 내지 약 0.1초, 약 0.05초 내지 약 5초, 약 0.05초 내지 약 3초, 약 0.05초 내지 약 2초, 약 0.05초 내지 약 1초, 약 0.05초 내지 약 0.5초, 약 0.05초 내지 약 0.3초, 약 0.05초 내지 약 0.1초, 약 0.07초 내지 약 5초, 약 0. 07초 내지 약 3초, 약 0. 07초 내지 약 2초, 약 0.07초 내지 약 1초, 약 0. 07초 내지 약 0.5초, 약 0. 07초 내지 약 0.3초, 약 0.07초 내지 약 0.1초, 약 0.1초 내지 약 5초, 약 0.1초 내지 약 3초, 약 0.1초 내지 약 2초, 약 0.1초 내지 약 1초, 약 0.1초 내지 약 0.5초, 또는 약 0.1초 내지 약 0.3초, 예컨대 약 0.1초로 할 수 있으나 이에 제한되는 것은 아니다.
예컨대, EMCCD 카메라를 사용하는 경우, 표지 물질 (예컨대, eGFP)로부터 생성된 광자(photon)는 EMCCD의 소자를 통해 전자로 바뀌어 계측된다 (광전효과, photoelectric effect). 이 때, 광자 1개 당 생성되는 전자의 개수를 gain 값을 통해 변경할 수 있다. 설정된 gain값이 높을수록 광자 1개 당 생성되는 전자의 개수가 늘어나서, EMCCD의 감도가 높아지는 동시에 background noise도 함께 증가하므로 signal-to-noise 비율이 중요하다. 일 구체예에서, 우수한 signal-to-noise 비율을 얻기 위하여, gain값을 약 10 내지 약 100, 약 10 내지 약 80, 약 10 내지 약 60, 약 10 내지 약 50, 약 20 내지 약 100, 약 20 내지 약 80, 약 20 내지 약 60, 약 20 내지 약 50, 약 30 내지 약 100, 약 30 내지 약 80, 약 30 내지 약 60, 또는 약 30 내지 약 50, 예컨대, 약 40 정도로 정할 수 있지만, 이에 한정되지 않고 카메라의 감도, 수명, 장비 구축 현황, 노이즈, 시험 조건 등을 고려하여 적절하게 선택될 수 있다.
총 촬영 프레임 개수와 노출 시간을 곱하면 총 촬영 시간이 얻어진다 (노출시간 * 총 촬영 프레임 개수 = 촬영 시간). 형광 물질의 발광 시간(lifetime) 이후에는 형광 신호가 사라지므로, 상기 촬영 시간이 발광시간 내에 진행되도록 총 촬영 프레임 개수 및/또는 노출 시간을 조절할 수 있다.
단백질-단백질 상호작용 측정 결과의 정확도를 높이기 위하여, 상기 영상화를 하나 이상, 예컨대, 2개 이상, 3개 이상, 4개 이상, 5개 이상, 7개 이상, 또는 10개 이상 (상한값은 기판의 크기 및 영상화 가능한 면적에 따라서 결정됨)의 기판 또는 이를 포함하는 하나 이상의 채널 (각 채널은 2개 이상의 기판을 포함함)에서 수행하고, 신호가 나타난 spot (PPI complex 라고도 함)의 개수를 구하거나, 및/또는 상기 얻어진 형광 신호를 정량화할 수 있으며, 이는 단백질-단백질 상호작용을 정량화한 것으로 볼 수 있다. 다른 예에서, 상기 측정된 형광 세기를 통상적인 장치를 이용하여 수치화함으로써 단백질-단백질 상호작용을 정량할 수도 있다.
단계 (3): PD-L1과 PD-1 간 상호작용 저해제를 선정하는 단계 (스크리닝 방법에 해당)
상기 단계(1) 및 (2)를 실시하여 얻은 PD-L1 및 PD-1의 상호작용 측정 값 (PD-L1 및 PD-1의 상호작용 수준)이 미리 설정된 기준 값 이하이면, PD-L1과 PD-1 간 상호작용 저해제로 선정하고, 기준 값을 초과하면 선정에서 제외한다.
일 예에서, 상기 기준 값은 후보 화합물을 처리하지 않은 대조군에서 측정된 PD-1 및 PD-L1 상호작용 측정 값 (예컨대, PPI complex 개수)일 수 있다. 즉, 상기 단계 (3)은 후보 화합물 처리시 단계 (2)에서 측정된 후보 화합물 처리시의 PD-L1 및 PD-1의 상호작용 수준을 상기 후보 화합물을 투여하지 않은 대조군의 PD-L1 및 PD-1의 상호작용 수준과 비교하여, 후보 화합물 처리시의 PD-L1 및 PD-1의 상호작용 수준이 대조군의 PD-L1 및 PD-1의 상호작용 수준보다 낮은 경우, 상기 후보 화합물을 PD-L1과 PD-1 간 상호작용 저해제로서 선정하는 단계를 포함할 수 있다. 이 경우, 단계 (3) 이전에, (1') PD-L1 및 표지물질이 부착된 PD-1을 기판에 공급하는 단계; 및 (2') PD-L1 및 PD-1 간의 상호작용에 의한 신호를 검출하여 PD-L1 및 PD-1의 상호작용 수준을 측정하는 단계를 추가로 포함할 수 있다 (대조군에서의 PD-L1 및 PD-1의 상호작용 수준을 측정 단계).
다른 예에서, 상기 기준 값은 기존에 알려진 저해제(양성 대조군; 기준 물질)를 투입한 경우의 PD-1 및 PD-L1 상호작용 측정 값 (예컨대, PPI complex 개수)과 저해제를 투입하지 않은 경우의 PD-1 및 PD-L1 상호작용 측정 값(예컨대, PPI complex 개수) 사이의 범위 (예컨대, 상기 기준값은 상기 후보 화합물과 기준 물질을 투여하지 않은 경우의 PD-1 및 PD-L1 상호작용 수준 미만이고 기준 물질을 투여한 경우의 PD-1 및 PD-L1 상호작용 수준 이상인 범위)에서 선택된 수치일 수 있고, 예컨대, 상기 범위 중에서 저해제(양성 대조군; 기준 물질)를 투입한 경우의 측정 값에 보다 가까운 범위에서 선택된 수치일 수 있다. 상기 측정 값은 특정 값(PD-1과 PD-L1의 상호작용 신호 (e.g., 형광신호) 상대값)으로 표준화하여 실시할 수 있다.
일 예로, 저해제를 투입하지 않은 경우의 PD-1과 PD-L1의 상호작용 측정 값을 1로 표준화하고, 기존에 알려진 저해제(기준 물질)를 투입한 경우의 PD-1과 PD-L1의 상호작용 측정 값을 0으로 표준화하여, 그 사이 범위 중 저해제를 투입한 경우의 PD-1과 PD-L1의 상호작용 측정 값인 0에 보다 가까운 범위, 예컨대, 0 내지 0.5, 0 내지 0.45, 0 내지 0.4, 0.1 내지 0.5, 0.1 내지 0.45, 0.1 내지 0.4, 0.2 내지 0.5, 0.2 내지 0.45, 0.2 내지 0.4, 0.3 내지 0.5, 0.3 내지 0.45, 또는 0.3 내지 0.4 범위에서 선택된 수치, 예컨대 0.4를 기준 값으로 설정할 수 있으나(도 2의 붉은 실선 참조), 이에 제한되는 것은 아니다. 저해제 후보 화합물 중에서 기준 값 이하의 PD-1과 PD-L1의 상호작용 측정 값을 나타내는 화합물이 많으면 (예컨대 전체 후보 화합물 중 50% 이상), 상기 정한 수치보다 낮은 기준 값을 설정하여 다시 스크리닝을 실시할 수도 있다. 상기 기존에 알려진 저해제는 PD-1과 PD-L1의 상호작용의 저해 효과가 확인된 물질 (예컨대, 항체, 소분자 화합물 등) 중에서 선택될 수 있으며, 일 예로 BMS-202 (CAS No.: 1675203-84-5), J105 (항-PD-1 모노클로날 항체 ; 인간 PD-1 표적), J116 (항-PD-1 모노클로날 항체; 인간 PD-1 표적), M1H4 (항-PD-1 모노클로날 항체; 인간 PD-1 표적), RMP1-14 (항-PD-1 모노클로날 항체; 마우스 PD-1 표적), NAT105 (항-PD-1 모노클로날 항체; 인간 PD-1 표적) 등으로 이루어진 군에서 선택된 하나 이상을 들 수 있으나, 이에 제한되는 것은 아니다.
다른 예에서, 본 명세서에서 제공되는 PD-L1 및 PD-1 상호작용 저해제의 작용 부위 또는 작용 아미노산을 확인하는 방법은 다음의 단계를 포함할 수 있다.
(a) PD-L1 또는 PD-1의 이들 간 결합부위 또는 주변 아미노산 잔기 중 하나 이상(예컨대, 하나)이 변이된, 변이 PD-L1 및 야생형 PD-1 또는 변이 PD-1 및 야생형 PD-L1를 준비하는 단계;
(b) 상기 얻어진 변이 PD-1 및 야생형 PD-L1, 또는 변이 PD-L1 및 야생형 PD-1에 PD-L1 및 PD-1 상호작용 저해제를 투입하고, PD-L1와 PD-1 간의 단백질-단백질 상호작용 수준을 측정하는 단계;
(c) 상기 (b)에서 측정된 PD-L1 및 PD-1 간 단백질-단백질 상호작용 수준을 변이 전 (야생형) PD-L1 및 PD-1 간 상호작용 수준과 비교하는 단계.
이하, 상기 단계를 보다 상세히 설명한다.
(a) PD-1 또는 PD-L1의 이들 간 결합부위 또는 주변 아미노산 잔기를 개별적으로 mutation하는 단계
보다 구체적으로, PD-1 및 PD-L1 간 결합 부위 (예컨대, 2개 이상의 아미노산 잔기 포함) 또는 그 주변의 아미노산 잔기들 중에서 PD-1 상에 위치하는 하나 이상(e.g., 하나)의 아미노산 잔기 또는 PD-L1 상에 위치하는 하나 이상(e.g., 하나)의 아미노산 잔기가 변이된 변이 PD-1와 야생형 PD-L1, 또는 변이 PD-L1과 야생형 PD-1을 준비하는 단계를 포함할 수 있다.
상기 아미노산 잔기의 변이는, 예컨대, 전하(charge)를 상실 또는 교체, 길이(length)를 조절, 아미노산 서열을 치환하는 등 다양한 방법에 의하여 수행될 수 있다.
상기 변이된 아미노산 잔기가 PD-1 및 PD-L1 간 상호작용에 필수적이거나 결정적인 부위라면, 이의 변이 자체로도 PD-1 및 PD-L1 간 상호작용의 저해를 유발할 수 있어서, PD-1 및 PD-L1 간 상호작용 저해제의 작용 부위를 확인하는데 장애 (noise)가 될 수 있다. 따라서, 보다 정확하게 PD-1 및 PD-L1 간 상호작용 저해제의 작용 부위를 확인하기 위하여, 상기 변이되는 아미노산 잔기는 PD-1 및 PD-L1 간 상호작용에 영향이 없거나 영향이 적은 아미노산 잔기일 수 있다. PD-1 및 PD-L1 간 상호작용에 영향이 없거나 영향이 적은 아미노산 잔기를 선택하여 변이시키기 위하여, 상기 단계 (a)에서 변이되는 아미노산 잔기는 이것이 변이된 변이 PD-L1와 야생형 PD-1 간, 또는 변이 PD-1와 야생형 PD-L1 간의 상호작용 수준(예컨대, 신호값)이 기준치 이상이 되도록 하는 것일 수 있다.
상기 '기준치'는 상기 '변이 PD-L1와 야생형 PD-1, 또는 변이 PD-1와 야생형 PD-L1 간의 단백질-단백질 상호작용 수준(신호값)'(이하, '변이 PD-L1 및 PD-1 간의 상호작용 수준 (및/또는 신호값)'으로 약칭함)을 야생형 PD-L1과 야생형 PD-1 간의 단백질-단백질 상호작용 수준 (신호값) (이하, '야생형 PD-L1 및 PD-1 간의 상호작용 수준 (및/또는 신호값)'으로 약칭함)에 대한 상대값으로 환산한 수치(예컨대, 변이 PD-L1 및 PD-1 간의 상호작용 수준을 야생형 PD-L1 및 PD-1 간의 상호작용 수준으로 나눈 값)를 기준으로 판단할 수 있다.
일 예에서, 상기 변이 PD-L1 및 PD-1 간의 상호작용 수준 및/또는 야생형 PD-L1 및 PD-1 간의 상호작용 수준은 앞서 설명한 단백질-단백질 상호작용 측정 방법 (단계 (2))로 측정할 수 있다. 측정된 변이 PD-L1 및 PD-1 간의 상호작용 수준의 야생형 PD-L1 및 PD-1 간의 상호작용 수준에 대한 상대값이 기준치 미만인 경우, 상기 변이된 아미노산 잔기 또는 부위는 상호작용 저해제 작용부위 도출(확인) 대상에서 제외한다. 이는, 앞서 설명한 바와 같이, 변이에 의한 상호작용 억제와 저해제에 의한 상호작용 억제를 구별함이 용이하지 않기 때문이다. 측정된 변이 PD-L1 및 PD-1 간의 상호작용 수준의 야생형 PD-L1 및 PD-1 간의 상호작용 수준에 대한 상대값이 기준치 이상인 경우, 상호작용 저해제의 효능을 확인하기 용이하므로 저해제 작용 부위 확인 대상에 포함한다.
예컨대, 상기 '기준치'는 야생형 PD-L1 및 PD-1 간의 상호작용 수준(신호값)을 1로 정상화하였을 때, 0 (신호가 발생하지 않음) 초과 1 미만, 예컨대, 0.1 내지 0.9의 범위에서 선택된 수치일 수 있으며, 구체예에서, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8 또는 0.9일 수 있으나, 이에 제한되는 것은 아니다. 상기 '기준치 이상'은 상기 변이 PD-L1 및 PD-1 간의 상호작용 수준의 야생형 PD-L1 및 PD-1 간의 상호작용 수준에 대한 상대값 (예컨대, 변이 PD-L1 및 PD-1 간의 상호작용 수준(신호값)을 야생형 PD-L1 및 PD-1 간의 상호작용 수준(신호값)으로 나눈 값)이 0.1 이상, 0.2 이상, 0.3 이상, 0.4 이상, 0.5 이상, 0.6 이상, 0.7 이상, 0.8 이상, 또는 0.9 이상 (예컨대, 0.2 이상)인 것을 의미할 수 있다 (상한 수치는 1일 수 있음).
일 예에서, 상기 단계 (a)는 앞서 설명한 바와 같은 변이 PD-L1 및 PD-1 간의 상호작용 수준의 야생형 PD-L1 및 PD-1 간의 상호작용 수준에 대한 상대값이 0.1 이상, 0.2 이상, 0.3 이상, 0.4 이상, 0.5 이상, 0.6 이상, 0.7 이상, 0.8 이상, 또는 0.9 이상 (예컨대, 0.2 이상)이 되도록 하는 아미노산 잔기의 변이를 수행하는 것일 수 있다 (상한 수치는 1일 수 있음).
다른 예에서, 하기 단계 (b)는, 상기 단계 (a)에서 준비된 변이 PD-1 및 야생형 PD-L1, 또는 변이 PD-L1와 야생형 PD-1를 반응시키고, 상호작용에 의한 신호값을 측정하고, 그 신호값을 야생형 PD-L1 및 PD-1 간의 상호작용 신호값으로 정상화한 수치 (즉, 야생형 PD-L1 및 PD-1 간의 상호작용 신호값으로 나눈 수치)가 0.1 이상, 0.2 이상, 0.3 이상, 0.4 이상, 0.5 이상, 0.6 이상, 0.7 이상, 0.8 이상, 또는 0.9 이상 (예컨대, 0.2 이상)인 시료를 선정하여, 선정된 시료에 대하여 PD-L1 및 PD-1 간의 상호작용 저해제를 투입하는 단계를 수행하는 것일 수 있다.
일 예에서, 단계 (a)는 PD-1 (예컨대, 서열번호 1)의 Y68, Q75, K78, T76, I126, L128, A132, I134, 및 E136로 이루어진 군에서 선택된 하나 이상(예컨대, 하나)의 아미노산 잔기(예컨대, Y68, Q75, T76, I134, 및 E136로 이루어진 군에서 선택된 어느 하나)를 다른 아미노산으로 치환하여 변이 PD-1를 생성하는 단계, 및/또는 PD-L1(예컨대, 서열번호 5)의 T20, D25, D26, Y56, E58, R113, M115, A121, D122, Y123, K124, 및 R125로 이루어진 군에서 선택된 하나 이상(예컨대, 하나)의 아미노산 잔기(예컨대, D25, Y56, E58, R113, 및 R125로 이루어진 군에서 선택된 어느 하나)를 다른 아미노산으로 치환하여 변이 PD-L1을 생성하는 단계를 포함할 수 있다.
다른 예에서, 상기 기준은 아미노산 잔기 치환 이외의 변이에도 적용 가능하다. 일 예에서, PD-L1 또는 PD-1의 동일한 부위(결합부위 또는 주변 아미노산 잔기)를 대상으로 하여, 아미노산 잔기 치환 이외의 mutation이 수행되는 경우, 전하를 변화시킨 경우에 상기와 같은 방법으로 측정된 상호작용 수준이 기준치 미만이고, 길이를 변화시킨 경우의 상호작용 수준은 기준치 이상이면, 전하를 변화시키는 mutation은 도출대상에서 제외하고, 길이를 변화시키는 mutation은 도출대상에 포함시켜, 최종적으로 길이 변화 mutation 해당 부위를 저해제 작용 부위 확인 대상에 포함시킬 수 있다. 이 경우, 본 단계 (a)에서 수행되는 mutation은 상기 부위의 길이를 변화시키는 것이거나, 하기의 (b) 및 (c) 단계를 (a) 단계에서 얻어진 반응물 중 길이를 변화시킨 mutation을 포함하는 반응물에 대하여 실시하는 것일 수 있다.
(b) PD-L1 및 PD-1 간의 상호작용 저해제(drug/inhibitor)를 투입하고 PD-L1 및 PD-1 간 단백질-단백질 상호작용 수준을 측정하는 단계
상기 단계 (a)에서 준비되거나, 앞서 설명된 바와 같이 선정된 변이 PD-1 및 야생형 PD-L1, 또는 변이 PD-L1와 야생형 PD-1에 PD-L1 및 PD-1 간의 상호작용 저해제를 투입하고, 변이 PD-1 및 야생형 PD-L1, 또는 변이 PD-L1와 야생형 PD-1 간의 단백질-단백질 상호작용 수준(변이 PD-L1 및 PD-1 간의 단백질-단백질 상호작용 수준으로 약칭함)을 측정하는 단계를 포함할 수 있다.
상기 PD-L1 및 PD-1 간의 상호작용 저해제는 PD-L1 및 PD-1 간의 상호작용 저해 활성이 있는 것으로 이미 알려져 있거나 예상되는 물질 (예컨대, 소분자 화합물, 항체 등) 중에서 선택된 하나 이상일 수 있다. 일 예에서, 상기 PD-L1 및 PD-1 간의 상호작용 저해제는 화학식 I (예컨대, 화학식 1)의 구조를 갖는 화합물, 화학식 II (예컨대, 화학식 2)의 구조를 갖는 화합물, 및 이의 약학적으로 허용가능한 염 중에서 선택된 것일 수 있다.
상기 변이 PD-L1 및 PD-1 간의 단백질-단백질 상호작용 수준은 앞서 설명한 단백질-단백질 상호작용 측정 방법 (단계 (2))로 측정할 수 있다.
(c) PD-L1 및 PD-1 간 상호작용을 비교하는 단계
상기 단계 (b)에서 PD-L1 및 PD-1 간 상호작용 저해제 처리 후 측정된 변이 PD-L1 및 PD-1 간의 단백질-단백질 상호작용 수준을 야생형 PD-L1 및 PD-1 간 단백질-단백질 상호작용 수준과 비교하는 단계를 포함할 수 있다. 상기 비교를 위하여, 본 방법은, 상기 비교하는 단계 이전에, 야생형 PD-L1 및 야생형 PD-1에 상기 저해제를 투여한 후 야생형 PD-L1 및 PD-1 간의 단백질-단백질 상호작용 수준(신호값)을 측정하는 단계를 추가로 포함할 수 있다.
상기 단백질-단백질 상호작용 수준은 앞서 설명한 단백질-단백질 상호작용 측정 방법 (단계 (2))로 측정할 수 있다.
상기 측정된 저해제 처리된 변이 PD-L1 및 PD-1 간의 단백질-단백질 상호작용 수준이 저해제 처리된 야생형 PD-L1 및 PD-1 간의 단백질-단백질 상호작용 수준보다 낮은 경우(야생형 대비 감소), 상기 저해제가 변이 여부에 무관하게 단백질-단백질 상호작용 저해 효과를 나타냄을 의미하므로, 상기 변이된 아미노산 잔기 또는 아미노산 부위는 상기 저해제의 작용 아미노산 잔기 또는 작용 부위가 아니라고 결정 (확인)할 수 있다. 반면, 상기 측정된 저해제 처리된 변이 PD-L1 및 PD-1 간의 단백질-단백질 상호작용 수준이 저해제 처리된 야생형 PD-L1 및 PD-1 간의 단백질-단백질 상호작용 수준 이상인 경우 (야생형 대비 증가), 상기 저해제가 상기 변이에 의하여 단백질-단백질 상호작용 저해 효과를 발휘하지 못함을 의미하므로, 상기 변이된 아미노산 잔기 또는 아미노산 부위는 상기 저해제의 작용 아미노산 잔기 또는 작용 부위라고 결정 (확인)할 수 있다.
본 명세서의 방법으로 도출된 상호작용 저해제 작용부위는, 직접적인 PD-1 및/또는 PD-L1 결합부위에 작용하는 것보다는 간접적으로 상호작용 저해제가 작용하는 부위를 도출함에 우수한 효과를 가질 수 있다. PPI 저해 약물은 직접적으로 두 단백질이 결합하는 부위를 저해하는 것 뿐만 아니라, 인근의 다른 부위에 결합 또는 작용하여 직접적인 결합부위의 결합을 저해하는 것도 포함한다. PPI는 그 작용이 단순한 아미노산 서열이기보다는, 넓은 interface에서 복합적으로 작용하기 때문에 PPI drug이 작용하는 부위도, 작용하는 방법도 복합적으로 다양하게 설계될 수 있다. 따라서, 본 명세서에 의한 작용부위 도출방법은 PPI drug의 작용방법 및 기능을 고려하여 실시하는 방법으로 우수한 효과를 가질 수 있다.
본 명세서에서 제공되는 PD-L1 및 PD-1 상호작용 저해제의 작용부위는 하기와 같다: PD-L1 (예컨대, 서열번호 5)은 E58, R113, 및 R125로 이루어진 군에서 선택된 하나 이상이 PD-L1 및 PD-1 상호작용 저해제 작용 아미노산에 포함될 수 있고, PD-1 (예컨대, 서열번호 1)은 R136이 저해제 작용 아미노산에 포함될 수 있다.
[PD-1 coding DNA sequence (서열번호 9)]
ATGCAGATCCCACAGGCGCCCTGGCCAGTCGTCTGGGCGGTGCTACAACTGGGCTGGCGGCCAGGATGGTTCTTAGACTCCCCAGACAGGCCCTGGAACCCCCCCACCTTCTCCCCAGCCCTGCTCGTGGTGACCGAAGGGGACAACGCCACCTTCACCTGCAGCTTCTCCAACACATCGGAGAGCTTCGTGCTAAACTGGTACCGCATGAGCCCCAGCAACCAGACGGACAAGCTGGCCGCCTTCCCCGAGGACCGCAGCCAGCCCGGCCAGGACTGCCGCTTCCGTGTCACACAACTGCCCAACGGGCGTGACnCCACATGAGCGTGGTCAGGGCCCGGCGCAATGACAGCGGCACCTACCTCTGTGGGGCCATCTCCCTGGCCCCCAAGGCGCAGATCAAA GAG AGCCTGCGGGCAGAGCTCAGGGTGACAGAGAGAAGGGCAGAAGTGCCCACAGCCCACCCCAGCCCCTCACCCAGGCCAGCCGGCCAGTTCCAAACCCTGGTGGTTGGTGTCGTGGGCCTGCTGGGCAGCCTGGTGCTGCTAGTCTGGGTCCTGGCCGTCATCTGCTCCCGGGCCGCACGAGGGACAATAGGAGCCAGGCGCACCGGCCAGCCCCTGAAGGAGGACCCCTCAGCCGTGCCTGTGTTCTCTGTGGACTATGGGGAGCTGGATTTCCAGTGGCGAGAGAAGACCCCGGAGCCCCCCGTGCCCTGTGTCCCTGAGCAGACGGAGTATGCCACCATTGTCTTTCCTAGCGGAATGGGCACCTCATCCCCCGCCCGCAGGGGCTCAGCTGACGGCCCTCGGAGTGCCCAGCCACTGAGGCCTGAGGATGGACACTGCTCTTGGCCCCTCTGA
(밑줄로 표시된 부분은 R136의 암호화 코돈임)
[PD-L1 coding DNA sequence (서열번호 10)]
ATGAGGATATTTGCTGTCTTTATATTCATGACCTACTGGCATTTGCTGAACGCATTTACTGTCACGGTTCCCAAGGACCTATATGTGGTAGAGTATGGTAGCAATATGACAATTGAATGCAAATTCCCAGTAGAAAAACAATTAGACCTGGCTGCACTAATTGTCTATTGG GAA ATGGAGGATAAGAACATTATTCAATTTGTGCATGGAGAGGAAGACCTGAAGGTTCAGCATAGTAGCTACAGACAGAGGGCCCGGCTGTTGAAGGACCAGCTCTCCCTGGGAAATGCTGCACTTCAGATCACAGATGTGAAATTGCAGGATGCAGGGGTGTAC CGC TGCATGATCAGCTATGGTGGTGCCGACTACAAG CGA ATTACTGTGAAAGTCAATGCCCCATACAACAAAATCAACCAAAGAATTTTGGTTGTGGATCCAGTCACCTCTGAACATGAACTGACATGTCAGGCTGAGGGCTACCCCAAGGCCGAAGTCATCTGGACAAGCAGTGACCATCAAGTCCTGAGTGGTAAGACCACCACCACCAATTCCAAGAGAGAGGAGAAGCTTTTCAATGTGACCAGCACACTGAGAATCAACACAACAACTAATGAGATTTTCTACTGCACTTTTAGGAGATTAGATCCTGAGGAAAACCATACAGCTGAATTGGTCATCCCAGAACTACCTCTGGCACATCCTCCAAATGAAAGGACTCACTTGGTAATTCTGGGAGCCATCTTATTATGCCTTGGTGTAGCACTGACATTCATCTTCCGTTTAAGAAAAGGGAGAATGATGGATGTGAAAAAATGTGGCATCCAAGATACAAACTCAAAGAAGCAAAGTGATACACATTTGGAGGAGACGTAA
(밑줄로 표시된 부분은 순서대로 E58, R113, 또는 R125의 암호화 코돈임)
이와 같이 확인된 PD-L1과 PD-1 간 상호작용 저해제의 작용 부위 또는 작용 아미노산 잔기는 PD-L1과 PD-1 간 상호작용 저해제의 저해 작용 메커니즘을 확인(규명)하거나, 및/또는 새로운 PD-L1과 PD-1 간 상호작용 저해제, 상기 저해제 (예컨대, 면역 항암제)의 표적인자, 바이오마커 등을 탐색 (개발)하는데 유용한 정보를 제공할 수 있다.
본 명세서에 기재된 조성물 또는 저해, 치료/예방 방법은 유효 성분인 화학식 I (예컨대, 화학식 1)의 구조를 갖는 화합물, 화학식 II (예컨대, 화학식 2)의 구조를 갖는 화합물, 및 이들의 약학적으로 허용가능한 염으로 이루어진 군에서 선택된 1종 이상을 "약학적 유효량"으로 포함하거나 투여하는 것일 수 있다. 상기 "약학적 유효량"은 소망하는 약리적 효과를 나타낼 수 있는 유효 성분의 약학 조성물 내 함량 또는 투여량을 의미하는 것일 수 있으며, 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 간격, 투여 경로, 배설 속도 및 반응 감수성과 같은 요인들에 의해 적절하게 정해질 수 있다. 예컨대, 상기 유효 성분의 1일 또는 1회 투여량은 0.0001 내지 1000 mg/kg (체중), 0.001 내지 500 mg/kg, 0.01 내지 100 mg/kg, 0.1 내지 50 mg/kg, 또는 0.5 내지 20 mg/kg 범위일 수 있으나 이에 제한되는 것은 아니다. 상기 1일 또는 1회 투여량은 단위 용량 형태로 하나의 제제로 제제화되거나, 적절하게 분량하여 제제화되거나, 다용량 용기 내에 내입시켜 제조될 수 있다.
상기 약학 조성물 내의 유효 성분의 함량은, 약학 조성물의 사용 형태, 환자의 상태, 목적하는 효과 등에 따라 적절히 조절할 수 있으며, 예컨대 0.0001 내지 99.9 중량%, 0.001 내지 99.9 중량%, 0.01 내지 99.9 중량%, 0.1 내지 99.9 중량%, 0.5 내지 99.9 중량%, 1 내지 99.9 중량%, 5 내지 99.9 중량%, 10 내지 99.9 중량%, 15 내지 99.9 중량%, 20 내지 99.9 중량%, 25 내지 99.9 중량%, 30 내지 99.9 중량%, 35 내지 99.9 중량%, 40 내지 99.9 중량%, 45 내지 99.9 중량%, 50 내지 99.9 중량%, 55 내지 99.9 중량%, 0.0001 내지 90 중량%, 0.001 내지 90 중량%, 0.01 내지 90 중량%, 0.1 내지 90 중량%, 0.5 내지 90 중량%, 1 내지 90 중량%, 5 내지 90 중량%, 10 내지 90 중량%, 15 내지 90 중량%, 20 내지 90 중량%, 25 내지 90 중량%, 30 내지 90 중량%, 35 내지 90 중량%, 40 내지 90 중량%, 45 내지 90 중량%, 50 내지 90 중량%, 55 내지 90 중량%, 0.0001 내지 70 중량%, 0.001 내지 70 중량%, 0.01 내지 70 중량%, 0.1 내지 70 중량%, 0.5 내지 70 중량%, 1 내지 70 중량%, 5 내지 70 중량%, 10 내지 70 중량%, 15 내지 70 중량%, 20 내지 70 중량%, 25 내지 70 중량%, 30 내지 70 중량%, 35 내지 70 중량%, 40 내지 70 중량%, 45 내지 70 중량%, 50 내지 70 중량%, 55 내지 70 중량%, 0.0001 내지 50 중량%, 0.001 내지 50 중량%, 0.01 내지 50 중량%, 0.1 내지 50 중량%, 0.5 내지 50 중량%, 1 내지 50 중량%, 5 내지 50 중량%, 10 내지 50 중량%, 15 내지 50 중량%, 20 내지 50 중량%, 25 내지 50 중량%, 30 내지 50 중량%, 35 내지 50 중량%, 40 내지 50 중량%, 45 내지 50 중량%, 0.0001 내지 40 중량%, 0.001 내지 40 중량%, 0.01 내지 40 중량%, 0.1 내지 40 중량%, 0.5 내지 40 중량%, 1 내지 40 중량%, 5 내지 40 중량%, 10 내지 40 중량%, 15 내지 40 중량%, 20 내지 40 중량%, 25 내지 40 중량%, 30 내지 40 중량%, 또는 35 내지 40 중량%일 수 있으나, 이에 제한되는 것은 아니다.
상기 약학 조성물은 수성 또는 유성 매질중의 용액, 현탁액, 시럽제 또는 유화액 형태이거나, 산제, 분말제, 과립제, 정제 또는 캅셀제 등의 형태로 제형화될 수 있으며, 제형화를 위하여 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
본 명세서에서 제공되는 조성물 및 방법에 있어서, "투여"는 경구 또는 비경구 경로로 수행될 수 있다. 비경구 투여인 경우에는 정맥내 주입, 피하 주입, 근육 주입, 복강 주입, 내피 투여, 병변 부위 국소 투여, 비내 투여, 폐내 투여, 또는 직장내 투여 등의 경로로 수행될 수 있다.
본 명세서에서 제공되는 조성물 및 방법에 있어서, 유효 물질이 투여되는 개체, 환자 또는 대상은 모든 포유류, 예컨대 인간, 원숭이 등의 영장류, 마우스, 래트 등의 설치류, 또는 이로부터 분리된 세포, 조직, 또는 이의 배양물 등일 수 있고, 예컨대, PD-L1과 PD-1 간 상호 작용과 관련된 질병을 갖는 환자일 수 있다. 상기 PD-L1과 PD-1 간 상호 작용과 관련된 질병은 PD-L1과 PD-1 간 상호 작용의 증가 (예컨대, 정상보다 증가)와 관련된 질병일 수 있으며, 예컨대, 암, 염증, 그 외 면역질환 등일 수 있다. 구체예에서, 상기 개체, 환자 또는 대상은 암환자일 수 있다.
본 명세서에서 사용되는 비교 기준으로서의 "정상"은 비-병리적 상태의 개체 또는 세포를 의미할 수 있으며, 상기 "비-병리적 상태"는 질병 상태가 아니거나, 돌연변이, 종양 형성, 기능적 및/또는 형태적 이상 등을 갖는 질병을 유발할 수 있는 상태가 아닌 것을 의미할 수 있다. 예컨대, 정상 세포는 PD-L1과 PD-1 간 상호 작용과 관련된 질병을 갖지 않는 개체 또는 세포일 수 있으며, 투여 대상, 세포, 또는 조직과 동일 또는 동종 유래의 것일 수 있다.
상기 암은 모든 고형암 및 혈액암 중에서 선택될 수 있으며, 예컨대 PD-L1과 PD-1 간 상호 작용과 관련된 암일 수 있다. 예컨대, 상기 암은 편평상피세포암, 소세포폐암, 비소세포폐암, 폐의 선암, 폐의 편평상피암, 복막암, 피부암, 피부 또는 안구내 흑색종, 직장암, 항문부근암, 식도암, 소장암, 내분비선암, 부갑상선암, 부신암, 연조직 육종, 요도암, 만성 또는 급성 백혈병, 림프구 림프종, 위암, 췌장암, 교아종, 경부암, 난소암, 방광암, 유방암, 결장암, 대장암, 자궁내막 또는 자궁암, 침샘암, 신장암, 전립선암, 음문암, 갑상선암, 두경부암, 뇌암 등으로 이루어진 군에서 선택된 1종 이상일 수 있으나 이에 제한되는 것은 아니다. 상기 암은 원발성 암뿐 아니라 전이성 암을 포함할 수 있다. 또한, 상기 암은 기존의 항암 치료에 대하여 저항성을 갖거나 획득한 암일 수 있다.
본 명세서에 사용된 바로서, 용어 "효과"는 약물 또는 치료가 처치 대상에서 달성하고자 하는 의학적 및/또는 약학적 효과를 의미하는 것으로, 처치 대상이 갖는 질병의 예방 및/또는 치료, 및/또는 증상의 완화 및/또는 개선 등을 의미하는 것일 수 있다. 예컨대, 상기 약물이 항암제이고 치료가 항암 치료이고, 상기 처치 대상이 암환자인 경우, 상기 효과는 항암 효과(암의 예방 및/또는 치료 효과)일 수 있고, 상기 항암 효과는 암세포의 성장을 억제하는 효과뿐 아니라, 이동(migration), 침습(invasion), 및/또는 전이(metastasis) 등을 억제, 및/또는 암의 악화를 억제, 및/또는 저항성을 감소 또는 제거하는 효과 등을 포함하는 것일 수 있다.
다른 예에서, 본 명세서에서 제공된 단백질-단백질 상호작용 측정 단계를 포함하는 방법에 사용하기 위한 단백질-단백질 상호작용 측정용 장치가 제공된다. 상기 단백질-단백질 상호작용 측정용 장치는 조직 내의 신호전달경로의 활성화 측정용 장치, 제1 단백질을 표적으로 하는 약물에 대한 반응성 예측 및/또는 모니터링용 장치, 제1 단백질을 표적으로 하는 치료에 적합한 개체를 선별하기 위한 장치, 및/또는 제1 단백질을 표적으로 하는 약물의 효능 확인용 장치로서 적용 가능하다. 상기 제1 단백질은 PD-L1 또는 PD-1이다.
상기 단백질-단백질 상호작용 측정용 장치는 앞서 설명한 세포 또는 조직 내의 신호전달경로의 활성화 측정, 제1 단백질을 표적으로 하는 약물에 대한 반응성 예측 방법, 제1 단백질을 표적으로 하는 약물에 대한 반응성 모니터링 방법, 제1 단백질을 표적으로 하는 치료에 적합한 개체를 선별하는 방법, 및/또는 약물의 스크리닝 방법에 적용됨으로써, 소량의 시료에서의 생체 분자 간 상호 작용도 정확하고 효율적으로 관찰, 분석, 검출, 및/또는 측정할 수 있다는 이점을 갖는다. 단백질-단백질 상호작용 측정용 장치 또는 이를 이용하는 분석 방법은 생검 (예컨대, needle biopsy) 시료와 같이 매우 소량의 시료에 대해서도 유용하고 효과적으로 적용될 수 있다. 또한, 상기 단백질-단백질 상호작용 측정용 장치 또는 이를 이용하는 분석 방법은 다양한 생체 분자 (예컨대, 단백질, 핵산 등) 간의 상호작용을 소량의 시료를 이용하여 정확하고 효율적으로 관찰, 분석, 검출, 및/또는 측정할 수 있다.
상기 단백질-단백질 상호작용 측정용 장치는,
제1 단백질에 특이적으로 결합하는 제1 단백질의 포획용 물질을 포함하는 반응부를 포함하는 것일 수 있고,
여기에 더하여 신호검출 수단을 추가로 포함할 수 있다.
상기 제1 단백질은 PD-L1 또는 PD-1이다.
상기 단백질-단백질 상호작용 측정용 장치는 PD-L1과 PD-1 간의 상호작용 (결합) 여부 및/또는 정도를 측정하는데 사용될 수 있다.
상기 반응부는 표면에 제1 단백질 포획용 물질이 고정화된 기판을 포함할 수 있으며, 상기 제1 단백질 포획용 물질은 앞서 제1 단백질이 고정화된 기판 준비 단계 부분에서 설명한 제1 단백질에 특이적으로 결합하는 물질, 예컨대, 항체 또는 이의 항원결합단편일 수 있다. 예컨대, 상기 항체 또는 이의 항원결합단편은, 앞서 설명한 바와 같이, PD-L1과 PD-1 간의 결합부위인 PD-L1의 N-말단 부위를 제외한 비결합 부위 (예컨대, C-말단 부위)에 결합하는 항 PD-L1 항체 또는 이의 항원결합단편, 및/또는 PD-L1과 PD-1 간의 결합부위인 PD-1의 N-말단 부위를 제외한 비결합 부위 (예컨대, C-말단 부위)에 결합하는 항 PD-1 항체 또는 이의 항원결합단편일 수 있다. 상기 반응부는 웰 (예컨대, 멀티웰) 타입, 슬라이드 타입, 채널 타입, 어레이 형태, 미세유체칩, 미세관 (캐필러리) 등일 수 있으나, 이에 제한되는 것은 아니다.
상기 단백질-단백질 상호작용 측정용 장치는 상기 제1 단백질과 상호작용하는 제2 단백질을 추가로 포함할 수 있다. 일 예에서, 상기 제2 단백질은 검출 가능한 신호를 발생시키는 표지 물질로 표지되거나 (표지 물질이, 예컨대, 화학적 (예컨대, 공유적 또는 비공유적), 재조합적, 또는 물리적으로, 결합되거나), 표지물질이 결합될 수 있는 tag이 부착된 형태일 수 있다.
상기 제1 단백질은 PD-L1 및 PD-1 중에서 선택된 어느 하나이고, 제2 단백질은 다른 하나이다. 예컨대, 제1 단백질이 PD-L1인 경우, 상기 제2 단백질은 PD-1이며, 상기 제1 단백질이 PD-1인 경우, 상기 제2 단백질은 PD-L1이다.
또한, 상기 단백질-단백질 상호작용 측정용 장치는 신호 검출 수단에서 측정된 신호값을 제1 단백질의 수준으로 정상화(normalization)시키기 위하여, 제1 단백질에 결합하는 탐지용 물질 및 상기 탐지용 물질에 결합하는 표지용 물질을 추가로 포함할 수 있다. 상기 제1 단백질에 결합하는 탐지용 물질은 앞서 설명한 멀티 웰에 포함된 제1 단백질의 포획용 물질과 상이한 부위에서 제1 단백질과 결합하는 생물 분자 (예컨대, 항체)일 수 있으며, 상기 표지용 물질은 검출 가능한 신호를 발생시키는 표지 물질로 표지되고 (표지 물질이, 예컨대, 화학적 (예컨대, 공유적 또는 비공유적으로 결합) 상기 제1 단백질에 결합하는 탐지용 물질에 결합 가능한 생물 분자 (예컨대, 항체)일 수 있다.
상기 신호검출 수단은 사용된 표지 물질에서 발생시키는 신호에 따라서 통상적으로 사용되는 모든 신호 검출 수단일 수 있다. 예컨대, 상기 신호 검출 수단은 신호 자극부 및 신호 검출부를 포함할 수 있으며, 여기에 더하여 측정된 신호를 분석 (예컨대, 정량 또는 영상화)하는 신호 분석부를 추가로 포함할 수 있다. 일 예에서, 신호 자극, 신호 검출, 및 신호 분석은 각각 다른 부위에서 수행되거나, 이들 중 적어도 두 가지 이상이 하나의 부위에서 동시에 또는 연속하여 수행될 수 있다. 일 예에서, 상기 표지가 형광물질인 경우, 상기 신호 검출 수단은 형광 신호를 발생 및 검출할 수 있는 모든 수단들 중에서 선택될 수 있으며, 예컨대, 형광 신호 자극부 (예컨대, 광원), 및 형광 신호 검출부, 및/또는 형광 신호 분석부를 포함할 수 있다. 일 구체예에서, 상기 신호 검출 수단은 전반사 형광 현미경(Total Internal Reflection Fluorescence (TIRF) microscope) 또는 공초점 현미경 (광원 및 형광신호 검출용)을 포함하거나, 여기에 더하여, 형광 카메라, 예컨대 EMCCD (Electron-multiplying charge-coupled device) 카메라 또는 CMOS (Complementary metal oxide semiconductor) 카메라를 추가로 포함하여, 광원 공급 및 형광 신호의 영상화 및/또는 정량을 수행할 수 있다. 상기 광원의 파장, 세기, 형광 카메라 측정 조건 (예컨대, 1 프레임당 노출시간, 레이저 파워, 카메라 gain값, 총 촬영 프레임 등)은 앞서 설명한 바와 같다.
다른 예에서, 앞서 설명한 바와 같은 제1 단백질에 특이적으로 결합하는 제1 단백질의 포획용 물질을 포함하는 반응부를 포함하는 단백질-단백질 상호작용 측정용 키트가 제공된다. 상기 단백질-단백질 상호작용 측정용 키트는 PD-L1과 PD-1 간의 상호작용 (결합) 여부 및/또는 정도의 측정에 사용될 수 있다. 상기 단백질-단백질 상호작용 측정용 키트는 조직 내의 PD-L1과 PD-1이 관여하는 신호전달경로의 활성화 측정용 키트, 제1 단백질을 표적으로 하는 약물에 대한 반응성 예측 및/또는 모니터링용 키트, 제1 단백질을 표적으로 하는 치료에 적합한 개체를 선별하기 위한 키트, 및/또는 제1 단백질을 표적으로 하는 약물의 효능 확인용 키트로서 적용 가능하다.
본 명세서에 제공된 단백질-단백질 상호작용 측정용 키트는 소량의 시료에서의 PD-L1과 PD-1 간 상호 작용을 정확하고 효율적으로 관찰, 분석, 검출, 및/또는 측정할 수 있다는 이점이 갖는다. 따라서, 상기 멀티 웰 또는 이를 이용하는 분석 방법은 생검 (예컨대, needle biopsy) 시료와 같이 매우 소량의 시료에 대해서도 유용하고 효과적으로 적용될 수 있다.
본 명세서에서 제공하는 PD-L1과 PD-1 간 상호작용 저해제는 소분자 화합물로 제조가 용이하여 대량 생산 가능하고, 비용이 항체의약품과 대비하여 저렴하므로 면역항암치료에 적극적으로 활용될 수 있다.
PD-L1과 PD-1 간 상호작용 저해제 스크리닝 방법은 단백질 상호작용 단분자 측정 기술을 이용하여 본 명세서에서 제시된 화합물 이외의 우수한 효능을 갖는 저해제를 추가적으로 스크리닝 할 수 있다.
본 명세서에서 제공되는 PD-L1 및 PD-1 상호작용 저해제의 작용부위 도출 방법은, 저해제의 작용 메커니즘을 도출할 수 있고, 면역항암제의 표적인자 및 바이오마커 발굴에도 활용될 수 있다.
본 명세서에서 제공되는 PD-L1 및 PD-1 상호작용 저해제의 작용 부위는, 본 명세서에서 제공하는 소분자 화합물 이외에 면역항암제의 표적으로 활용될 수 있다.
도 1a는 GFP-PD-1과 mcherry PD-L1을 각각 발현시킨 세포 용해액을 이용하여 단백질-단백질 상호작용 저해제 스크리닝하는 과정을 예시적으로 보여주는 모식도이다.
도 1b은 10nM의 GFP-PD-1과 mcherry PD-L1을 사용하여 진행하여 얻어진 단백질-단백질 상호작용의 형광 이미지이고, 도 1c는 이를 정량한 결과(PPI complex 개수; Fluorescence-counts; F-counts)를 보여주는 그래프이다.
도 2는 PPI drug library의 화합물을 사용하여 얻어진 PD-1/PD-L1 간의 PPI complex 개수(F-counts)를 보여주는 그래프이다 (Total 10434 compounds, 이 중에서, 8540 from ASINEX library & Rest from FDA approved library).
도 3a는 기판에 PD-L1을 고정시킨 경우와, PD-1을 고정시킨 경우의 F-counts(왼쪽) 및 형광 이미지 (오른쪽)를 보여준다.
도 3b는 기판에 PD-L1을 고정시킨 경우와, PD-1을 고정시킨 경우의 F-counts의 cluster ratio (%) (왼쪽) 및 형광 이미지 (오른쪽)를 보여준다.
도 4a, 도 4b는 PD-1과 PD-L1 간 단백질 상호작용 저해제의 구조도이다.
도 4c는 도 4a(compound 1), 도 4b(compound 2) 및 BMS-202를 각 투입한 후 농도별(concentration) PD-1 및 PD-L1 간 단백질 상호작용 값 (normalized PPI(%): 화합물을 처리하지 않은 well (DMSO 처리)에서 보이는 신호를 100%로 표준화하고, 이에 대하여 농도별 화합물을 처리했을 때의 PPI complex (cluster 또는 single 형태 모두 포함)의 수를 카운팅하여 상대적으로 나타낸 것)의 변화 정도를 보여준다 (x축: 화합물 농도).
도 5a는 PD-L1의 일부 잔기를 mutation한 후 PD-1 및 PD-L1의 상호작용에 의한 F-counts 값(왼쪽)과, PD-1의 일부 잔기를 mutation한 후 PD-1 및 PD-L1의 상호작용에 의한 F-counts 값(오른쪽)이다.
도 5b는 도 5a에서 도출된 영역 중 mutation 후 compound 1에 대하여 일부 영역이 저항성을 보여주는 그래프이다. WT은 mutation하지 않은 PD-1, PD-L1에 compound 1 투입 전/후 F-counts의 변화 값을 보여준다.
도 5c는 도 5a에서 도출된 영역 중 mutation 후 compound 2에 대하여 일부 영역이 저항성을 보여주는 그래프이다. WT은 mutation하지 않은 PD-1, PD-L1에 compound 2 투입 전/후 F-counts의 변화 값을 보여준다.
도 6은 화합물 1 및 화합물 2의 항암효과를 종양/면역세포 공동 배양 실험을 통하여 확인한 결과 (cell viability, %)를 보여주는 그래프이다 (X축: 화합물 처리 농도).
도 7은 실시예 1.7에서 다양한 항체를 기판에 고정시키고 GFP-PD-1과 mcherry PD-L1을 사용하여 진행하여 얻어진 PD-1/PD-L1 간의 PPI complex 개수(F-counts)를 나타낸 그래프이다.
도 8a는 억제제 후보 약물 스크리닝 과정을 모식적으로 보여준다.
도 8b는 약물 스크리닝을 위한 tube에서의 one-step reaction의 반응 조건(반응 시간)을 최적화하기 위한 시험 결과를 보여주는 그래프이다.
도 8c는 시판중인 두 종의 PD-1/PD-L1 억제제인 BMS202 및 S7911(이상, Selleck Chem에서 구입)을 사용하여 얻어진 PD-1/PD-L1 간의 PPI complex 개수(F-counts)를 보여주는 그래프이다.
도 9a는 에피토프 맵핑을 위한 PD-L1 mutant construct를 설계 과정을 모식적으로 보여준다.
도 9b는 PD-L1 antibody (9A11)의 PD-L1 WT (야생형), d280, 또는 d270 변이체에 대한 결합 정도를 보여준다.
도 9c는 PD-1와 PD-L1 WT, d280, 또는 d270 변이체 간의 단백질-단백질 상호작용 정도를 보여준다.
본 발명을 하기 실시예를 들어 더욱 자세히 설명할 것이나, 본 발명의 권리범위가 하기 실시예로 한정되는 의도는 아니다.
실시예 1: PD-1 및 PD-L1 간 상호작용 측정
1.1. 면역단백질 PD-1 및 PD-L1의 준비
PD-1은 GFP로 표지하여 GFP labeled PD-1 형태로, PD-L1은 mcherry로 표지하여 mcherry labeled PD-L1 형태로 각각 준비하였다.
PD-1-GFP는 human PD-1 (GenBank Accession No: NP_005009.2 encoded by NM_005018.3) 고유의 신호 서열 (Signal sequence)을 포함한, 1번부터 288번까지의 단백질 서열 (서열번호 1) 및 상기 아미노산 서열의 카복시 말단 (C-terminal)에 연결된 GFP (아미노산
서열:
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK (서열번호 2))로 구성되며, 상기 두 단백질은 19개 아미노산으로 구성된 펩타이드 링커에 의하여 연결되도록 준비하였다 [N'-(PD-l)-(펩타이드 링커)-(GFP)-C'].
상기 PD-1와 GFP 사이에 사용된 링커의 아미노산 서열 및 이를 암호화하는 핵산 서열은 다음과 같다:
핵산 서열:
N'-AGAATTCTGCAGTCGACGGTACCGCGGGCCCGGGATCCACCGGTCGGATCTGGTAGT-3'
(서열번호 4);
아미노산 서열:
N'-RILQSTVPRARDPPVGSGS-C' (서열번호 3).
단, 상기 링커의 길이 및 서열은 단지 예시에 불과하다.
링커의 길이가 특정 개수, 예를 들어 아미노산 개수 기준으로 8개 (아미노산 기준) 미만으로 짧아지게 되거나, 또는 강직한(rigid) 및/또는 큰(bulky) 아미노산으로 구성될 경우, 앞부분 (N-말단 부분)의 PD-1과 뒷부분(C-말단 부분)의 GFP사이에 겹침(clash)가 생겨서 단백질이 오접힘(misfolding)이 되거나, 쉽게 분해(degradation)이 일어날 수 있어, PPI 측정에 영향을 미칠 수 있다. 상기 링커는 하나 이상의 G(글라이신) 및/또는 하나 이상의 S(세린)을 포함할 수 있으나, 이에 한정되는 것은 아니다. 글라이신과 세린은 다른 아미노산들과 비교하여 상대적으로 유연(flexible)하기 때문에 단백질의 접힘(folding) 및 PPI 측정에 유리할 수 있다.
PD-L1-mCherry는 human PD-L1 (GenBank Accession No: NP_054862.1 encoded by NM_014143.4) 고유의 신호서열 (Signal sequence)을 포함한, 1번부터 290번까지의 단백질 서열 (서열번호 5)과 상기 단백질 서열의 카복시 말단 (C-terminal)에 연결된 mCherry (아미노산 서열: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK (서열번호 6))로 구성되며, 상기 두 단백질은 16개 아미노산으로 구성된 펩타이드 링커에 의하여 연결되도록 준비하였다 [N'-(PD-L1)-(펩타이드 링커)-(mcherry)-C'].
상기 PD-L1-mCherry 사이에 사용된 링커의 아미노산 서열 및 이를 암호화하는 핵산 서열은 다음과 같다:
핵산 서열:
5'-TACCCAACTTTCTTGTACAAAGTGGTTGATCCGGTACCGGTCGCCACC-3'(서열번호 8);
아미노산 서열:
N'-YPTFLYKVVDPVPVAT-C' (서열번호 7).
단, 상기 링커의 길이 및 서열은 단지 예시에 불과하다.
상기 사용된 링커는 16개의 아미노산으로 구성된 구조이며, N terminal의 PD-L1과 C terminal의 mCherry를 연결하고 있다. 링커의 길이가 특정 개수, 예를 들어 아미노산 개수 기준으로 8개 (아미노산 기준) 미만으로 짧아지게 되거나, 또는 강직한(rigid) 및/또는 큰(bulky) 아미노산으로 구성될 경우, 앞부분(N-말단 부분)의 PD-1과 뒷부분(C-말단 부분)의 GFP사이에 겹침(clash)가 생겨서 단백질이 오접힘(misfolding)이 되거나, 쉽게 분해(degradation)이 일어날 수 있어 PPI 측정에 영향을 미칠 수 있다. 상기 링커는 하나 이상의 G(글라이신) 및/또는 하나 이상의 S(세린)을 포함할 수 있으나, 이에 한정되는 것은 아니다. 글라이신과 세린은 다른 아미노산들과 비교하여 상대적으로 유연(flexible)하기 때문에 단백질의 접힘(folding) 및 PPI 측정에 유리할 수 있다. 여기에 더하여, 링커가 너무 짧아지게 될 경우 C-terminus를 epitope로 사용하고 있는 PD_L1 항체(예컨대, 9A11 (Cell Signaling Technology, #29122S) 등)와의 결합(binding)이 심각하게 저해되고 pull-down 효율이 많이 떨어질 수 있어, PPI 측정에 영향을 미칠 수 있다.
단, 기판에 고정되는 (즉, 제1 단백질로 사용되는) PD-L1에 결합된 표지 (본 실시예의 경우 mcherry)는 PPI 측정에 필수적인 것은 아니며, PD-L1에 mCherry 부착 없이도 PD-1/PD-L1의 상호작용을 측정할 수 있다.
한편, 제1 단백질로 사용되는 PD-L1에 표지 (예컨대, mCherry)를 붙이면 기판에 부착된 PD-L1을 정량할 수 있다는 장점이 있다. 이 경우, Spectrophotometer 를 이용한 형광 정량이 가능하기 때문에, 목적하는 농도의 PD-L1을 기판에 코팅할 수 있으며, 반대로, 해당 조건에서 기판에 코팅되는 PD-L1의 개수를 정량적으로 추적할 수도 있다.
PD-L1의 개수를 정량 추적할 경우의 장점은 다음과 같이 예시할 수 있다:
기판에 코팅되는 PD-L1의 수를 추적하면 drug screening을 할 경우 inhibitor의 negative selection에 도움이 될 수 있다. Tube reaction을 통하여 PD-1*(*는 형광표지)/PD-L1/inhibitor mixture를 기판에 incubation 하고 PD-1*를 count하게 되면 PD-1과 PD-L1의 상호작용을 저해하는 약물을 선별할 수 있지만, 간혹 PD-L1과 항-PD-L1 항체의 결합을 저해하는 약물도 잘못 선별될 수 있다. 이때 기판에 결합된 PD-L1의 수를 관찰하면 이와 같이 잘못 선별된 약물들을 다시 골라낼 수 있다.
한편, 표지되지 않은 PD-L1을 사용하는 경우에도 negative selection이 불가능한 것은 아니다. PD-L1 ELISA를 통하여 관찰할 수 있다. 다만, 표지된 (예컨대, mCherry로 표지된) PD-L1을 사용하게 되면 해당 과정을 one-step으로 진행할 수 있다.
상기 준비된 [(PD-1)-(펩타이드 링커)-(GFP)]와 [(PD-L1)-(펩타이드 링커)-(mCherry)]를 암호화하는 두 유전자를 각각 pCDNA 3.1 backbone(Addgene)에 삽입하고, HEK293T 세포에 도입하여, 단백질로 발현시켰다.
유전자의 숙주 세포 내 도입을 위하여, 통상적으로 사용 가능한 모든 수단, 예컨대, PEI(polyethyleneimine)을 이용하는 형질도입, lipofectamine 등을 이용하는 lipofection, electroporation 등의 방법이 사용될 수 있다.
본 실시예에서는, 예시적으로 PEI를 이용한 transfection을 수행하였다. PEI는 highly positive charge를 갖는 물질로, DNA를 머금고 세포 안으로 침투하여, 단백질로 발현시킨다. PEI를 이용한 transfection의 구체적 과정은 다음과 같다:
100mm dish를 기준으로 50만개의 HEK293T 세포 (ATCC [293T (ATCC® CRL-3216TM)])를 준비하였다. Opti-MEM buffer (Thermo Fisher Scientific) 2ml을 준비하여, 1ml은 DNA (앞서 준비된 [(PD-1)-(펩타이드 링커)-(GFP)]와 [(PD-L1)-(펩타이드 링커)-(mCherry)]를 암호화하는 유전자를 각각 포함하는 벡터) 20ug과, 나머지 1ml은 PEI 50ug과 각각 혼합하였다. 5분 후, DNA와 PEI를 서로 혼합하고, 추가로 20분 동안 배양하였다. DNA와 PEI 혼합물을 상기 준비된 HEK293T 세포에 처리하고, 48시간동안 배양한 후, 세포를 수집하였다.
세포 용해 과정에 사용된 용해 버퍼 (Lysis buffer)의 조성을 다음의 표 1에 정리하였다:
Figure PCTKR2019011265-appb-T000001
수집한 세포의 양에 맞게 용해 버퍼를 첨가한 후, re-suspension, ice에서 30분 incubation한 후, 14000g 이상에서 15분 동안 원심분리하였다. 이때 protease inhibitor (Sigma-Aldrich (11836170001)), phosphatase inhibitor (Sigma-Aldrich (P5726))를 첨가하였다. 상등액을 취하여, Fluorometer를 이용하여 형광 농도를 측정한 후 보관하였다.
1.2. 기판의 준비
Coverslip을 KOH 1M 용액에 침지시킨 후, sonicator에 담아서 세척하였다 (20-30 min). 그 후, 3차 증류수로 잘 씻은 후, piranha solution(황산:과산화수소 = 2:1 ~ 3:1 (v/v))을 이용하여 세척하였다. 세척한 coverslip 표면에 대하여 aminopropylsilane와 PEG(polyethylene glycol)를 차례로 처리하여 코팅을 수행하였다.
2시간 반응 후, 3차 증류수로 세척한 뒤 PEG 코팅된 면이 접촉되지 않게 하여 -20℃에서 사용시까지 보관하였다.
동시에 석영 재질의 channel 형태의 기판 또는 아크릴 재질의 well 형태의 기판을 준비하였다. 석영 재질의 기판의 경우, 앞서 설명한 coverslip 처리 과정을 참조로 세척 및 PEG 코팅 과정을 수행하였다.
아크릴 재질의 기판의 경우, 제작 후 3차 증류수에 침지시킨 후 sonication하여 세척하였다. 세척된 아크릴 재질의 기판을 5% BSA 용액에 침지시키고 2시간 반응시켜 비특이적 단백질 흡착 (nonspecific protein adsorption)을 방지하고, -20℃에서 사용시까지 보관하였다.
하기 시험에서는 상기 준비된 coverslip과 아크릴 재질의 기판을 사용하였으며, 시험 전에 상기 coverslip과 아크릴 재질의 기판을 해동하여 조립하거나, PEG 코팅이 끝난 뒤 미리 조립하고, 조립된 형태로 -20℃에 보관하여 사용 전에 해동하여 사용하였다.
1.3. PD-L1과 PD-1 간 단백질-단백질 상호 작용 측정
PD-L1과 PD-1 간 단백질-단백질 상호 작용 유도
상기 실시예 1.2에서 준비된 기판에 Avidin 계열의 단백질인 Neutravidin (Thermo, A2666)을 0.1 mg/ml 농도로 투입하였다. 상온에서 5분 반응 시킨 후 PBS buffer 30 ul를 이용하여 2회 기판을 세척하였다.
제1 단백질로서 PD-L1 또는 PD-1을 사용한 경우를 예시하기 위하여, 상기 준비된 기판에 상기 제1 단백질에 대한 항체를 처리하였다. 이 때, 사용되는 항체는 biotin이 접합된 형태인 것으로 준비하였다. 항체의 농도는 항체-항원의 affinity (dissociation constant, KD)에 따라 적절히 조절될 수 있으며, 본 실험예에서는 2 ug/ml 정도로 사용하였고, 반응시간은 5분 정도로 하였다. Biotin이 접합되어 있지 않은 항체를 사용하는 경우에는 이차 항체를 이용하여 제 1 단백질의 항체를 부착할 수 있다.
본 실시예에서 사용된 제1 단백질에 대한 항체를 다음의 표 2에 정리하였다:
Figure PCTKR2019011265-appb-T000002
이하, 항 PD-L1 항체를 기판에 고정시킨 시험을 예시한다.
상기 표 2에 예시된 항 PD-L1 항체(9A11 또는 #D8T4X)가 처리된 기판을 PBS buffer 30 ul를 이용하여 2회 세척하였다. 상기 준비된 기판에 앞서 실시예 1에서 준비한 PD-L1 단백질 용해액 (mCherry-PD-L1 발현 세포 용해액의 원심분리 후의 상등액; 제1 단백질로 사용)을 투입하여, 기판에 PD-L1을 고정화시켰다. 항원-항체 반응의 경우 15분까지는 계속 증가할 수 있고 15분을 초과하면서 시간대비 항원-항체 반응 효율이 낮아질 수 있어서, 반응시간을 15분 정도로 설정하였다. 반응 후, 기판을 PBS에 tween 20이 0.05%(v/v) 포함된 버퍼를 이용하여 세척하였다. Tween 20 0.05%는 nonspecific binding을 줄여주는 동시에, 막단백질의 hydrophobic region이 손상되지 않도록 도와준다.
그 후, 상기 얻어진 표면에 PD-L1 단백질이 고정된 기판에 실시예 1.1에서 얻어진 PD-1 단백질 용해액 (GFP-PD-1 발현 세포 용해액의 원심분리 후의 상등액)을 투입하였다. PD-L1 단백질은 10nM 농도로 사용하고, PD-1 단백질은 10nM, 30nM, 또는 50nM 농도로 사용하였다.
상기 시험 과정을 도 1a에 모식적으로 나타내었다.
단백질 단백질 상호작용에 의한 복합체(PPI complex)의 이미징
단백질 복합체 (PPI complex)이미징 과정은 다음과 같다:
상기 준비된 기판 (well type 또는 quartz slide 중 어느 것을 사용하여도 무방함)을 전반사 형광현미경 (Total Internal Reflection Fluorescence (TIRF) microscope) 위에 고정시켰다. eGFP의 형광신호 관측을 위하여, 488 nm의 파장을 이용하였으나, 이에 제한되지 않고 eGFP를 발광 시킬 수 있는 어떠한 파장의 레이저를 사용해도 무방하다 (레이저 파장 범위: 460 ~ 500 nm). 형광 이미지는 EMCCD (Electron-multiplying charge-coupled device; Andor iXon Ultra 897 EX2 (DU-897U-CS0-EXF)) 카메라를 사용하여 얻었다.
예시적으로, 이미징을 위한 EMCCD 카메라의 각종 수치를 다음과 같이 조정하였다:
a. 레이저 파워 : 2 mW
레이저 파워가 너무 높으면 eGFP가 빨리 형광신호를 잃어버리게 되고 (photobleaching), 너무 낮으면 EMCCD에 의해 신호를 관측하기 어려워진다. 상기 레이저 파워 범위는 eGFP의 발광시간 (lifetime)을 11초 정도로 유지시켜 주는 범위이다.
b. EMCCD 카메라의 1 프레임 당 노출시간 (exposure time) : 0.1초
1 프레임 당 노출시간이 짧을수록 1 프레임에 누적되는 신호가 줄어들게 되므로, 이를 극복하기 위해서 레이저 파워를 높이거나, EMCCD의 감도를 높여야 한다.
c. EMCCD의 gain (gain이 클수록 측정된 신호가 증폭되고 동시에 노이즈도 증가함) : 40
eGFP에서 생성된 광자 (photon)는 EMCCD의 소자를 통해 전자로 바뀌어 계측된다 (광전효과, photoelectric effect). 이 때, 광자 1개 당 생성되는 전자의 개수를 gain 값을 통해 변경할 수 있다. 설정된 gain이 높을수록 광자 1개 당 생성되는 전자의 개수가 늘어나서, EMCCD의 감도가 높아진다. 동시에 background noise도 함께 증가하므로 signal-to-noise 비율이 중요하다. 따라서, 본 실시예에서는 EMCCD의 gain을 40으로 조정하였지만, 이에 제한되는 것은 아니고, 앞서 설명한 내용을 근거로 적절히 변경할 수 있다.
d. 총 촬영 프레임 : 10 프레임
10 프레임 촬영을 하게 되면 현재 노출시간을 기준으로 1초동안의 PPI 변화를 관찰할 수 있다. 본 실시예에서는 30분 간의 tube incubation, 15분 간의 기판에서의 incubation, washing step을 차례로 진행한 후, 이미징을 진행하므로, 이미징에서 관찰되는 신호의 세기 및 강도는 굉장히 안정적이다. 따라서 실험시간의 단축을 위하여 10프레임으로 고정하여 사용하고 있으며 분석은 주로 (5-7) 프레임을 진행한다. 다만, 10프레임 중 초기 프레임(1-3), 후반 프레임(8-10)을 측정하더라도 비슷한 값을 확보할 수 있다.
한 조건에 대해 (하나의 well 혹은 하나의 channel), 위치를 옮겨가며 각각 다른 위치에서 최소 10장의 이미지를 얻고, 상기 얻어진 10장의 이미지를 각각 분석한 후, 평균과 표준편차를 각 조건의 대표값으로 설정하였다. 10장은 최소 기준이며, 장 수가 많을수록 통계적 정확도가 높아진다. 한 조건에서 모든 이미지를 얻고 나면 다음으로 이동하여 (다음 well 혹은 다음 channel) 동일한 동작을 반복하였다.
앞서 설명한 바와 같이, PD-L1을 기판에 고정하는 경우, PPI 신호가 cluster를 형성할 수 있다. 이 경우, 레이저 파워를 줄이거나 gain 수를 줄이면 spot의 형광신호 세기가 줄어들어, single GFP spot은 거의 안보이고, cluster의 신호만을 남길 수 있고, Cluster에 대한 분석만을 진행하거나, 또는 single molecule 만을 분석하고자 할 때, 또는 상관관계를 분석하고자 할 때 해당 step을 추가적으로 진행할 수도 있을 것으로 생각된다.
1.4. PPI complex 분석
상기와 같이 이미징된 단백질 복합체 (PPI complex)는 다음의 과정으로 분석하였다:
본 실시예에서는 Matlab 프로그램(MathWorks 제공)에서 제공되는 toolkit에 기반하여 단백질 복합체를 분석하였다.
(1) 상기 얻어진 형광이미지는 16bit unsigned integer 형식으로 저장하였다. PD-1-PD-L1 분석에 있어서, 5-7 프레임의 총 3개의 프레임을 사용하여 아래 과정을 수행하였다. 앞서 기재한 바와 같이 washing 과정이 포함되기 때문에 이미징에서 보이는 신호의 세기, 안정성이 매우 우수하고, 10개의 프레임 중에서 1-3 프레임을 분석한 결과와 8-10 프레임을 분석한 결과, 1-10 프레임을 모두 분석한 결과를 비교해도 큰 차이가 없었다. 이 구간은 이미징 조건/장비구축 상태에 따라서 달라질 수 있다.
(2) 노이즈를 제거하기 위해, 각 프레임 마다 아래와 같은 절차를 수행하였다:
a. 최초 시작은 왼쪽 상단에서 시작하였다. 1 프레임은 512x512 개의 픽셀로 구성되어 있다. 기준 픽셀을 기준으로 오른쪽으로 11개, 아래쪽으로 11개인 11x11 개의 픽셀에서 median 값을 구하고, 이 median 값을 기준 픽셀의 수치에서 빼주었다 [(Intensity_pixel) - (medianIntensity_11x11neighborhood)]. 512x512의 모든 픽셀에 대해서 위 절차를 수행하였다. Median filtering을 통해서 pepper & salt noise를 제거하였다.
b. 위의 처리된 이미지에서 sigma=0.7, size=5 x 5의 Gaussian smoothing을 수행하였다. 이를 통해 이미지를 부드럽게 만들어 주었다.
c. Threshold를 설정하였다. Threshold는 전체 이미지에서 pixel intensity가 threshold 이하가 되는 pixel의 값을 threshold 값으로 모두 만들어 주었다. 이를 통해 이미지에서 형광신호에 의해서 만들어지지 않은 국소극대값 (local maximum)을 제거할 수 있다. 본 실시예에서 이미징 조건에서 사용되는 threshold 값은 70이다.
(3) 형광단백질로부터 나오는 신호는 특정 위치에 모여있는 형태로 발생한다 (localized point spread function (PSF)). 즉 이 PSF (물리적인 값)가 관측하고자 하는 PPI complex (생물학적인 값)이다. 아래 단계는 이 PSF를 판별하기 위한 과정이다:
a. Local maximum의 위치를 구하였다 (예를 들어, i번째 row, j번째 column pixel). 앞서 기술한 바와 같이 단분자 형광신호는 512x512 픽셀 중에서 특정 위치에 (현재 관측장비 하에서 대략 5x5 픽셀 사이즈, 1 pixel = 0.167 마이크로미터) 모여 형성되므로, local maximum을 찾으면 개별 PSF를 선별할 수 있다. 이는 Matlab에서 제공되는 toolkit을 이용하여 구할 수 있다.
b. 위에서 구한 local maximum이 실제 PSF로부터 발생한 것인지에 대한 판별과정을 수행하였다. 우선 local maximum의 최소값을 정의하고 (minimum intensity value), 얻어진 local maximum 중에서 이 최소값보다 큰 경우만 분석에 사용하였다. 본 실시예에서는 최소값을 75로 정의하였으며, 이는 레이저 파워/노출시간/장비구축 상황에 따라서 달라질 수 있다. 최종적으로 얻어진 local maximum 좌표를 중심으로 5x5 픽셀의 정보를 불러오고, 이 5x5 픽셀에서 밝기에 대한 중심을 구하였다 (centroid of intensity). 이 때, 구해진 밝기 중심이 기존 local maximum 좌표에 대하 0.5 pixel 이상 벗어나게 되면 (PSF 모양에 대한 2D 대칭이 사라지면), 정상적이지 않은 형광신호라고 판단하고 분석에서 제거하였다.
c. 모든 조건을 통과한 PSF 만 최종적으로 분류하여 좌표와 전체 개수를 구하였다.
모든 파일에 대해 상기 a-c의 과정을 수행하면서 PPI complex의 개수를 구하였다. 같은 조건하에서 촬영된 각 파일의 정보를 취합하여 평균과 표준편차를 구하였다. 이 값이 최종적으로 특정 조건에서 PPI complex의 개수를 나타내는 값이 된다.
상기 얻어진 PPI complex의 개수는 PPI 신호의 count를 구한 것이나, 그 외에도 PPI 신호의 intensity의 합을 구하거나, 측정 영역에서 spot의 ratio 등을 측정하여 분석할 수도 있다.
일 예에서, cluster의 신호만을 측정한 경우, 레이저 파워, gain 수를 조절하여, Cluster 신호의 크기가 줄어들면, 즉 형광의 세기가 너무 진한 spot이 줄어들게 되고, PSF의 정확한 계산에 조금 더 유리하게 된다 (local maximum이 줄어들기 때문도 있고, 겹쳐진 spot이 구분되는 경우도 있다). cluster intensity를 측정함으로써, 약물의 특성을 좀 더 면밀하게 파악할 수 있을 것이다. 어떤 약물의 경우에는 PD-1과 PD-L1의 clustering을 억제하는 약물이 있다. 해당 약물의 경우 single spot의 count는 오히려 늘어나거나 비슷하겠지만, cluster의 개수는 줄어들게 될것이고, 실제적으로 clustering을 동반한 체내의 PD-1과 PD-L1의 interaction은 효과적으로 억제할 수 있을 것이다. 따라서 cluster의 분포, 수를 분석하는 것이 의미가 있을 것이다.
또한, 전체 intensity에서 cluster intensity를 빼면 single molecule 만의 intensity를 도출할 수 있다.
cluster를 특정하여 접근하는 경우 특정 threshold 이상의 cluster intensity를 갖는 신호의 count 또는 sum으로 분석할 수 있고, 또는 cluster ratio를 분석할 수도 있다. Single molecule을 특정하여 분석하는 경우도 마찬가지이다.
1.5. PD-L1*의 형광신호 대비 PD-1*의 형광신호 값 분석
1) mCherry가 부착된 PD-L1을 기판에 공급한 후, mCherry에 의해 형성되는 신호 중 특정 threshold 이상에서 형성되는 형광신호 a를 검출하였다.
2) GFP가 부착된 PD-1을 공급한 후 GFP에 의해 형성되는 신호 중 특정 threshold 이상에서 형성되는 형광신호 b를 검출하였다.
3) 형광신호 a 값에 대한 형광신호 b 값을 분석하였다. 상기 형광신호 값은 PPI count, sum, 또는 ratio 등 일수 있다.
형광신호 a값에 대한 형광신호 b값을 분석함으로써, 형광신호 b값만을 분석하는 경우보다 더 정성적인 데이터를 확인할 수 있다. 형광신호 a값을 측정하면, 특정 농도의 mcherry-PD-L1을 기판에 주입하였으나 기판에 부착되지 않은 PD-L1*에 대한 영향도 고려할 수 있다. 따라서, PD-L1과 PD-1*의 상호작용을 정량화 함에 정확도가 향상될 수 있다.
1.6. 비교예
비교를 위하여, PD-1과 PD-L1의 결합을 저해하는 PD-1 돌연변이인 K78A를 포함하는 PD-1 변이체, 또는 PD-1과 PD-L1의 결합을 저해하는 PD-L1 돌연변이인 D122A+K124A를 포함하는 PD-L1 변이체, 또는 PD-1과 PD-L1의 결합을 증대시키는 PD-1 돌연변이인 A132L을 포함하는 PD-1 변이체를 사용하여, 상기와 동일한 시험을 수행하였다.
1.7. 결과
상기 기판에 항 PD-L1 항체인 9A11(#CST-29122; Cell Signaling Technology)를 사용하여 얻어진 형광 이미지를 도 1b에, 이를 정량한 결과 (PPI complex 개수; F-counts)를 도 1c에 각각 나타내었다. 도 1b 및 1c에 나타난 바와 같이, PD-1과 PD-L1을 모두 야생형(WT)인 것으로 사용할 경우, 정상적으로 PD-L1에 PD-1이 결합하면서 PD-1의 농도 의존적으로 GFP 신호가 관찰된 반면, PD-1과 PD-L1의 결합을 저해하는 돌연변이인 PD-1 K78A 변이체 또는 PD-L1 D122A+K124A 변이체를 사용한 경우, PD-1의 농도와 상관없이, GFP 신호를 관찰할 수 없었으며, PD-1과 PD-L1의 결합력을 증대시키는 PD-1 A132L 변이체를 사용할 경우에는 WT과 비교하여 더 많은 신호를 관찰할 수 있었다. 상기 결과는 본 실시예에서 수행된 방법에 의하여 PD-1과 PD-L1 간의 단백질-단백질 상호작용(PD-L1/PD-1 상호작용)을 정확하게 측정할 수 있음을 확인시키는 것이다.
PD-L1/PD-1 상호작용 측정에 있어서, 기판에 항-PD-L1 항체를 고정하여 시험하는 경우, 형광신호에서 cluster로 보이는 spot이 관찰되는 반면, 반대로, 제1 단백질로서 PD-1을 제2 단백질로서 PD-L1을 각각 사용하고, 항 PD-1 항체를 기판에 고정하여, 상기와 동일한 과정으로 시험한 결과, cluster가 전혀 관찰되지 않고, single GFP spot으로 보이는 이미지가 관찰되었다.
따라서, physiologic condition에서 nanoculster를 이루는 PD-1/PD-L1의 특성상 PD-L1 항체를 사용하여 PD-L1를 기판에 고정화하여 사용하는 조건이 inhibitor의 효능에 대한 정량 분석 등의 다양한 분석에 접근하는데 보다 유리할 수 있다고 예측되었다.
기판에 항 PD-1 항체를 처리하여 PD-1를 고정화하여 PPI를 측정하는 것을 배제하는 것은 아니다. 그런 경우, PD-1-mcherry 및 PDL1-GFP로 단백질이 재조합되는 것 이외에, 상기한 PPI 측정 방법에 차이가 없다. 다만, cluster 형성에 의한 신호 발생의 차이가 있으므로, 이에 따라서 분석 방법을 적절하게 변경 적용할 수 있다.
또한, 기판에 PD-L1이 고정화되도록 설계할 때, PD-L1의 특정 도메인(PD-1과 binding하는 부위)이 노출되도록 하기 위하여, PD-L1을 기판에 고정화하는데 사용되는 항체를 적절히 선택할 수 있다.
상기 표 2에 예시된 항-PD-L1 항체 중, 9A11(#CST-29122; Cell Signaling Technology)는 PD-L1의 C-말단에 결합하는 항체이고, #D8T4X(Cell Signaling Technology)는 PD-L1의 N-말단에 결합하는 항체이며, 항-PD-1 항체 중, D4W2J(Cell Signaling Technology)는 PD-1의 C-말단에 결합하는 항체이고, NAT105 (Abcam)는 PD-1의 N-말단에 결합하는 항체이다.
이들 항 PD-L1 항체를 기판에 고정하여 상기한 시험을 수행 한 결과 얻어진 PPI complex 개수 (F-counts)를 도 7에 나타내었다. 도 7에서, 항-PD-L1 항체를 사용하여 시험한 경우, PD-L1의 농도는 5nM로 고정하고, PD-1 농도를 0 nM, 5 nM, 및 15 nM로 증가시키면서 시험하고, 항-PD-1 항체를 사용하여 시험한 경우, PD-1의 농도는 5nM로 고정하고, PD-L1 농도를 0 nM, 5 nM, 및 15 nM로 증가시키면서 시험하였다.
도 7에 나타난 바와 같이, PD-L1의 N-말단에 결합하는 항체인 #D8T4X(Cell Signaling Technology)를 사용하는 경우, C-말단에 결합하는 항체인 9A11 (CST#29122; Cell Signaling Technology)을 사용하는 경우와 비교하여, PD-1/PD-L1 상호 작용이 조건에서 적게 counting되는 것을 확인할 수 있다.
상기 결과는, PD-1과 PD-L1이 상호작용을 하는 계면이 N-말단 부위로 한정되어 있기 때문에, 기판쪽으로 PD-L1의 C-말단 부위를 고정하는 것이, 안정적인 PD-1 및 PDL1 간 상호작용을 유도하는 것에 유리함을 보여준다.
실시예 2. PD-1 및 PD-L1 상호작용 저해제 스크리닝
상기 실시예 1의 상호작용 측정방법을 이용하여, 상호작용 저해제를 스크리닝하였다.
저해제를 처리하지 않았을 때 관찰되는 신호(실시예 1.4. PPI complex 분석에 따라 측정된 PPI complex의 개수 (PPI 신호의 count))의 평균 값을 1로 환산하고, 대조군으로 사용하는 BMS-202(CAS No.: 1675203-84-5)를 처리한 경우 관찰되는 신호의 평균값을 0으로 환산하였다. 임의의 기준 값을 0.4로 설정하여 기준치 이하의 신호 값을 보이는 약물을 저해제로 선정하였다. 상기 설정된 기준 값은 임의의 기준 값으로, 후보약물(candidate)의 분포도에 따라 더 적은 값으로 설정될 수 있다. 즉, 반복 실시에의해 기준 값의 설정은 변경될 수 있다.
약 10000여개의 library (asinex의 non-macrocyclic PPI inhibitor library (약 8000여종)와 FDA approved drug (약 2000여종))의 약물을 스크리닝한 결과 (도 2 참조), PPI complex 개수 (F-counts)가 0에 가까운 화합물로, 다음의 화학식 1 (도 4a 참조)의 구조를 갖는 화합물 1 및 화학식 2 (도 4b 참조)의 구조를 갖는 화합물 2가 선정되었다.
[화학식 1]
Figure PCTKR2019011265-appb-I000009
[화학식 2]
Figure PCTKR2019011265-appb-I000010
실시예 3. PD-1 및 PD-L1 상호작용 저해제 효능 검증
상기 실시예 1 및 2의 상호작용 측정방법을 이용하여, 화합물 1 및 화합물 2의 PD-1과 PD-L1 간 상호작용 저해 효능을 분석한다.
실시예 1의 PD-L1 단백질이 고정된 기판에 PD-1 단백질 용해액(GFP-PD-1 발현 세포 용해액의 원심분리 후의 상등액) 12ul (microliter) 및 화학식 1 또는 2의 화합물 20uM 내지 20nM를 투입한 후, PD-1과 PD-L1 간 상호작용 [Normalized PPI(%)]의 변화를 측정하여, 도 4c에 나타내었다. 비교를 위하여, 대조화합물인 BMS-202을 사용하여 동일한 시험을 수행한 결과도 함께 나타내었다. 상기 BMS-202는 PD-1과 PD-L1 간의 상호작용을 억제하는 물질로 실험에서 통상적으로 사용되는 화합물이다. 도 4c에서 Y축 (normalized PPI, %)는 화합물을 처리하지 않은 well (DMSO 처리)에서 보이는 신호를 100%로 표준화하고, 이에 대하여 농도별 화합물을 처리했을 때의 PPI complex (cluster 또는 single 형태 모두 포함)의 수를 카운팅하여 상대적으로 나타낸 것이고, X축은 화합물 처리 농도를 나타낸다.
도 4c에서 나타난 바와 같이 화합물 1 또는 2는 기존에 PD-1과 PD-L1의 상호작용 저해제로 알려진 BMS-202보다 PD-1과 PD-L1의 상호작용을 억제하는 정도가 현저하게 높은 것을 확인할 수 있다.
실시예 4. PD-1 및 PD-L1 상호작용 저해제의 작용부위 도출
PD-L1과 PD-1이 상호작용하는 결합부위 또는 주변 잔기를 저해제 작용부위 후보군으로 도출하였다.
PD-L1 (서열번호 5) 결합부위 또는 주변 잔기: T20, D25, Y56, E58, R113, M115, A121, D122, Y123, K124, R125;
PD-1 (서열번호 1) 결합부위 또는 주변 잔기: Y68, Q75, T76, K78, I126, L128, A132, I134, E136.
상기 후보군으로 도출된 아미노산 잔기를 변이시킨 변이 PD-L1 또는 변이 PD-1과 야생형 PD-1 또는 야생형 PD-L1을 각각 반응시켜, 이들 간 상호작용에 의한 PPI 신호를 측정하였다 (실시예 1 참조). 본 실시예에서, 상기 아미노산 잔기의 변이는 야생형의 아미노산 잔기와 상이한 아미노산으로 치환한 것을 의미하며, 구체적인 변이 내용은 도 5a 내지 5c의 x축에 기재되어 있다. 예컨대, PD-L1 (서열번호 5)의 T20을 변이시킨 변이 PD-L1과 야생형 PD-1의 상호작용에 의한 PPI 신호를 측정하였다. 다른 예로 PD-L1 (서열번호 1)의 D25를 변이시킨 PD-L1과 야생형 PD-1의 상호작용에 의한 PPI 신호를 측정하였다. 또 다른 예로 Y68을 mutation한 PD-1과 야생형 PD-L1의 상호작용에 의한 PPI 신호를 측정하였다. 또 다른 예로 Y68을 mutation한 PD-1과 야생형 PD-L1의 상호작용에 의한 PPI 신호를 측정하였다. 이와 같이 상기 PD-L1 또는 PD-1의 결합부위 또는 주변 잔기를 개별적으로 mutation하여 PD-1 및 PD-L1의 상호작용에 의한 PPI 신호를 측정하여 그 결과를 도 5a에 나타내었다.
도 5a의 결과로부터, Mutation 후의 PPI 신호가, mutation 전의 PPI 신호와 비교하여, 동등하거나, 이보다 낮지만 Mutation 전의 PPI 신호(1)에 대한 상대값이 0.2 이상인 결합부위 또는 주변 잔기를 선별하였다. 그 결과, PD-L1 (서열번호 5)의 D25, Y56, E58, R113, R125, 및 PD-1 (서열번호 1)의 Y68, Q75, T76, I134, E136 각각을 상기 억제제의 작용부위를 확인하기 위한 변이 아미노산 잔기로 선정하였다.
상기 확보된 작용부위(결합부위 또는 주변 잔기)를 mutation 한 경우와 mutation 하지 않은 경우의 두 군으로 나누어, 화합물 1 또는 2를 투입한 후, 변이 또는 야생형 PD-L1과 야생형 또는 변이 PD-1 간의 PPI 값을 측정하여, 그 결과를 도 5b (화합물 1 처리) 및 도 5c (화합물 2 처리)에 각각 나타내었다. 상기 mutation 후 화합물을 처리한 경우의 PPI 값이 mutation 하지 않고 화합물을 처리한 경우의 PPI 값과 동등하거나 낮은 경우 도출대상에서 제외하고, mutation 후 화합물 처리한 경우 PPI 값이 mutation 하지 않고 화합물 처리한 경우의 PPI 값보다 증가(즉, 화합물의 PPI 저해 활성이 감소)하면 도출대상에 포함시켰다. 상기 증가된 PPI 값이 설정된 기준 값을 초과하면 최종 도출대상에 포함하였다. 도 5b및 도 5c에 나타난 바와 같이, PD-L1 (서열번호 5)의 E58, R113, R125, 및 PD-1 (서열번호 1)의 E136이 변이된 경우, 화합물 1 또는 화합물 2가 PD-L1와 PD-1 간 상호작용을 저해하지 못함을 확인할 수 있고, 이는 상기 아미노산 잔기 (야생형)가 화합물 1 및/또는 화합물 2의 작용 대상 부위의 아미노산 잔기 (작용과 밀접한 관련이 있는 아미노산 잔기)임을 의미하는 것이다. 따라서, 최종적으로 도출된 화합물 1 또는 2가 작용하는 PD-L1와 PD-1 간 결합부위 또는 주변의 아미노산 잔기는 PD-L1 (서열번호 5)의 E58, R113, R125, 및 PD-1 (서열번호 1)의 E136이다. 즉, 화합물 1 또는 2의 화합물이 PD-1 또는 PD-L1의 E58, R113, R125, E136에 작용하여 PD-1과 PD-L1의 상호작용을 억제하고, PPI 신호를 약화시킴을 나타낸다.
상기와 같은 PD-1과 PD-L1의 변이에 사용된 프라이머를 표 3 및 표 4에 정리하였다:
Figure PCTKR2019011265-appb-T000003
Figure PCTKR2019011265-appb-T000004
실시예 5. 기판에 PD-1을 고정시킨 경우와 PD-L1을 고정시킨 경우의 비교
실시예 1의 과정을 참조하여, 기판에 PD-L1을 고정시킨 경우와, PD-1을 고정시킨 경우의 PD-L1와 PD-1 간 단백질-단백질 상호작용 (형광 complex 개수: F counts)을 측정하였다.
Total GFP-labeled count 및 형광 이미지를 도 3a에 나타내었다 (PSF cut off >150). 도 3a에 나타난 바와 같이, 기판에 PD-L1을 고정시킨 조건과 PD-1을 고정시킨 조건에서 유사한 결과를 나타냄을 확인할 수 있다.
GFP PD-L1 및 GFP PD-1의 cluster ratio (%) (calculated by [Count @ PSF cut off >350/Count @ PSF cut off >150])를 도 3b에 나타내었다. 상기 Cluster ratio(%)는 PSF (point spread function) cut off 350이상으로 정의한 cluster population을 cut off 150이상의 total count로 나눈 값을 백분율로 표시한 값이다. 도 3b에 나타난 바와 같이, 기판에 PD-L1을 고정시킨 조건에서, PD-1을 고정시킨 조건과 비교하여, 40% 이상 증가한 cluster ratio를 보이는 것을 확인할 수 있다.
이후의 분석과정은 상기 실시예 1의 PPI complex의 이미징 및 PPI complex 분석과정과 동일하게 수행한다.
실시예 6. 화합물 1 및 화합물 2의 항암효과 ( In vitro )
EGFR을 발현하는 세포에 대한 면역활성을 갖는 aEGFR Jurkat 세포(Effector Cell Line: PD-1; ATCC; TIB-152)와 EGFR을 과발현시킨 293T 세포(Target Cell Line: EGFR/PD-L1; KCLB; CRL-3216)를 공동배양한 후, 대조약물 (BMS-202), 화학식 1의 화합물, 또는 화학식 2의 화합물을 각각 0.01 내지 10 uM의 양으로 처리한 후 세포의 생존율을 측정하였다. 상기 종양/면역 세포 공동배양 모델은 종양세포와 면역세포가 각각 PD-L1 및 PD-1을 발현하는 것을 모사한 것으로, 이들 간 상호작용이 저해되는 경우, 세포 생존률이 감소하도록 설계되어 있다.
상기 얻어진 결과를 도 6에 나타내었다. 도 6에서 확인되는 바와 같이, 화학식 1의 화합물 및 화학식 2의 화합물은 모두 농도 의존적으로 우수한 종양/면역세포 사멸 효과를 나타냈으며, 그 효과는 대조군 (DMSO 처리군) 대비 현저하게 높을 뿐 아니라, 기존에 효과가 알려진 대조약물 BMS-202와 비교하여도 동등 수준이었다. 이러한 결과는 화합물 1 및 화합물 2가 모두 우수한 항암 효능을 가짐을 보여준다.
실시예 7. PD-1/PD-L1 상호작용 억제 약물 스크리닝에의 적용
상기 실시예 1에서 준비된 기판에 Avidin 계열의 단백질인 Neutravidin (Thermo, A2666)을 0.1 mg/ml 농도로 투입하였다. 상온에서 5분 반응 시킨 후 PBS buffer 30 ul를 이용하여 2회 기판을 세척하였다.
상기 준비된 기판에 항 PD-L1 항체 9A11 (CST#29122)를 처리하여 2 ug/ml 정도의 양으로 약 5분 간 처리하여, 표면에 항 PD-L1 항체(9A11)가 코팅된 기판을 준비하였다. 상기 준비된 기판을 PBS buffer 30 ul를 이용하여 2회 세척하여 이후 시험에 사용하였다.
실시예 1에서 준비된 GFP-PD-1(10nM)과 mcherry-PD-L1(30nM) (PD-L1의 경우 mcherry가 부착되지 않은 형태로도 사용 가능함)를 PD-1/PD-L1 상호작용 억제제 후보 물질과 함께 tube에서 30분동안 반응시킨 반응물을 20ul의 양으로 상기 준비된 기판에 가하여 15분간 반응시켰다.
PD-L1, PD-1*(GFP 표지된 PD-1), 및 후보 약물을 tube에서 동시에 반응(one-step reaction)시킨 반응물을 기판에 처리하는 이유 (즉, 순차적으로 처리하지 않은 이유)는 다음과 같다:
억제제가 PD-L1/PD-1*의 상호작용을 저해하는 경우는 크게 3가지로 구분할 수 있다: 1) 억제제가 PD-L1과 PD-1의 binding interface에 강한 세기로 결합하는 경우; 2) 억제제가 (PD-1 independently) PD-L1의 특정 부위에 결합하여 PD-L1의 구조 변화를 유도하는 경우; 및 3) 억제제가 (PD-L1 independently) PD-1의 특정 부위에 결합하여 PD-1의 구조 변화를 유도하는 경우.
본 시험을 one-step reaction이 아닌 stepwise reaction (PD-L1, inhibitor, PD-1을 순차적으로 washing/binding 과정을 통하여 결합)에 의하여 수행하는 경우, 상기 1)번의 경우는 효과적으로 선별할 수 있는 반면, 2) 및 3) 번의 경우는, 약물과 target의 collision 자체가 유도되지 않을 수 있기 때문에, 검출에서 놓치는 population이 생기게 되어, 정확한 억제 효과를 시험하는데 한계가 있다. 또한 one-step reaction을 하는 경우가 시간적인 면에서도 효율적이므로, 본 실시예에서는 tube (Standard 1.5ml ep-tube) 에서의 one-step reaction 방식을 채택하였다.
이후의 시험 과정은 상기 실시예 1의 PPI complex)의 이미징 (488 nm) 및 PPI complex 분석과정과 동일하게 수행하였다.
도 8a는 본 실시예의 억제제 후보 약물 스크리닝과정을 모식적으로 보여준다.
도 8b는 tube에서의 one-step reaction의 반응 조건을 최적화하기 위한 시험 결과를 보여주는 것으로, 실시예 1에서 준비된 GFP-PD-1와 mcherry-PD-L1을 tube에서 혼합한 후 30분 또는 2시간동안 incubation하고, Fluorescence counts (F-counts)를 추적한 결과를 보여주는 그래프이다. 도 2b에서, 'Negative'는 tube에 mch-PDL1을 첨가하지 않은 반응물, 'Negative'는 tube에 GFP-PD1을 첨가하지 않은 반응물을 각각 의미한다. 도 8b에서 확인되는 바와 같이, 30분 incubation을 진행한 경우와 2시간 incubation을 진행한 경우에서 PPI complex 개수는 큰 차이를 보이지 않았다.
PD-1/PD-L1 상호작용 억제제 후보 물질로서 시판중인 두 종의 PD-1/PD-L1 억제제인 BMS202 및 S7911 (이상, Selleck Chem에서 구입)을 사용하여 얻어진 PPI complex 개수(F-counts)를 도 8c에 나타내었다. 도 8c에서, PD-1/PD-L1 complex가 상기 억제제 처리 농도 의존적으로 감소하는 것을 확인할 수 있다. 또한, BMS202의 경우에는, 정제된 단백질을 사용하여 계산된 IC50값과 유사한 정도의 IC50 값 (18nM)을 보이는 것을 확인하였다. 상기 결과는 본 실시예에서 수행된 PD-1/PD-L1 상호작용 측정에의하여 PD-1/PD-L1 억제제를 정확하게 판별할 수 있음을 보여준다.
실시예 8. 항 PD-L1 항체의 에피토프 맵핑
PD-L1를 기판에 고정시키기에 적합한 항 PD-L1 항체의 에피토프 맵핑을 위하여, PD-L1 mutant construct를 설계하였다 (도 9a 참조). 구체적으로, PD-L1 cytosolic domain targeting antibody의 epitope을 확인하기 위하여, PD-L1 cytosolic domain deletion mutant construct를 설계하였으며, 상기 mutant는 PD-L1 아미노산 서열 중, 아미노산 260-290번에 해당하는 cytosolic part 를 10개 단위로 나누어, 각각 d280 (281번째 이후의 아미노산 부위 결실) 또는 d270 (271번째 이후의 아미노산 부위 결실)의 변이를 포함하는 단백질을 생산하였다.
실시예 1을 참조하여, PD-L1 pull-down assay를 통하여, 앞서 (실시예 1.7 및 도 7 참조) PD-L1/PD-1 상호작용 측정에 효과적인 것으로 나타난 PD-L1 antibody (9A11)의 PD-L1 WT (야생형), d280, 또는 d270 변이체에 대한 결합 정도 (항체와 PD-L1 간 결합에 의한 형광 complex 개수: F-counts)를 측정하여, 도 9b에 나타내었다. 도 9b에 나타난 바와 같이, PD-L1의 d280 또는 d270 변이체의 경우, 항체와 전혀 결합하지 않는 반면, WT의 경우에는 항체와 민감하게 결합하는 것을 확인할 수 있다. 이를 통하여, PD-L1의 아미노산 280-290번에 해당하는 서열이 PD-L1/PD-1 상호작용 측정에서 PD-L1을 기판에 고정화하기 위하여 사용되는 항체와의 반응에 중요하게 작용할 것임을 예측할 수 있다.
또한, PD-L1의 d280 또는 d270 변이가 PD-1과의 상호작용에 미치는 영향을 시험하기 위하여, PD-1/PD-L1 상호작용을 기반으로 한 면역침강실험 (실시예 1 참조)에 의하여 PD-1 (항 PD-1 항체를 이용하여 기판에 고정시킴)와 PD-L1 WT, d280, 또는 d270 변이체 간의 단백질-단백질 상호작용 정도를 측정하여, 도 9c에 나타내었다. 도 9c에 나타난 바와 같이, PD-L1의 d270 변이체 및 d280 변이체의 경우, WT 대비 약 70% 정도의 수준으로 PD-1과의 결합력을 보임을 확인할 수 있다.

Claims (24)

  1. 다음의 화학식 I 또는 화학식 II의 구조를 갖는 화합물 또는 이의 약학적으로 허용 가능한 염을 포함하는, PD-L1과 PD-1의 상호작용 저해용 조성물:
    [화학식 I]
    Figure PCTKR2019011265-appb-I000011
    [화학식 II]
    Figure PCTKR2019011265-appb-I000012
    상기 화학식 I, 및 II에 있어서,
    R1은 수소 또는 탄소수 1 내지 3의 알킬이고,
    R2는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R3는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R4는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R5는 수소, 탄소수 1 내지 3의 알킬, 또는 탄소수 1 내지 3의 알콕시임.
  2. 제1항에 있어서, 상기 화학식 I 또는 화학식 II의 구조를 갖는 화합물은 다음의 화학식 1 또는 화학식 2의 구조를 갖는 화합물인, PD-L1과 PD-1의 상호작용 저해용 조성물:
    [화학식 1]
    Figure PCTKR2019011265-appb-I000013
    [화학식 2]
    Figure PCTKR2019011265-appb-I000014
  3. 다음의 화학식 I 또는 화학식 II의 구조를 갖는 화합물 또는 이의 약학적으로 허용 가능한 염을 포함하는, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 또는 치료용 약학 조성물:
    [화학식 I]
    Figure PCTKR2019011265-appb-I000015
    [화학식 II]
    Figure PCTKR2019011265-appb-I000016
    상기 화학식 I, 및 II에 있어서,
    R1은 수소 또는 탄소수 1 내지 3의 알킬이고,
    R2는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R3는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R4는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R5는 수소, 탄소수 1 내지 3의 알킬, 또는 탄소수 1 내지 3의 알콕시임.
  4. 제3항에 있어서, 상기 화학식 I 또는 화학식 II의 구조를 갖는 화합물은 다음의 화학식 1 또는 화학식 2의 구조를 갖는 화합물인, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 또는 치료용 약학 조성물:
    [화학식 1]
    Figure PCTKR2019011265-appb-I000017
    [화학식 2]
    Figure PCTKR2019011265-appb-I000018
  5. 제3항 또는 제4항에 있어서, 상기 PD-L1과 PD-1의 상호작용과 관련된 질병은 면역 질환인, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 또는 치료용 약학 조성물.
  6. 제3항 또는 제4항에 있어서, 상기 PD-L1과 PD-1의 상호작용과 관련된 질병은 암인, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 또는 치료용 약학 조성물.
  7. (a) 표면에 PD-L1과 특이적으로 결합 가능한 물질이 결합되거나 또는 PD-L1이 상기 결합 가능한 물질을 통하여 결합된 기판, 및
    (b) PD-1에 탐지 가능한 신호를 발생하는 표지 물질을 결합시킨 표지된 PD-1을 포함하고,
    PD-L1과 PD-1 간의 클러스터가 형성된 형태로 PD-L1과 PD-1 간의 상호작용을 측정하는데 사용하기 위한, PD-L1과 PD-1 간의 상호작용 측정용 키트.
  8. 제7항에 있어서, 상기 PD-L1과 특이적으로 결합 가능한 물질은 PD-L1 중의 T20, D25, D26, Y56, E58, R113, M115, A121, D122, Y123, K124, 및 R125을 포함하지 않는 부위에 결합 가능한 항체 또는 이의 항원 결합 단편인, PD-L1과 PD-1 간의 상호작용 측정용 키트.
  9. (a) 표면에 PD-1과 특이적으로 결합 가능한 물질이 결합되거나 또는 PD-1이 상기 결합 가능한 물질을 통하여 결합된 기판, 및
    (b) PD-L1에 탐지 가능한 신호를 발생하는 표지 물질을 결합시킨 표지된 PD-L1을 포함하고,
    PD-L1과 PD-1 간의 단일 스팟에서의 상호작용을 측정하는데 사용하기 위한, PD-L1과 PD-1 간의 상호작용 측정용 키트.
  10. 제9항에 있어서, 상기 PD-L1과 특이적으로 결합 가능한 물질은 PD-1 중의 PD-1의 Y68, Q75, K78, T76, I126, L128, A132, I134, 및 E136을 포함하지 않는 부위에 결합 가능한 항체 또는 이의 항원 결합 단편인, PD-L1과 PD-1 간의 상호작용 측정용 키트.
  11. (1) PD-L1, 표지물질이 부착된 PD-1, 및 후보 화합물을 기판에 공급하는 단계;
    (2) PD-L1 및 PD-1 간의 상호작용에 의한 신호를 검출하여 PD-L1 및 PD-1의 상호작용 수준을 측정하는 단계;
    (3) 상기 단계 (2)에서 측정된 후보 화합물 처리시의 PD-L1 및 PD-1의 상호작용 수준을 상기 후보 화합물을 투여하지 않은 대조군의 PD-L1 및 PD-1의 상호작용 수준과 비교하여, 상기 후보 화합물 처리시의 PD-L1 및 PD-1의 상호작용 수준이 상기 후보 화합물을 투여하지 않은 대조군의 PD-L1 및 PD-1의 상호작용 수준보다 낮은 경우, 상기 후보 화합물을 PD-L1과 PD-1 간 상호작용 저해제로서 선정하는 단계
    를 포함하는,
    PD-L1 및 PD-1 간 상호작용 저해제의 스크리닝 방법.
  12. 제11항에 있어서, 상기 단계 (1)은,
    PD-L1 결합 물질이 도포된 기판에 PD-L1을 공급하여 결합시킨 후, 상기 PD-L1이 결합된 기판에 표지물질이 부착된 PD-1과 후보 화합물을 공급하는 단계, 또는
    PD-L1과 표지자가 부착된 PD-1 및 후보 화합물의 혼합물을 PD-L1 결합 물질이 도포된 기판에 동시에 공급하는 단계
    를 포함하는 것인, PD-L1 및 PD-1 간 상호작용 저해제의 스크리닝 방법.
  13. 제11항 또는 제12항에 있어서, 상기 PD-L1 결합 물질은 PD-L1 중의 T20, D25, D26, Y56, E58, R113, M115, A121, D122, Y123, K124, 및 R125을 포함하지 않는 부위에 결합 가능한 항체 또는 이의 항원 결합 단편인, PD-L1 및 PD-1 간 상호작용 저해제의 스크리닝 방법.
  14. 제11항 내지 제13항 중 어느 한 항에 있어서,
    상기 단계 (2)는 PD-L1 및 PD-1 간의 상호작용에 의하여 신호가 나타난 스팟의 개수를 측정하는 단계를 포함하는 것인,
    PD-L1 및 PD-1 간 상호작용 저해제의 스크리닝 방법.
  15. (a) PD-L1 또는 PD-1의 이들 간 결합부위 또는 주변 아미노산 잔기 중 하나가 변이된, 변이 PD-L1 및 야생형 PD-1 또는 변이 PD-1 및 야생형 PD-L1를 준비하는 단계;
    (b) 상기 단계 (a)에서 준비된 변이 PD-1 및 야생형 PD-L1, 또는 변이 PD-L1와 야생형 PD-1에 PD-L1 및 PD-1 간의 상호작용 저해제를 투입하여 반응시키고, PD-L1 및 PD-1 간 상호작용 수준을 측정하는 단계; 및
    (c) 상기 (b)에서 측정된 PD-L1 및 PD-1 간 상호작용 수준을 상기 PD-L1 및 PD-1 간의 상호작용 저해제가 처리된 야생형 PD-L1 및 야생형 PD-1 간 상호작용 수준과 비교하는 단계
    를 포함하고,
    상기 (c)에서 비교한 결과, 상기 (b)에서 측정된 PD-L1 및 PD-1 간 상호작용 수준이 야생형 PD-L1 및 야생형 PD-1 간 상호작용 수준과 비교하여 동등 또는 증가한 경우, 상기 변이된 아미노산 잔기를 상기 PD-L1 및 PD-1 간의 상호작용 저해제의 작용 아미노산 잔기로 결정하는,
    PD-L1 및 PD-1 간의 상호작용 저해제의 작용 아미노산 잔기 확인 방법.
  16. 제15항에 있어서, 상기 단계 (a) 또는 (b)의 변이 PD-L1 또는 변이 PD-1는 변이 PD-L1 및 야생형 PD-1 간 또는 변이 PD-1 및 야생형 PD-L1 간의 상호작용 수준을 야생형 PD-L1 및 야생형 PD-1 간의 상호작용 수준으로 나눈 값이 0.2 이상인 것인, PD-L1 및 PD-1 간의 상호작용 저해제의 작용 아미노산 잔기 확인 방법.
  17. 다음의 화학식 I 또는 화학식 II의 구조를 갖는 화합물 또는 이의 약학적으로 허용 가능한 염을 PD-L1과 PD-1의 상호작용 저해를 필요로 하는 대상에게 투여하는 단계를 포함하는, PD-L1과 PD-1의 상호작용 저해 방법:
    [화학식 I]
    Figure PCTKR2019011265-appb-I000019
    [화학식 II]
    Figure PCTKR2019011265-appb-I000020
    상기 화학식 I, 및 II에 있어서,
    R1은 수소 또는 탄소수 1 내지 3의 알킬이고,
    R2는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R3는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R4는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R5는 수소, 탄소수 1 내지 3의 알킬, 또는 탄소수 1 내지 3의 알콕시임.
  18. 제17항에 있어서, 상기 화학식 I 또는 화학식 II의 구조를 갖는 화합물은 다음의 화학식 1 또는 화학식 2의 구조를 갖는 화합물인, PD-L1과 PD-1의 상호작용 저해 방법:
    [화학식 1]
    Figure PCTKR2019011265-appb-I000021
    [화학식 2]
    Figure PCTKR2019011265-appb-I000022
  19. 다음의 화학식 I 또는 화학식 II의 구조를 갖는 화합물 또는 이의 약학적으로 허용 가능한 염을 PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 또는 치료를 필요로 하는 대상에게 투여하는 단계를 포함하는, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 또는 치료 방법:
    [화학식 I]
    Figure PCTKR2019011265-appb-I000023
    [화학식 II]
    Figure PCTKR2019011265-appb-I000024
    상기 화학식 I, 및 II에 있어서,
    R1은 수소 또는 탄소수 1 내지 3의 알킬이고,
    R2는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R3는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R4는 수소 또는 탄소수 1 내지 3의 알킬이고,
    R5는 수소, 탄소수 1 내지 3의 알킬, 또는 탄소수 1 내지 3의 알콕시임.
  20. 제19항에 있어서, 상기 화학식 I 또는 화학식 II의 구조를 갖는 화합물은 다음의 화학식 1 또는 화학식 2의 구조를 갖는 화합물인, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 또는 치료 방법:
    [화학식 1]
    Figure PCTKR2019011265-appb-I000025
    [화학식 2]
    Figure PCTKR2019011265-appb-I000026
  21. 제19항에 있어서, 상기 PD-L1과 PD-1의 상호작용과 관련된 질병은 면역 질환인, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 또는 치료 방법.
  22. 제21항에 있어서, 상기 PD-L1과 PD-1의 상호작용과 관련된 질병은 암인, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 또는 치료 방법.
  23. 제20항에 있어서, 상기 PD-L1과 PD-1의 상호작용과 관련된 질병은 면역 질환인, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 또는 치료 방법.
  24. 제23항에 있어서, 상기 PD-L1과 PD-1의 상호작용과 관련된 질병은 암인, PD-L1과 PD-1의 상호작용과 관련된 질병의 예방 또는 치료 방법.
PCT/KR2019/011265 2018-10-18 2019-09-02 Pd-l1과 pd-1 간 상호작용 분석 방법, pd-l1과 pd-1 간 상호작용 저해제 및 상기 저해제의 스크리닝 방법 WO2020080672A1 (ko)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2018-0124738 2018-10-18
KR20180124738 2018-10-18
KR1020190076647A KR20210001095A (ko) 2019-06-26 2019-06-26 Pd-l1과 pd-1 간 상호작용 저해제 및 스크리닝 방법
KR10-2019-0076647 2019-06-26

Publications (1)

Publication Number Publication Date
WO2020080672A1 true WO2020080672A1 (ko) 2020-04-23

Family

ID=70284680

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2019/011265 WO2020080672A1 (ko) 2018-10-18 2019-09-02 Pd-l1과 pd-1 간 상호작용 분석 방법, pd-l1과 pd-1 간 상호작용 저해제 및 상기 저해제의 스크리닝 방법

Country Status (1)

Country Link
WO (1) WO2020080672A1 (ko)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021219807A1 (en) * 2020-04-30 2021-11-04 Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. Pd-l1 variants with improved affinity towards pd-1
CN117243953A (zh) * 2022-06-09 2023-12-19 上海中医药大学附属龙华医院 PD1-PDL1 inhibitor 2在筛选治疗PD-1/PD-L1靶向抑制引起的心脏毒性的药物中的用途

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070092504A1 (en) * 2001-04-02 2007-04-26 Wyeth Use of agents that modulate the interaction between PD-1 and its ligands in the downmodulation of immune responses
KR20120120093A (ko) * 2011-04-20 2012-11-01 한국과학기술원 세포 환경 내에서의 단일 분자 수준의 단백질-단백질 상호작용 분석 장치
KR20140099322A (ko) * 2011-12-05 2014-08-11 가부시키가이샤 이가쿠세이부츠가쿠겐큐쇼 단백질 간의 상호작용의 판정 방법
CN105566321A (zh) * 2014-10-29 2016-05-11 广东东阳光药业有限公司 杂芳化合物及其在药物中的应用
WO2017118762A1 (en) * 2016-01-08 2017-07-13 Rijksuniversiteit Groningen Inhibitors of the pd-1/pd-l1 protein/protein interaction

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070092504A1 (en) * 2001-04-02 2007-04-26 Wyeth Use of agents that modulate the interaction between PD-1 and its ligands in the downmodulation of immune responses
KR20120120093A (ko) * 2011-04-20 2012-11-01 한국과학기술원 세포 환경 내에서의 단일 분자 수준의 단백질-단백질 상호작용 분석 장치
KR20140099322A (ko) * 2011-12-05 2014-08-11 가부시키가이샤 이가쿠세이부츠가쿠겐큐쇼 단백질 간의 상호작용의 판정 방법
CN105566321A (zh) * 2014-10-29 2016-05-11 广东东阳光药业有限公司 杂芳化合物及其在药物中的应用
WO2017118762A1 (en) * 2016-01-08 2017-07-13 Rijksuniversiteit Groningen Inhibitors of the pd-1/pd-l1 protein/protein interaction

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021219807A1 (en) * 2020-04-30 2021-11-04 Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. Pd-l1 variants with improved affinity towards pd-1
CN117243953A (zh) * 2022-06-09 2023-12-19 上海中医药大学附属龙华医院 PD1-PDL1 inhibitor 2在筛选治疗PD-1/PD-L1靶向抑制引起的心脏毒性的药物中的用途

Similar Documents

Publication Publication Date Title
WO2020080891A1 (ko) 유방암 재발 예측 방법
WO2021194188A1 (ko) 사스-코로나바이러스-2에 중화 활성을 갖는 결합 분자
WO2020080672A1 (ko) Pd-l1과 pd-1 간 상호작용 분석 방법, pd-l1과 pd-1 간 상호작용 저해제 및 상기 저해제의 스크리닝 방법
WO2019124951A9 (en) Gpcr heteromer inhibitors and uses thereof
WO2013048185A2 (ko) 세포 내에서의 빛을 이용한 가역적 단백질 나노클러스터 형성방법
WO2013187724A1 (en) Novel antibody specific for clec14a and uses thereof
WO2019177345A1 (ko) 초고감도 바이오마커 다중 검출 방법
WO2021162521A1 (ko) 외부에서 도입된 세포 신호 조절 인자를 과발현하는 면역 세포 및 이들의 용도
WO2020045984A1 (ko) 타겟 물질 검출을 위한 방법 및 키트
WO2018038352A2 (ko) 치매진단용 자가항체 바이오마커 및 이를 이용한 치매진단 방법
WO2016200189A1 (ko) 광견병 바이러스 g 단백질의 에피토프 및 이에 특이적으로 결합하는 광견병 바이러스 중화 결합 분자
WO2022211558A1 (ko) 사스-코로나바이러스-2 스파이크 단백질의 에피토프에 결합하는 사스-코로나바이러스-2 중화 결합 분자
WO2022019671A1 (ko) 사스-코로나바이러스-2 스파이크 단백질의 에피토프에 결합하는 사스-코로나바이러스-2 중화 결합 분자
WO2020080892A1 (ko) Her2 및 her3의 헤테로다이머를 표적으로 하는 약물 및 이의 스크리닝 방법
WO2018026249A1 (ko) 프로그램화된 세포 사멸 단백질 리간드-1 (pd-l1)에 대한 항체 및 이의 용도
WO2021112635A2 (ko) Bcl2 계통 단백질 표적 약물에 대한 반응성 예측 방법
WO2023287212A1 (ko) 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체
WO2019235824A1 (ko) Cox2 과발현 질환 진단용 조성물 및 이의 스크리닝 방법
WO2015088256A1 (ko) 광견병 바이러스를 중화시킬 수 있는 결합 분자
WO2020209645A1 (ko) 프로그램화된 세포 사멸 단백질 리간드-1 (pd-l1)에 대한 항체 및 이의 용도
WO2014157952A1 (ko) 신규한 신데칸-2 단편 및 이의 용도
WO2020250204A1 (ko) 신규 cthrc1에 특이적 항체 및 이의 용도
WO2016117949A1 (ko) 포스파티딜이노시톨포스페이트 결합 물질의 세포 사멸 검출 용도
WO2022220581A1 (ko) 가시광선으로 광가교 결합되는 신규 화합물 및 이의 용도
WO2024143643A1 (ko) Cd137에 특이적으로 결합하는 어피바디 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19873662

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 19873662

Country of ref document: EP

Kind code of ref document: A1