WO2019148445A1 - Precision/context-dependent activatable antibodies, and methods of making and using the same - Google Patents

Precision/context-dependent activatable antibodies, and methods of making and using the same Download PDF

Info

Publication number
WO2019148445A1
WO2019148445A1 PCT/CN2018/075065 CN2018075065W WO2019148445A1 WO 2019148445 A1 WO2019148445 A1 WO 2019148445A1 CN 2018075065 W CN2018075065 W CN 2018075065W WO 2019148445 A1 WO2019148445 A1 WO 2019148445A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
caspase
amino acid
library
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/CN2018/075065
Other languages
English (en)
French (fr)
Inventor
Peter Peizhi LUO
Fangyong Du
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Adagene Inc
Original Assignee
Adagene Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Adagene Inc filed Critical Adagene Inc
Priority to PCT/CN2018/075065 priority Critical patent/WO2019148445A1/en
Priority to US16/265,851 priority patent/US20190241886A1/en
Priority to CN202511032704.1A priority patent/CN121046961A/zh
Priority to AU2019214189A priority patent/AU2019214189B2/en
Priority to SG11202007166XA priority patent/SG11202007166XA/en
Priority to US16/966,848 priority patent/US11952681B2/en
Priority to CA3090027A priority patent/CA3090027A1/en
Priority to JP2020541957A priority patent/JP2021512122A/ja
Priority to IL326606A priority patent/IL326606A/en
Priority to PCT/CN2019/074581 priority patent/WO2019149282A1/en
Priority to KR1020257021619A priority patent/KR20250106739A/ko
Priority to CN201980021653.9A priority patent/CN112771066B/zh
Priority to EP19747798.7A priority patent/EP3746461A4/en
Priority to BR112020015380-0A priority patent/BR112020015380A2/pt
Priority to KR1020207024940A priority patent/KR102828375B1/ko
Priority to MX2020008180A priority patent/MX2020008180A/es
Publication of WO2019148445A1 publication Critical patent/WO2019148445A1/en
Priority to IL276285A priority patent/IL276285B1/en
Anticipated expiration legal-status Critical
Priority to MX2025005685A priority patent/MX2025005685A/es
Priority to ZA2020/05260A priority patent/ZA202005260B/en
Priority to US18/153,221 priority patent/US20240150749A1/en
Priority to JP2023099859A priority patent/JP7596450B2/ja
Priority to AU2024219607A priority patent/AU2024219607A1/en
Priority to JP2024206403A priority patent/JP2025037964A/ja
Ceased legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries
    • C12N15/1037Screening libraries presented on the surface of microorganisms, e.g. phage display, E. coli display
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C40COMBINATORIAL TECHNOLOGY
    • C40BCOMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
    • C40B10/00Directed molecular evolution of macromolecules, e.g. RNA, DNA or proteins
    • CCHEMISTRY; METALLURGY
    • C40COMBINATORIAL TECHNOLOGY
    • C40BCOMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
    • C40B40/00Libraries per se, e.g. arrays, mixtures
    • C40B40/02Libraries contained in or displayed by microorganisms, e.g. bacteria or animal cells; Libraries contained in or displayed by vectors, e.g. plasmids; Libraries containing only microorganisms or vectors
    • CCHEMISTRY; METALLURGY
    • C40COMBINATORIAL TECHNOLOGY
    • C40BCOMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
    • C40B40/00Libraries per se, e.g. arrays, mixtures
    • C40B40/04Libraries containing only organic compounds
    • C40B40/06Libraries containing nucleotides or polynucleotides, or derivatives thereof
    • C40B40/08Libraries containing RNA or DNA which encodes proteins, e.g. gene libraries
    • CCHEMISTRY; METALLURGY
    • C40COMBINATORIAL TECHNOLOGY
    • C40BCOMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
    • C40B40/00Libraries per se, e.g. arrays, mixtures
    • C40B40/04Libraries containing only organic compounds
    • C40B40/10Libraries containing peptides or polypeptides, or derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001116Receptors for cytokines
    • A61K39/001117Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR] or CD30
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/74Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor

Definitions

  • the present disclosure relates to polynucleotides and polynucleotide libraries useful for screening for and/or identifying one or more precision/context-dependent activatable binding polypeptides (e.g., activatable antibodies) , as well as polypeptides and polypeptide libraries useful for screening for and/or identifying precision/context-dependent activatable binding polypeptides (e.g., activatable antibodies capable of binding to CTLA4 or CD137 when in active form) , cells, methods, and kits related thereto.
  • precision/context-dependent activatable binding polypeptides e.g., activatable antibodies
  • Activatable binding polypeptides exhibit an “activatable” conformation such that an antigen binding moiety contained therein is less accessible to bind to its target when uncleaved than after cleavage in the presence of one or more specific proteases.
  • These activatable binding polypeptides thus provide antigen-specific binding proteins that are only capable of binding their targets in certain contexts (e.g., in the protease-rich tumor microenvironment) . While a number of interesting activatable binding polypeptides have been developed, the process of developing such proteins is slow, labor intensive, and costly. Accordingly, there exists a need for improved methods and products useful for identifying self-blocking peptides for activatable binding polypeptides.
  • libraries of polynucleotides e.g., that are useful for screening for and/or identifying activatable binding polypeptides (i.e., activatable antibodies) .
  • the present disclosure is based, at least in part, on the finding that polypeptides described herein show a significantly improved masking efficiency before activation, allowing for better design, screening and/or identification of activatable binding polypeptides (i.e., activatable antibodies) with superior therapeutic indexes and safety profiles.
  • the present disclosure is further based, at least in part, on the surprising finding that the polynucleotide libraries described herein may be successfully constructed and screened to identify activatable binding polypeptides, (see Examples 1 and 2 below) .
  • Disclosed herein are precision/context-dependent activatable binding polypeptides that bind to human CTLA4 (see Example 3) or human CD137 (see Example 5) when in active form but not in inactive form, i.e., they bind their target (when in active form) only after cleavage of the cleavable moiety (CM) to remove the first peptide (FP) (i.e., a masking moiety (MM) or self-blocking peptide) .
  • CM cleavable moiety
  • FP first peptide
  • MM masking moiety
  • the discovered first peptides (FPs) (e.g., masking moieties) described herein are capable of efficiently masking antibody activity and/or reducing or completely inhibiting antigen binding, while in some embodiments being devoid of the chemically labile residues methionine and/or tryptophan.
  • activatable antibodies identified using the polynucleotide libraries described herein are as efficient at treating multiple cancer types as their parental antibody, while having significantly reduced cytotoxicity even in susceptible animals (NOD mice, see Example 4) .
  • a library comprising polynucleotides, wherein at least one of the polynucleotides encodes a polypeptide comprising, from N-terminus to C-terminus, a first peptide (FP) , a cleavable moiety (CM) , and a target binding moiety (TBM) , wherein the FP comprises an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , wherein m is from 3-10, n is from 3-10, and o is from 1-10, and wherein each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y; wherein the CM comprises at least a first cleavage site; and wherein the TBM comprises an antibody light chain variable region and/
  • the polynucleotides in the library encode at least two, at least three, at least four, at least five, or at least ten unique polypeptides and each unique polypeptide comprise, from N-terminus to C-terminus, a first peptide (FP) , a cleavable moiety (CM) , and a target binding moiety (TBM) , wherein the FP comprises an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , wherein m is from 3-10, n is from 3-10, and o is from 1-10, and wherein each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y; wherein the CM comprises at least a first cleavage site; and wherein the TBM comprises an antibody light chain variable
  • each of the polynucleotides in the library encodes a polypeptide comprising, from N-terminus to C-terminus, a first peptide (FP) , a cleavable moiety (CM) , and a target binding moiety (TBM)
  • the FP comprises an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , wherein m is from 3-10, n is from 3-10, and o is from 1-10, and wherein each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y; wherein the CM comprises at least a first cleavage site; and wherein the TBM comprises an antibody light chain variable region and/or an antibody heavy chain variable region.
  • the FP is encoded by a polynucleotide sequence comprising a nucleic acid sequence according to Formula (XIV) : (NNK) m TGY (NNK) n TGY (NNK) o (SEQ ID NO: 87) , wherein each N is independently A, G, T, or C, wherein each K is independently T or G, and wherein each Y is independently T or C.
  • each X is not M, W, or C. In some embodiments that may be combined with any of the preceding embodiments, each X in X m of Formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P. In some embodiments that may be combined with any of the preceding embodiments, each X in X n of Formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • each X in X o of Formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • m is 6.
  • n is from 6-8.
  • n is 6.
  • o is from 1-2.
  • o is 2.
  • the FP further comprises, at its N-terminus, an additional amino acid sequence.
  • the additional amino acid sequence comprises the amino acid sequence of SEQ ID NO: 16.
  • the first cleavage site is a protease cleavage site for a protease selected from the group consisting of urokinase-type plasminogen activator (uPA) , matrix metalloproteinase-1 (MMP-1) , MMP-2, MMP-3, MMP-8, MMP-9, MMP-14, Tobacco Etch Virus (TEV) protease, plasmin, Thrombin, Factor X, PSA, PSMA, Cathepsin D, Cathepsin K, Cathepsin S, ADAM10, ADAM12, ADAMTS, Caspase-1, Caspase-2, Caspase-3, Caspase-4, Caspase-5, Caspase-6, Caspase-7, Caspase-8, Caspase-9, Caspase-10, Caspase-11, Caspase-12, Caspase-13,
  • uPA urokinase-type plasm
  • the CM further comprises a first linker (L 1 ) C-terminal to the first cleavage site.
  • the L 1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 17-24.
  • the CM further comprises a second cleavage site. In some embodiments, the second cleavage site is C-terminal to the L 1 .
  • the second cleavage site is a protease cleavage site for a protease selected from the group consisting of urokinase-type plasminogen activator (uPA) , matrix metalloproteinase-1 (MMP-1) , MMP-2, MMP-3, MMP-8, MMP-9, MMP-14, Tobacco Etch Virus (TEV) protease, plasmin, Thrombin, Factor X, PSA, PSMA, Cathepsin D, Cathepsin K, Cathepsin S, ADAM10, ADAM12, ADAMTS, Caspase-1, Caspase-2, Caspase-3, Caspase-4, Caspase-5, Caspase-6, Caspase-7, Caspase-8, Caspase-9, Caspase-10, Caspase-11, Caspase-12, Caspase- 13, Caspase-14, and TACE.
  • uPA
  • the first and second cleavage sites are different.
  • the CM further comprises a second linker (L 2 ) C-terminal to the second cleavage site.
  • the L 2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 17-24.
  • the polypeptide encoded by one or more polynucleotides in the library comprises a first peptide (FP) and a cleavable moiety (CM) comprising an amino acid sequence according to Formula (III) : EVGSYX 1 X 2 X 3 X 4 X 5 X 6 CX 7 X 8 X 9 X 10 X 11 X 12 CX 13 X 14 SGRSAGGGGTENLYFQGSGGS (SEQ ID NO: 3) , wherein X1 is A, D, I, N, P, or Y, x2 is A, F, N, S, or V, X3 is A, H, L, P, S, V, or Y, X4 is A, H, S, or Y, X5 is A, D, P, S, V, or Y, X6 is A, D, L, S, or Y, X7 is D, P, or V,
  • each of the polynucleotides in the library encodes a polypeptide comprising an amino acid sequence according to Formula (III) .
  • the polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 25-46.
  • the TBM comprises an antibody light chain variable region.
  • the TBM further comprises a heavy chain variable region C-terminal to the light chain variable region.
  • the library further comprises polynucleotides that encode one or more antibody heavy chain variable regions.
  • the heavy chain variable region and light chain variable region forms an antigen binding site that is capable of binding to a target in the absence of a masking moiety (MM) .
  • MM masking moiety
  • the TBM comprises an antibody heavy chain variable region.
  • the TBM further comprises a light chain variable region C-terminal to the heavy chain variable region.
  • the library further comprises polynucleotides that encode one or more antibody light chain variable regions.
  • the heavy chain variable region and light chain variable region forms an antigen binding site that is capable of binding to a target in the absence of a masking moiety (MM) .
  • MM masking moiety
  • At least one of the polynucleotides encoding the polypeptide is in a vector.
  • the vector is an expression vector or a display vector.
  • at least one of the polynucleotides encoding the polypeptide is in a cell.
  • the cell is a bacterial cell, a yeast cell, an insect cell, or a mammalian cell.
  • aspects of the present disclosure relate to a method of producing an activatable antibody comprising culturing any of the cells described herein under conditions suitable for producing the activatable antibody.
  • the method further comprises recovering the activatable antibody produced by the cell.
  • the method further comprises testing the activatable antibody for the ability to maintain an activatable phenotype while soluble.
  • aspects of the present disclosure relate to a method of using any of the libraries described herein to screen for an activatable antibody that binds to a target, comprising the steps of a) contacting the expression products of the library with the target before the CM is cleaved, b) contacting the expression products of the library with the target after the CM is cleaved, and c) isolating one or more of the expression products that binds to the target after the CM is cleaved, but does not bind to the target before the CM is cleaved.
  • the CM comprises at least a first protease cleavage site for a protease selected from the group consisting of urokinase-type plasminogen activator (uPA) , matrix metalloproteinase-1 (MMP-1) , MMP-2, MMP-3, MMP-8, MMP-9, MMP-14, Tobacco Etch Virus (TEV) protease, plasmin, Thrombin, Factor X, PSA, PSMA, Cathepsin D, Cathepsin K, Cathepsin S, ADAM10, ADAM12, ADAMTS, Caspase-1, Caspase-2, Caspase-3, Caspase-4, Caspase-5, Caspase-6, Caspase-7, Caspase-8, Caspase-9, Caspase-10, Caspase-11, Caspase-12, Caspase-13, Caspase-14, and TACE.
  • uPA ur
  • the target is CTLA4, CD137, PD-1, PD-L1, PD-L2, LAG3, TIM3, B7-H3, OX40, CD3, CD19, CD20, CD40, CD95, CD120a, BTLA, VISTA, ICOS, BCMA, Her1, Her2, Her3, and/or B7-H4.
  • the target is CTLA4 or CD137.
  • kits comprising any of the libraries described herein.
  • a library comprising antigen binding domains, wherein at least one of the antigen binding domains comprises a polypeptide comprising, from N-terminus to C-terminus, a first peptide (FP) , a cleavable moiety (CM) , and a target binding moiety (TBM) , wherein the FP comprises an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , wherein m is from 3-10, n is from 3-10, and o is from 1-10, and wherein each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y; wherein the CM comprises at least a first cleavage site; and wherein the TBM comprises an antibody light chain variable region and/or an antibody heavy chain variable region.
  • FP comprises an amino
  • At least two, at least three, at least four, at least five, or at least ten of the antigen binding domains comprise a unique polypeptide comprising, from N-terminus to C-terminus, a first peptide (FP) , a cleavable moiety (CM) , and a target binding moiety (TBM)
  • the FP comprises an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , wherein m is from 3-10, n is from 3-10, and o is from 1-10, and wherein each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y; wherein the CM comprises at least a first cleavage site; and wherein the TBM comprises an antibody light chain variable region and/or an antibody heavy chain
  • each of the antigen binding domains comprises a unique polypeptide comprising, from N-terminus to C-terminus, a first peptide (FP) , a cleavable moiety (CM) , and a target binding moiety (TBM)
  • the FP comprises an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , wherein m is from 3-10, n is from 3-10, and o is from 1-10, and wherein each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y; wherein the CM comprises at least a first cleavage site; and wherein the TBM comprises an antibody light chain variable region and/or an antibody heavy chain variable region.
  • the TBM comprises an antibody light chain variable region and the antigen binding domain further comprises an antibody heavy chain variable region. In some embodiments that may be combined with any of the preceding embodiments, the TBM comprises an antibody heavy chain variable region and the antigen binding domain further comprises an antibody light chain variable region. In some embodiments that may be combined with any of the preceding embodiments, each X is not M, W, or C. In some embodiments that may be combined with any of the preceding embodiments, each X in X m in formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • each X in X n of Formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • each X in X o of Formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • an antibody light chain comprising a polypeptide comprising, from N-terminus to C-terminus, a first peptide (FP) , a cleavable moiety (CM) , and a target binding moiety (TBM)
  • the FP comprises an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , wherein m is from 3-10, n is from 3-10, and o is from 1-10
  • each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y
  • each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P
  • the CM comprises at least a first cleavage site
  • an antibody heavy chain comprising a polypeptide comprising, from N-terminus to C-terminus, a first peptide (FP) , a cleavable moiety (CM) , and a target binding moiety (TBM)
  • the FP comprises an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , wherein m is from 3-10, n is from 3-10, and o is from 1-10
  • each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y
  • each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P
  • the CM comprises at least a first cleavage site
  • a cell comprising at least one polypeptide displayed on its surface, wherein the at least polypeptide comprises, from N-terminus to C-terminus, a first peptide (FP) , a cleavable moiety (CM) , and a target binding moiety (TBM) , wherein the FP comprises an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , wherein m is from 3-10, n is from 3-10, and o is from 1-10, wherein each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and wherein each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P; wherein the CM comprises at
  • the cell is a bacterial cell, a yeast cell, an insect cell, or a mammalian cell.
  • each X is not M, W, or C.
  • each X in X m of formula (I) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • each X in X n of formula (I) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • an activatable antibody comprising: a) a polypeptide comprising, from N-terminus to C-terminus, a masking moiety (MM) , a cleavable moiety (CM) , and a target binding moiety (TBM) , wherein the MM comprises an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , wherein m is from 3-10, n is from 3-10, and o is from 1-10, wherein each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and wherein each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P; wherein the MM inhibits the binding of the activatable
  • the CM comprises at least a first protease cleavage site and is cleaved with one or more proteases selected from the group consisting of urokinase-type plasminogen activator (uPA) , matrix metalloproteinase-1 (MMP-1) , MMP-2, MMP-3, MMP-8, MMP-9, MMP-14, Tobacco Etch Virus (TEV) protease, plasmin, Thrombin, Factor X, PSA, PSMA, Cathepsin D, Cathepsin K, Cathepsin S, ADAM10, ADAM12, ADAMTS, Caspase-1, Caspase-2, Caspase-3, Caspase-4, Caspase-5, Caspase-6, Caspase-7, Caspase-8, Caspase-9, Caspase-10, Caspase-11, Caspase-12, Caspase-13, Caspase-14,
  • each X is not M, W, or C. In some embodiments that may be combined with any of the preceding embodiments, each X in X m of formula (I) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P. In some embodiments that may be combined with any of the preceding embodiments, each X in X n of formula (I) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • the MM comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 72-78.
  • the VL comprises an HVR-L1 comprising the amino acid sequence of SEQ ID NO: 62, an HVR-L2 comprising the amino acid sequence of SEQ ID NO: 63, and an HVR-L3 comprising the amino acid sequence of SEQ ID NO: 64.
  • the VL comprises the amino acid sequence of SEQ ID NO: 48.
  • the VH comprises an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 59, an HVR-H2 comprising the amino acid sequence of SEQ ID NO: 60, and an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 61. In some embodiments that may be combined with any of the preceding embodiments, the VH comprises the amino acid sequence of SEQ ID NO: 47.
  • an activatable antibody comprising: a) a polypeptide comprising, from N-terminus to C-terminus, a masking moiety (MM) , a cleavable moiety (CM) , and a target binding moiety (TBM) , wherein the MM comprises an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , wherein m is from 3-10, n is from 3-10, and o is from 1-10, wherein each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and wherein each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P; wherein the MM inhibits the binding of the activatable
  • the CM comprises at least a first protease cleavage site and is cleaved with one or more proteases selected from the group consisting of urokinase-type plasminogen activator (uPA) , matrix metalloproteinase-1 (MMP-1) , MMP-2, MMP-3, MMP-8, MMP-9, MMP-14, Tobacco Etch Virus (TEV) protease, plasmin, Thrombin, Factor X, PSA, PSMA, Cathepsin D, Cathepsin K, Cathepsin S, ADAM10, ADAM12, ADAMTS, Caspase-1, Caspase-2, Caspase-3, Caspase-4, Caspase-5, Caspase-6, Caspase-7, Caspase-8, Caspase-9, Caspase-10, Caspase-11, Caspase-12, Caspase-13, Caspase-14,
  • each X is not M, W, or C. In some embodiments that may be combined with any of the preceding embodiments, each X in X m of formula (I) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P. In some embodiments that may be combined with any of the preceding embodiments, each X in X n of formula (I) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • the MM comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 79-85.
  • the VL comprises an HVR-L1 comprising the amino acid sequence of SEQ ID NO: 68, an HVR-L2 comprising the amino acid sequence of SEQ ID NO: 69, and an HVR-L3 comprising the amino acid sequence of SEQ ID NO: 70.
  • the VL comprises the amino acid sequence of SEQ ID NO: 50.
  • the VH comprises an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 65, an HVR-H2 comprising the amino acid sequence of SEQ ID NO: 66, and an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 67. In some embodiments that may be combined with any of the preceding embodiments, the VH comprises the amino acid sequence of SEQ ID NO: 49.
  • the present disclosure relates to a polynucleotide encoding any of the activatable antibodies described herein.
  • the present disclosure relates to a vector comprising any of the polynucleotides described herein (e.g., a polynucleotide encoding an activatable antibody) .
  • the vector is an expression vector and/or a display vector.
  • the present disclosure relates to a host cell comprising any of the polynucleotides and/or vectors described herein (e.g., a polynucleotide and/or vector encoding an activatable antibody) .
  • the host cell is a eukaryotic cell.
  • the host cell is a Chinese Hamster Ovary (CHO) cell.
  • the present disclosure relates to a method of making an activatable antibody comprising culturing any of the host cells described herein under conditions suitable for producing the antibody or activatable antibody. In some embodiments, the method further comprises recovering the antibody or activatable antibody produced by the cell.
  • aspects of the present disclosure relate to a method of treating or delaying progression of cancer in a subject in need thereof, the method comprising administering to the subject an effective amount of a polypeptide encoded by one or more polynucleotides from any of the libraries described herein and/or any of the activatable antibodies described herein.
  • the method further comprises administering to the subject an effective amount of at least one additional therapeutic agent.
  • the at least one additional therapeutic agent is selected from the group consisting of viral gene therapy, immune checkpoint inhibitors, target therapies, radiation therapies, and chemotherapies.
  • the at least one additional therapeutic agent is selected from the group consisting of pomalyst, revlimid, lenalidomide, pomalidomide, thalidomide, a DNA-alkylating platinum-containing derivative, cisplatin, 5-fluorouracil, cyclophosphamide, an anti-CD137 antibody, an anti-CTLA4 antibody, an anti-PD-1 antibody, an anti-PD-L1 antibody, an anti-CD20 antibody, an anti-CD40 antibody, an anti-DR5 antibody, an anti-CD1d antibody, an anti-TIM3 antibody, an anti-SLAMF7 antibody, an anti-KIR receptor antibody, an anti-OX40 antibody, an anti-HER2 antibody, an anti-ErbB-2 antibody, an anti-EGFR antibody, cetuximab, rituximab, trastuzumab, pembrolizumab, radiotherapy, single dose radiation, fractionated radiation, focal radiation, whole organ radiation, IL-12, IFN ⁇ ,
  • FIG. 1 shows a schematic of an exemplary selection process for self-blocking peptides using the Fab fragment of the target antibody displayed on yeast surface.
  • FIG. 2 shows a schematic of an exemplary selection process for self-blocking peptide using the scFv fragment of the target antibody displayed on yeast surface.
  • FIGS. 3A-B show functional display of Fabs and scFvs targeting CTLA4 on yeast, as determined by flow cytometry.
  • FIG. 3A shows functional display of Fabs targeting CTLA4 on the surface of yeast.
  • FIG. 3B shows functional display of scFvs targeting CTLA4 on the surface of yeast.
  • FIG. 4 shows an exemplary selection process for activatable antibodies targeting human CTLA4.
  • a yeast library displaying fusion proteins were subjected to several rounds of FACS-based screening.
  • FIGS. 5A-B show CTLA4 binding affinity of exemplary CTLA4 activatable antibody clones, as determined by flow cytometry.
  • FIG. 5A shows binding affinity of CTLA4 activatable antibody clones in the scFv format, including the CTLA4 activatable antibody clone B13287 with the masking peptide intact, or with the masking peptide cleaved by the TEV protease, as compared to the scFv fragment of the target antibody with no masking peptide.
  • FIG. 5A shows binding affinity of CTLA4 activatable antibody clones in the scFv format, including the CTLA4 activatable antibody clone B13287 with the masking peptide intact, or with the masking peptide cleaved by the TEV protease, as compared to the scFv fragment of the target antibody with no masking peptide.
  • FIG. 5B shows CTLA4 binding affinity of CTLA4 activatable antibody clones in the Fab format, including the CTLA4 activatable antibody clone B13189 with the masking peptide intact, or with the masking peptide cleaved by the TEV protease, as compared to the Fab fragment of the target antibody with no masking peptide.
  • FIGS. 6A-B show the masking efficiency of exemplary CTLA4 activatable antibodies TY22401, TY22403, TY22402, and TY22404, as compared to the parental antibody TY21580.
  • FIG. 6A shows the association and dissociation curves of the indicated activatable antibodies as compared to the parental antibody TY21580, as determined by the ForteBio system.
  • FIG. 6B shows a graph of the relative ratio of bound activatable antibodies, as compared to the parental antibody TY21580.
  • FIGS. 7A-C show the masking efficiency of exemplary CTLA4 activatable antibodies against recombinant human CTLA4-Fc, as determined by ELISA.
  • FIG. 7A shows a first batch of ELISA data indicating binding of CTLA4 activatable antibodies TY22401, TY22402, TY22403, TY22404 to recombinant human CTLA4-Fc, as compared to the parental antibody TY21580.
  • FIG. 7B shows a second batch of ELISA data indicating binding of CTLA4 activatable antibodies TY22401, TY22402, TY22403, TY22404 to recombinant human CTLA4-Fc, as compared to the parental antibody TY21580.
  • FIG. 7C shows binding of CTLA4 activatable antibodies TY22563, TY22564, TY22565, TY22566 to recombinant human CTLA4-Fc, as compared to the parental antibody TY21580.
  • FIGS. 8A-B show activity of CTLA4 activatable antibody TY22404 upon removal of the masking peptide.
  • FIG. 8A shows SDS-PAGE results of activatable antibody TY22404 with no treatment, treated with the protease uPA, or treated with 5 or 10 units of the protease MMP-9.
  • FIG. 8B shows binding of activatable antibody TY22404 with no treatment, treated with the protease uPA, or treated with the protease MMP-9, as compared to the parental antibody TY21580, determined by ELISA.
  • FIGS. 9A-C show the size-exclusion chromatography (SEC) profiles of exemplary activatable antibodies under accelerated stress conditions.
  • FIG. 9A shows the SEC profiles of activatable antibody TY22402 after six cycles of freezing and thawing, as compared to the control condition.
  • FIG. 9B shows the SEC profiles of activatable antibody TY22402 after seven days at 50°C, as compared to the control condition.
  • FIG. 9C shows the percentages of SEC main peak area of the exemplary activatable antibodies after seven days at 50°C, after storage at 40°C for up to 28 days, or after six cycles of freezing and thawing, as compared to the control condition.
  • FIG. 10 shows the percentages of SEC main peak area of activatable antibodies TY22401 and TY22402 after storage at approximately 8mg/mL or at >150mg/mL.
  • FIG. 11 shows the masking efficiency of untreated activatable antibodies TY21580, TY22401, TY22402 and TY22566 incubated at pH 3.7 for 30 minutes, or incubated at pH 3.7 for an hour, as determined by the ForteBio System.
  • FIGS. 12A-B show human peripheral blood mononuclear cell (PBMC) activation by isotype control antibody, parental antibody TY21580, or exemplary CTLA4 activatable antibodies TY22401, TY22402, or TY22404, as measured by ELISA.
  • FIG. 12A shows the effect on IL-2 secretion from CD3-primed human PBMCs stimulated with isotype control antibody, parental antibody TY21580, and exemplary CTLA4 activatable antibodies TY22401, TY22402, or TY22404.
  • FIG. 12A shows the effect on IL-2 secretion from CD3-primed human PBMCs stimulated with isotype control antibody, parental antibody TY21580, and exemplary CTLA4 activatable antibodies TY22401, TY22402, or TY22404.
  • FIG. 12B shows the effect on IFN ⁇ secretion from CD3-primed human PBMCs stimulated with isotype control antibody, parental antibody TY21580, and exemplary CTLA4 activatable antibodies TY22401, TY22402, or TY22404.
  • FIG. 13 shows the antibody-dependent cell-mediated cytotoxicity (ADCC) activity of isotype control antibody, the parental antibody TY21580, or exemplary activatable antibodies TY22401, TY21580, or TY22404 on HEK293F cells transiently overexpressing human CTLA4, as determined by an ADCC reporter gene assay.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • FIGS. 14A-B show the in vivo anti-tumor efficacy of parental antibody TY21580, isotype control antibody, or exemplary CTLA4 activatable antibodies TY22401, TY22402, or TY22566 in an MC38 syngeneic mouse colorectal tumor model.
  • FIG. 14A shows the tumor growth curves of different treatment groups of female C57BL/6 mice bearing MC38-established tumors. Data points represent group mean; error bars represent SEM.
  • FIG. 14B shows individual tumor growth curves for the groups treated with TY21580, TY22401, TY22402, and TY22566.
  • FIG. 15 shows the in vivo anti-tumor efficacy of isotype control antibody, parental antibody TY21580, or one of three activatable antibodies, in a CT26 syngeneic mouse colorectal tumor model. Tumor growth curves of different treatment groups of female C57BL/6 mice bearing CT26-established tumors are shown. Data points represent group mean; error bars represent SEM.
  • FIG. 16 shows the in vivo anti-tumor efficacy of isotype control antibody, parental antibody TY21580, or one of three activatable antibodies, in an H22 syngeneic mouse liver tumor model.
  • Tumor growth curves of different treatment groups of female C57BL/6 mice bearing H22-established tumors are shown. Data points represent group mean; error bars represent SEM.
  • FIGS. 17A-B show the in vivo anti-tumor efficacy of parental antibody TY21580, isotype control antibody, and exemplary activatable antibodies TY22401, TY22402, or TY22566 in a 3LL syngeneic mouse lung tumor model.
  • FIG. 17A shows the tumor growth curves of different treatment groups of female C57BL/6 mice bearing 3LL-established tumors. Data points represent group mean; error bars represent SEM.
  • FIG. 17B shows individual tumor growth curves for the groups treated with TY21580, TY22401, TY22402, and TY22566.
  • FIGS. 18A-C show time courses of the blood concentrations of the test articles (TAs) intravenously administered at a concentration of 10 mg/kg to female BALB/c mice, as determined by ELISA.
  • FIG. 18A shows a time course of the blood concentrations of the activatable antibody TY22401 intravenously administered at a concentration of 10 mg/kg to female BALB/c mice, as compared to the parental antibody TY21580.
  • FIG. 18B shows a time course of the blood concentrations of the activatable antibody TY22402 intravenously administered at a concentration of 10 mg/kg to female BALB/c mice, as compared to the parental antibody TY21580.
  • FIG. 18C shows a time course of the blood concentrations of the activatable antibody TY22404 intravenously administered at a concentration of 10 mg/kg to female BALB/c mice, as compared to the parental antibody TY21580.
  • FIG. 19 shows the repeated dosing toxicity of isotype control antibody, parental antibody TY21580, and exemplary activatable antibodies TY22566, TY22401, and TY22402 using the NOD mouse model. Percent survival rate over 20 days were shown for each treatment group.
  • FIGS. 20A-B show functional display of Fabs and scFvs targeting human CD137 on yeast, as determined by flow cytometry.
  • FIG. 20A shows scFvs targeting CD137 on the surface of yeast.
  • FIG. 20B shows Fabs targeting CD137 on the surface of yeast.
  • FIG. 21 shows an exemplary selection process for activatable antibodies targeting human CD137.
  • a yeast library displaying fusion proteins were subjected to several rounds of FACS-based screening.
  • FIGS. 22A-B show CD137 binding affinity of exemplary CD137 activatable antibody clones, as determined by flow cytometry.
  • FIG. 22A shows binding affinity of CD137 activatable antibody clones in the scFv format, including the CD137 activatable antibody clone B13428 with the masking peptide intact, or with the masking peptide cleaved by the TEV protease, as compared to the scFv fragment of the target antibody with no masking peptide.
  • FIG. 22A shows binding affinity of CD137 activatable antibody clones in the scFv format, including the CD137 activatable antibody clone B13428 with the masking peptide intact, or with the masking peptide cleaved by the TEV protease, as compared to the scFv fragment of the target antibody with no masking peptide.
  • FIG. 22A shows binding affinity of CD137 activatable antibody clones in the scFv format
  • CD137 binding affinity of CD137 activatable antibody clones in the scFv format including the CD137 activatable antibody clone B13439 with the masking peptide intact, or with the masking peptide cleaved by the TEV protease, as compared to the scFv fragment of the target antibody with no masking peptide.
  • FIG. 23 shows masking efficiency of exemplary activatable antibodies against human CD137, as compared to the parental antibody TY21242, determined by flow cytometry.
  • a and/or B is intended to include both A and B; A or B; A (alone) ; and B (alone) .
  • the term “and/or” as used herein a phrase such as “A, B, and/or C” is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone) ; B (alone) ; and C (alone) .
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine.
  • amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid but the C-terminal carboxy group, the N-terminal amino group, or side chain functional group has been chemically modified to another functional group.
  • amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
  • polypeptide ” “protein, ” and “peptide” are used interchangeably herein and may refer to polymers of two or more amino acids.
  • the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase or by a synthetic reaction.
  • a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure may be imparted before or after assembly of the polymer.
  • the sequence of nucleotides may be interrupted by non-nucleotide components.
  • a polynucleotide may comprise modification (s) made after synthesis, such as conjugation to a label.
  • modifications include, for example, “caps, ” substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoamidates, carbamates, etc. ) and with charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.
  • those containing pendant moieties such as, for example, proteins (e.g., nucleases, toxins, antibodies, signal peptides, ply-L-lysine, etc. ) , those with intercalators (e.g., acridine, psoralen, etc. ) , those containing chelators (e.g., metals, radioactive metals, boron, oxidative metals, etc. ) , those containing alkylators, those with modified linkages (e.g., alpha anomeric nucleic acids, etc. ) , as well as unmodified forms of the polynucleotides (s) .
  • proteins e.g., nucleases, toxins, antibodies, signal peptides, ply-L-lysine, etc.
  • intercalators e.g., acridine, psoralen, etc.
  • those chelators e.g., metals, radioactive metals
  • any of the hydroxyl groups ordinarily present in the sugars may be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or may be conjugated to solid or semi-solid supports.
  • the 5’ and 3’ terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
  • Other hydroxyls may also be derivatized to standard protecting groups.
  • Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2’-O-methyl-, 2’-O-allyl-, 2’-fluoro-or 2’-azido-ribose, carbocyclic sugar analogs, ⁇ -anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs, and basic nucleoside analogs such as methyl riboside.
  • One or more phosphodiester linkages may be replaced by alternative linking groups.
  • linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P (O) S ( “thioate” ) , P (S) S ( “dithioate” ) , (O) NR2 ( “amidate” ) , P (O) R, P (O) OR’, CO, or CH2 ( “formacetal” ) , in which each R or R’ is independently H or substituted or unsubstituted alkyl (1-20 C) optionally containing an ether (-O-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
  • isolated nucleic acid refers to a nucleic acid molecule of genomic, cDNA, or synthetic origin, or a combination thereof, which is separated from other nucleic acid molecules present in the natural source of the nucleic acid.
  • genomic DNA the term “isolated” includes nucleic acid molecules which are separated from the chromosome with which the genomic DNA is naturally associated.
  • an “isolated” nucleic acid is free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5′and 3′ends of the nucleic acid of interest.
  • library refers to a set of two or more entities having a shared class.
  • a library containing polynucleotides may refer to a set of two or more polynucleotides.
  • library is used herein in the broadest sense and specifically covers sub-libraries that may or may not be combined.
  • unique refers to a member of a set that is different from other members of the set.
  • a unique activatable antibody in a library may refer to an activatable antibody having a particular sequence not shared by other activatable antibodies in the library.
  • a “unique” member of a physical realization of a library may be present in more than one copy.
  • a library may contain a plurality of “unique” activatable antibodies, with one or more of the “unique” activatable antibody molecules occurring in more than one copy.
  • a diversity of antibodies in a library may refer to a variety of antibodies with unique sequences present in the library.
  • antibody is used herein in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies) , polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies, trispecific antibodies) , and antibody fragments (e.g., Fab, Fab’, Fab’-SH, F (ab’) 2, Fv and/or a single-chain variable fragment or scFv) so long as they exhibit the desired biological activity.
  • monoclonal antibodies including full length monoclonal antibodies
  • polyclonal antibodies e.g., multispecific antibodies (e.g., bispecific antibodies, trispecific antibodies)
  • antibody fragments e.g., Fab, Fab’, Fab’-SH, F (ab’) 2, Fv and/or a single-chain variable fragment or scFv
  • the term “antibody” refers to an antigen-binding protein (i.e., immunoglobulin) having a basic four-polypeptide chain structure consisting of two identical heavy (H) chains and two identical light (L) chains. Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype.
  • Each heavy chain has, at the N-terminus, a variable region (abbreviated herein as V H ) followed by a constant region.
  • the heavy chain constant region is comprised of three domains, C H1 , C H2 and C H3 .
  • Each light chain has, at the N-terminus, a variable region (abbreviated herein as V I ) followed by a constant region at its other end.
  • the light chain constant region is comprised of one domain, C L .
  • the V L is aligned with the V H and the C L is aligned with the first constant domain of the heavy chain (CH1) .
  • CH1 first constant domain of the heavy chain
  • the pairing of a V H and V L together forms a single antigen-binding site.
  • An IgM antibody consists of 5 of the basic heterotetramer units along with an additional polypeptide called J chain, and therefore contains 10 antigen binding sites, while secreted IgA antibodies can polymerize to form polyvalent assemblages comprising 2-5 of the basic 4-chain units along with J chain.
  • the V H and V L regions can be further subdivided into regions of hypervariability, termed hyper-variable regions (HVR) based on structural and sequence analysis. HVRs are interspersed with regions that are more conserved, termed framework regions (FW) (see e.g., Chen et al. (1999) J. Mol. Biol. (1999) 293, 865-881) .
  • FW framework regions
  • Each V H and V L is composed of three HVRs and four FWs, arranged from amino-terminus to carboxy-terminus in the following order: FW-1_HVR-1_FW-2_HVR-2_FW-3_HVR-3_FW4.
  • variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • the variable and constant regions are joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 or more amino acids (see e.g., Fundamental Immunology Ch. 7 (Paul, W., ed., 2 nd ed. Raven Press, N.Y) . (1989) ) .
  • the L chain from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains.
  • antibodies can be assigned to different classes or isotypes. There are five classes of antibodies: IgA, IgD, IgE, IgG, and IgM, having heavy chains designated ⁇ (alpha) , ⁇ (delta) , ⁇ (epsilon) , ⁇ (gamma) , and ⁇ (mu) , respectively.
  • the IgG class of antibody can be further classified into four subclasses IgG1, IgG2, IgG3, and IgG4 by the gamma heavy chains, Y1-Y4, respectively.
  • antigen-binding fragment or “antigen binding portion” of an antibody refers to one or more portions of an antibody that retain the ability to bind to the antigen that the antibody bonds to.
  • antigen-binding fragments include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L and C H1 domains; (ii) a F (ab′) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and C H1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., Nature 341: 544-546 (1989) ) , which consists of a V H domain; and (vi) an isolated complementarity determining region (CDR) .
  • CDR complementarity determining region
  • CTLA4 is used in the present application, and includes the human CTLA4 (e.g., UniProt accession number P16410) , as well as variants, isoforms, and species homologs thereof (e.g., mouse CTLA4 (UniProt accession number P09793) , rat CTLA4 (UniProt accession number Q9Z1A7) , dog CTLA4 (UniProt accession number Q9XSI1) , cynomolgus monkey CTLA4 (UniProt accession number G7PL88) , etc. ) .
  • a binding molecule e.g., an activatable antibody
  • CD137 is used in the present application, and includes the human CD137 (e.g., GenBank Accession No. NM _ 001561; NP _ 001552) , as well as variants, isoforms, and species homologs thereof (e.g., mouse CD137 (GenBank Gene ID 21942) , rat CD137 (GenBank Gene ID 500590) , dog CD137 (GenBank Gene ID 608274) , cynomolgus monkey CTLA4 (GenBank Gene ID 102127961) , etc. ) .
  • a binding molecule e.g., an activatable antibody
  • chimeric antibody refers to an antibody that comprises amino acid sequences derived from different animal species, such as those having a variable region derived from a human antibody and a murine immunoglobulin constant region.
  • Compet for binding refers to the interaction of two antibodies in their binding to a binding target.
  • a first antibody competes for binding with a second antibody if binding of the first antibody with its cognate epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody.
  • the alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody can, but need not, be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope.
  • each antibody detectably inhibits the binding of the other antibody with its cognate epitope whether to the same, greater, or lesser extent, the antibodies are said to “cross-compete” with each other for binding of their respective epitope (s) .
  • epitope refers to a part of an antigen to which an antibody (or antigen-binding fragment thereof) binds.
  • Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope can include various numbers of amino acids in a unique spatial conformation.
  • Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography, 2-dimensional nuclear magnetic resonance, deuterium and hydrogen exchange in combination with mass spectrometry, or site-directed mutagenesis, or all methods used in combination with computational modeling of antigen and its complex structure with its binding antibody and its variants (see e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996) ) .
  • antibodies to that epitope can be generated, e.g., using the techniques described herein. The generation and characterization of antibodies may also elucidate information about desirable epitopes.
  • germline refers to the nucleotide sequences of the antibody genes and gene segments as they are passed from parents to offspring via the germ cells.
  • the germline sequence is distinguished from the nucleotide sequences encoding antibodies in mature B cells which have been altered by recombination and hypermutation events during the course of B cell maturation.
  • glycosylation sites refers to amino acid residues which are recognized by a eukaryotic cell as locations for the attachment of sugar residues.
  • the amino acids where carbohydrate, such as oligosaccharide, is attached are typically asparagine (N-linkage) , serine (O-linkage) , and threonine (O-linkage) residues.
  • the specific site of attachment is typically signaled by a sequence of amino acids, referred to herein as a “glycosylation site sequence” .
  • the glycosylation site sequence for N-linked glycosylation is: -Asn-X-Ser-or -Asn-X-Thr-, where X may be any of the conventional amino acids, other than proline.
  • N-linked and O-linked refer to the chemical group that serves as the attachment site between the sugar molecule and the amino acid residue. N-linked sugars are attached through an amino group; O- linked sugars are attached through a hydroxyl group.
  • glycan occupancy refers to the existence of a carbohydrate moiety linked to a glycosylation site (i.e., the glycan site is occupied) . Where there are at least two potential glycosylation sites on a polypeptide, either none (0-glycan site occupancy) , one (1-glycan site occupancy) or both (2-glycan site occupancy) sites can be occupied by a carbohydrate moiety.
  • host cell refers to a cellular system which can be engineered to generate proteins, protein fragments, or peptides of interest.
  • Host cells include, without limitation, cultured cells, e.g., mammalian cultured cells derived from rodents (rats, mice, guinea pigs, or hamsters) such as CHO, BHK, NSO, SP2/0, YB2/0; human cells (e.g., HEK293F cells, HEK293T cells; or human tissues or hybridoma cells, yeast cells, insect cells (e.g., S2 cells) , bacterial cells (e.g., E. coli cells) and cells comprised within a transgenic animal or cultured tissue.
  • cultured cells e.g., mammalian cultured cells derived from rodents (rats, mice, guinea pigs, or hamsters) such as CHO, BHK, NSO, SP2/0, YB2/0
  • the term encompasses not only the particular subject cell but also the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not be identical to the parent cell, but are still included within the scope of the term “host cell. ”
  • a “human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • humanized antibody refers to a chimeric antibody that contains amino acid residues derived from human antibody sequences.
  • a humanized antibody may contain some or all of the CDRs or HVRs from a non-human animal or synthetic antibody while the framework and constant regions of the antibody contain amino acid residues derived from human antibody sequences.
  • an antibody refers to any one of the antibodies described herein. These antibodies may be in any class (e.g., IgA, IgD, IgE, IgG, and IgM) . Thus, each antibody identified above encompasses antibodies in all five classes that have the same amino acid sequences for the V L and V H regions. Further, the antibodies in the IgG class may be in any subclass (e.g., IgG1 IgG2, IgG3, and IgG4) . Thus, each antibody identified above in the IgG subclass encompasses antibodies in all four subclasses that have the same amino acid sequences for the V L and V H regions.
  • amino acid sequences of the heavy chain constant regions of human antibodies in the five classes, as well as in the four IgG subclasses, are known in the art.
  • amino acid sequence of the full length heavy chain and light chain for the IgG4 subclass of each of the illustrative antibodies shown in in Table 1b is provided in the disclosure.
  • an “isolated” antibody or binding molecule is one which has been separated from a component of its natural environment.
  • an antibody is purified to greater than 95%or 99%purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF) , capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC) .
  • electrophoretic e.g., SDS-PAGE, isoelectric focusing (IEF) , capillary electrophoresis
  • chromatographic e.g., ion exchange or reverse phase HPLC
  • k a refers to the association rate constant of a particular antibody -antigen interaction
  • k d refers to the dissociation rate constant of a particular antibody -antigen interaction
  • K D refers to the equilibrium dissociation constant of a particular antibody-antigen interaction. It is obtained from the ratio of k d to k a (i.e., k d /k a ) and is expressed as a molar concentration (M) . K D is used as a measure for the affinity of an antibody’s binding to its binding partner. The smaller the K D , the more tightly bound the antibody is, or the higher the affinity between antibody and the antigen. For example, an antibody with a nanomolar (nM) dissociation constant binds more tightly to a particular antigen than an antibody with a micromolar ( ⁇ M) dissociation constant. K D values for antibodies can be determined using methods well established in the art. One method for determining the K D of an antibody is by using an ELISA. For example, an assay procedure using an ELISA is described in at least Example 3 of the present disclosure.
  • mammal refers to any animal species of the Mammalia class. Examples of mammals include: humans; laboratory animals such as rats, mice, hamsters, rabbits, non- human primates, and guinea pigs; domestic animals such as cats, dogs, cattle, sheep, goats, horses, and pigs; and captive wild animals such as lions, tigers, elephants, and the like.
  • prevent or “preventing, ” with reference to a certain disease condition in a mammal, refers to preventing or delaying the onset of the disease, or preventing the manifestation of clinical or subclinical symptoms thereof.
  • sequence identity between two polypeptide sequences indicates the percentage of amino acids that are identical between the sequences.
  • the amino acid sequence identity of polypeptides can be determined conventionally using known computer programs such as Bestfit, FASTA, or BLAST (see e.g., Pearson, Methods Enzymol. 183: 63-98 (1990) ; Pearson, Methods Mol. Biol. 132: 185-219 (2000) ; Altschul et al., J. Mol. Biol. 215: 403-410 (1990) ; Altschul et al., Nucleic Acids Res. 25: 3389-3402 (1997) ) .
  • the parameters are set such that the percentage of identity is calculated over the full length of the reference amino acid sequence and that gaps in homology of up to 5%of the total number of amino acid residues in the reference sequence are allowed.
  • This aforementioned method in determining the percentage of identity between polypeptides is applicable to all proteins, fragments, or variants thereof disclosed herein.
  • the term “binds” refers to measurable and reproducible interactions such as binding between a target and an antibody, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules including biological molecules.
  • an antibody that binds to or specifically binds to a target is an antibody that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets.
  • the extent of binding of an antibody to an unrelated target is less than about 10%of the binding of the antibody to the target as measured, e.g., by a radioimmunoassay (RIA) .
  • an antibody that specifically binds to a target has a dissociation constant (Kd) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, or ⁇ 0.1 nM.
  • Kd dissociation constant
  • an antibody specifically binds to an epitope on a protein that is conserved among the protein from different species.
  • specific binding can include, but does not require exclusive binding.
  • treat refers causing a desirable or beneficial effect in the mammal having the disease condition.
  • the desirable or beneficial effect may include reduced frequency or severity of one or more symptoms of the disease (i.e., tumor growth and/or metastasis, or other effect mediated by the numbers and/or activity of immune cells, and the like) , or arrest or inhibition of further development of the disease, condition, or disorder.
  • the desirable or beneficial effect may include inhibition of further growth or spread of cancer cells, death of cancer cells, inhibition of reoccurrence of cancer, reduction of pain associated with the cancer, or improved survival of the mammal.
  • the effect can be either subjective or objective.
  • the mammal is human
  • the human may note improved vigor or vitality or decreased pain as subjective symptoms of improvement or response to therapy.
  • the clinician may notice a decrease in tumor size or tumor burden based on physical exam, laboratory parameters, tumor markers or radiographic findings.
  • Some laboratory signs that the clinician may observe for response to treatment include normalization of tests, such as white blood cell count, red blood cell count, platelet count, erythrocyte sedimentation rate, and various enzyme levels.
  • the clinician may observe a decrease in a detectable tumor marker.
  • other tests can be used to evaluate objective improvement, such as sonograms, nuclear magnetic resonance testing and positron emissions testing.
  • vector refers to a nucleic acid molecule capable of transporting a foreign nucleic acid molecule.
  • the foreign nucleic acid molecule is linked to the vector nucleic acid molecule by a recombinant technique, such as ligation or recombination. This allows the foreign nucleic acid molecule to be multiplied, selected, further manipulated or expressed in a host cell or organism.
  • a vector can be a plasmid, phage, transposon, cosmid, chromosome, virus, or virion.
  • vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome (e.g., non-episomal mammalian vectors) .
  • Another type of vector is capable of autonomous replication in a host cell into which it is introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors) .
  • Another specific type of vector capable of directing the expression of expressible foreign nucleic acids to which they are operatively linked is commonly referred to as “expression vectors. ”
  • Expression vectors generally have control sequences that drive expression of the expressible foreign nucleic acids.
  • vectors Simpler vectors, known as “transcription vectors, ” are only capable of being transcribed but not translated: they can be replicated in a target cell but not expressed.
  • the term “vector” encompasses all types of vectors regardless of their function. Vectors capable of directing the expression of expressible nucleic acids to which they are operatively linked are commonly referred to “expression vectors. ” Other examples of “vectors” may include display vectors (e.g., vectors that direct expression and display of an encoded polypeptide on the surface of a virus or cell (such as a bacterial cell, yeast cell, insect cell, and/or mammalian cell) .
  • a “subject” , “patient” , or “individual” may refer to a human or a non-human animal.
  • a “non-human animal” may refer to any animal not classified as a human, such as domestic, farm, or zoo animals, sports, pet animals (such as dogs, horses, cats, cows, etc. ) , as well as animals used in research.
  • Research animals may refer without limitation to nematodes, arthropods, vertebrates, mammals, frogs, rodents (e.g., mice or rats) , fish (e.g., zebrafish or pufferfish) , birds (e.g., chickens) , dogs, cats, and non-human primates (e.g., rhesus monkeys, cynomolgus monkeys, chimpanzees, etc. ) .
  • the subject, patient, or individual is a human.
  • an “effective amount” refers to at least an amount effective, at dosages and for periods of time necessary, to achieve one or more desired or indicated effects, including a therapeutic or prophylactic result.
  • An effective amount can be provided in one or more administrations.
  • an effective amount of antibody, drug, compound, or pharmaceutical composition is an amount sufficient to accomplish prophylactic or therapeutic treatment either directly or indirectly.
  • an effective amount of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition (e.g., an effective amount as administered as a monotherapy or combination therapy) .
  • an “effective amount” may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
  • Certain aspects of the present disclosure relate to polynucleotides (e.g., encoding any of the polypeptides described herein) and/or libraries of polynucleotides e.g., that encode polypeptides useful for screening for and/or identifying one or more activatable binding polypeptides (i.e., one or more activatable antibodies) , including activatable antibodies, activatable antigen binding fragments thereof, or derivatives of activatable antibodies.
  • polynucleotides e.g., encoding any of the polypeptides described herein
  • libraries of polynucleotides e.g., that encode polypeptides useful for screening for and/or identifying one or more activatable binding polypeptides (i.e., one or more activatable antibodies) , including activatable antibodies, activatable antigen binding fragments thereof, or derivatives of activatable antibodies.
  • activatable binding polypeptide includes a polypeptide that comprises a target binding moiety (TBM) , a cleavable moiety (CM) , and a masking moiety (MM) .
  • TBM comprises an amino acid sequence that binds to a target.
  • the TBM comprises an antigen binding domain (ABD) of an antibody or antibody fragment thereof.
  • the TBM comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH) , wherein the VH and VL forms a binding domain that binds to the target in the absence of the MM.
  • the VH and VL are covalently linked, e.g., in an scFv. In some embodiments, the VH and VL form a Fab fragment. In some embodiments, the VH is linked to an antibody heavy chain constant region, and the VL is linked to an antibody light chain constant region.
  • the activatable antibody comprises a polypeptide comprising the structure, from N-terminus to C-terminus, of: masking moiety (MM) -cleavable moiety (CM) -VL, and the activatable antibody further comprises a second polypeptide comprising a VH (e.g., a Fab fragment) .
  • the activatable antibody comprises a polypeptide comprising the structure, from N-terminus to C-terminus, of: masking moiety (MM) -cleavable moiety (CM) -VL-VH (e.g., an scFv) .
  • the activatable antibody comprises a polypeptide comprising the structure, from N-terminus to C-terminus, of: masking moiety (MM) -cleavable moiety (CM) -VH, and the activatable antibody further comprises a second polypeptide comprising a VL (e.g., a Fab fragment) .
  • the activatable antibody comprises a polypeptide comprising the structure, from N-terminus to C-terminus, of: masking moiety (MM) -cleavable moiety (CM) -VH-VL (e.g., an scFv) .
  • the CM generally includes an amino acid sequence that is cleavable, for example, serves as the substrate for an enzyme and/or a cysteine-cysteine pair capable of forming a reducible disulfide bond.
  • cleavage e.g., by a protease
  • the MM refers to an amino acid sequence that, when the CM of the activatable antibody is intact (e.g., uncleaved by a corresponding enzyme, and/or containing an unreduced cysteine-cysteine disulfide bond) , the MM interferes with or inhibits binding of the TBM to its target. In some embodiments, the MM interferes with or inhibits binding of the TBM to its target so efficiently that binding of the TBM to its target is extremely low and/or below the limit of detection (e.g., binding cannot be detected in an ELISA or flow cytometry assay) .
  • the amino acid sequence of the CM may overlap with or be included within the MM.
  • ABSP activatable antibody
  • CM e.g., a protease
  • release of at least the MM e.g., where the MM is not joined to the ABP by a covalent bond (e.g., a disulfide bond between cysteine residues)
  • covalent bond e.g., a disulfide bond between cysteine residues
  • a library of the present disclosure may contain one or more polynucleotides encoding any of the polypeptides described herein (e.g., one or more of the activatable binding polypeptides described herein) .
  • one or more (i.e., one, some, or all) of the polynucleotides of a library described herein encode (s) a polypeptide comprising full length antibody light and/or heavy chain (s) .
  • one or more (i.e., one, some, or all) of the polynucleotides of a library described herein encode (s) a polypeptide comprising light and/or heavy chain Fab fragment (s) .
  • one or more (i.e., one, some, or all) of the polynucleotides of a library described herein encode (s) a polypeptide comprising single-chain variable fragment (s) (scFvs) .
  • polypeptides e.g., any of the polypeptides described herein
  • libraries of polypeptides useful for screening for and/or identifying one or more activatable binding polypeptides (i.e., one or more activatable antibodies) , including activatable antibodies, activatable antigen binding fragments thereof, or derivatives of activatable antibodies.
  • a library of the present disclosure may contain one or more of the polypeptides described herein (e.g., one or more activatable binding polypeptides) .
  • one or more (e.g., one, some, or all) of the polypeptides of a library described herein comprise full length antibody light and/or heavy chain (s) .
  • one or more (e.g., one, some, or all) of the polypeptides of a library described herein comprise light and/or heavy chain Fab fragment (s) .
  • one or more (e.g., one, some, or all) of the polypeptides of a library described herein comprise single-chain variable fragment (s) (scFvs) .
  • the polypeptides are expressed on a cell surface (e.g., yeast or mammalian cell display) .
  • a polypeptide of the present disclosure comprises: (a) a first peptide (FP) ; (b) a cleavable moiety (CM) ; and (c) a target binding moiety (TBM) .
  • the FP is any of the first peptides described herein (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y) .
  • X is not W, M, and/or C.
  • each X in X m of formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P
  • each X in X n of formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P
  • each X in X o of formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • the FP is any of the first peptides described herein (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P) .
  • FP a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10,
  • X is not W, M, and/or C.
  • each X in X m of formula (I) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P and/or each X in X n of formula (I) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • the FP is any of the first peptides described herein (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (XII) : Z m CZ n CZ o (SEQ ID NO: 71) , where m is from 3-10, n is from 3-10, and o is from 1-10, and each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P) .
  • a first peptide (FP) comprising an amino acid sequence according to Formula (XII) : Z m CZ n CZ o (SEQ ID NO: 71) , where m is from 3-10, n is from 3-10, and o is from 1-10, and each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P) .
  • the CM is any of the cleavable moieties described herein (e.g., a cleavable moiety (CM) comprising at least a first protease cleavage site) .
  • the CM is any of the cleavable moieties described herein (e.g., a cleavable moiety (CM) comprising at least a first protease cleavage site) .
  • the TBM is any of the target binding moieties described herein (e.g., a target binding moiety (TBM) comprising an antibody light chain variable region and/or an antibody heavy chain variable region) .
  • the first peptide (FP) interferes with, obstructs, reduces the ability of, prevents, inhibits, or competes with the target binding moiety for binding to its target (e.g., an “inactive activatable antibody) .
  • the first peptide (FP) interferes with, obstructs, reduces, prevents, inhibits, or competes with the target binding moiety for binding to its target only when the polypeptide has not been activated (e.g., activated by a change in pH (increased or decreased) , activated by a temperature shift (increased or decreased) , activated after being contacted with a second molecule (such as a small molecule or a protein ligand) , etc. ) .
  • activation induces cleavage of the polypeptide within the cleavage moiety.
  • activation induces conformation changes in the polypeptide (e.g., displacement of the first peptide (FP) ) , leading to the first peptide no longer preventing the activatable antibody from binding to its target.
  • the first peptide (FP) interferes with, obstructs, reduces the ability of, prevents, inhibits, or competes with the target binding moiety for binding to its target only when the cleavable moiety (CM) has not been cleaved by one or more proteases that cleave within the cleavable moiety (CM) .
  • the first peptide (FP) has a masking efficiency of at least about 2.0 (e.g., at least about 2.0, at least about 3.0, at least about 4.0, at least about 5.0, at least about 6.0, at least about 7.0, at least about 8.0, at least about 9.0, at least about 10, at least about 25, at least about 50, at least about 75, at least about 100, at least about 150, at least about 200, at least about 300, at least about 400, at least about 500, etc. ) prior to activation.
  • at least about 2.0 e.g., at least about 2.0, at least about 3.0, at least about 4.0, at least about 5.0, at least about 6.0, at least about 7.0, at least about 8.0, at least about 9.0, at least about 10, at least about 25, at least about 50, at least about 75, at least about 100, at least about 150, at least about 200, at least about 300, at least about 400, at least about 500, etc.
  • masking efficiency is measured as the difference in affinity of an activatable antibody comprising the first peptide (FP) for binding its target (before activation) relative to the affinity of a polypeptide lacking the first peptide for binding its target (e.g., the difference in affinity for a target antigen (such as CTLA4) of an activatable antibody comprising a first peptide (FP) (before activation) relative to a parental antibody lacking the first peptide (FP) , or the difference in affinity for a target antigen (such as CTLA4) of an activatable antibody comprising a first peptide (FP) (before activation) relative to the affinity for the target antigen of the activatable antibody after activation) .
  • a target antigen such as CTLA4
  • the masking efficiency is measured by dividing the EC 50 for binding of an activatable antibody comprising a first peptide (FP) (before activation) by the EC 50 of the parental antibody (e.g., by measuring EC 50 by ELISA; see e.g., the methods of Example 3) .
  • masking efficiency is measured as the difference in affinity of an activatable antibody comprising the first peptide (FP) for binding its target before activation relative to the affinity of the activatable antibody comprising the first peptide (FP) for binding its target after activation (e.g., the difference in affinity for a target antigen (such as CTLA4) of an activatable antibody before activation relative to the activatable antibody after activation) .
  • the first peptide (FP) binds to the target binding moiety (TBM) , and prevents the activatable antibody from binding to its target (e.g., an “inactive” activatable antibody) .
  • the first peptide (FP) has a dissociation constant for binding to the target binding moiety (TBM) that is greater than the dissociation constant of the target binding moiety (TBM) for its target.
  • the first peptide (FP) is a masking moiety (MM) .
  • the first peptide (FP) does not interfere with, obstruct, reduce the ability of, prevent, inhibit, or compete with the target binding moiety (TBM) for binding to its target after the polypeptide has been activated (e.g., activated by treatment with one or more proteases that cleave within the cleavable moiety (CM) , activated by a change in pH (increased or decreased) , activated by a temperature shift (increased or decreased) , activated after being contacted with a second molecule (such as an enzyme) , etc. ) .
  • TBM target binding moiety
  • the first peptide (FP) does not interfere with, obstruct, reduce the ability of, prevent, inhibit, or compete with the target binding moiety (TBM) for binding to its target after the cleavable moiety (CM) has been cleaved by one or more proteases that cleave within the cleavable moiety (CM) .
  • the first peptide (FP) has a masking efficiency of at most about 1.75 (e.g., at most about 1.75, at most about 1.5, at most about 1.4, at most about 1.3, at most about 1.2, at most about 1.1, at most about 1.0, at most about 0.9, at most about 0.8, at most about 0.7, at most about 0.6, or at most about 0.5, etc. ) after to activation (e.g., the relative affinity of the activatable antibody after activation as compared to the affinity of a parental antibody) .
  • activation e.g., the relative affinity of the activatable antibody after activation as compared to the affinity of a parental antibody
  • a polypeptide of the present disclosure comprises the structure, from N-terminus to C-terminus, of: the first peptide (FP) -the cleavable moiety (CM) -the target binding moiety (TBM) .
  • Libraries of the present disclosure may be used to screen for one or more activatable binding polypeptides (i.e., activatable antibodies) that, when in active form, bind to any target of interest, including, for example, CTLA4, CD137, PD-1, PD-L1, PD-L2, LAG3, TIM3, B7-H3, OX40, CD3, CD19, CD20, CD40, CD95, CD120a, BTLA, VISTA, ICOS, BCMA, Her1, Her2, Her3, and/or B7-H4.
  • activatable binding polypeptides i.e., activatable antibodies
  • any target of interest including, for example, CTLA4, CD137, PD-1, PD-L1, PD-L2, LAG3, TIM3, B7-H3, OX40, CD3, CD19, CD20, CD40, CD95, CD120a, BTLA, VISTA, ICOS, BCMA, Her1, Her2, Her3, and/or B7-H4.
  • a library of the present disclosure contains a plurality of polynucleotides that encodes at least one, at least 50, at least 100, at least 250, at least 500, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 unique polypeptides comprising: (a) a first peptide (FP) ; (b) a cleavable moiety (CM) ; and (c) a target binding moiety (TBM) , as described herein.
  • FP first peptide
  • CM cleavable moiety
  • TBM target binding moiety
  • a library of the present disclosure 1) encodes and/or contains a smaller number of unique peptides (e.g., FPs comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) or Formula (I) : X m CX n CZ o (SEQ ID NO: 1) ) than are found in typical random peptide libraries; 2) encodes and/or contains peptides (e.g., FPs comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) or Formula (I) : X m CX n CZ o (SEQ ID NO: 1) ) comprising a pair of cysteine residues at fixed positions to ensure that the display peptides had constrained conformations; and/or 3) encodes and/or contains peptides (e.g., FPs comprising an amino acid sequence according to Formula
  • libraries of the present disclosure have dramatically reduced library size relative to random peptide libraries, enabling the construction of libraries with much better coverage of the peptides (e.g., FPs comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) or Formula (I) : X m CX n CZ o (SEQ ID NO: 1) ) .
  • FPs comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) or Formula (I) : X m CX n CZ o (SEQ ID NO: 1)
  • libraries of the present disclosure have peptides (e.g., FPs comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) or Formula (I) : X m CX n CZ o (SEQ ID NO: 1) ) including few to no unfavorable residues for manufacturing processes, such as methionine or tryptophan.
  • peptides e.g., FPs comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) or Formula (I) : X m CX n CZ o (SEQ ID NO: 1)
  • peptides e.g., FPs comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) or Formula (I) : X m CX n C
  • a library of the present disclosure contains a plurality of polynucleotides, with at least one of the polynucleotides in the library encoding a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y; (b) a cleavable moiety (CM) comprising at least a first cleavage site (e.g., at least a first protease cleavage site) ; and c) a target binding moiety (TBM) comprising an antibody light chain variable region and/or
  • At least one of the polynucleotides in the library encodes an activatable binding polypeptide (i.e., an activatable antibody) .
  • one or more polynucleotides of the library are in a vector (e.g., an expression vector or display vector) .
  • a library of the present disclosure contains a plurality of polynucleotides, with at least one of the polynucleotides in the library encoding a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, where each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and where each Z is independently an amino acid selected from D, A, Y, S, T, N, I, L, F, V, H, and P; (b) a cleavable moiety (CM) comprising at least a first cleavage site (e.g., at least a first protease
  • At least one of the polynucleotides in the library encodes an activatable binding polypeptide (i.e., an activatable antibody) .
  • one or more polynucleotides of the library are in a vector (e.g., an expression vector or display vector) .
  • At least one of the polynucleotides in the library encodes a polypeptide comprising an amino acid sequence according to Formula (III) , EVGSYX 1 X 2 X 3 X 4 X 5 X 6 CX 7 X 8 X 9 X 10 X 11 X 12 CX 13 X 14 SGRSAGGGGTENLYFQGSGGS (SEQ ID NO: 3) , where X1 is A, D, I, N, P, or Y, x2 is A, F, N, S, or V, X3 is A, H, L, P, S, V, or Y, X4 is A, H, S, or Y, X5 is A, D, P, S, V, or Y, X6 is A, D, L, S, or Y, X7 is D, P, or V, X8 is A, D, H, P, S, or T, X9 is A, D, F, H, P, or Y
  • At least one of the polynucleotides in the library encodes an activatable binding polypeptide (i.e., an activatable antibody) .
  • one or more polynucleotides of the library are in a vector (e.g., an expression vector or display vector) .
  • At least one of the polynucleotides in the library encodes a polypeptide comprising an amino acid sequence selected from SEQ ID NOS: 25-46. In some embodiments, at least one of the polynucleotides in the library encodes an activatable binding polypeptide (i.e., an activatable antibody) . In some embodiments, one or more polynucleotides of the library are in a vector (e.g., an expression vector or display vector) .
  • At least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 100, at least 250, at least 500, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 of the polynucleotides in the library encodes a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (XIII)
  • At least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 100, at least 250, at least 500, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 of the polynucleotides in the library encodes a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (I)
  • At least one of the polynucleotides in the library encodes an activatable binding polypeptide (i.e., an activatable antibody) .
  • one or more polynucleotides of the library are in a vector (e.g., an expression vector or display vector) .
  • At least one of the polynucleotides in the library encodes an activatable binding polypeptide (i.e., an activatable antibody) .
  • one or more polynucleotides of the library are in a vector (e.g., an expression vector or display vector) .
  • At least one of the polynucleotides in the library encodes an activatable binding polypeptide (i.e., an activatable antibody) .
  • one or more polynucleotides of the library are in a vector (e.g., an expression vector or display vector) .
  • each of the polynucleotides in the library encode a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y; (b) a cleavable moiety (CM) comprising at least a first cleavage site (e.g., at least a first protease cleavage site) ; and c) a target binding moiety (TBM) comprising an antibody light chain variable region and/or an antibody heavy chain variable region.
  • FP first peptide
  • XIII : X m CX n
  • each of the polynucleotides in the library encode a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, where each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and where each Z is independently an amino acid selected from D, A, Y, S, T, N, I, L, F, V, H, and P; (b) a cleavable moiety (CM) comprising at least a first cleavage site (e.g., at least a first protease cleavage site) ; and c) a target binding moiety (TBM) comprising an antibody
  • At least one of the polynucleotides in the library encodes an activatable binding polypeptide (i.e., an activatable antibody) .
  • one or more polynucleotides of the library are in a vector (e.g., an expression vector or display vector) .
  • each of the polynucleotides in the library encode a polypeptide comprising an amino acid sequence according to Formula (III) , EVGSYX 1 X 2 X 3 X 4 X 5 X 6 CX 7 X 8 X 9 X 10 X 11 X 12 CX 13 X 14 SGRSAGGGGTENLYFQGSGGS (SEQ ID NO: 3) , where X1 is A, D, I, N, P, or Y, x2 is A, F, N, S, or V, X3 is A, H, L, P, S, V, or Y, X4 is A, H, S, or Y, X5 is A, D, P, S, V, or Y, X6 is A, D, L, S, or Y, X7 is D, P, or V, X8 is A, D, H, P, S, or T, X9 is A, D, F, H, P, or Y, X
  • At least one of the polynucleotides in the library encodes an activatable binding polypeptide (i.e., an activatable antibody) .
  • one or more polynucleotides of the library are in a vector (e.g., an expression vector or display vector) .
  • each of the polynucleotides in the library encodes a polypeptide comprising an amino acid sequence selected from SEQ ID NOS: 25-46.
  • at least one of the polynucleotides in the library encodes an activatable binding polypeptide (i.e., an activatable antibody) .
  • one or more polynucleotides of the library are in a vector (e.g., an expression vector or display vector) .
  • a library of the present disclosure contains at least one (e.g., at least one, at least two, at least 5, at least 10, at least 100, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 ) polynucleotide encoding a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3- 10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F,
  • FP
  • a library of the present disclosure contains at least one (e.g., at least one, at least two, at least 5, at least 10, at least 100, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 ) polynucleotide encoding a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, where each X is independently an amino acid selected from A, C, D, E, F, G, H
  • the polypeptide comprising the structure, from N-terminus to C-terminus, of: first peptide (FP) -cleavable moiety (CM) -VL-VH.
  • at least one of the polypeptides is an activatable binding polypeptide (i.e., an activatable antibody) .
  • a linker sequence separates the VL and VH (i.e., the structure VL-linker-VH) .
  • the inker sequence may be any linker sequence known in the art, e.g., any of the linker sequences described herein.
  • the linker sequence is any copy number of GGGGS (SEQ ID NO: 17) (e.g., repeated 2 times, repeated 3 times, etc. ) .
  • a library of the present disclosure contains at least one (e.g., at least one, at least two, at least 5, at least 10, at least 100, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 ) polynucleotide encoding a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F
  • a library of the present disclosure contains at least one (e.g., at least one, at least two, at least 5, at least 10, at least 100, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 ) polynucleotide encoding a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, where each X is independently an amino acid selected from A, C, D, E, F, G, H
  • the polynucleotide encoding the polypeptide comprising a target binding moiety (TBM) comprising an antibody light chain variable region, and the polynucleotide encoding an antibody heavy chain variable region are on the same vector (e.g., expressed from their own promoters) or on different vectors.
  • at least one of the polypeptides forms an activatable binding polypeptide (i.e., an activatable antibody) when coupled with the antibody heavy chain variable region.
  • a library of the present disclosure contains at least one (e.g., at least one, at least two, at least 5, at least 10, at least 100, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 ) polynucleotide encoding a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F
  • the activatable binding polypeptide comprises a polypeptide comprising the structure, from N-terminus to C-terminus, of: first peptide (FP) -cleavable moiety (CM) -VH-VL
  • a library of the present disclosure contains at least one (e.g., at least one, at least two, at least 5, at least 10, at least 100, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 ) polynucleotide encoding a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX
  • the activatable binding polypeptide comprises a polypeptide comprising the structure, from N-terminus to C-terminus, of: first peptide (FP) -cleavable moiety (CM) -VH-VL.
  • at least one of the polypeptides is an activatable binding polypeptide (i.e., an activatable antibody) .
  • a linker sequence separates the VH and VL (i.e., the structure VH-linker-VL) .
  • the inker sequence may be any linker sequence known in the art, e.g., any of the linker sequences described herein.
  • the linker sequence is any copy number of GGGGS (SEQ ID NO: 17) (e.g., repeated 2 times, repeated 3 times, etc. ) .
  • a library of the present disclosure contains at least one (e.g., at least one, at least two, at least 5, at least 10, at least 100, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 ) polynucleotide encoding a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F
  • a library of the present disclosure contains at least one (e.g., at least one, at least two, at least 5, at least 10, at least 100, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 ) polynucleotide encoding a polypeptide comprising: (a) a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, where each X is independently an amino acid selected from A, C, D, E, F, G, H
  • the polynucleotide encoding the polypeptide comprising a target binding moiety (TBM) comprising an antibody heavy chain variable region, and the polynucleotide encoding an antibody light chain variable region are on the same vector (e.g., expressed from their own promoters) or on different vectors.
  • at least one of the polypeptides forms an activatable binding polypeptide (i.e., an activatable antibody) when coupled with the antibody light chain variable region.
  • Polynucleotides and/or polynucleotide libraries described herein may incorporate any of the HVR sequences (e.g., one, two, or three of the heavy chain variable region HVR sequences, and/or one, two, or three of the light chain variable region HVR sequences) , heavy chain variable region sequences, and/or light chain variable region sequences of any of the antibodies described herein (e.g., an anti-CTLA4 antibody, an anti-CD137 antibody) .
  • HVR sequences e.g., one, two, or three of the heavy chain variable region HVR sequences, and/or one, two, or three of the light chain variable region HVR sequences
  • heavy chain variable region sequences e.g., an anti-CTLA4 antibody, an anti-CD137 antibody
  • Polynucleotides and/or polynucleotide libraries described herein may also incorporate any of the HVR sequences (e.g., one, two, or three of the heavy chain variable region HVR sequences, and/or one, two, or three of the light chain variable region HVR sequences) , heavy chain variable region sequences, light chain variable region sequences, heavy chains, and/or light chains described in PCT application number PCT/CN2017/098333 (incorporated herein by reference in its entirety) , and/or PCT application number PCT/CN2017/098299 (incorporated herein by reference in its entirety) .
  • HVR sequences e.g., one, two, or three of the heavy chain variable region HVR sequences, and/or one, two, or three of the light chain variable region HVR sequences
  • a library of the present disclosure includes one or more vectors (e.g., an expression vector and/or display vector) encoding one or more polynucleotides (e.g., synthetic polynucleotides) of the present disclosure.
  • vectors e.g., an expression vector and/or display vector
  • polynucleotides e.g., synthetic polynucleotides
  • a method of preparing a library e.g., by providing and assembling the polynucleotide sequences (e.g., synthetic polynucleotide (s) ) of a library of the present disclosure.
  • polynucleotide sequences e.g., synthetic polynucleotide (s)
  • Also provided herein is a method of making a library e.g., by selecting multiple (e.g., at least one, at least two, at least 5, at least 10, at least 100, at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , at least 10 11 , at least 10 12 , at least 10 13 , at least 10 14 , at least 10 15 , at least 10 16 , at least 10 17 , at least 10 18 , or at least 10 19 ) first peptide (FP) sequences, cleavable moiety (CM) sequences, and/or target binding moiety (TBM) sequences (e.g., any one or more of the FP, CM, and TBM sequences described herein) , and assembling polynucleotide sequences encoding these sequences to produce a library of polynucleotides (e.g., synthetic polyn
  • Polynucleotides encoding polypeptides as described herein can be cloned into any suitable vector for expression of a portion or the entire polypeptide sequence.
  • the polynucleotide is cloned into a vector allowing for production of a portion or the entire polypeptide fused to all or a portion of a protein (e.g., a viral coat protein, a bacterial surface protein, a yeast surface protein, an insect cell surface protein, a mammalian cell surface protein) (i.e., creating a fusion protein) and displayed on the surface of a particle or cell.
  • a protein e.g., a viral coat protein, a bacterial surface protein, a yeast surface protein, an insect cell surface protein, a mammalian cell surface protein
  • phagemid vectors are available and may be used to practice the present disclosure, for example, phagemid vectors.
  • Phagemid vectors generally contain a variety of components including promoters, signal sequences, phenotypic selection genes, origin of replication sites, and other necessary components as are known to those of ordinary skill in the art.
  • the polynucleotides encoding the polypeptide regions can be cloned into vectors for expression in bacterial cells for bacterial display or in yeast cells for yeast display. Exemplary vectors are described in US PG Pub. No. US20160145604.
  • the vector is a display vector comprising, from 5’ to 3’, a polynucleotide encoding an amino acid sequence to be displayed on a surface (e.g., a surface of phage, bacteria, yeast, insect, or mammalian cells) , a restriction site, a second polynucleotide encoding a surface peptide capable of being displayed on the surface, and a second restriction site.
  • the second polynucleotide encodes a phage coat protein, a yeast outer wall protein (such as Aga2) , a bacterial outer membrane protein, a cell surface tether domain, or an adapter, or a truncation or derivative thereof.
  • the surface peptide is for phage display, yeast display, bacterial display, insect display, or mammalian display, or shuttling display there between.
  • the amino acid sequence and the surface peptide are displayed as a fusion protein on the surface.
  • the vector further comprises a fusion tag 5’ to the first restriction site or 3’ to the second restriction site.
  • Certain aspects of the present disclosure relate to a population of cells containing vector (s) described herein.
  • Polypeptides encoded by polynucleotides generated by any of the techniques described herein, or other suitable techniques can be expressed and screened to identify activatable binding polypeptides having desired structure and/or activity.
  • Expression of the polypeptides can be carried out, for example, using cell-free extracts (e.g., ribosome display) , phage display, prokaryotic cells (e.g., bacterial display) , or eukaryotic cells (e.g., yeast display) .
  • the cells are bacterial cells, yeast cells, insect cells, or mammalian cells (such as Chinese Hamster Ovary (CHO) cells) .
  • the polynucleotides can be expressed in an E. coli expression system, such as that described by Pluckthun and Skerra. (Meth. Enzymol., 1989, 178: 476; Biotechnology, 1991, 9: 273) .
  • the mutant proteins can be expressed for secretion in the medium and/or in the cytoplasm of the bacteria, as described by Better and Horwitz, Meth. Enzymol., 1989, 178: 476.
  • the polypeptides are attached to the 3′end of a sequence encoding a signal sequence, such as the ompA, phoA or pelB signal sequence (Lei et al., J. Bacteriol., 1987, 169: 4379) .
  • a gene encoding a polypeptide comprising a first peptide (FP) , a cleavable moiety (CM) , and a target binding moiety (TBM) comprising an antibody light chain can be concurrently expressed with an antibody heavy chain gene to produce a polypeptide of interest.
  • polypeptide sequences of the present disclosure are expressed on the membrane surface of a prokaryote, e.g., E. coli, using a secretion signal and lipidation moiety as described, e.g., in US20040072740; US20030100023; and US20030036092.
  • polypeptide sequences of the present disclosure can be expressed and screened by anchored periplasmic expression (APEx 2-hybrid surface display) , as described, for example, in Jeong et al., PNAS, 2007, 104: 8247 or by other anchoring methods as described, for example, in Mazor et al., Nature Biotechnology, 2007, 25: 563.
  • APIEx 2-hybrid surface display anchored periplasmic expression
  • Higher eukaryotic cells such as mammalian cells, for example myeloma cells (e.g., NS/0 cells) , hybridoma cells, Chinese hamster ovary (CHO) cells, and human embryonic kidney (HEK) cells, can also be used for expression of the polypeptides of the present disclosure.
  • Mammalian cells for example myeloma cells (e.g., NS/0 cells) , hybridoma cells, Chinese hamster ovary (CHO) cells, and human embryonic kidney (HEK) cells
  • Polypeptides e.g., activatable binding polypeptides
  • expressed in mammalian cells may be designed to be secreted into the culture medium, or expressed on the surface of the cell.
  • polypeptides can be selected using mammalian cell display (Ho et al., PNAS, 2006, 103: 9637) .
  • polypeptides e.g., activatable binding polypeptides
  • a non-human animal comprising a polynucleotide or polynucleotide library of the present disclosure.
  • a non-human animal of the present disclosure may be modified such that its genome includes a polynucleotide encoding a polypeptide (e.g., an activatable binding polypeptide) of the present disclosure.
  • the transgenic animal e.g., mouse
  • the transgenic animal expresses polypeptides encoded by the polynucleotides.
  • Techniques for modifying the genome of a non-human animal are known in the art (e.g., methods used to generate Xenomouse TM ) .
  • the screening for activatable binding polypeptides derived from the libraries of the present disclosure can be carried out by any appropriate means (e.g., determining target binding before and after activation (such as treatment of a polypeptide with one or more proteases that cleave a sequence within the cleavable moiety (CM) ) ) .
  • binding activity can be evaluated by standard immunoassay and/or affinity chromatography.
  • Screening of the polypeptides of the present disclosure for catalytic function, e.g., proteolytic function can be accomplished using a standard assays, e.g., a hemoglobin plaque assay.
  • Determining binding affinity of a polypeptide (e.g., an activatable binding polypeptide) to a target can be assayed in vitro using a variety of well-known techniques, e.g., an ELISA, a BIACORE TM instrument, which measures binding rates of an protein to a given target based on surface plasmon resonance, or Bio-Layer Interferometry (BLI) , as exemplified below using the ForteBio RED96 platform (Pall Life Sciences) .
  • In vivo assays can be conducted using any of a number of animal models and then subsequently tested, as appropriate, in humans. Cell-based biological assays are also contemplated.
  • polypeptides can be further selected for functional activity, for example, antagonist or agonist activity.
  • affinity of binding between a polypeptide comprising fab fragment (s) and one or more target (s) is measured using BLI by tagging antigens with human IgG1-Fc tag and capture by Anti-hIgG-Fc Capture (AHC) Biosensor (e.g., before and after activation) .
  • Polypeptides can be tagged at the C-terminus of the CH1 domain with a His6 tag, over-expressed in a host cell such as E. coli, and purified, e.g., using a Ni-NTA resin.
  • Affinity can then be measured using AHC sensors (anti-human IgG-Fc capture dip and read biosensors) dipped into wells containing the purified polypeptides comprising the Fabs diluted, e.g., to 5-10 ⁇ g/mL with kinetic buffer (e.g., before and after activation) .
  • AHC sensors anti-human IgG-Fc capture dip and read biosensors
  • kinetic buffer e.g., before and after activation
  • binders are identified (e.g., by determining that the polypeptide is capable of binding to a target or antigen when “active” (e.g., after treatment with protease) , but not when “inactive” (e.g., before treatment with protease) )
  • the nucleic acid can be extracted. Extracted DNA can then be used directly to transform E. coli host cells or alternatively, the encoding sequences can be amplified, for example using PCR with suitable primers, and sequenced by any typical sequencing method. DNA sequences of the binders can be restriction enzyme digested and then inserted into a vector for protein expression.
  • the present disclosure relates to polynucleotides and/or polynucleotide libraries encoding one or more polypeptides comprising a first peptide (FP) . In some embodiments, the present disclosure relates to polypeptides and/or polypeptide libraries comprising at least one polypeptide comprising a first peptide (FP) .
  • the first peptide (FP) comprises an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y. In some embodiments, X is not W, M, and/or C.
  • each X in X m of formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P
  • each X in X n of formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P
  • each X in X o of formula (XIII) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • the FP comprises a polypeptide encoded by a polynucleotide sequence according to Formula (XIV) : (NNK) m TGY (NNK) n TGY (NNK) o (SEQ ID NO: 87) , where each N is independently A, G, T, or C, where each K is independently T or G, and where each Y is independently T or C, and wherein each H is independently A, T, or C.
  • Formula (XIV) (NNK) m TGY (NNK) n TGY (NNK) o (SEQ ID NO: 87) , where each N is independently A, G, T, or C, where each K is independently T or G, and where each Y is independently T or C, and wherein each H is independently A, T, or C.
  • the first peptide (FP) comprises an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, where each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and where each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • X is not W, M, and/or C.
  • each X in X m of formula (I) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P and each X in X n of formula (I) is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • the FP comprises a polypeptide encoded by a polynucleotide sequence according to Formula (II) : (NNK) m TGY (NNK) n TGY (NHC) o (SEQ ID NO: 2) , wherein each N is independently A, G, T, or C, wherein each K is independently T or G, wherein each Y is independently T or C, and wherein each H is independently A, T, or C.
  • Formula (II) (NNK) m TGY (NNK) n TGY (NHC) o (SEQ ID NO: 2) , wherein each N is independently A, G, T, or C, wherein each K is independently T or G, wherein each Y is independently T or C, and wherein each H is independently A, T, or C.
  • the first peptide (FP) comprises an amino acid sequence according to Formula (XII) : Z m CZ n CZ o (SEQ ID NO: 71) , where m is from 3-10, n is from 3-10, and o is from 1-10, and each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • m is from 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8, 8-10, 8-9, or 9-10.
  • m is from 6-8.
  • m is 3, 4, 5, 6, 7, 8, 9, or 10.
  • m is 6.
  • n is from 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8, 8-10, 8-9, or 9-10.
  • n is from 6-8.
  • n is 3, 4, 5, 6, 7, 8, 9, or 10.
  • n is 6.
  • n is 8.
  • o is from 1-10, 1-9, 1-8, 1-7, 1-6, 1-5, 1-4, 1-3, 1-2, 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8, 8-10, 8-9, or 9-10.
  • o is from 1-2.
  • o is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
  • o is 2.
  • the first peptide (FP) comprises an amino acid sequence according to Formula (IV) : Z6CX6CZ2 (SEQ ID NO: 55) , where each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and where each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • the first peptide (FP) comprises an amino acid sequence according to Formula (V) : Z6CX8CZ2 (SEQ ID NO: 56) where each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and where each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • the first peptide (FP) comprises an amino acid sequence according to Formula (VI) : (Z6) C (Z6) C (Z2) (SEQ ID NO: 57) , where each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • the first peptide (FP) comprises an amino acid sequence according to Formula (VII) : (Z6) C (Z8) C (Z2) (SEQ ID NO: 58) , where each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • the first peptide (FP) comprises an amino acid sequence selected from SEQ ID NOS: 72-85.
  • any of the first peptides (FPs) described herein may further comprise one or more additional amino acid sequences (e.g., one or more polypeptide tags) .
  • additional amino acid sequence may include, without limitation, purification tags (such as his-tags, flag-tags, maltose binding protein and glutathione-S-transferase tags) , detection tags (such as tags that may be detected photometrically (e.g., red or green fluorescent protein, etc. ) ) , tags that have a detectable enzymatic activity (e.g., alkaline phosphatase, etc.
  • the one or more additional amino acid sequences are at the N-terminus of the first peptide (FP) .
  • the additional amino acid sequence comprises or consists of the sequence EVGSY (SEQ ID NO: 16) .
  • the first peptide is a masking peptide that binds to the target binding moiety (TBM) and inhibits the polypeptide from binding to its target before activation (e.g., before treatment with one or more proteases that cleave within the cleavable moiety (CM) , before undergoing a (local) change in pH (increased or decreased) , before a temperature shift (increased or decreased) , before being contacted with a second molecule (such as a small molecule or a protein ligand) , etc.
  • TBM target binding moiety
  • CM cleavable moiety
  • the first peptide (FP) (e.g., a masking moiety) inhibits binding of a polypeptide (e.g., an activatable binding polypeptide (i.e., an activatable antibody) ) to its target when the CM is not cleaved, but does not inhibit binding of a polypeptide (e.g., an activatable binding polypeptide (i.e., an activatable antibody) ) to its target when the CM is cleaved.
  • a polypeptide e.g., an activatable binding polypeptide (i.e., an activatable antibody)
  • the first peptide (FP) (e.g., a masking moiety) has a dissociation constant for binding to the TBM that is greater (e.g., at least about 1.5-fold greater, at least about 2-fold greater, at least about 2.5-fold greater, at least about 3-fold greater, at least about 3.5-fold greater, at least about 4-fold greater, at least about 4.5-fold greater, at least about 5-fold greater, at least about 10-fold greater, at least about 100-fold greater, at least about 500-fold greater, etc. ) than the dissociation constant of the polypeptide (e.g., an activatable polypeptide (i.e., activatable antibody) ) for its target.
  • the polypeptide e.g., an activatable polypeptide (i.e., activatable antibody)
  • CMs Cleavable moieties
  • the present disclosure relates to polynucleotides and/or polynucleotide libraries encoding one or more polypeptides comprising a cleavable moiety (CM) . In some embodiments, the present disclosure relates to polypeptides and/or polypeptide libraries comprising at least one polypeptide comprising a cleavable moiety (CM) .
  • the cleavable moiety comprises at least a first cleavage site (CS 1 ) (e.g., a first protease cleavage site) .
  • the first cleavage site is a first protease cleavage site.
  • Any suitable protease cleavage site recognized and/or cleaved by any protease e.g., a protease that is known to be co-localized with a target of a polypeptide comprising the CM
  • a protease cleavage site recognized and/or cleaved by urokinase-type plasminogen activator (uPA) e.g., urokinase-type plasminogen activator (uPA) ; matrix metalloproteinases (e.g., MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13, MMP-14, MMP-15, MMP-16, MMP-17, MMP-19, MMP-20, MMP-23, MMP-24, MMP-26, and/or MMP-27) ; Tobacco Etch Virus (TEV) protease; plasmin; Thr
  • the first protease cleavage site is a cleavage site for a protease selected from uPA, MMP-1, MMP-2, MMP-3, MMP-8, MMP-9, MMP-14, TEV protease, plasmin, Thrombin, Factor X, PSA, PSMA, Cathepsin D, Cathepsin K, Cathepsin S, ADAM10, ADAM12, ADAMTS, Caspase-1, Caspase-2, Caspase-3, Caspase-4, Caspase-5, Caspase-6, Caspase-7, Caspase-8, Caspase-9, Caspase-10, Caspase-11, Caspase-12, Caspase-13, Caspase-14, and TACE.
  • a protease selected from uPA, MMP-1, MMP-2, MMP-3, MMP-8, MMP-9, MMP-14, TEV protease, plasmin,
  • the first protease cleavage site is a cleavage site for a protease selected from uPA, MMP-2, MMP-9, and/or TEV protease.
  • the protease cleavage comprises an amino acid sequence selected from SGRSA (SEQ ID NO: 13) , PLGLAG (SEQ ID NO: 14) , and ENLYFQG (SEQ ID NO: 15) .
  • a polypeptide comprising a first peptide (FP) and a cleavable moiety (CM) comprises an amino acid sequence according to Formula (VIII) : EVGSY (Z6) C (Z6) C (Z2) SGRSA (SEQ ID NO: 4) , where each Z is independently an amino acid selected from D, A, Y, S, T, N, I, L, F, V, H, and P.
  • a polypeptide comprising a first peptide (FP) and a cleavable moiety (CM) comprises an amino acid sequence according to Formula (IX) : EVGSY (Z6) C (X6) C (Z2) SGRSA (SEQ ID NO: 5) , where each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and where each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • a polypeptide comprising a first peptide (FP) and a cleavable moiety (CM) comprises an amino acid sequence according to Formula (X) : EVGSY (Z6) C (Z8) C (Z2) SGRSA (SEQ ID NO: 6) , where each Z is independently an amino acid selected from D, A, Y, S, T, N, I, L, F, V, H, and P.
  • a polypeptide comprising a first peptide (FP) and a cleavable moiety (CM) comprises an amino acid sequence according to Formula (XI) : EVGSY (Z6) C (X8) C (Z2) SGRSA (SEQ ID NO: 7) , where each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and wherein each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P.
  • the cleavable moiety (CM) further comprises a first linker (L 1 ) .
  • the first linker (L 1 ) is C-terminal to the first cleavage site (CS 1 ) (e.g., a first protease cleavage site) .
  • the cleavable moiety (CM) comprises a structure, from N-terminus to C-terminus, of: (CS 1 ) -L 1 .
  • Any suitable linker e.g., a flexible linker known in the art may be used, including, for example: glycine polymers (G) n, where n is an integer of at least 1 (e.g., at least one, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, etc. ) ; glycine-serine polymers (GS) n, where n is an integer of at least 1 (e.g., at least one, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, etc.
  • G glycine polymers
  • GS glycine-serine polymers
  • GGGGS such as GGGGS (SEQ ID NO: 17) , SGGS (SEQ ID NO: 18) , GGSG (SEQ ID NO: 19) , GGSGG (SEQ ID NO: 20) , GSGSG (SEQ ID NO: 21) , GSGGG (SEQ ID NO: 22) , GGGSG (SEQ ID NO: 23) , and/or GSSSG (SEQ ID NO: 24) )
  • GGGGS SEQ ID NO: 17
  • SGGS SEQ ID NO: 18
  • GGSG SEQ ID NO: 19
  • GGSGG SEQ ID NO: 20
  • GSGSG SEQ ID NO: 21
  • GSGGG SEQ ID NO: 22
  • GGGSG GGGSG
  • GSSSG GSSSG
  • Linker sequences may be of any length, such as from about 1 amino acid (e.g., glycine or serine) to about 20 amino acids (e.g., 20 amino acid glycine polymers or glycine-serine polymers) , about 1 amino acid to about 15 amino acids, about 3 amino acids to about 12 amino acids, about 4 amino acids to about 10 amino acids, about 5 amino acids to about 9 amino acids, about 6 amino acids to about 8 amino acids, etc.
  • the linker is any of about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids in length.
  • the linker comprises an amino acid sequence selected from SEQ ID NOS: 17-24.
  • the linker comprises an amino acid sequence of SEQ ID NO: 17 or 18.
  • the cleavable moiety (CM) further comprises at least a second cleavage site (e.g., at least a second, at least a third, at least a fourth, at least a fifth, etc. ) .
  • the cleavable moiety (CM) further comprises a second cleavage site (CS 2 ) .
  • the second cleavage site is a second protease cleavage site.
  • the second protease cleavage site may be any suitable protease cleavage site recognized and/or cleaved by any of the proteases described above.
  • the first (CS 1 ) and second (CS 2 ) cleavage sites are protease cleavage sites recognized and/or cleaved by the same protease.
  • the first (CS 1 ) and second (CS 2 ) cleavage sites are protease cleavage sites recognized and/or cleaved by different proteases (e.g., the first protease cleavage site is recognized and/or cleaved by uPA, and the second protease cleavage site is recognized and/or cleaved by MMP-2; the first protease cleavage site is recognized and/or cleaved by uPA, and the second protease cleavage site is recognized and/or cleaved by MMP-9; the first protease cleavage site is recognized and/or cleaved by uPA, and the second protease cleavage site is recognized and/or cleavage site is recognized and
  • the at least second cleavage site (CS 2 ) is C-terminal to the first linker (L 1 ) .
  • the cleavable moiety (CM) comprises a structure, from N-terminus to C-terminus, of: (CS 1 ) -L 1 - (CS 2 ) .
  • the cleavable moiety (CM) further comprises at least a second linker (e.g., at least a second, at least a third, at least a fourth, at least a fifth, etc. ) .
  • the cleavable moiety (CM) further comprises a second linker (L 2 ) .
  • the second linker (L 2 ) may be any suitable linker described above.
  • the second linker comprises an amino acid sequence selected from SEQ ID NO: 17-24.
  • the first (L 1 ) and second (L 2 ) linkers are the same (e.g., both linkers comprise the sequence of SEQ ID NO: 17 or 18) .
  • the first (L 1 ) and second (L 2 ) linkers are different (e.g., the first linker (L 1 ) comprises the amino acid sequence of SEQ ID NO: 17, and the second linker (L 2 ) comprises the amino acid sequence of SEQ ID NO: 18, etc. ) .
  • the at least second linker (L 2 ) is C-terminal to the second cleavage site (CS 2 ) .
  • the cleavable moiety (CM) comprises a structure, from N-terminus to C-terminus, of: (CS 1 ) -L 1 -(CS 2 ) -L 2 .
  • a polypeptide of the present disclosure comprises the structure, from N-terminus to C-terminus, of: (FP) - (PCS 1 ) -L 1 - (PCS 2 ) -L 2 .
  • a polypeptide of the present disclosure comprises the amino acid sequence of:
  • EVGSYSNNFASCLWRHRSCADSGRSAGGGGSPLGLAGSGGS (SEQ ID NO: 45) ;
  • a polypeptide of the present disclosure comprises the structure, from N-terminus to C-terminus, of: (FP) - (PCS 1 ) -L 1 - (PCS 2 ) -L 2 - (TBM) .
  • TBMs Target binding moieties
  • the present disclosure relates to polynucleotides and/or polynucleotide libraries encoding one or more polypeptides comprising a target binding moiety (TBM) .
  • the present disclosure relates to polypeptides and/or polypeptide libraries comprising at least one polypeptide comprising a target binding moiety (TBM) .
  • the target binding moiety (TBM) comprises an antibody light chain variable region and/or an antibody heavy chain variable region.
  • the target binding moiety (TBM) comprises an antibody light chain variable region.
  • the target binding moiety (TBM) comprises an antibody heavy chain variable region.
  • the target binding moiety comprises an antibody light chain variable region and an antibody heavy chain variable region.
  • the antibody heavy chain variable region is C-terminal to the antibody light chain variable region. In some embodiments, the antibody light chain variable region is C-terminal to the antibody heavy chain variable region.
  • a target binding moiety (TBM) of the present disclosure comprises an antibody light chain variable region and/or an antibody heavy chain variable region with specificity for any target of interest, including, for example, CTLA4, CD137, PD-1, PD-L1, PD-L2, LAG3, TIM3, B7-H3, OX40, CD3, CD19, CD20, CD40, CD95, CD120a, BTLA, VISTA, ICOS, BCMA, Her1, Her2, Her3, and/or B7-H4.
  • the target binding moiety comprises a full length antibody light chain and/or a full length antibody heavy chain.
  • the antibody light chain may be a kappa or lambda light chain.
  • the antibody heavy chain may be in any class, such as IgG, IgM, IgE, IgA, or IgD.
  • the antibody heavy chain is in the IgG class, such as IgG1, IgG2, IgG3, or IgG4 subclass.
  • An antibody heavy chain described herein may be converted from one class or subclass to another class or subclass using methods known in the art.
  • any one or more of the target binding moieties (TBMs) described herein may incorporate any of the HVR sequences (e.g., one, two, or three of the heavy chain variable region HVR sequences, and/or one, two, or three of the light chain variable region HVR sequences) , heavy chain variable region sequences, and/or light chain variable region sequences of any of the antibodies described in PCT application number PCT/CN2017/098333 (incorporated herein by reference in its entirety) , PCT application number PCT/CN2017/098299 (incorporated herein by reference in its entirety) , PCT application number PCT/CN2017/098332 (incorporated herein by reference in its entirety) , and/or the PCT application titled “Compositions Comprising Cross-reactive Anti-CTLA4 Antibodies, and Methods of Making and Using the Same” , filed concurrently herewith under Attorney Docket No. 69540-2000540 (incorporated herein by reference in its entirety) .
  • any one or more of the target binding moieties (TBMs) described herein may incorporate any of the HVR sequences (e.g., one, two, or three of the heavy chain variable region HVR sequences, and/or one, two, or three of the light chain variable region HVR sequences) , heavy chain variable region sequences, and/or light chain variable region sequences of any of the antibodies described herein (e.g., an anti-CTLA4 antibody, an anti-CD137 antibody) .
  • HVR sequences e.g., one, two, or three of the heavy chain variable region HVR sequences, and/or one, two, or three of the light chain variable region HVR sequences
  • heavy chain variable region sequences e.g., an anti-CTLA4 antibody, an anti-CD137 antibody
  • the target binding moiety comprises a sequence of one or more of the anti-CTLA4 antibodies described herein, including antibodies described with reference to specific amino acid sequences of HVRs, variable regions (VL, VH) , and/or light and heavy chains (e.g., IgG1, IgG2, IgG4) .
  • the target binding moiety comprises an antibody light chain variable region comprising an HVR-L1 comprising the amino acid sequence RASQSVRGRFLA (SEQ ID NO: 62) , an HVR-L2 comprising the amino acid sequence DASNRATGI (SEQ ID NO: 63) , and/or an HVR-L3 comprising the amino acid sequence YCQQSSSWPPT (SEQ ID NO: 64) .
  • the target binding moiety (TBM) comprises an antibody light chain variable region comprising the amino acid sequence of SEQ ID NO: 48.
  • the target binding moiety comprises an antibody heavy chain variable region comprising an HVR-H1 comprising the amino acid sequence YSISSGYHWSWI (SEQ ID NO: 59) , an HVR-H2 comprising the amino acid sequence LARIDWDDDKYYSTSLKSRL (SEQ ID NO: 60) , and/or an HVR-H3 comprising the amino acid sequence ARSYVYFDY (SEQ ID NO: 61) .
  • the target binding moiety (TBM) comprises an antibody heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 47.
  • the target binding moiety comprises: a) an antibody light chain variable region comprising an HVR-L1 comprising the amino acid sequence RASQSVRGRFLA (SEQ ID NO: 62) , an HVR-L2 comprising the amino acid sequence DASNRATGI (SEQ ID NO: 63) , and/or an HVR-L3 comprising the amino acid sequence YCQQSSSWPPT (SEQ ID NO: 64) ; and b) an antibody heavy chain variable region comprising an HVR-H1 comprising the amino acid sequence YSISSGYHWSWI (SEQ ID NO: 59) , an HVR-H2 comprising the amino acid sequence LARIDWDDDKYYSTSLKSRL (SEQ ID NO: 60) , and/or an HVR-H3 comprising the amino acid sequence ARSYVYFDY (SEQ ID NO: 61) .
  • the target binding moiety (TBM) comprises an antibody light chain variable region comprising the amino acid
  • the target binding moiety comprises a sequence of one or more of the anti-CD137 antibodies described herein, including antibodies described with reference to specific amino acid sequences of HVRs, variable regions (VL, VH) , and/or light and heavy chains (e.g., IgG1, IgG2, IgG4) .
  • the target binding moiety comprises an antibody light chain variable region comprising an HVR-L1 comprising the amino acid sequence RASQSIGSYLA (SEQ ID NO: 68) , an HVR-L2 comprising the amino acid sequence DASNLETGV (SEQ ID NO: 69) , and/or an HVR-L3 comprising the amino acid sequence YCQQGYYLWT (SEQ ID NO: 70) .
  • the target binding moiety (TBM) comprises an antibody light chain variable region comprising the amino acid sequence of SEQ ID NO: 50.
  • the target binding moiety comprises an antibody heavy chain variable region comprising an HVR-H1 comprising the amino acid sequence FSLSTGGVGVGWI (SEQ ID NO: 65) , an HVR-H2 comprising the amino acid sequence LALIDWADDKYYSPSLKSRL (SEQ ID NO: 66) , and/or an HVR-H3 comprising the amino acid sequence ARGGSDTVIGDWFAY (SEQ ID NO: 67) .
  • the target binding moiety (TBM) comprises an antibody heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 49.
  • the target binding moiety (TBM) comprises: a) an antibody light chain variable region comprising an HVR-L1 comprising the amino acid sequence RASQSIGSYLA (SEQ ID NO: 68) , an HVR-L2 comprising the amino acid sequence DASNLETGV (SEQ ID NO: 69) , and/or an HVR-L3 comprising the amino acid sequence YCQQGYYLWT (SEQ ID NO: 70) ; and b) an antibody heavy chain variable region comprising an HVR-H1 comprising the amino acid sequence FSLSTGGVGVGWI (SEQ ID NO: 65) , an HVR-H2 comprising the amino acid sequence LALIDWADDKYYSPSLKSRL (SEQ ID NO: 66) , and/or an HVR-H3 comprising the amino acid sequence ARGGSDTVIGDWFAY (SEQ ID NO: 67) .
  • the target binding moiety (TBM) comprises an antibody light chain variable region comprising the
  • polypeptides e.g., any of the polypeptides described herein
  • libraries of polypeptides useful for screening for, identifying, and/or selecting one or more activatable binding polypeptides (i.e., one or more activatable antibodies) , including activatable antibodies, activatable antigen binding fragments thereof, or derivatives of activatable antibodies.
  • a library of the present disclosure may contain one or more of the polypeptides described herein (e.g., one or more activatable binding polypeptides) .
  • one or more (e.g., one, some, or all) of the polypeptides of a library described herein comprise antigen binding domain (s) .
  • one or more (e.g., one, some, or all) of the polypeptides of a library described herein comprise full length antibody light and/or heavy chain (s) .
  • one or more (e.g., one, some, or all) of the polypeptides of a library described herein comprise light and/or heavy chain Fab fragment (s) .
  • one or more (e.g., one, some, or all) of the polypeptides of a library described herein comprise single-chain variable fragment (s) (scFvs) .
  • the polypeptides are expressed on a cell surface (e.g., yeast or mammalian cell display) .
  • a polypeptide of the present disclosure (e.g., in a library) comprises: (a) a first peptide (FP) ; (b) a cleavable moiety (CM) ; and (c) a target binding moiety (TBM) .
  • the FP is any of the first peptides described herein (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y) .
  • a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N
  • the FP is any of the first peptides described herein (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P) .
  • FP a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10,
  • the CM is any of the cleavable moieties described herein (e.g., a cleavable moiety (CM) comprising at least a first protease cleavage site) .
  • the TBM is any of the target binding moieties described herein (e.g., a target binding moiety (TBM) comprising an antibody light chain variable region and/or an antibody heavy chain variable region) .
  • an antigen binding domain and/or a library comprising antigen binding domains wherein at least one (e.g., one, some, or all) of the antigen binding domains comprises a polypeptide of the present disclosure.
  • At least one (e.g., one, some, or all) of the antigen binding domains comprises a polypeptide comprising, from N-terminus to C-terminus: (a) a first peptide (FP) (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y) ; (b) a cleavable moiety (e.g., a cleavable moiety (CM) comprising at least a first protease cleavage site) ; and (c) a target binding moiety comprising an antibody
  • At least one (e.g., one, some, or all) of the antigen binding domains comprises a polypeptide comprising, from N-terminus to C-terminus: (a) a first peptide (FP) (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P) ; (b) a cleavable moiety (e.g., a cleavable moiety
  • the antigen binding domain further comprises an antibody heavy chain variable region.
  • at least one (e.g., one, some, or all) of the antigen binding domains comprises a polypeptide comprising, from N-terminus to C-terminus: (a) a first peptide (FP) (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y) ; (b) a cleavable moiety (e.g., a cleavable moiety (CM) comprising at least a first protease clea
  • At least one (e.g., one, some, or all) of the antigen binding domains comprises a polypeptide comprising, from N-terminus to C-terminus: (a) a first peptide (FP) (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P) ; (b) a cleavable moiety (e.g., a cleavable moiety
  • an antibody fragment or scFv comprising any of the polypeptides described herein.
  • the antibody fragment or scFv comprises a polypeptide comprising a target binding moiety (TBM) comprising an antibody light chain variable region.
  • the antibody fragment or scFv comprises a polypeptide comprising a target binding moiety (TBM) comprising an antibody heavy chain variable region.
  • TBM target binding moiety
  • a library of antibody fragments or scFvs wherein at least one of the antibody fragments or scFvs comprises any of the polypeptides described herein.
  • At least one (e.g., one, some, or all) of the antibody fragments or scFvs in the library comprises a polypeptide comprising a target binding moiety (TBM) comprising an antibody light chain variable region. In some embodiments, at least one (e.g., one, some, or all) of the antibody fragments or scFvs in the library comprises a polypeptide comprising a target binding moiety (TBM) comprising an antibody heavy chain variable region.
  • TBM target binding moiety
  • TBM target binding moiety
  • the present disclosure relates to an antibody light chain comprising a polypeptide of the present disclosure.
  • the antibody light chain comprises a polypeptide comprising, from N-terminus to C-terminus: (a) a first peptide (FP) (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y) ; (b) a cleavable moiety (e.g., a cleavable moiety (CM) comprising at least a first protease cleavage site) ; and (c) a cleavable moiety
  • the antibody light chain comprises a polypeptide comprising, from N-terminus to C-terminus: (a) a first peptide (FP) (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P) ; (b) a cleavable moiety (e.g., a cleavable moiety (CM) comprising at least a first protease cleavage site
  • the present disclosure relates to a library comprising antibody light chains, where at least one (e.g., one, some, or all) of the antibody light chains in the library are antibody light chains as described above) .
  • the present disclosure relates to an antibody comprising an antibody light chain and an antibody heavy chain, wherein the antibody light chain is an antibody light chain as described above.
  • the antibody heavy chain is any antibody heavy chain known in the art (including any of the antibody heavy chains described herein) .
  • the present disclosure relates to a library comprising antibodies, where at least one (e.g., one, some, or all) of the antibodies are antibodies as described above) .
  • the present disclosure relates to an antibody heavy chain comprising a polypeptide of the present disclosure.
  • the antibody heavy chain comprises a polypeptide comprising, from N-terminus to C-terminus: (a) a first peptide (FP) (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (XIII) : X m CX n CX o (SEQ ID NO: 86) , where m is from 3-10, n is from 3-10, and o is from 1-10, and where each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y) ; (b) a cleavable moiety (e.g., a cleavable moiety (CM) comprising at least a first protease cleavage site) ; and (c) a cleavable moiety
  • the antibody heavy chain comprises a polypeptide comprising, from N-terminus to C-terminus: (a) a first peptide (FP) (e.g., a first peptide (FP) comprising an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, each X is independently an amino acid selected from A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P) ; (b) a cleavable moiety (e.g., a cleavable moiety (CM) comprising at least a first protease cleavage site
  • the present disclosure relates to a library comprising antibody heavy chains, where at least one (e.g., one, some, or all) of the antibody heavy chains in the library are antibody heavy chains as described above) .
  • the present disclosure relates to an antibody comprising an antibody heavy chain and an antibody light chain, wherein the antibody heavy chain is an antibody heavy chain as described above.
  • the antibody light chain is any antibody light chain known in the art (including any of the antibody light chains described herein) .
  • the present disclosure relates to a library comprising antibodies, where at least one (e.g., one, some, or all) of the antibodies are antibodies as described above) .
  • Polypeptides (e.g., any of the antibodies described above) of the present disclosure may be produced using recombinant methods and compositions, e.g., as described in U.S. Patent No. 4,816,567.
  • isolated nucleic acids encoding any or the polypeptides (e.g., any of the antibodies described above) are provided.
  • Such nucleic acids may encode an amino acid sequence comprising the V L and/or an amino acid sequence comprising the V H of the antibodies (e.g., the light and/or heavy chains of the antibodies) .
  • one or more vectors comprising such nucleic acids are provided herein.
  • a host cell comprising such nucleic acids.
  • a host cell comprises (e.g., has been transformed with) : (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising a polypeptide of the present disclosure comprising a V L and an amino acid sequence comprising a V H (e.g., an activatable binding polypeptide (i.e., an activatable antibody) ) , (2) a vector comprising a nucleic acid that encodes an amino acid sequence comprising a polypeptide of the present disclosure comprising a V H and an amino acid sequence comprising the V L (e.g., an activatable binding polypeptide (i.e., an activatable antibody) ) , (3) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising a polypeptide of the present disclosure comprising a V L and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the
  • the host cell is eukaryotic, e.g. a yeast cell, an insect cell, a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell) .
  • a method of making a polypeptide e.g., an activatable binding polypeptide (i.e., an activatable antibody)
  • the method comprises culturing a host cell comprising a nucleic acid encoding the polypeptide (e.g., an activatable binding polypeptide (i.e., an activatable antibody) ) , as provided above, under conditions suitable for expression of the polypeptide, and optionally recovering the polypeptide (e.g., an activatable binding polypeptide (i.e., an activatable antibody) ) from the host cell (or host cell culture medium) .
  • nucleic acid encoding a polypeptide e.g., an activatable binding polypeptide (i.e., an activatable antibody)
  • nucleic acid is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
  • Such nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the polypeptide (s) ) .
  • Suitable host cells for cloning or expression of polypeptide-encoding include prokaryotic or eukaryotic cells.
  • polypeptides e.g., an activatable binding polypeptide (i.e., an activatable antibody)
  • polypeptides may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed (see, e.g., U.S. Patent Nos. 5,648,237, 5,789,199, and 5,840,523; See also Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C.
  • the polypeptide may be isolated from the bacterial cell paste in a soluble fraction and may be further purified.
  • eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for polypeptide-encoding (e.g., activatable binding polypeptide (i.e., activatable antibody) -encoding) vectors, including fungi and yeast strains whose glycosylation pathways have been “humanized, ” resulting in the production of a polypeptide with a partially or fully human glycosylation pattern.
  • polypeptide-encoding e.g., activatable binding polypeptide (i.e., activatable antibody) -encoding
  • yeast strains including fungi and yeast strains whose glycosylation pathways have been “humanized, ” resulting in the production of a polypeptide with a partially or fully human glycosylation pattern.
  • Suitable host cells for the expression of glycosylated polypeptides are also derived from multicellular organisms (invertebrates and vertebrates) .
  • invertebrate cells include plant and insect cells.
  • Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
  • Plant cell cultures can also be utilized as hosts. See, e.g., US Patent Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIES TM technology for producing antibodies in transgenic plants) .
  • Vertebrate cells may also be used as hosts.
  • mammalian cell lines that are adapted to grow in suspension may be useful.
  • Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7) ; human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36: 59 (1977) ) ; baby hamster kidney cells (BHK) ; mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod.
  • monkey kidney cells (CV1) ; African green monkey kidney cells (VERO-76) ; human cervical carcinoma cells (HELA) ; canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A) ; human lung cells (W138) ; human liver cells (Hep G2) ; mouse mammary tumor (MMT 060562) ; TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383: 44-68 (1982) ; MRC 5 cells; and FS4 cells.
  • CHO Chinese hamster ovary
  • DHFR - CHO cells Urlaub et al., Proc. Natl. Acad. Sci. USA 77: 4216 (1980)
  • myeloma cell lines such as Y0, NS0 and Sp2/0.
  • Yazaki and Wu Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ) , pp. 255-268 (2003) .
  • activatable binding polypeptides e.g., activatable antibodies
  • activatable antibodies of the present disclosure are context-dependent (e.g., are activated (are only capable of binding their targets) in certain contexts (such as in the protease-rich tumor microenvironment) ) .
  • the activatable antibodies of the present disclosure provide improved safety over more traditional, non-activatable antibodies (e.g., show reduced toxicity, do not induce significant alterations to the weights of many organs, do not alter liver histopathology, hematology, and/or blood biochemistry, etc. ) .
  • activatable antibodies of the present disclosure have improved pharmacokinetic properties as compared to more traditional, non-activatable antibodies (e.g., have longer in vivo half-lives) .
  • an activatable binding polypeptide of the present disclosure comprises: (a) a first peptide (FP) (e.g., a masking moiety) , (b) a cleavable moiety, and (c) a target binding moiety.
  • the first peptide (FP) binds to the target binding moiety (TBM) of the activatable binding domain and reduces or inhibits binding of the activatable binding moiety to its target (e.g., human CTLA4 or human CD137) , as compared to the binding of a corresponding binding polypeptide lacking the masking moiety to the target and/or as compared to the binding of a parental antibody to the target.
  • TBM target binding moiety
  • an “activatable” binding polypeptides refers to a binding polypeptide that exhibits a first level of binding to a target when in an inhibited, masked, and/or uncleaved state, and exhibits a second level of binding to the target in an uninhibited, unmasked, and/or cleaved state, where the second level of target binding is greater than the first level of target binding.
  • access to the target by the activatable binding polypeptide is greater after cleavage within the cleavable moiety (e.g., by one or more proteases.
  • a polypeptide of the present disclosure is generally considered to be an “activatable” binding polypeptide when binding affinity of the polypeptide to its target (e.g., human CTLA4 or CD137) increases by at least about 2-fold (e.g., at least about 2-fold, at least about 2.5-fold, at least about 3, at least about 3.5-fold, at least about 4-fold, at least about 4.5-fold, at least about 5-fold, at least about 5.5-fold, at least about 6-fold, at least about 6.5-fold, at least about 7-fold, at least about 7.5-fold, at least about 8-fold, at least about 8.5-fold, at least about 9-fold, at least about 9.5-fold, at least about 10-fold, at least about 25-fold, at least about 50-fold, at least about 75-fold, at least about 100-fold, at least about 250-fold, at least about 500-fold, at least about 750-fold, or at least about 1000-fold, or more) after activation of the polypeptide as
  • a polypeptide of the present disclosure is generally considered “activatable” if the EC 50 of the polypeptide increases by at least about 2-fold (e.g., at least about 2-fold, at least about 2.5-fold, at least about 3, at least about 3.5-fold, at least about 4-fold, at least about 4.5-fold, at least about 5-fold, at least about 5.5-fold, at least about 6-fold, at least about 6.5-fold, at least about 7-fold, at least about 7.5-fold, at least about 8-fold, at least about 8.5-fold, at least about 9-fold, at least about 9.5-fold, at least about 10-fold, at least about 25-fold, at least about 50-fold, at least about 75-fold, at least about 100-fold, at least about 250-fold, at least about 500-fold, at least about 750-fold, or at least about 1000-fold, or more) after “activation” (e.g., as measured by an ELISA or FACS assay; see the
  • a polypeptide of the present disclosure is generally considered “activatable” if the EC 50 of the polypeptide increases by at least about 2-fold after treatment with a protease that cleaves within the cleavable moiety (e.g., as measured by an ELISA or FACS assay; see the examples below)
  • the K D of the activatable binding polypeptide for its target is about 2 (e.g., about 2, about 2.5, about 3, about 3.5 about 4, about 4.5, about 5, about 5.5, about 6, about 6.5, about 7, about 7.5, about 8, about 8.5, about 9, about 9.5, about 10, about 25, about 50, about 75, about 100, about 250, about 500, about 750, or about 1000 or more) times greater than when the masking moiety is not bound to the target binding moiety (e.g., after “activation” of the activatable binding polypeptide (such as after protease treatment to cleave within the cleavable moiety) ) and/or than the K D of the parental antibody for the target.
  • Methods of measuring affinity are known in the art, including, for example, by the methods described in Example 3 below) .
  • the K D of the activatable binding polypeptide for its target is reduced by at least about 25% (e.g., at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 99%) relative to when the masking moiety is not bound to the target binding moiety (e.g., after “activation” of the activatable binding polypeptide (such as after protease treatment to cleave within the cleavable moiety) ) and/or relative to the K D of the parental antibody for the target.
  • Methods of measuring affinity are known in the art, including, for example, by the methods described in Example 3 below) .
  • the masking moiety sterically hinders binding of the activatable binding polypeptide to its target and/or allosterically hinders binding of the activatable binding polypeptide to its target. In some embodiments, the masking moiety does not comprise an amino acid sequence of a natural binding partner of activatable binding polypeptide.
  • the dissociation constant of the masking moiety for the target binding moiety is greater than the dissociation constant for the activatable binding polypeptide for the target (when in active activate form) .
  • the dissociation constant of the masking moiety for the target binding moiety is about 2 (e.g., about 2, about 2.5, about 3, about 3.5 about 4, about 4.5, about 5, about 5.5, about 6, about 6.5, about 7, about 7.5, about 8, about 8.5, about 9, about 9.5, about 10, about 25, about 50, about 75, about 100, about 250, about 500, about 750, or about 1000 or more) times greater than the dissociation constant for the activatable binding polypeptide for the target (when in activate form) .
  • the dissociation constant of the masking moiety for the target binding moiety is about equal to the dissociation constant for the activatable binding polypeptide for the target (when in activate form) .
  • the first peptide (FP) binds to the target binding moiety (TBM) , and prevents the polypeptide from binding to its target only when the polypeptide has not been activated (e.g., activated by treatment with one or more proteases that cleave within the cleavable moiety (CM) , activated by a change in pH (increased or decreased) , activated by a temperature shift (increased or decreased) , activated after being contacted with a second molecule (such as a small molecule or a protein ligand) , etc.
  • a second molecule such as a small molecule or a protein ligand
  • activation induces cleavage of the polypeptide within the cleavage moiety. In some embodiments, activation induces conformation changes in the polypeptide (e.g., displacement of the first peptide (FP) ) , leading to the first peptide no longer preventing the polypeptide from binding to its target.
  • conformation changes in the polypeptide e.g., displacement of the first peptide (FP)
  • activatable binding polypeptides i.e., activatable antibodies
  • activatable binding polypeptides may be further modified.
  • the activatable binding polypeptides are linked to an additional molecular entity.
  • additional molecular entities include pharmaceutical agents, peptides or proteins, detection agent or labels, and antibodies.
  • an activatable binding polypeptide of the present disclosure is linked to a pharmaceutical agent.
  • pharmaceutical agents include cytotoxic agents or other cancer therapeutic agents, and radioactive isotopes.
  • cytotoxic agents include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
  • Therapeutic agents also include, for example, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine) , alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU) , cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin) , anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin) , antibiotics (e.g., dactinomycin (formerly actinomycin) , bleomycin, mithramycin, and anthramycin (AMC) ) ,
  • radioactive isotopes that can be conjugated to antibodies for use diagnostically or therapeutically include, but are not limited to, iodine 131 , indium 111 , yttrium 90 and lutetium 177 .
  • Methods for linking a polypeptide to a pharmaceutical agent are known in the art, such as using various linker technologies. Examples of linker types include hydrazones, thioethers, esters, disulfides and peptide-containing linkers.
  • linkers and methods for linking therapeutic agents to antibodies see e.g., Saito et al., Adv. Drug Deliv. Rev. 55: 199-215 (2003) ; Trail, et al., Cancer Immunol. Immunother.
  • the present disclosure relates to activatable binding polypeptides (i.e., activatable antibodies) that bind to human CTLA4, including activatable anti-CTLA4 antibodies, antigen binding fragments of the activatable anti-CTLA4 antibodies, and/or derivatives of the activatable anti-CTLA4 antibodies.
  • activatable binding polypeptides i.e., activatable antibodies
  • human CTLA4 including activatable anti-CTLA4 antibodies, antigen binding fragments of the activatable anti-CTLA4 antibodies, and/or derivatives of the activatable anti-CTLA4 antibodies.
  • the activatable antibody comprises: (a) a polypeptide comprising, from N-terminus to C-terminus, a masking moiety (MM) , a cleavable moiety (CM) , and a target binding moiety (TBM) , where the MM comprises an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, where each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and wherein each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P; where the CM comprises at least a first cleavage site (e.g.,
  • the MM inhibits the binding of the activatable antibody to human CTLA4 when the CM is not cleaved.
  • the activatable antibody is capable of binding to human CTLA4 when the CM is cleaved.
  • the MM comprises an amino acid sequence selected from SEQ ID NOS: 72-78.
  • the activatable binding polypeptides comprise any of the anti-CTLA4 antibodies described herein, including antibodies described with reference to specific amino acid sequences of HVRs, variable regions (VL, VH) , and/or light and heavy chains (e.g., IgG1, IgG2, IgG4) .
  • the anti-CTLA4 antibodies are human antibodies.
  • the anti-CTLA4 antibodies are humanized antibodies and/or chimeric antibodies.
  • the activatable binding polypeptide comprises: a) an HVR-H1 comprising the amino acid sequence YSISSGYHWSWI (SEQ ID NO: 59) , an HVR-H2 comprising the amino acid sequence LARIDWDDDKYYSTSLKSRL (SEQ ID NO: 60) , and an HVR-H3 comprising the amino acid sequence ARSYVYFDY (SEQ ID NO: 61) ; and/or b) an HVR-L1 comprising the amino acid sequence RASQSVRGRFLA (SEQ ID NO: 62) , an HVR-L2 comprising the amino acid sequence DASNRATGI (SEQ ID NO: 63) , and an HVR-L3 comprising the amino acid sequence YCQQSSSWPPT (SEQ ID NO: 64) .
  • the activatable binding polypeptide comprises: a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 47; and/or b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 48.
  • the present disclosure relates to activatable binding polypeptides that bind to human CTLA4 when in active form (e.g., the activatable binding polypeptides are active after cleavage in the cleavable moiety (e.g., with one or more proteases) , but inactive prior to cleavage in the cleavable moiety (e.g., with one or more proteases) ) , and have at least one (e.g., at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, or all nine) of the following functional properties: (a) bind to human, cynomolgus monkey, mouse, rat, and/or dog CTLA4 with a K D of 500 nM or less; (b) have antagonist activity on human CTLA4; (c) do not bind to human PD-1, PD-L1, PD-L2, LAG3, TIM3, B7-H
  • the activatable binding polypeptides bind to human, cynomolgus monkey, mouse, rat, and/or dog CTLA4 with a K D of about 500 nM or more when in inactive form. In some embodiments, the activatable binding polypeptides bind to human, cynomolgus monkey, mouse, rat, and/or dog CTLA4 with a K D of about 500 nM or less when in active form (e.g., about 500 nM or less, about 450 nM or less, about 400 nM or less, about 350 nM or less, about 300 nM or less, about 250 nM or less, about 200 nM or less, about 150 nM or less, about 100 nM or less, about 90 nM or less, about 80 nM or less, about 70 nM or less, about 60 nM or less, about 50 nM or less, about 40 nM or less, about 30 nM or less, about 25
  • the activatable binding polypeptides bind to human, cynomolgus monkey, mouse, rat, and/or dog CTLA4 with a K D of about 350 nM or less when in active form. In some embodiments, the activatable binding polypeptides bind to human CTLA4 with a K D of about 100 nM or less when in active form. In some embodiments, the activatable binding polypeptides bind to human CTLA4 with a K D of about 50 nM or less when in active form. In some embodiments, the activatable binding polypeptides bind to human CTLA4 with a K D of about 10 nM or less when in active form.
  • Methods of measuring the K D of an activatable binding polypeptide may be carried out using any method known in the art, including for example, by surface plasmon resonance, an ELISA, isothermal titration calorimetry, a filter binding assay, an EMSA, etc.
  • the K D is measured by an ELISA (see e.g., Example 3 below) .
  • the activatable binding polypeptides do not have antagonist activity on human CTLA4 when in inactive form. In some embodiments, the activatable binding polypeptides have antagonist activity on human CTLA4 when in active form (e.g., induces ADCC effects (such as on Tregs) , activates PBMCs (such as by activating, inducing, and/or stimulating IL-2 and/or IFN ⁇ secretion) , bocks binding of human CTLA4 to human CD80 and/or human CD86, etc. ) .
  • ADCC effects such as on Tregs
  • PBMCs such as by activating, inducing, and/or stimulating IL-2 and/or IFN ⁇ secretion
  • the activatable binding polypeptides repress one or more activities of human CTLA4 when in active form (e.g., repress one or more activities of human CTLA4 when a cell (such as a human cell) expressing human CTLA4 is contacted by an activated activatable binding polypeptide) .
  • the activatable binding polypeptides when in inactive form, are not cross-reactive with monkey (e.g., cynomolgus monkey) , mouse, rat, and/or dog CTLA4. In some embodiments, when in active form, the activatable binding polypeptides are cross-reactive with monkey (e.g., cynomolgus monkey) , mouse, rat, and/or dog CTLA4. In some embodiments, when in active form, the activatable binding polypeptides are cross-reactive with monkey CTLA4. In some embodiments, when in active form, the activatable binding polypeptides are cross-reactive with mouse CTLA4.
  • the activatable binding polypeptides when in active form, are cross-reactive with rat CTLA4. In some embodiments, when in active form, the activatable binding polypeptides are cross-reactive with dog CTLA4. In some embodiments, when in active form, the activatable binding polypeptides are cross reactive with monkey and mouse CTLA4; monkey and rat CTLA4; monkey and dog CTLA4; mouse and rat CTLA4; mouse and dog CTLA4; rat and dog CTLA4; monkey, mouse, and rat CTLA4; monkey, mouse, and dog CTLA4; monkey, rat, and dog CTLA4; mouse, rat, and dog CTLA4; or monkey, mouse, rat, and dog CTLA4.
  • the activatable binding polypeptides when in active form, are cross-reactive at about 350 nM (e.g., at about 1nM, at about 10nM, at about 25nM, at about 50nM, at about 75nM, at about 100nM, at about 150 nM, at about 200 nM, at about 250 nM, at about 300 nM, at about 350 nM) .
  • Methods of measuring cross-reactivity are known in the art, including, without limitation, surface plasmon resonance, an ELISA, isothermal titration calorimetry, a filter binding assay, an EMSA, etc.
  • the activatable binding polypeptides do not induce ADCC effects (e.g., on human cells such as Tregs) when in inactive form.
  • the activatable binding polypeptides have reduced ADCC effects (e.g., on human cells such as Tregs) when in inactive form as compared to a control binding polypeptide (e.g., a parental antibody lacking the first peptide (FP) and cleavable moiety (CM) ) .
  • the activatable antibodies induce ADCC effects (e.g., on human cells such as Tregs) when in active form.
  • the activatable binding polypeptides when in inactive form, induce ADCC effects by less than about 10% (e.g., induce ADCC by less than about 10%, less than about 5%, less than about 1%, etc. ) relative to a control (e.g., a parental antibody lacking the first peptide (FP) and cleavable moiety (CM) ) .
  • a control e.g., a parental antibody lacking the first peptide (FP) and cleavable moiety (CM)
  • the activatable binding polypeptides when in active form, induce ADCC effects by more than about 10% (e.g., induce ADCC by more than about 10%, more than about 15%, more than about 20%, more than about 25%, more than about 30%, more than about 35%, more than about 40%, etc. ) relative to a control (e.g., an isotype control) .
  • a control e.g., an isotype control
  • the activatable binding polypeptides are capable of inhibiting tumor cell growth and/or proliferation.
  • the tumor cell growth and/or proliferation is inhibited by at least about 5% (e.g., at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 99%) when contacted with the activatable binding polypeptides relative to corresponding tumor cells not contacted with the activatable binding polypeptides (or relative to corresponding tumor cells contacted with an isotype control antibody) .
  • the activatable binding polypeptides are capable of reducing tumor volume in a subject when the subject is administered the activatable binding polypeptides. In some embodiments, the activatable binding polypeptides are capable of reducing tumor volume in a subject by at least about 5% (e.g., at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 99%) relative to the initial tumor volume in the subject (e.g., prior to administration of the activatable binding polypeptides; as compared to a corresponding tumor in a subject administered an isotype control antibody) .
  • Methods of monitoring tumor cell growth/proliferation, tumor volume, and/or tumor inhibition are known in the art, including, for example, via the methods described in Example 4 below.
  • the activatable binding polypeptides have therapeutic effect on a cancer. In some embodiments, the activatable binding polypeptides reduce one or more signs or symptoms of a cancer. In some embodiments, a subject suffering from a cancer goes into partial or complete remission when administered the activatable binding polypeptides.
  • the present disclosure provides isolated activatable binding polypeptides that, when in active form, compete or cross-compete for binding to human CTLA4 with an antibody comprising: a) an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 59; an HVR-H2 comprising the amino acid sequence of SEQ ID NO: 60; and an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 61; and/or b) an HVR-L1 comprising the amino acid sequence of SEQ ID NO: 62; an HVR-L2 comprising the amino acid sequence of SEQ ID NO: 63; and an HVR-L3 comprising the amino acid sequence of SEQ ID NO: 54.
  • the present disclosure provides isolated activatable binding polypeptides that, when in active form, compete or cross-compete for binding to human CTLA4 with an antibody comprising: a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 47; and/or b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 48.
  • the ability of an activatable binding polypeptide to compete or cross-compete for binding with an antibody can be determined using standard binding assays known in the art, such as BIAcore analysis, ELISA assays, or flow cytometry.
  • the activatable binding polypeptides (when in inactive form) do not inhibit the binding between CTLA4 and one or more of its binding partners (e.g., human CTLA4 and human CD80, human CTLA4 and human CD86) . In some embodiments, the activatable binding polypeptides (when in active form) inhibit the binding between CTLA4 and one or more of its binding partners (e.g., human CTLA4 and human CD80, human CTLA4 and human CD86) . In some embodiments, the activatable binding polypeptides inhibit the binding between CTLA4 and its ligand in vitro.
  • the activatable binding polypeptides have a half maximal inhibitory concentration (IC 50 ) of about 500 nM or less (e.g., about 500 nM or less, about 400nM or less, about 300nM or less, about 200nM or less, about 100nM or less, about 50nM or less, about 25nM or less, about 10nM or less, about 1nM or less, etc. ) for inhibiting binding of CTLA4 to CD80 and/or CD86.
  • the activatable binding polypeptides have a half maximal inhibitory concentration (IC 50 ) of about 100 nM or less for inhibiting binding of CTLA4 to CD80 and/or CD86.
  • the activatable binding polypeptides completely inhibit binding of human CTLA4 to CD80 and/or CD86 when provided at a concentration of about 100 nM or greater (e.g., about 100nM or greater, about 500nM or greater, about 1 ⁇ M or greater, about 10 ⁇ M or greater, etc. ) .
  • the term “complete inhibiting” or “completely inhibits” refers to the activatable binding polypeptide’s ability to reduce binding between a first protein and a second protein by at least about 80% (e.g., at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, etc. ) .
  • Methods of measuring the ability of an a polypeptide to inhibit binding of a first protein e.g., human CTLA4
  • a second protein e.g., human CD80 or human CD86
  • the present disclosure relates to activatable binding polypeptides (i.e., activatable antibodies) that bind to human CD137, including activatable anti-CD137 antibodies, antigen binding fragments of the activatable anti-CD137 antibodies, and/or derivatives of the activatable anti-CD137 antibodies.
  • activatable binding polypeptides i.e., activatable antibodies
  • human CD137 including activatable anti-CD137 antibodies, antigen binding fragments of the activatable anti-CD137 antibodies, and/or derivatives of the activatable anti-CD137 antibodies.
  • the activatable antibody comprises: (a) a polypeptide comprising, from N-terminus to C-terminus, a masking moiety (MM) , a cleavable moiety (CM) , and a target binding moiety (TBM) , where the MM comprises an amino acid sequence according to Formula (I) : X m CX n CZ o (SEQ ID NO: 1) , where m is from 3-10, n is from 3-10, and o is from 1-10, where each X is independently an amino acid selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, and Y, and wherein each Z is independently an amino acid selected from the group consisting of D, A, Y, S, T, N, I, L, F, V, H, and P; where the CM comprises at least a first cleavage site (e.g.,
  • the MM inhibits the binding of the activatable antibody to human CD137 when the CM is not cleaved.
  • the activatable antibody is capable of binding to human CD137 when the CM is cleaved.
  • the MM comprises an amino acid sequence selected from SEQ ID NOS: 79-85.
  • the activatable binding polypeptides comprise any of the anti-CD137 antibodies described herein, including antibodies described with reference to specific amino acid sequences of HVRs, variable regions (VL, VH) , and/or light and heavy chains (e.g., IgG1, IgG2, IgG4) .
  • the anti-CD137 antibodies are human antibodies.
  • the anti-CD137 antibodies are humanized antibodies and/or chimeric antibodies.
  • the activatable binding polypeptide comprises: a) an HVR-H1 comprising the amino acid sequence FSLSTGGVGVGWI (SEQ ID NO: 65) , an HVR-H2 comprising the amino acid sequence LALIDWADDKYYSPSLKSRL (SEQ ID NO: 66) , and an HVR-H3 comprising the amino acid sequence ARGGSDTVIGDWFAY (SEQ ID NO: 67) ; and/or b) an HVR-L1 comprising the amino acid sequence RASQSIGSYLA (SEQ ID NO: 68) , an HVR-L2 comprising the amino acid sequence DASNLETGV (SEQ ID NO: 69) , and an HVR-L3 comprising the amino acid sequence YCQQGYYLWT (SEQ ID NO: 70) .
  • the activatable binding polypeptide comprises: a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 49; and/or b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 50.
  • the present disclosure relates to activatable binding polypeptides that bind to human CD137 when in active form (e.g., the activatable binding polypeptides are active after cleavage in the cleavable moiety (e.g., with one or more proteases) , but inactive prior to cleavage in the cleavable moiety (e.g., with one or more proteases) ) and have at least one (e.g., at least one, at least two, at least three, at least four, at least five, at least six, at least seven, or all eight) of the following functional properties: (a) bind to human CD137 with a K D of 500 nM or less; (b) have agonist activity on human CD137; (c) do not bind to human OX40, CD40, GITR and/or CD27 receptor at concentration up to 1000 nM; (d) are cross-reactive with monkey, mouse, rat, and/or dog CD137; (e) do
  • the activatable binding polypeptides disclosed herein can also inhibit, e.g., completely inhibit, the binding between CD137 and its ligand CD137L. Also provided herein are one or more activatable binding polypeptides anti-CD137 antibodies or antigen-binding fragments that cross-compete for binding to human CD137 with one or more of the CD137-targeting activatable binding polypeptides and/or anti-CD137 antibodies described herein.
  • the activatable binding polypeptides (when in inactive form) bind to human CD137 with a K D of about 500 nM or more. In some embodiments, the activatable binding polypeptides (when in active form) bind to human CD137 with a K D of about 500 nM or less (e.g., about 500 nM or less, about 400 nM or less, about 300 nM or less, about 200 nM or less, about 150 nM or less, about 100 nM or less, about 90 nM or less, about 80 nM or less, about 75 nM or less, about 70 nM or less, about 60 nM or less, about 50 nM or less, about 40 nM or less, about 30 nM or less, about 25 nM or less, about 20 nM or less, about 10 nM or less, about 1 nM or less, about 0.1 nM or less, etc.
  • 500 nM or less e.g., about 500 n
  • the activatable binding polypeptides bind to human CD137 with a K D of about 100 nM or less. In some embodiments, the activatable binding polypeptides bind to human CD137 with a K D of about 50 nM or less.
  • Methods of measuring the K D of an activatable binding polypeptide may be carried out using any method known in the art, including for example, by surface plasmon resonance, an ELISA, isothermal titration calorimetry, a filter binding assay, an EMSA, etc. In some embodiments, the K D is measured by an ELISA (see e.g., Example 5 below) .
  • the activatable binding polypeptides (when in active form) described herein have agonist activity on human CD137.
  • the activatable binding polypeptides induce one or more (e.g., one or more, two or more, three or more, etc. ) activities of human CD137 when a cell (e.g., a human cell) expressing human CD137 is contacted by the (active) activatable binding polypeptide.
  • CD137 activities are known in the art and may include, without limitation, induction of NF- ⁇ B-dependent transcription, induction of T cell proliferation, prolonging T cell survival, co-stimulation of activated T cells, induction of cytokine secretion (such as IL-2) , and induction of monocyte activation .
  • the one or more CD137 activities is not CD137 binding to its ligand.
  • Methods of measuring CD137 activity e.g., the induction of NF- ⁇ B-dependent transcription and/or T cell proliferation, etc.
  • the activatable binding polypeptides increase NF- ⁇ B dependent transcription in cells (e.g., human cells) expressing human CD137.
  • NF- ⁇ B dependent transcription is increased by about 10%or more, about 20%or more, about 30%or more, about 40%or more, about 50%or more, about 60%or more, about 70%or more, about 80%or more, about 90%or more, or about 99%or more in cells (e.g., human cells) expressing CD137 contacted with the (active) activatable binding polypeptide, relative to a corresponding cell not contacted with the activatable binding polypeptide (e.g., a corresponding cell contacted with an isotype control antibody) , or contacted with the activatable binding polypeptide when in inactive form.
  • cells e.g., human cells
  • the activatable binding polypeptide e.g., a corresponding cell contacted with an isotype control antibody
  • NF- ⁇ B dependent transcription is increased by about 2-fold, 3-fold, 4-folr, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 100-fold, 1000-fold or more in cells (e.g., human cells) expressing CD137 contacted with the activatable binding polypeptide (when in active form) , relative to a corresponding cell not contacted with the activatable binding polypeptide (e.g., a corresponding cell contacted with an isotype control antibody) , or contacted with the activatable binding polypeptide when in inactive form.
  • cells e.g., human cells
  • the activatable binding polypeptide when in active form
  • a corresponding cell not contacted with the activatable binding polypeptide e.g., a corresponding cell contacted with an isotype control antibody
  • the activatable binding polypeptides are not cross-reactive with monkey (e.g., cynomolgus monkey) , mouse, rat, and/or dog CD137. In some embodiments, the activatable binding polypeptides (when in active form) are cross-reactive with monkey (e.g., cynomolgus monkey) , mouse, rat, and/or dog CD137. In some embodiments, the activatable binding polypeptides are cross-reactive with monkey CD137. In some embodiments, the activatable binding polypeptides are cross-reactive with mouse CD137. In some embodiments, the activatable binding polypeptides are cross-reactive with rat CD137.
  • the activatable binding polypeptides are cross-reactive with dog CD137.
  • the activatable binding polypeptides are cross reactive with monkey and mouse CD137; monkey and rat CD137; monkey and dog CD137; mouse and rat CD137; mouse and dog CD137; rat and dog CD137; monkey, mouse, and rat CD137; monkey, mouse, and dog CD137; monkey, rat, and dog CD137; mouse, rat, and dog CD137; or monkey, mouse, rat, and dog CD137.
  • the activatable binding polypeptides are cross-reactive at about 100 nM (e.g., at about 1nM, at about 10nM, at about 25nM, at about 50nM, at about 75nM, at about 100nM) .
  • Methods of measuring cross-reactivity are known in the art, including, without limitation, surface plasmon resonance, an ELISA, isothermal titration calorimetry, a filter binding assay, an EMSA, etc.
  • the activatable binding polypeptides do not induce ADCC effects. Methods of measuring ADCC effects are known in the art. In some embodiments, the activatable binding polypeptides (when in active form or inactive form) do not ADCC effects by more than about 10% (do not induce ADCC by more than about 10%, more than about 5%, more than about 1%, more than about 0.1%, more than about 0.01%) relative to a control.
  • the activatable binding polypeptides are capable of inhibiting tumor cell growth and/or proliferation.
  • the tumor cell growth and/or proliferation is inhibited by at least about 5% (e.g., at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 99%) when contacted with the activatable binding polypeptides relative to corresponding tumor cells not contacted with the activatable binding polypeptides (or relative to corresponding tumor cells contacted with an isotype control antibody) .
  • the activatable binding polypeptides are capable of reducing tumor volume in a subject when the subject is administered the activatable binding polypeptides. In some embodiments, the activatable binding polypeptides are capable of reducing tumor volume in a subject by at least about 5% (e.g., at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 99%) relative to the initial tumor volume in the subject (e.g., prior to administration of the activatable binding polypeptides; as compared to a corresponding tumor in a subject administered an isotype control antibody) .
  • Methods of monitoring tumor cell growth/proliferation, tumor volume, and/or tumor inhibition are known in the art.
  • the activatable binding polypeptides have therapeutic effect on a cancer. In some embodiments, the activatable binding polypeptides reduce one or more signs or symptoms of a cancer. In some embodiments, a subject suffering from a cancer goes into partial or complete remission when administered the activatable binding polypeptides.
  • the present disclosure provides isolated activatable binding polypeptides that, when in active form, compete or cross-compete for binding to human CD137 with an antibody comprising: a) an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 65; an HVR-H2 comprising the amino acid sequence of SEQ ID NO: 66; and an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 67; and/or b) an HVR-L1 comprising the amino acid sequence of SEQ ID NO: 68; an HVR-L2 comprising the amino acid sequence of SEQ ID NO: 69; and an HVR-L3 comprising the amino acid sequence of SEQ ID NO: 70.
  • the present disclosure provides isolated activatable binding polypeptides that, when in active form, compete or cross-compete for binding to human CD137 with an antibody comprising: a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 49; and/or b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 50.
  • the ability of an activatable binding polypeptide to compete or cross-compete for binding with an antibody can be determined using standard binding assays known in the art, such as BIAcore analysis, ELISA assays, or flow cytometry.
  • test activatable binding polypeptide when in active form
  • the test activatable binding polypeptide binds to a different epitope then the antibody.
  • the test activatable binding polypeptide binds to the same epitope, an overlapping epitope, or an epitope that is in close proximity to the epitope bound by the antibody.
  • This experiment can be performed using various methods, such as ELISA, RIA, FACS or surface plasmon resonance.
  • the activatable binding polypeptides (when in inactive form) do not inhibit the binding between CD137 and its ligand (e.g., human CD137 and human CD137L) . In some embodiments, the activatable binding polypeptides (when in active form) inhibit the binding between CD137 and its ligand (e.g., human CD137 and human CD137L) . In some embodiments, the activatable binding polypeptides inhibit the binding between CD137 and its ligand in vitro.
  • the activatable binding polypeptide (when in active form) has a half maximal inhibitory concentration (IC 50 ) of about 500 nM or less (e.g., about 500 nM or less, about 400nM or less, about 300nM or less, about 200nM or less, about 100nM or less, about 50nM or less, about 25nM or less, about 10nM or less, about 1nM or less, etc. ) for inhibiting binding of CD137 to its ligand. In some embodiments, the activatable binding polypeptide has a half maximal inhibitory concentration (IC 50 ) of about 100 nM or less for inhibiting binding of CD137 to its ligand.
  • IC 50 half maximal inhibitory concentration
  • the activatable binding polypeptide completely inhibits binding of human CD137 to its ligand when provided at a concentration of about 100 nM or greater (e.g., about 100nM or greater, about 500nM or greater, about 1 ⁇ M or greater, about 10 ⁇ M or greater, etc. ) .
  • concentration of about 100 nM or greater e.g., about 100nM or greater, about 500nM or greater, about 1 ⁇ M or greater, about 10 ⁇ M or greater, etc.
  • Methods of measuring the ability of a polypeptide to inhibit binding of a first protein (e.g., CD137) and a second protein (e.g., CD137L) are known in the art, including, without limitation, via BIAcore analysis, ELISA assays, and flow cytometry.
  • the present disclosure relates to an activatable binding polypeptide comprising an antibody described herein (e.g., a CTLA4 or CD137 antibody described above) .
  • the antibodies described herein e.g., a CTLA4 or CD137 antibody
  • the antibodies described herein may be in any class, such as IgG, IgM, IgE, IgA, or IgD.
  • the antibodies described herein are in the IgG class, such as IgG1, IgG2, IgG3, or IgG4 subclass.
  • An antibody described herein e.g., a CTLA4 or CD137 antibody
  • An exemplary method for producing an antibody in a desired class or subclass comprises the steps of isolating a nucleic acid encoding a heavy chain of an antibody described herein (e.g., a CTLA4 or CD137 antibody) and a nucleic acid encoding a light chain of an antibody described herein (e.g., a CTLA4 or CD137 antibody) , isolating the sequence encoding the V H region, ligating the V H sequence to a sequence encoding a heavy chain constant region of the desired class or subclass, expressing the light chain gene and the heavy chain construct in a cell, and collecting the antibody.
  • the present disclosure relates to an activatable binding polypeptide comprising an antigen-binding fragment (e.g., an antigen binding fragment of an antibody described herein (e.g., a CTLA4 or CD137 antibody) ) .
  • an antigen-binding fragment e.g., an antigen binding fragment of an antibody described herein (e.g., a CTLA4 or CD137 antibody) .
  • the antigen-binding fragment may comprise any sequences of any of the antibodies described herein.
  • the antigen-binding fragment comprises the amino acid sequence of: (1) a light chain of an antibody described herein (e.g., a CTLA4 or CD137 antibody) ; (2) a heavy chain of an antibody described herein (e.g., a CTLA4 or CD137 antibody) ; (3) a variable region from the light chain of an antibody described herein (e.g., a CTLA4 or CD137 antibody) ; (4) a variable region from the heavy chain of an antibody described herein (e.g., a CTLA4 or CD137 antibody) ; (5) one or more HVRs (e.g., one, two, three, four, five, or six HVRs) of an antibody described herein (e.g., a CTLA4 or CD137 antibody) ; or (6) three HVRs from the light chain and three HVRs from the heavy chain of an antibody described herein (e.g., a CTLA
  • the present disclosure provides an antigen-binding fragment of an antibody comprising a heavy chain variable region comprising: an HVR-H1 comprising the amino acid sequence YSISSGYHWSWI (SEQ ID NO: 59) , an HVR-H2 comprising the amino acid sequence LARIDWDDDKYYSTSLKSRL (SEQ ID NO: 60) , and an HVR-H3 comprising the amino acid sequence ARSYVYFDY (SEQ ID NO: 61) ; and/or a light chain variable region comprising: an HVR-L1 comprising the amino acid sequence RASQSVRGRFLA (SEQ ID NO: 62) , an HVR-L2 comprising the amino acid sequence DASNRATGI (SEQ ID NO: 63) , and an HVR-L3 comprising the amino acid sequence YCQQSSSWPPT (SEQ ID NO: 64) .
  • the present disclosure provides an antigen-binding fragment of an antibody comprising: a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 47; and/or b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 48.
  • the present disclosure provides an antigen-binding fragment of an antibody comprising a heavy chain variable region comprising: an HVR-H1 comprising the amino acid sequence FSLSTGGVGVGWI (SEQ ID NO: 65) , an HVR-H2 comprising the amino acid sequence LALIDWADDKYYSPSLKSRL (SEQ ID NO: 66) , and an HVR-H3 comprising the amino acid sequence ARGGSDTVIGDWFAY (SEQ ID NO: 67) ; and/or a light chain variable region comprising: an HVR-L1 comprising the amino acid sequence RASQSIGSYLA (SEQ ID NO: 68) , an HVR-L2 comprising the amino acid sequence DASNLETGV (SEQ ID NO: 69) , and an HVR-L3 comprising the amino acid sequence YCQQGYYLWT (SEQ ID NO: 70) .
  • the present disclosure provides an antigen-binding fragment of an antibody comprising: a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 49; and/or b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 50.
  • the antigen-binding fragments of an antibody described herein include: (i) a Fab fragment, which is a monovalent fragment consisting of the V L , V H , C L and C H 1 domains; (ii) a F (ab′) 2 fragment, which is a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and C H 1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody; (v) a dAb fragment (Ward et al., (1989) Nature 341: 544-546) , which consists of a V H domain; (vi) an isolated CDR, and (vii) single chain antibody (scFv) , which is a polypeptide comprising a V L region of an antibody linked to a V
  • the present disclosure provides an activatable binding polypeptide comprising a derivative of an antibody described herein (e.g., a CTLA4 or CD137 antibody) .
  • the antibody derivative is derived from modifications of the amino acid sequences of the parent antibody while conserving the overall molecular structure of the parent antibody amino acid sequence.
  • Amino acid sequences of any regions of the parent antibody chains may be modified, such as framework regions, HVR regions, or constant regions. Types of modifications include substitutions, insertions, deletions, or combinations thereof, of one or more amino acids of the parent antibody.
  • the antibody derivative comprises a V L or V H region that is at least 65%, at least 75%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%identical to the amino acid sequence as set forth in any of SEQ ID NOS: 47-50.
  • the antibody derivative comprises an HVR-H1 amino acid sequence region that is at least 65%, at least 75%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%identical to an amino acid sequence as set forth in any of SEQ ID NOS: 59 or 65.
  • the antibody derivative comprises an HVR-H2 amino acid sequence region that is at least 65%, at least 75%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%identical to an amino acid sequence as set forth in any of SEQ ID NOS: 60 or 66.
  • the antibody derivative comprises an HVR-H3 amino acid sequence region that is at least 65%, at least 75%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%identical to an amino acid sequence as set forth in any of SEQ ID NOS: 61 or 67.
  • the antibody derivative comprises an HVR-L1 amino acid sequence region that is at least 65%, at least 75%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%identical to an amino acid sequence as set forth in any of SEQ ID NOS: 62 or 68.
  • the antibody derivative comprises an HVR-L2 amino acid sequence region that is at least 65%, at least 75%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%identical to an amino acid sequence as set forth in any of SEQ ID NOS: 63 or 69.
  • the antibody derivative comprises an HVR-L3 amino acid sequence region that is at least 65%, at least 75%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%identical to an amino acid sequence as set forth in any of SEQ ID NOS: 64 or 70.
  • the derivative comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 conservative or non-conservative substitutions, and/or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 additions and/or deletions to an amino acid sequence of an antibody described herein (e.g., a CTLA4 or CD137 antibody) .
  • an antibody described herein e.g., a CTLA4 or CD137 antibody
  • Amino acid substitutions encompass both conservative substitutions and non-conservative substitutions.
  • conservative amino acid substitution means a replacement of one amino acid with another amino acid where the two amino acids have similarity in certain physico-chemical properties such as polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.
  • substitutions typically may be made within each of the following groups: (a) nonpolar (hydrophobic) amino acids, such as alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine; (b) polar neutral amino acids, such as glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine; (c) positively charged (basic) amino acids, such as arginine, lysine, and histidine; and (d) negatively charged (acidic) amino acids, such as aspartic acid and glutamic acid.
  • nonpolar amino acids such as alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine
  • polar neutral amino acids such as glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine
  • the present disclosure provides an antibody derivative that contains the V H and V L HVR sequences of an illustrative antibody described herein (e.g., a CTLA4 or CD137 antibody) , yet contains framework sequences different from those of the illustrative antibody.
  • framework sequences can be obtained from public DNA databases or published references that include germline antibody gene sequences.
  • germline DNA sequences for human heavy and light chain variable region genes can be found in the Genbank database or in the “VBase” human germline sequence database (Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, U.S.
  • Framework sequences that may be used in constructing an antibody derivative include those that are structurally similar to the framework sequences used by illustrative antibodies of the disclosure
  • the HVR-H1, HVR-H2, and HVR-H3 sequences, and the HVR-L1, HVR-L2, and HVR-L3 sequences of an illustrative antibody can be grafted onto framework regions that have the identical sequence as that found in the germline immunoglobulin gene from which the framework sequence derive, or the HVR sequences can be grafted onto framework regions that contain one or more mutations as compared to the germline sequences.
  • the antibody derivative is a chimeric antibody which comprises an amino acid sequence of an illustrative antibody described herein (e.g., a CTLA4 or CD137 antibody) .
  • an illustrative antibody described herein e.g., a CTLA4 or CD137 antibody
  • one or more HVRs from one or more illustrative antibodies are combined with HVRs from an antibody from a non-human animal, such as mouse or rat.
  • all of the HVRs of the chimeric antibody are derived from one or more illustrative antibodies.
  • the chimeric antibody comprises one, two, or three HVRs from the heavy chain variable region and/or one, two, or three HVRs from the light chain variable region of an illustrative antibody. Chimeric antibodies can be generated using conventional methods known in the art.
  • Another type of modification is to mutate amino acid residues within the HVR regions of the V H and/or V L chain.
  • Site-directed mutagenesis or PCR-mediated mutagenesis can be performed to introduce the mutation (s) and the effect on antibody binding, or other functional property of interest, can be evaluated in in vitro or in vivo assays known in the art. Typically, conservative substitutions are introduced.
  • the mutations may be amino acid additions and/or deletions. Moreover, typically no more than one, two, three, four or five residues within an HVR region are altered.
  • the antibody derivative comprises 1, 2, 3, or 4 amino acid substitutions in the heavy chain HVRs and/or in the light chain HVRs.
  • the amino acid substitution is to change one or more cysteines in an antibody to another residue, such as, without limitation, alanine or serine.
  • the cysteine may be a canonical or non-canonical cysteine.
  • the antibody derivative has 1, 2, 3, or 4 conservative amino acid substitutions in the heavy chain HVR regions relative to the amino acid sequences of an illustrative antibody.
  • Modifications may also be made to the framework residues within the V H and/or V L regions. Typically, such framework variants are made to decrease the immunogenicity of the antibody.
  • One approach is to “back mutate” one or more framework residues to the corresponding germline sequence.
  • An antibody that has undergone somatic mutation may contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived. To return the framework region sequences to their germline configuration, the somatic mutations can be “back mutated” to the germline sequence by, for example, site-directed mutagenesis or PCR-mediated mutagenesis.
  • modifications may also be made within the Fc region of an illustrative antibody, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
  • the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased. This approach is described further in U.S. Pat. No. 5,677,425.
  • the number of cysteine residues in the hinge region of CH1 is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
  • the Fc hinge region of an antibody is mutated to decrease the biological half-life of the antibody.
  • an antibody of the present disclosure may be modified to alter its potential glycosylation site or pattern in accordance with routine experimentation known in the art.
  • the present disclosure provides a derivative of an antibody described herein (e.g., a CTLA4 or CD137 antibody) that contains at least one mutation in a variable region of a light chain or heavy chain that changes the pattern of glycosylation in the variable region.
  • a derivative of an antibody described herein e.g., a CTLA4 or CD137 antibody
  • Such an antibody derivative may have an increased affinity and/or a modified specificity for binding an antigen.
  • the mutations may add a novel glycosylation site in the V region, change the location of one or more V region glycosylation site (s) , or remove a pre-existing V region glycosylation site.
  • the present disclosure provides a derivative of an antibody described herein (e.g., a CTLA4 or CD137 antibody) having a potential N-linked glycosylation site at asparagine in the heavy chain variable region, wherein the potential N-linked glycosylation site in one heavy chain variable region is removed.
  • the present disclosure provides a derivative of an antibody described herein (e.g., a CTLA4 or CD137 antibody) having a potential N-linked glycosylation site at asparagine in the heavy chain variable region, wherein the potential N-linked glycosylation site in both heavy chain variable regions is removed.
  • a “single-chain antibody” consists of a single polypeptide chain comprising a V L domain linked to a V H domain wherein V L domain and V H domain are paired to form a monovalent molecule.
  • Single chain antibody can be prepared according to method known in the art (see e.g., Bird et al., (1988) Science 242: 423-426 and Huston et al., (1988) Proc. Natl. Acad. Sci. USA 85: 5879-5883) .
  • a “diabody” consists of two chains, each chain comprising a heavy chain variable region connected to a light chain variable region on the same polypeptide chain connected by a short peptide linker, wherein the two regions on the same chain do not pair with each other but with complementary domains on the other chain to form a bispecific molecule.
  • Methods of preparing diabodies are known in the art (see e.g., Holliger P. et al., (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448, and Poljak R.J. et al., (1994) Structure 2: 1121-1123) .
  • Domain antibodies are small functional binding units of antibodies, corresponding to the variable regions of either the heavy or light chains of antibodies. Domain antibodies are well expressed in bacterial, yeast, and mammalian cell systems. Further details of domain antibodies and methods of production thereof are known in the art (see e.g., U.S. Pat. Nos. 6,291,158; 6,582,915; 6,593,081; 6,172,197; 6,696,245; European Patents 0368684 &0616640; WO05/035572, WO04/101790, WO04/081026, WO04/058821, WO04/003019 and WO03/002609) . Nanobodies are derived from the heavy chains of an antibody.
  • a nanobody typically comprises a single variable domain and two constant domains (CH2 and CH3) and retains antigen-binding capacity of the original antibody.
  • Nanobodies can be prepared by methods known in the art (see e.g., U.S. Pat. No. 6,765,087, U.S. Pat. No. 6,838,254, WO 06/079372) .
  • Unibodies consist of one light chain and one heavy chain of an IgG4 antibody. Unibodies may be made by the removal of the hinge region of IgG4 antibodies. Further details of unibodies and methods of preparing them may be found in WO2007/059782.
  • the present disclosure provides a composition comprising one or more of the polypeptides (e.g., activatable binding polypeptides) described herein.
  • the composition is a pharmaceutical composition comprising a polypeptide (e.g., an activatable binding polypeptide) and a pharmaceutically acceptable carrier.
  • the compositions can be prepared by conventional methods known in the art.
  • pharmaceutically acceptable carrier refers to any inactive substance that is suitable for use in a formulation for the delivery of a polypeptide (e.g., an activatable binding polypeptide) .
  • a carrier may be an anti-adherent, binder, coating, disintegrant, filler or diluent, preservative (such as antioxidant, antibacterial, or antifungal agent) , sweetener, absorption delaying agent, wetting agent, emulsifying agent, buffer, and the like.
  • Suitable pharmaceutically acceptable carriers include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like) dextrose, vegetable oils (such as olive oil) , saline, buffer, buffered saline, and isotonic agents such as sugars, polyalcohols, sorbitol, and sodium chloride.
  • compositions may be in any suitable forms, such as liquid, semi-solid, and solid dosage forms.
  • liquid dosage forms include solution (e.g., injectable and infusible solutions) , microemulsion, liposome, dispersion, or suspension.
  • solid dosage forms include tablet, pill, capsule, microcapsule, and powder.
  • a particular form of the composition suitable for delivering a polypeptide is a sterile liquid, such as a solution, suspension, or dispersion, for injection or infusion.
  • Sterile solutions can be prepared by incorporating the polypeptide (e.g., an activatable binding polypeptide) in the required amount in an appropriate carrier, followed by sterilization microfiltration.
  • Dispersions may be prepared by incorporating the polypeptide (e.g., an activatable binding polypeptide) into a sterile vehicle that contains a basic dispersion medium and other carriers.
  • a sterile vehicle that contains a basic dispersion medium and other carriers.
  • methods of preparation include vacuum drying and freeze-drying (lyophilization) to yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the various dosage forms of the compositions can be prepared by conventional techniques known in the art.
  • the relative amount of a polypeptide (e.g., an activatable binding polypeptide) included in the composition will vary depending upon a number of factors, such as the specific polypeptide and carriers used, dosage form, and desired release and pharmacodynamic characteristics.
  • the amount of a polypeptide (e.g., an activatable binding polypeptide) in a single dosage form will generally be that amount which produces a therapeutic effect, but may also be a lesser amount. Generally, this amount will range from about 0.01 percent to about 99 percent, from about 0.1 percent to about 70 percent, or from about 1 percent to about 30 percent relative to the total weight of the dosage form.
  • one or more additional therapeutic agents may be included in the composition.
  • additional therapeutic agents are described herein below.
  • the suitable amount of the additional therapeutic agent to be included in the composition can be readily selected by a person skilled in the art, and will vary depending on a number of factors, such as the particular agent and carriers used, dosage form, and desired release and pharmacodynamic characteristics.
  • the amount of the additional therapeutic agent included in a single dosage form will generally be that amount of the agent which produces a therapeutic effect, but may be a lesser amount as well.
  • any of the polypeptides (e.g., activatable binding polypeptides) and/or compositions (e.g., pharmaceutical compositions) described herein may be used in the preparation of a medicament (e.g., a medicament for use in treating or delaying progression of cancer in a subject in need thereof) .
  • Polypeptides e.g., activatable binding polypeptides
  • pharmaceutical compositions thereof provided by the present disclosure are useful for therapeutic, diagnostic, or other purposes, such as modulating an immune response, treating cancer, enhancing efficacy of other cancer therapy, enhancing vaccine efficacy, or treating autoimmune diseases.
  • the present disclosure provides methods of using the polypeptides (e.g., activatable binding polypeptides) or pharmaceutical compositions thereof.
  • the present disclosure provides a method of treating a disorder in a mammal, which comprises administering to the mammal in need of treatment an effective amount of a polypeptide (e.g., an activatable binding polypeptide) or composition thereof provided by the present disclosure.
  • the polypeptide is an activatable binding polypeptide that binds CTLA4 (e.g., human CTLA4) or CD137 (e.g., human CD137) when in active form.
  • CTLA4 e.g., human CTLA4
  • CD137 e.g., human CD137
  • the mammal is a human.
  • the disorder is a cancer.
  • cancers may be treated or prevented with a method, use, or medicament provided by the present disclosure.
  • lung cancers such as bronchogenic carcinoma (e.g., squamous cell carcinoma, small cell carcinoma, large cell carcinoma, and adenocarcinoma) , alveolar cell carcinoma, bronchial adenoma, chondromatous hamartoma (noncancerous) , and sarcoma (cancerous) ; heart cancer such as myxoma, fibromas, and rhabdomyomas; bone cancers such as osteochondromas, condromas, chondroblastomas, chondromyxoid fibromas, osteoid osteomas, giant cell tumors, chondrosarcoma, multiple myeloma, osteosarcoma, fibrosarcomas, malignant fibrous histiocytomas, Ewing's tumor (Ewing's s)
  • bronchogenic carcinoma e
  • the present disclosure provides a method of enhancing an immune response in a mammal, which comprises administering to the mammal an effective amount of a polypeptide (e.g., an activatable binding polypeptide) or composition thereof provided by the present disclosure.
  • a polypeptide e.g., an activatable binding polypeptide
  • the polypeptide is an activatable binding polypeptide that binds CTLA4 (e.g., human CTLA4) or CD137 (e.g., human CD137)
  • CTLA4 e.g., human CTLA4
  • CD137 e.g., human CD137
  • the term “enhancing immune response” or its grammatical variations means stimulating, evoking, increasing, improving, or augmenting any response of a mammal's immune system.
  • the immune response may be a cellular response (i.e.
  • cytotoxic T lymphocyte mediated such as cytotoxic T lymphocyte mediated
  • a humoral response i.e. antibody mediated
  • enhancement of immune response include activation of PBMCs and/or T cells (including increasing secretion of one or more cytokines such as IL-2 and/or IFN ⁇ ) .
  • the enhancement of immune response can be assessed using a number of in vitro or in vivo measurements known to those skilled in the art, including, but not limited to, cytotoxic T lymphocyte assays, release of cytokines, regression of tumors, survival of tumor bearing animals, antibody production, immune cell proliferation, expression of cell surface markers, and cytotoxicity.
  • methods of the present disclosure enhance the immune response by a mammal when compared to the immune response by an untreated mammal or a mammal not treated using the recited methods.
  • the polypeptides may be administered alone as monotherapy, or administered in combination with one or more additional therapeutic agents or therapies.
  • the present disclosure provides a combination therapy, which comprises a polypeptide (e.g., an activatable binding polypeptide) in combination with one or more additional therapies or therapeutic agents for separate, sequential or simultaneous administration.
  • additional therapeutic agent may refer to any therapeutic agent other than a polypeptide (e.g., an activatable binding polypeptide) provided by the disclosure.
  • the present disclosure provides a combination therapy for treating cancer in a mammal, which comprises administering to the mammal an effective amount of a polypeptide (e.g., an activatable binding polypeptide) provided herein in combination with one or more additional therapeutic agents.
  • a polypeptide e.g., an activatable binding polypeptide
  • the mammal is a human.
  • cancer therapeutic agents may be used in combination with a polypeptide (e.g., an activatable binding polypeptide) provided by the present disclosure.
  • a polypeptide e.g., an activatable binding polypeptide
  • One of ordinary skill in the art will recognize the presence and development of other cancer therapies which can be used in combination with the methods and polypeptides of the present disclosure, and will not be restricted to those forms of therapy set forth herein.
  • additional therapeutic agents that may be used in the combination therapy for treating cancer include (1) chemotherapeutic agents, (2) immunotherapeutic agents, and (3) hormone therapeutic agents.
  • the additional therapeutic is a viral gene therapy, an immune checkpoint inhibitor, a target therapy, a radiation therapies, and/or a chemotherapeutic.
  • chemotherapeutic agent refers to a chemical or biological substance that can cause death of cancer cells, or interfere with growth, division, repair, and/or function of cancer cells.
  • chemotherapeutic agents include those that are disclosed in WO 2006/129163, and US 20060153808, the disclosures of which are incorporated herein by reference.
  • chemotherapeutic agents include: (1) alkylating agents, such as chlorambucil (LEUKERAN) , mcyclophosphamide (CYTOXAN) , ifosfamide (IFEX) , mechlorethamine hydrochloride (MUSTARGEN) , thiotepa (THIOPLEX) , streptozotocin (ZANOSAR) , carmustine (BICNU, GLIADEL WAFER) , lomustine (CEENU) , and dacarbazine (DTIC-DOME) ; (2) alkaloids or plant vinca alkaloids, including cytotoxic antibiotics, such as doxorubicin (ADRIAMYCIN) , epirubicin (ELLENCE, PHARMORUBICIN) , daunorubicin (CERUBIDINE, DAUNOXOME) , nemorubicin, idarubicin (IDAMYCIN PFS, ZAVEDOS
  • immunotherapeutic agents refers to a chemical or biological substance that can enhance an immune response of a mammal.
  • immunotherapeutic agents include: bacillus Calmette-Guerin (BCG) ; cytokines such as interferons; vaccines such as MyVax personalized immunotherapy, Onyvax-P, Oncophage, GRNVAC1, Favld, Provenge, GVAX, Lovaxin C, BiovaxID, GMXX, and NeuVax; and antibodies such as alemtuzumab (CAMPATH) , bevacizumab (AVASTIN) , cetuximab (ERBITUX) , gemtuzunab ozogamicin (MYLOTARG) , ibritumomab tiuxetan (ZEVALIN) , panitumumab (VECTIBIX) , rituximab (RITUXAN, MABTHERA) ,
  • BCG Bacill
  • hormone therapeutic agent refers to a chemical or biological substance that inhibits or eliminates the production of a hormone, or inhibits or counteracts the effect of a hormone on the growth and/or survival of cancerous cells.
  • agents suitable for the methods herein include those that are disclosed in US20070117809.
  • hormone therapeutic agents include tamoxifen (NOLVADEX) , toremifene (Fareston) , fulvestrant (FASLODEX) , anastrozole (ARIMIDEX) , exemestane (AROMASIN) , letrozole (FEMARA) , megestrol acetate (MEGACE) , goserelin (ZOLADEX) , and leuprolide (LUPRON) .
  • NOLVADEX tamoxifen
  • Fareston toremifene
  • FASLODEX fulvestrant
  • ARMIDEX anastrozole
  • AROMASIN exemestane
  • FTYASIN letrozole
  • MEGACE megestrol acetate
  • ZOLADEX goserelin
  • LUPRON leuprolide
  • binding molecules of this disclosure may also be used in combination with non-drug hormone therapies such as (1) surgical methods that remove all or part of the organs or glands which participate in the production of the hormone, such as the ovaries, the testicles, the adrenal gland, and the pituitary gland, and (2) radiation treatment, in which the organs or glands of the patient are subjected to radiation in an amount sufficient to inhibit or eliminate the production of the targeted hormone.
  • non-drug hormone therapies such as (1) surgical methods that remove all or part of the organs or glands which participate in the production of the hormone, such as the ovaries, the testicles, the adrenal gland, and the pituitary gland, and (2) radiation treatment, in which the organs or glands of the patient are subjected to radiation in an amount sufficient to inhibit or eliminate the production of the targeted hormone.
  • the additional therapeutic agent is one or more of pomalyst, revlimid, lenalidomide, pomalidomide, thalidomide, a DNA-alkylating platinum-containing derivative, cisplatin, 5-fluorouracil, cyclophosphamide, an anti-CD137 antibody, an anti-CTLA4 antibody, an anti-PD-1 antibody, an anti-PD-L1 antibody, an anti-CD20 antibody, an anti-CD40 antibody, an anti-DR5 antibody, an anti-CD1d antibody, an anti-TIM3 antibody, an anti-SLAMF7 antibody, an anti-KIR receptor antibody, an anti-OX40 antibody, an anti-HER2 antibody, an anti-ErbB-2 antibody, an anti-EGFR antibody, cetuximab, rituximab, trastuzumab, pembrolizumab, radiotherapy, single dose radiation, fractionated radiation, focal radiation, whole organ radiation, IL-12, IFN ⁇ , GM-CSF, a DNA-al
  • the combination therapy for treating cancer also encompasses the combination of a binding molecule with surgery to remove a tumor.
  • the binding molecule may be administered to the mammal before, during, or after the surgery.
  • the combination therapy for treating cancer also encompasses combinations of a polypeptide (e.g., an activatable binding polypeptide) with radiation therapy, such as ionizing (electromagnetic) radiotherapy (e.g., X-rays or gamma rays) and particle beam radiation therapy (e.g., high linear energy radiation) .
  • radiation therapy such as ionizing (electromagnetic) radiotherapy (e.g., X-rays or gamma rays) and particle beam radiation therapy (e.g., high linear energy radiation) .
  • the source of radiation can be external or internal to the mammal.
  • the polypeptide may be administered to the mammal before, during, or after the radiation therapy.
  • enteral route refers to the administration via any part of the gastrointestinal tract.
  • enteral routes include oral, mucosal, buccal, and rectal route, or intragastric route.
  • Parenteral route refers to a route of administration other than enteral route.
  • parenteral routes of administration examples include intravenous, intramuscular, intradermal, intraperitoneal, intratumor, intravesical, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, transtracheal, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal, subcutaneous, or topical administration.
  • the polypeptides (e.g., activatable binding polypeptides) and compositions of the present disclosure can be administered using any suitable method, such as by oral ingestion, nasogastric tube, gastrostomy tube, injection, infusion, implantable infusion pump, and osmotic pump.
  • the suitable route and method of administration may vary depending on a number of factors such as the specific polypeptide being used, the rate of absorption desired, specific formulation or dosage form used, type or severity of the disorder being treated, the specific site of action, and conditions of the patient, and can be readily selected by a person skilled in the art.
  • an “effective amount” of a binding molecule may refer to an amount that is effective for an intended therapeutic purpose.
  • an “effective amount” may be any amount that is effective in stimulating, evoking, increasing, improving, or augmenting any response of a mammal's immune system.
  • an “effective amount” may be any amount that is sufficient to cause any desirable or beneficial effect in the mammal being treated.
  • desirable or beneficial effects include inhibition of further growth or spread of cancer cells, death of cancer cells, inhibition of reoccurrence of cancer, reduction of pain associated with the cancer, or improved survival of the mammal.
  • the effective amount of a polypeptide (e.g., an activatable binding polypeptide) described herein may range from about 0.001 to about 500 mg/kg, or about 0.01 to about 100 mg/kg, of the body weight of the mammal.
  • the amount can be about 0.3 mg/kg, 1 mg/kg, 3 mg/kg, 5 mg/kg, 10 mg/kg, 50 mg/kg, or 100 mg/kg of body weight of the mammal.
  • the effective amount of a polypeptide (e.g., an activatable binding polypeptide) of the present disclosure is in the range of about 0.01-30 mg/kg of body weight of the mammal.
  • the effective amount of a polypeptide (e.g., an activatable binding polypeptide) of the present disclosure is in the range of about 0.05-15 mg/kg of body weight of the mammal.
  • the precise dosage level to be administered can be readily determined by a person skilled in the art and will depend on a number of factors, such as the type, and severity of the disorder to be treated, the particular polypeptide employed, the route of administration, the time of administration, the duration of the treatment, the particular additional therapy employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • a polypeptide (e.g., an activatable binding polypeptide) or composition thereof may be administered on multiple occasions. Intervals between single doses can be, for example, daily, weekly, monthly, every three months or yearly.
  • An exemplary treatment regimen entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every three months or once every three to six months.
  • Dosage regimens for a polypeptide (e.g., an activatable binding polypeptide) of the present disclosure may include 1 mg/kg body weight or 3 mg/kg body weight via intravenous administration, using one of the following dosing schedules: (i) every four weeks for six dosages, then every three months; (ii) every three weeks; (iii) 3 mg/kg body weight once followed by 1 mg/kg body weight every three weeks.
  • kits comprising a library of polynucleotides of the present disclosure.
  • the kit further comprises a package insert comprising instructions for expressing, modifying, screening, or otherwise using the library, e.g., to identify an activatable binding polypeptide of interest.
  • the kit further comprises one or more buffers, e.g., for storing, transferring, transfecting, or otherwise using one or more of the polynucleotides (e.g., synthetic polynucleotides) .
  • the kit further comprises one or more containers for storing one or more of the polynucleotides.
  • the kit further comprises one or more vectors, e.g., for transfection of a host cell with one or more of the polynucleotides.
  • kits comprising activatable binding polypeptides and/or compositions described herein.
  • the kit further comprises a package insert comprising instructions for use of the activatable binding polypeptides and/or compositions.
  • the kit further comprises one or more buffers, e.g., for storing, transferring, administering, or otherwise using the activatable binding polypeptides and/or compositions.
  • the kit further comprises one or more containers for storing or administering (e.g., syringes, etc. ) the activatable binding polypeptides and/or compositions.
  • Example 1 Methods of identifying self-blocking peptides for activatable binding polypeptides
  • the yeast library then underwent several rounds of FACS-based screening: first the yeast clones that have low binding to antigen were enriched, then the enriched yeast clones were treated with a protease to remove the N-terminal peptide, and the clones with high binding to antigen were selected (FIGS. 1 and 2) . After 4-5 rounds of sorting, the plasmids were extracted from these clones and the masking peptide sequences were confirmed through DNA sequencing.
  • a protease cleavage-mediated activation mechanism was integrated into the screening processes. This was to ensure that the discovered peptides not only masked antigen binding before activation, but no longer blocked antigen binding after protease cleavage. These were the prerequisites considered for qualifying as a good masking peptide for any activatable antibody.
  • the NHC codon encodes 12 amino acid residues (D, A, Y, S, T, N, I, L, F, V, H, and P) , and does not include unfavorable residues for manufacturing processes, such as methionine, tryptophan, or cysteine.
  • use of the NHC codon also dramatically reduced the theoretical peptide library size relative to an NNK (or NNS) codon, and therefore, enabled the construction of libraries with much better coverage. These libraries performed well when tested against different target antibodies.
  • CPLs constrained peptide libraries
  • the CPLs and the invariant cleavage peptide were fused to the N-terminus of light chain of the target antibody, in the form of either scFv or Fab, that is connected to the yeast surface displayed Aga2 protein.
  • the inclusion of the surrogate TEV protease recognition site was important in identifying the right type of masking peptide sequences, i.e, the antigen binding is blocked before protease cleavage, and antigen binding is enabled after protease cleavage.
  • the exmples described below demonstrated that the cleavage-activation mechanism of activatable antibodies initially shown in yeast was replicated in full IgG molecules expressed in malian cells.
  • a low copy number, CEN/ARS-based vector was used to express the target antibody (antibody TY21580, targeting human CTLA4) under the control of the inducible GAL1-10 promoter in the yeast S. cerevisiae.
  • the surface display of scFvs was achieved through the Aga2 protein fused at its C-terminus under the control of the GAL1 promoter, similar to previously published arrangements (Boder and Wittrup (1997) Nat Biotechnol 15 (6) : 553-7) .
  • Fabs their surface display was achieved through the Aga2 protein fused to the N-terminus of the heavy chain (fusion of VH and CH1) , under the control of the GAL1 promoter, while the light chain (fusion of VL and CL) was under the control of the GAL10 promoter.
  • the Fabs were displayed on the yeast surface through its association with the membrane anchored heavy chain.
  • the surface display of the Fab or scFv was verified by staining with antibodies recognizing the fused affinity tag, and the functionality of the Fabs or scFvs displayed on yeast was examined using biotinylated human CTLA4. Briefly, 48 hours after induction in galactose medium, yeast cells (1x10 ⁇ 6) were harvested, washed once with PBSA buffer, and then incubated with 10 nM of biotinylated antigen for 1 hour at room temperature. The yeast cells were then washed twice with PBSA buffer, and incubated with PE conjugated streptavidin (1: 500 dilution) (eBioscience #2-4317-87) for 30 minutes at 4°C. The yeast cells were then analyzed by flow cytometry. As shown in FIGS. 3A-B, both Fabs (FIG. 3A) and scFvs (FIG. 3B) targeting CTLA4 were successfully displayed on the yeast surface, and were both capable of binding strongly to their antigens.
  • Synthesized oligonucleotides encoding the CPLs were fused with the oligonucleotides encoding the cleavage peptides through 5 cycles of PCR.
  • the primers used (F-primer and R-primer) are listed in Table 3.
  • the compositions of PCR reactions were: 1X PrimeSTAR buffer, 2.5 mM dNTP, 100 ⁇ M of F-primer and R-primer each, and 100 ⁇ M each of template 1 (CPL oligonucleotide) and template 2 (oligonucleotide encoding the cleavage peptide) , and 2.5 U of PrimeSTAR HS DNA Polymerase.
  • the PCR program used was: a) 1 cycle of 96°C for 5 minutes; 2) 5 cycles of 96°C (15 sec) , 60°C (15 sec) , 72°C (6 sec) ; and 3) 1 cycle of 72 °C for 3 minutes.
  • Exonuclease I was used to digest the single-stranded DNA before purification of the PCR product through gel electrophoresis. The purified PCR product was then digested with BamHI and KpnI, and cloned into a bacterial filter vector digested with the same two restriction enzymes.
  • the CPL and the cleavage peptides were placed downstream of a bacterial secretion signal peptide, and upstream of a beta-lactamase lacking signal sequence.
  • the functional beta-lactamase selected on ampicillin plates, indicated in-frame fusions of CPLs and the cleavage peptides, thereby eliminating any out-of-frame errors (N-1 or N-2) introduced into the synthesized degenerate oligonucleotides.
  • N-1 or N-2 out-of-frame errors
  • some poorly folded sequences were also reduced from the pool.
  • the ligation product was transformed into electro-competent bacterial cells, and the diversity of CPL libraries was generally between 5x10 ⁇ 9 and 1x10 ⁇ 10. Sequencing of individual clones indicated that very high in-frame rate (in many cases, almost 100%) were achieved through this approach.
  • the plasmids were extracted from the bacterial libraries, and used as templates for PCR amplification of the DNA fragments encoding the CPLs and cleavage peptide.
  • the primers used (PL0009_F and BL1024_R) are listed in Table 3.
  • the amplified PCR fragments were purified through gel-electrophoresis, and together with a linearized plasmid that expressed the target antibody fused to Aga2, were transformed into electro-competent yeast cells.
  • the homologous sequences on both ends of the PCR fragments and the plasmids ensured efficient homologous recombination inside yeast cells.
  • the diversity of the constructed yeast libraries was generally between 1x10 ⁇ 9 to 2x10 ⁇ 9.
  • yeast cells induced in galactose medium were harvested, washed once with PBSA buffer, and then incubated with 10 nM (decreased to 1 nM in the later rounds) of biotinylated antigen for 1 hour at room temperature. The yeast cells were then washed twice with PBSA buffer, and incubated with PE conjugated streptavidin (1: 500 dilution) (eBioscience #2-4317-87) for 30 minutes at 4°C.
  • the yeast cells were adjusted to 2-3 OD/mL, and subject to sorting. As shown in FIG. 4, in round 1, 10 nM of biotinylated CTLA4-Fc was used, and the weak binders were enriched.
  • the yeast cells from round 1 after growth in glucose medium, were induced in galactose medium and treated with AcTEV protease (6U/OD cell) (Thermo Fisher Scientific #12575015) for 2 hours at 30°C, and the strong binders were purified. Starting from the 3 rd round of sorting, the concentration of the biotinylated CTLA4-Fc was reduced to 1 nM, and the weak binders were collected.
  • the selected CTLA4 activatable antibody clones either in scFv (FIG. 5A) or Fab (FIG. 5B) format, exhibited little binding to antigen in the presence of masking peptide.
  • binding to antigen was dramatically increased when the yeast cells were treated with TEV protease to remove the masking peptide.
  • the shuttle plasmids were extracted from the selected yeast clones (Generay #GK2002-200) , and transformed into competent E. coli cells. The plasmids were prepared, and the regions encoding the masking peptides were sequenced and aligned. As anticipated, these sequences could be separated into several groups, indicating clear enrichment through rounds of sorting. Four groups of masking peptide sequences, together with the invariant cleavage peptide sequences, are listed in Table 4.
  • the heavy and light chains were cloned into the mammalian expression vector pCDNA3.3 (Thermo Fisher Scientific, cat#K830001) separately, and the masking peptides and the invariant cleavage peptide were fused to the N-terminus of the light chain in the same manner as displayed on yeast surface.
  • the VH and VL sequences for the parental CTLA4 antibody (TY21580) are listed below (See also PCT International Application titled “Compositions Comprising Cross-reactive Anti-CTLA4 Antibodies, and Methods of Making and Using the Same” filed concurrently herewith under Attorney Docket No. 69540-2000540, incorporated herein by reference in its entirety) :
  • Anti-CTLA4 heavy chain variable region (SEQ ID NO: 47) :
  • Anti-CTLA4 light chain variable region (SEQ ID NO: 48) :
  • Pairs of plasmids were transiently transfected into HEK293F cells. After six days, the supernatants were harvested, cleared by centrifugation and filtration, and IgGs were purified with standard protein A affinity chromatography (MabSelect SuRe, GE Healthcare) . The IgGs were eluted and neutralized, and buffer exchanged into PB buffer (20 mM sodium phosphate, 150 mM NaCl, pH 7.0) . Protein concentrations were determined by UV-spectrophotometry, and IgG purity was analyzed under denaturing, reducing and non-reducing conditions by SDS-PAGE or SEC-HPLC.
  • the expression levels of the activatable antibodies in HEK293 cells were similar to their parental antibody, and their purification yields after protein A resin were also similar, suggesting that the presence of the masking and cleavage peptides do not have a negative impact on antibody expression in mammalian cells.
  • the ForteBio Octet RED96 system (Pall, USA) was used to quickly assess the efficiency of the masking peptides. Briefly, activatable antibodies (and their parent antibody, TY21580) were diluted to 30 ⁇ g/mL in KB buffer (PBS buffer supplemented with 0.02%Tween 20 and 0.1%BSA) , and captured by anti-Human IgG Capture (AHC) Biosensors (Pall, USA ) in parallel. The sensors were then allowed to associate with His-tagged CTLA4 protein (25 nM) for 300 seconds, and then dissociate in KB buffer for another 300 seconds.
  • KB buffer PBS buffer supplemented with 0.02%Tween 20 and 0.1%BSA
  • AHC anti-Human IgG Capture
  • association and dissociation curves were fitted to a 1: 1 Langmuir binding model using ForteBio Data Analysis 7.1 (Pall, USA) according to the manufacturer's guidelines.
  • FIGS. 6A-B the responses achieved with the activatable antibodies were significantly lower than that for the parent antibody, suggesting that masking peptides effectively blocked the binding of the antibody to its antigen.
  • TY22401 was less effective, consistent with the results from the ELISA assay discussed below.
  • Recombinant human CTLA4-Fc was diluted to 1 ⁇ g/mL in PBS and coated on a Maxisorp plate at 4°C overnight. Plates were blocked with PBS supplemented with 3%non-fat milk at 37°C for 1 hour. After washing, 100 ⁇ L of 3-fold serial dilutions of antibodies were added to each well. After incubation at 37°C for 1 hour, plates were washed four times, and 100 ⁇ L HRP conjugated anti-human IgG (Fab specific) (1: 6000 dilution) was added to each well. Plates were incubated at 37°C for 1 hour, washed four times, and then 50 ⁇ L TMB substrate solution was added to each well, and the plate was incubated at room temperature.
  • the purified activatable antibodies were treated with the proteases which recognize the cleavage sequences, and were then tested to determine whether removal of the masking peptide restored their activity.
  • 20 ⁇ g of TY22404 (0.5 mg/mL) was treated with 1 ⁇ g of recombinant human uPA (Acrobiosystems, #PLU-H5229) in reaction buffer (50 mM Tris-HCl, 0.01%Tween 20, pH 8.5) ; or TY22404 was treated with 5 or 10 units of recombinant human MMP-9 (BioVision, #7867-500) in reaction buffer (50 mM Tris, 150 mM NaCl, 5 mM CaCl 2 , 20 ⁇ M ZnCl 2 , pH 7.5) .
  • activatable antibodies For manufacturing purpose, it is critical that the discovered activatable antibodies have a good developability profile.
  • Several different tests were performed with purified activatable antibodies that were expressed in mammalian cells.
  • the activatable antibodies were adjusted to 1 mg/mL in 20 mM Histidine, pH 5.5, and antibody quality analysis was performed using analytical size-exclusion chromatography using a Waters 2695 with a Waters 2996 UV detector and aTSKgel g3000 SWXL column (300 mm ⁇ 7.8 mm) (Tosoh Bioscience) .
  • 10 ⁇ g of antibody was injected, and fractionation was performed at a flow rate of 0.5 mL/min in buffer (200 mM sodium phosphate at pH 7.0) .
  • activatable antibodies were concentrated to more than 150 mg/mL in 20 mM histidine, pH 5.5 (Table 8) . No activatable antibody precipitation was observed, and viscosity of the samples was quite manageable.
  • the concentrated activatable antibodies were then diluted to either 20 mg/mL or 1 mg/mL for analysis of high molecular weight (HMW) species. As shown in FIG. 10 and Table 8, no apparent increase of the HMW species was observed, suggesting that these activatable antibodies were very soluble and stable in the buffer tested, up to high concentrations.
  • HMW high molecular weight
  • the purified activatable antibodies (at 10 mg/mL in 20 mM histidine, pH 5.5) were titrated to 1 mg/mL with citric acid, and the pH was adjusted to 3.7 and held at room temperature for 30 and 60 minutes. Afterwards, the samples were neutralized to pH 7.0 with 1 M Tris-base.
  • the masking efficiency of the activatable antibodies was measured with ForteBio, as described above. As shown in FIG. 11, masking efficiency remained unchanged after low pH incubation for 30 or 60 minutes, suggesting that the masking peptides retained their blocking efficacy after low pH incubation.
  • Example 4 In vitro and in vivo characterization of activatable antibodies targeting CTLA4
  • Human PBMCs were freshly isolated from the blood of a healthy donor (#44) by density gradient centrifugation using Histopaque-1077 (Sigma) .
  • Anti-CD3 (OKT-3) antibody was coated on a 96 well plate overnight at 4°C. After washing, 1x10 ⁇ 5 freshly isolated human PBMCs were added to each well, followed by the addition of the test articles at different concentrations. Induction of IL-2 was measured 48 hours after stimulation using a Human IL-2 ELISA Ready-SET-Go (Invitrogen) kit.
  • IFN- ⁇ in the supernatant was measured using a Human IFN- ⁇ ELISA Ready-SET-Go (Invitrogen) kit.
  • TY22404 induced IL-2 production
  • TY22401 induced IFN- ⁇ production.
  • the activities of the activatable antibodies were significantly lower than that of the parental TY21580 antibody.
  • HEK293F cells overexpressing human CTLA4 HEK293F/hCTLA-4 cells
  • HEK293F/hCTLA-4 cells HEK293F/hCTLA-4 cells
  • a Jurkat cell line overexpressing CD16a and NFAT-Luc Jurkat/CD16a cells
  • 1x10 ⁇ 5 Jurkat/CD16a cells and 1x10 ⁇ 4 HEK293F/hCTLA-4 cells E: T ratio 10: 1) were mixed with different concentrations of antibody.
  • the activatable antibodies showed several log lower ADCC activities than the parental antibody TY21580.
  • the ADCC activity of TY22401 was higher than that of TY22402 and TY22404.
  • the anti-tumor activities of the activatable antibodies were next evaluated and compared with the anti-tumor activity of the parental antibody TY21580 in multiple syngeneic mouse tumor models, including an MC38 colorectal tumor model, a CT26 colorectal tumor models, an H22 liver tumor model, and a 3LL lung tumor model.
  • MC38 NTCC-MC38
  • treatment began with isotype control antibody, parental antibody TY21580, or one of three activatable antibodies by intraperitoneal injection, twice a week. Tumor growth was monitored twice a week, the mean tumor volume ⁇ s.e.m. over time (FIG. 14A) and individual tumor growth curves (FIG. 14B) were assessed.
  • FIGS. 14A-B all three activatable antibodies showed potent anti-tumor activities, comparable to the parental antibody TY21580 in the MC38 syngeneic mouse tumor model.
  • CT26 Sthai Institutes for Biological Sciences
  • isotype control antibody parental antibody TY21580
  • one of three activatable antibodies at 5mg/kg by intraperitoneal injection, twice a week. Tumor growth was monitored twice a week and reported as the mean tumor volume ⁇ s.e.m. over time.
  • all three activatable antibodies showed potent anti-tumor activities, comparable to the parental antibody TY21580 in CT26 syngeneic mouse tumor model.
  • H22 China Center for Type Culture Collection
  • isotype control antibody parental antibody TY21580
  • one of three activatable antibodies at 5mg/kg by intraperitoneal injection, twice a week. Tumor growth was monitored twice a week and reported as the mean tumor volume ⁇ s.e.m. over time.
  • all three activatable antibodies showed potent anti-tumor activities, comparable to the parental antibody TY21580 in H22 syngeneic mouse tumor model.
  • 3LL 3LL
  • treatment began with isotype control antibody, parental antibody TY21580, or one of three activatable antibodies by intraperitoneal injection, twice a week. Tumor growth was monitored twice a week, the mean tumor volume ⁇ s.e.m. over time (FIG. 17A) and individual tumor growth curves (FIG. 17B) were assessed.
  • FIGS. 17A-B all three activatable antibodies showed potent anti-tumor activities, comparable to the parental antibody TY21580 in 3LL syngeneic mouse tumor model.
  • a pharmacokinetics study was conducted in BALB/c female mice at about eight weeks of age. Three mice per group were intraperitoneally injected with the test article at 10 mg/kg. Blood samples ( ⁇ 50ul per sample) were collected at 3, 6, 24, 48, 96, and 168 hours post-dosing. Blank control blood was collected from three female mice without antibody administration. Serum concentrations of each test antibody were determined by ELISA, in which anti-human IgG Fc was used for capture, and HRP-labeled anti-human IgG (Fab specific) antibody (Sigma) was used for detection (FIGS. 18A-C) . As compared to the previous data collected for parental antibody TY21580, activatable antibodies TY22401 (FIG.
  • TY22402 FOG. 18B
  • TY22404 FOG. 18C
  • TY22401 has a half-life of 196 hours, and the drug concentration at 168 hours was about 55 ⁇ g/mL.
  • TY22402 had a half-life of 134 hours, and the drug concentration at 168 hours was about 40 ⁇ g/mL.
  • TY22404 had a half-life of 254 hours, and the drug concentration at 168 hours was about 45 ⁇ g/mL.
  • the parental antibody TY21580 had a half-life of 107 hours, and the drug concentration at 168 hours was about 17 ⁇ g/mL.
  • NOD mice While evaluating the effect of TY21580 on diabetes onset age in NOD mice, it was found that high dosages of TY21580 could lead to animal death of NOD but not normal BALB/c mice.
  • NOD mouse model was used to evaluate the safety of the activatable antibodies, as compared to that of TY21580.
  • 1 animal died after the third dosing, and 3 animals died after the fourth dosing.
  • Activatable antibodies targeting human CD137 were developed similarly to the scheme used for the development of the anti-CTLA4 activatable antibodies described in Example 3 above.
  • Fab fragments (FIG. 20A) or scFvs (FIG. 20B) of a parental CD137 antibody were displayed on the surface of yeast through fusion to the Aga2 protein, and their ability to bind to CD137 was confirmed by flow cytometry.
  • the VH and VL sequences for the parental CD137 antibody (TY21242) are listed below (See also PCT International Application No. PCT/CN2017/098332, incorporated herein by reference in its entirety) :
  • Anti-CD137 heavy chain variable region (SEQ ID NO: 49) :
  • Anti-CD137 light chain variable region (SEQ ID NO: 50) :
  • the yeast libraries were constructed with CPLs fused to the N-terminus of the light chain, and were subjected to a FACS-based screening processes.
  • the single clones from the 4 th or 5 th round of sorting (FIG. 21) were plated on selective media, and grown individually for confirmation of cleavage-mediated activated antigen binding.
  • FIGS. 22A-B the selected CD137 activatable antibody clones exhibited little binding to antigen in the presence of masking peptide; however, the binding to antigen was dramatically increased when the yeast cells were treated with TEV protease to remove the masking peptide.
  • the identified masking sequences could be separated into several groups, indicating clear enrichment through rounds of sorting. Seven groups of masking peptide sequences, together with the invariant cleavage peptide sequence, are listed in Table 9. Several of these sequence groups (TY22594, TY22595, TY22596, TY22598, TY22599) were derived from the CPL011 library, which contains NNK codons in the loop between the two fixed Cys residues. Interestingly, there are two or more Arg residues in the loop for all these sequence groups, suggesting that charge-charge interactions may be involved between the masking peptides and the CDRs of the parental antibody. Indeed, there are negatively charged Asp residues in the VH CDR2 and VH CDR3.
  • the masking sequences and the invariant cleavage sequences were then tested in full IgG4 molecules expressed in mammalian cells. Their expression levels were similar to their parental antibody, and their purification yields after protein A resin were also similar, suggesting that the presence of masking peptide and cleavage peptide did not have any negative impacts on antibody expression in mammalian cells.
  • yeast cells displaying human CD137 on their surface washed twice with PBSA buffer, and 50 ⁇ L (1x10 ⁇ 6) cells were dispensed into each well of a 96 well plate. Cells were then incubated with 3-fold serial dilutions of antibodies for 1 hour on ice, washed once with PBSA buffer, and then incubated with 100 ⁇ L of PE conjugated mouse anti-human Fc (1 ⁇ g/ml) for 30 minutes on ice. The cells were then washed once prior to analysis by flow cytometry ( CytoFlex) . As shown in FIG.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Plant Pathology (AREA)
  • Virology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/CN2018/075065 2018-02-02 2018-02-02 Precision/context-dependent activatable antibodies, and methods of making and using the same Ceased WO2019148445A1 (en)

Priority Applications (23)

Application Number Priority Date Filing Date Title
PCT/CN2018/075065 WO2019148445A1 (en) 2018-02-02 2018-02-02 Precision/context-dependent activatable antibodies, and methods of making and using the same
US16/265,851 US20190241886A1 (en) 2018-02-02 2019-02-01 Precision/context-dependent activatable antibodies, and methods of making and using the same
CN201980021653.9A CN112771066B (zh) 2018-02-02 2019-02-02 可活化抗体及其制备和使用方法
BR112020015380-0A BR112020015380A2 (pt) 2018-02-02 2019-02-02 Biblioteca compreendendo polinucleotídeos, métodos de produção de um anticorpo ativável e de uso da biblioteca, polipeptídeo, kit, biblioteca compreendendo domínios de ligação a antígeno, cadeia leve de anticorpo, anticorpo, cadeia pesada de anticorpo, célula, anticorpo ativável e método de tratamento ou retardo da progressão de câncer
SG11202007166XA SG11202007166XA (en) 2018-02-02 2019-02-02 Activatable antibodies and methods of making and using thereof
US16/966,848 US11952681B2 (en) 2018-02-02 2019-02-02 Masked activatable CD137 antibodies
CA3090027A CA3090027A1 (en) 2018-02-02 2019-02-02 Activatable antibodies and methods of making and using thereof
JP2020541957A JP2021512122A (ja) 2018-02-02 2019-02-02 活性化可能抗体ならびにその作製及び使用方法
IL326606A IL326606A (en) 2018-02-02 2019-02-02 Activatable antibodies and methods for their preparation and use
PCT/CN2019/074581 WO2019149282A1 (en) 2018-02-02 2019-02-02 Activatable antibodies and methods of making and using thereof
KR1020257021619A KR20250106739A (ko) 2018-02-02 2019-02-02 활성화 가능한 항체 그리고 이의 제조 방법 및 사용 방법
CN202511032704.1A CN121046961A (zh) 2018-02-02 2019-02-02 可活化抗体及其制备和使用方法
EP19747798.7A EP3746461A4 (en) 2018-02-02 2019-02-02 ACTIVABLE ANTIBODIES AND METHOD OF MANUFACTURING AND USING THEREOF
AU2019214189A AU2019214189B2 (en) 2018-02-02 2019-02-02 Activatable antibodies and methods of making and using thereof
KR1020207024940A KR102828375B1 (ko) 2018-02-02 2019-02-02 활성화 가능한 항체 그리고 이의 제조 방법 및 사용 방법
MX2020008180A MX2020008180A (es) 2018-02-02 2019-02-02 Anticuerpos activables y métodos para elaborarlos y usarlos.
IL276285A IL276285B1 (en) 2018-02-02 2020-07-26 Activatable antibodies and methods for their preparation and use
MX2025005685A MX2025005685A (es) 2018-02-02 2020-08-03 Anticuerpos activables y metodos para elaborarlos y usarlos
ZA2020/05260A ZA202005260B (en) 2018-02-02 2020-08-24 Activatable antibodies and methods of making and using thereof
US18/153,221 US20240150749A1 (en) 2018-02-02 2023-01-11 Activatable antibodies and methods of making and using thereof
JP2023099859A JP7596450B2 (ja) 2018-02-02 2023-06-19 活性化可能抗体ならびにその作製及び使用方法
AU2024219607A AU2024219607A1 (en) 2018-02-02 2024-09-11 Activatable antibodies and methods of making and using thereof
JP2024206403A JP2025037964A (ja) 2018-02-02 2024-11-27 活性化可能抗体ならびにその作製及び使用方法

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
PCT/CN2018/075065 WO2019148445A1 (en) 2018-02-02 2018-02-02 Precision/context-dependent activatable antibodies, and methods of making and using the same

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/265,851 Continuation-In-Part US20190241886A1 (en) 2018-02-02 2019-02-01 Precision/context-dependent activatable antibodies, and methods of making and using the same

Publications (1)

Publication Number Publication Date
WO2019148445A1 true WO2019148445A1 (en) 2019-08-08

Family

ID=67476415

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/CN2018/075065 Ceased WO2019148445A1 (en) 2018-02-02 2018-02-02 Precision/context-dependent activatable antibodies, and methods of making and using the same
PCT/CN2019/074581 Ceased WO2019149282A1 (en) 2018-02-02 2019-02-02 Activatable antibodies and methods of making and using thereof

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/CN2019/074581 Ceased WO2019149282A1 (en) 2018-02-02 2019-02-02 Activatable antibodies and methods of making and using thereof

Country Status (13)

Country Link
US (3) US20190241886A1 (enExample)
EP (1) EP3746461A4 (enExample)
JP (3) JP2021512122A (enExample)
KR (2) KR102828375B1 (enExample)
CN (2) CN121046961A (enExample)
AU (2) AU2019214189B2 (enExample)
BR (1) BR112020015380A2 (enExample)
CA (1) CA3090027A1 (enExample)
IL (2) IL326606A (enExample)
MX (2) MX2020008180A (enExample)
SG (1) SG11202007166XA (enExample)
WO (2) WO2019148445A1 (enExample)
ZA (1) ZA202005260B (enExample)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021227156A1 (en) * 2020-05-13 2021-11-18 Adagene Ag Compositions and methods for treating cancer
US11242395B2 (en) 2017-08-21 2022-02-08 Adagene Inc. Anti-CD137 molecules and use thereof
US11952681B2 (en) 2018-02-02 2024-04-09 Adagene Inc. Masked activatable CD137 antibodies
US12240906B2 (en) 2017-05-19 2025-03-04 Wuxi Biologics (Shanghai) Co., Ltd. Monoclonal antibodies to cytotoxic T-lymphocyte-associated protein 4 (CTLA-4)
US12384845B2 (en) 2018-12-26 2025-08-12 Xilio Development, Inc. Activatable masked anti-CTLA4 binding proteins

Families Citing this family (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019148444A1 (en) 2018-02-02 2019-08-08 Adagene Inc. Anti-ctla4 antibodies and methods of making and using the same
SG11202010235QA (en) 2018-04-18 2020-11-27 Exelixis Inc Anti-ror antibody constructs
MX2022005666A (es) * 2019-11-14 2022-10-07 Werewolf Therapeutics Inc Polipeptidos de citocina activables y metodos de uso de los mismos.
CN115279796A (zh) * 2020-01-23 2022-11-01 天演药业(瑞士)公司 具有Fc突变的异二聚蛋白质
US20220119549A1 (en) * 2020-10-15 2022-04-21 Tavotek Biotherapeutics (Hong Kong) Limited Shielded biologics with masking domains to shield antigen binding capability of biologics and uses thereof
WO2022170619A1 (en) * 2021-02-11 2022-08-18 Adagene Pte. Ltd. Anti-cd3 antibodies and methods of use thereof
JP2024517381A (ja) * 2021-04-11 2024-04-22 アダジーン インコーポレイテッド がんを治療するための併用療法
WO2023168547A1 (en) * 2022-03-07 2023-09-14 Adagene Pte. Ltd. Anti-cd137 antibodies and methods of making and using the same
WO2023193239A1 (en) * 2022-04-08 2023-10-12 Peter Peizhi Luo Anti-cd28 antibodies and methods of use thereof
CN120380024A (zh) 2022-12-21 2025-07-25 建新公司 抗pd-1×4-1bb结合蛋白
TW202500587A (zh) 2023-02-16 2025-01-01 法商賽諾菲公司 Cd40結合蛋白
WO2024212151A1 (en) * 2023-04-13 2024-10-17 Adagene Pte. Ltd. Masked antibodies, libraries and methods of use
WO2024212152A1 (en) * 2023-04-13 2024-10-17 Adagene Pte. Ltd. Anti-ctla4 antibodies and methods of making and using the same
IL326412A (en) 2023-08-11 2026-04-01 Wuxi Biologics Ireland Ltd Anti-muc16 antibodies and uses thereof
CN119234000B (zh) * 2023-09-25 2026-04-17 深圳湾实验室 可激活穿膜构建体和降解子
WO2025066568A1 (zh) * 2023-09-25 2025-04-03 深圳湾实验室 可激活穿膜构建体和降解子
TW202540200A (zh) 2023-12-01 2025-10-16 美商基利科學股份有限公司 抗fap-light融合蛋白及其用途
WO2025259871A1 (en) 2024-06-14 2025-12-18 Gilead Sciences, Inc. Anti-ccr8 antibodies and uses thereof

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010081173A2 (en) * 2009-01-12 2010-07-15 Cytomx Therapeutics, Llc Modified antibody compositions, methods of making and using thereof
CN106163556A (zh) * 2013-09-25 2016-11-23 西托姆克斯治疗公司 基质金属蛋白酶底物和其它可切割部分及其使用方法

Family Cites Families (126)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
GB8601597D0 (en) 1986-01-23 1986-02-26 Wilson R H Nucleotide sequences
GB8717430D0 (en) 1987-07-23 1987-08-26 Celltech Ltd Recombinant dna product
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
GB8809129D0 (en) 1988-04-18 1988-05-18 Celltech Ltd Recombinant dna methods vectors and host cells
EP0368684B2 (en) 1988-11-11 2004-09-29 Medical Research Council Cloning immunoglobulin variable domain sequences.
US6291158B1 (en) 1989-05-16 2001-09-18 Scripps Research Institute Method for tapping the immunological repertoire
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
US7018809B1 (en) 1991-09-19 2006-03-28 Genentech, Inc. Expression of functional antibody fragments
PT1024191E (pt) 1991-12-02 2008-12-22 Medical Res Council Produção de auto-anticorpos a partir de reportórios de segmentos de anticorpo e exibidos em fagos
DE69233408T2 (de) 1991-12-02 2005-09-22 Cambridge Antibody Technology Ltd., Melbourn Herstellung von Antikörpern auf Phagenoberflächen ausgehend von Antikörpersegmentbibliotheken.
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US6765087B1 (en) 1992-08-21 2004-07-20 Vrije Universiteit Brussel Immunoglobulins devoid of light chains
ES2162863T3 (es) 1993-04-29 2002-01-16 Unilever Nv Produccion de anticuerpos o fragmentos (funcionalizados) de los mismos derivados de inmunoglobulinas de cadena pesada de camelidae.
US7138500B1 (en) 1993-05-07 2006-11-21 Immunex Corporation Antibodies to human 4-1BB
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
DK0766745T3 (da) 1995-04-08 2002-11-25 Lg Chemical Ltd Monoklonalt antistof, som er specifikt for humant 4-1BB samt cellelinje, som producerer dette
US5994619A (en) 1996-04-01 1999-11-30 University Of Massachusetts, A Public Institution Of Higher Education Of The Commonwealth Of Massachusetts, As Represented By Its Amherst Campus Production of chimeric bovine or porcine animals using cultured inner cell mass cells
JP2001523958A (ja) 1997-03-21 2001-11-27 ブライハム アンド ウィミンズ ホスピタル,インコーポレイテッド 免疫療法のctla−4結合ペプチド
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
GB9722131D0 (en) 1997-10-20 1997-12-17 Medical Res Council Method
KR20000034847A (ko) 1998-11-17 2000-06-26 성재갑 인간 4-1비비 분자에 대한 인간화 항체 및 이를 포함하는 약학조성물
CZ302706B6 (cs) 1998-12-23 2011-09-14 Pfizer Inc. Lidská monoklonální protilátka, farmaceutická kompozice tuto protilátku obsahující, bunecná linie produkující tuto protilátku, izolovaná molekula kódující težký nebo lehký retezec uvedené protilátky, hostitelská bunka obsahující tuto izolovanou molek
US20030118588A1 (en) 1999-05-22 2003-06-26 Linda Diehl Induction of anti-tumor CTL immunity through in vivo triggering of 4-1BB and/or CD40
EP1212422B1 (en) 1999-08-24 2007-02-21 Medarex, Inc. Human ctla-4 antibodies and their uses
US7605238B2 (en) 1999-08-24 2009-10-20 Medarex, Inc. Human CTLA-4 antibodies and their uses
ES2248127T3 (es) 1999-10-04 2006-03-16 Medicago Inc. Metodo para regular la transcripcion de genes foraneos en presencia de nigtrogeno.
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
JP4200627B2 (ja) 2000-03-01 2008-12-24 味の素株式会社 変異型チロシンリプレッサー遺伝子とその利用
ME00502B (me) 2001-01-05 2011-10-10 Amgen Fremont Inc Antitjela za insulinu sličan receptor faktora i rasta
KR100983997B1 (ko) 2001-01-09 2010-09-28 메르크 파텐트 게엠베하 수용체 타이로신 키나아제 저해제 및 혈관형성 저해제를 사용하는 병용 요법
DK1399484T3 (da) 2001-06-28 2010-11-08 Domantis Ltd Dobbelt-specifik ligand og anvendelse af denne
ATE411054T1 (de) 2001-08-17 2008-10-15 Coley Pharm Gmbh Kombinations-motif-immunstimulierende oligonukleotide mit verbesserter wirkung
AR039067A1 (es) 2001-11-09 2005-02-09 Pfizer Prod Inc Anticuerpos para cd40
US7771951B2 (en) 2001-12-03 2010-08-10 Amgen Fremont Inc. Antibody categorization based on binding characteristics
WO2003074678A2 (en) 2002-03-01 2003-09-12 Dyax Corp. Modular recombinatorial display libraries
AU2003244817B2 (en) 2002-06-28 2010-08-26 Domantis Limited Antigen-binding immunoglobulin single variable domains and dual-specific constructs
JP2006500921A (ja) 2002-07-30 2006-01-12 ブリストル−マイヤーズ スクイブ カンパニー ヒト4−1bbに対するヒト化抗体
AR040996A1 (es) 2002-08-19 2005-04-27 Coley Pharm Group Inc Acidos nucleicos inmunoestimuladores
BRPI0315295C1 (pt) 2002-10-17 2021-05-25 Genmab As anticorpo monoclonal humano isolado, célula hospedeira procariótica, composição farmacêutica, molécula biespecífica, usos de um anticorpo, métodos in vitro de detectar a presença de antígeno de cd20 ou uma célula que expressa cd20 em uma amostra, kit, e, vetor de expressão
TWI335821B (en) 2002-12-16 2011-01-11 Genentech Inc Immunoglobulin variants and uses thereof
EP1578801A2 (en) 2002-12-27 2005-09-28 Domantis Limited Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand
US20090005257A1 (en) 2003-05-14 2009-01-01 Jespers Laurent S Process for Recovering Polypeptides that Unfold Reversibly from a Polypeptide Repertoire
DE602004017726D1 (de) 2003-06-30 2008-12-24 Domantis Ltd Pegylierte Single-domain-antikörper (dAb)
AR046094A1 (es) 2003-10-10 2005-11-23 Bristol Myers Squibb Co Anticuerpos completamente humanos contra 4-1bb humano
US7288638B2 (en) 2003-10-10 2007-10-30 Bristol-Myers Squibb Company Fully human antibodies against human 4-1BB
US9296820B2 (en) 2003-11-05 2016-03-29 Roche Glycart Ag Polynucleotides encoding anti-CD20 antigen binding molecules with increased Fc receptor binding affinity and effector function
US7850962B2 (en) 2004-04-20 2010-12-14 Genmab A/S Human monoclonal antibodies against CD20
US20070253961A1 (en) 2004-06-09 2007-11-01 Ulsan Industrial Education Foundation Pharmaceutical Composition Comprising the Anti-4-1Bb Antibody for Treating or Preventing Rheumatoid Arthritis
US20080152655A1 (en) 2004-09-08 2008-06-26 The Ohio State University Research Foundation Combination Therapy With Anti-Ctla4 and Anti-4-1BB Antibodies
WO2006055697A2 (en) 2004-11-17 2006-05-26 Board Of Regents, The University Of Texas System Cancer immunotherapy incorporating p53
DE102004063494A1 (de) 2004-12-23 2006-07-13 Tegenero Ag Antikörper
AU2005325801A1 (en) 2005-01-31 2006-08-03 Ablynx N.V. Method for generating variable domain sequences of heavy chain antibodies
EP2399935A3 (en) 2005-02-15 2012-02-22 GTC Biotherapeutics, Inc. An anti-CD137 antibody as an agent in the treatment of cancer and glycosylation variants thereof
DK2439273T3 (da) 2005-05-09 2019-06-03 Ono Pharmaceutical Co Humane monoklonale antistoffer til programmeret død-1(pd-1) og fremgangsmåder til behandling af cancer ved anvendelse af anti-pd-1- antistoffer alene eller i kombination med andre immunterapeutika
JP2008542354A (ja) 2005-06-03 2008-11-27 ファイザー・プロダクツ・インク 癌治療におけるerbB2阻害剤と他の治療薬の併用
AU2006290433B2 (en) 2005-08-26 2012-06-07 Roche Glycart Ag Modified antigen binding molecules with altered cell signaling activity
CN1294146C (zh) 2005-10-17 2007-01-10 山东大学 与t细胞表面共刺激分子cd137结合的多肽及其应用
JP5256042B2 (ja) 2005-11-22 2013-08-07 インサイト・コーポレイション 癌の処置のための併用療法
CA2631184A1 (en) 2005-11-28 2007-05-31 Genmab A/S Recombinant monovalent antibodies and methods for production thereof
KR20080107050A (ko) 2007-06-05 2008-12-10 울산대학교 산학협력단 항-cd137 단일클론 항체를 포함하는 만성이식편대숙주 질환의 예방 또는 치료용 약학적 조성물
MX2010000970A (es) 2007-07-31 2010-03-09 Regeneron Pharma Anticuerpos humanos contra cd20 humano y metodo para utilizarlos.
CA2696460A1 (en) 2007-08-13 2009-02-19 Pfizer Inc. Combination motif immune stimulatory oligonucleotides with improved activity
US20090304719A1 (en) 2007-08-22 2009-12-10 Patrick Daugherty Activatable binding polypeptides and methods of identification and use thereof
AU2013202755B2 (en) 2007-08-22 2016-05-12 Cytomx Therapeutics, Inc. Activatable binding polypeptides and methods of identification and use thereof
ES2336873B1 (es) 2007-11-07 2011-01-24 Proyecto De Biomedicina Cima, S.L. Composicion farmaceutica para el tratamiento de cancer.
PT2594590E (pt) 2007-12-14 2015-01-14 Bristol Myers Squibb Co Moléculas de ligação ao recetor humano ox40
WO2010014784A2 (en) 2008-08-01 2010-02-04 Bristol-Myers Squibb Company Combination of anti-ctla4 antibody with diverse therapeutic regimens for the synergistic treatment of proliferative diseases
WO2010132389A2 (en) 2009-05-14 2010-11-18 University Of Maryland, Baltimore Methods for treating cancers and diseases associated with 4-1bb (cd137) expression
US9193791B2 (en) * 2010-08-03 2015-11-24 City Of Hope Development of masked therapeutic antibodies to limit off-target effects
MX337040B (es) 2010-09-09 2016-02-09 Pfizer Moleculas de union a 4-1bb.
WO2012065086A1 (en) 2010-11-12 2012-05-18 Nektar Therapeutics Conjugates of an il-2 moiety and a polymer
GB201203442D0 (en) 2012-02-28 2012-04-11 Univ Birmingham Immunotherapeutic molecules and uses
EP2863948B1 (en) 2012-06-22 2018-10-24 Cytomx Therapeutics Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
CN105247050B (zh) 2013-03-14 2020-06-16 天演药业 用于文库构建、亲和力结合剂筛选和其表达的整合系统
CN104250302B (zh) 2013-06-26 2017-11-14 上海君实生物医药科技股份有限公司 抗pd‑1抗体及其应用
AU2014364593A1 (en) 2013-12-17 2016-07-07 Genentech, Inc. Methods of treating cancer using PD-1 axis binding antagonists and an anti-CD20 antibody
SG11201604965RA (en) 2013-12-20 2016-07-28 Univ Singapore Differentiation therapy with cd137 ligand agonists
KR102410090B1 (ko) 2014-02-21 2022-06-16 넥타르 테라퓨틱스 (인디아) 프라이빗 리미티드 항-ctla-4 항체 또는 항-pd-1 항체와 조합한 il-2r베타-선택적 효현제
AU2015244814B2 (en) 2014-04-07 2020-12-24 Chugai Seiyaku Kabushiki Kaisha Immunoactivating antigen-binding molecule
CA2955947A1 (en) * 2014-07-25 2016-01-28 Cytomx Therapeutics, Inc. Anti-cd3 antibodies, activatable anti-cd3 antibodies, multispecific anti-cd3 antibodies, multispecific activatable anti-cd3 antibodies, and methods of using the same
CN105296433B (zh) 2014-08-01 2018-02-09 中山康方生物医药有限公司 一种ctla4抗体、其药物组合物及其用途
ES2789351T3 (es) 2015-01-13 2020-10-26 Hope City Máscaras de enlace peptídico de proteínas de unión a CTLA4
EP3256165B1 (en) 2015-02-13 2021-07-14 Sorrento Therapeutics, Inc. Antibody therapeutics that bind ctla4
KR20180016972A (ko) 2015-02-22 2018-02-20 소렌토 쎄라퓨틱스, 인코포레이티드 Cd137에 결합하는 항체 치료제
CN108112254B (zh) 2015-03-13 2022-01-28 西托姆克斯治疗公司 抗-pdl1抗体、可活化的抗-pdl1抗体、及其使用方法
CA2984892A1 (en) * 2015-05-04 2016-11-10 Cytomx Therapeutics, Inc. Anti-itga3 antibodies, activatable anti-itga3 antibodies, and methods of use thereof
IL292798A (en) 2015-05-04 2022-07-01 Cytomx Therapeutics Inc Anti-cd166 antibodies, activatable anti-cd166 antibodies, preparations containing them and their uses
CN114181309B (zh) 2015-05-21 2024-07-30 鳄鱼生物科学公司 新型多肽
US20160362469A1 (en) * 2015-06-12 2016-12-15 Tianxin Wang Methods for protein modification in pharmaceutical applications
CN107709356A (zh) * 2015-06-26 2018-02-16 南加利福尼亚大学 用于肿瘤特异性活化的掩蔽嵌合抗原受体t细胞
MX383464B (es) * 2015-07-13 2025-03-14 Cytomx Therapeutics Inc Anticuerpos anti-pd-1, anticuerpos anti-pd-1 activables, y métodos de uso de los mismos.
JP6845846B6 (ja) 2015-09-22 2021-04-21 ディンフー バイオターゲット カンパニー リミテッド 抗ヒトcd137の完全ヒト抗体及びその用途
GB201519481D0 (en) 2015-11-04 2015-12-16 Cancer Rec Tech Ltd Immunomodulatory antibodies
ES2979210T3 (es) 2015-12-15 2024-09-24 Oncoc4 Inc Anticuerpos monoclonales anti-CTLA4 humano quiméricos y humanizados y usos de los mismos
ES2986067T3 (es) 2015-12-17 2024-11-08 Novartis Ag Moléculas de anticuerpos frente a PD-1 y usos de las mismas
EP3394107A1 (en) 2015-12-22 2018-10-31 AbbVie Stemcentrx LLC Novel anti-tnfsf9 antibodies and methods of use
WO2017140826A1 (en) 2016-02-18 2017-08-24 Institut Gustave Roussy Methods and kits for predicting the sensitivity of a subject to immunotherapy
CA3014466A1 (en) 2016-03-03 2017-09-08 Cue Biopharma, Inc. T-cell modulatory multimeric polypeptides and methods of use thereof
SG10201603721TA (en) 2016-05-10 2017-12-28 Agency Science Tech & Res Anti-CTLA-4 Antibodies
WO2017205745A1 (en) 2016-05-27 2017-11-30 Abbvie Biotherapeutics Inc. Anti-4-1bb antibodies and their uses
WO2018011421A1 (en) 2016-07-14 2018-01-18 Genmab A/S Multispecific antibodies against cd40 and cd137
CN114456269A (zh) 2016-09-21 2022-05-10 基石药业(苏州)有限公司 一种新的pd-1单克隆抗体
GB201619648D0 (en) 2016-11-21 2017-01-04 Alligator Bioscience Ab Novel antibodies and uses thereof
CN112210010B (zh) 2017-01-06 2023-12-05 优特力克斯有限公司 抗-人4-1bb抗体及其应用
KR20240017409A (ko) 2017-04-13 2024-02-07 아게누스 인코포레이티드 항-cd137 항체 및 이의 사용 방법
KR20180119135A (ko) 2017-04-24 2018-11-01 주식회사 제넥신 4-1bbl 변이체 및 이를 포함하는 융합 단백질
RU2019138067A (ru) 2017-05-02 2021-06-02 Эллигейтор Биосайенс Аб Биспецифическое антитело против ox40 и ctla-4
JP7173993B2 (ja) 2017-05-19 2022-11-17 ウーシー バイオロジクス(シャンハイ)カンパニー リミテッド 細胞傷害性tリンパ球関連タンパク質4(ctla-4)に対する新規モノクローナル抗体
AU2018301393B2 (en) 2017-07-11 2025-02-27 Compass Therapeutics Llc Agonist antibodies that bind human CD137 and uses thereof
WO2019036855A1 (en) 2017-08-21 2019-02-28 Adagene Inc. Anti-cd137 molecules and use thereof
IL272696B2 (en) 2017-08-21 2025-01-01 Adagene Inc Dynamic human heavy chain antibody libraries
NZ761785A (en) 2017-08-21 2025-11-28 Adagene Inc Dynamic human antibody light chain libraries
WO2019089753A2 (en) 2017-10-31 2019-05-09 Compass Therapeutics Llc Cd137 antibodies and pd-1 antagonists and uses thereof
WO2019104716A1 (en) 2017-12-01 2019-06-06 Adagene Inc. Methods for using cd137 ligand as biomarker for treatment with anti-cd137 antibody
WO2019148444A1 (en) 2018-02-02 2019-08-08 Adagene Inc. Anti-ctla4 antibodies and methods of making and using the same
WO2019148445A1 (en) 2018-02-02 2019-08-08 Adagene Inc. Precision/context-dependent activatable antibodies, and methods of making and using the same
US20220089757A1 (en) 2019-06-05 2022-03-24 Adagene Pte. Ltd. Anti-cd137l antibodies and methods of using same
EP4559477A3 (en) 2020-05-13 2025-08-13 Adagene AG Compositions and methods for treating cancer
EP4168048A4 (en) 2020-06-23 2024-10-16 Adagene Pte. Ltd. COMBINATION THERAPY INCLUDING ANTI-CD137 ANTIBODIES
WO2023168547A1 (en) * 2022-03-07 2023-09-14 Adagene Pte. Ltd. Anti-cd137 antibodies and methods of making and using the same

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010081173A2 (en) * 2009-01-12 2010-07-15 Cytomx Therapeutics, Llc Modified antibody compositions, methods of making and using thereof
CN106163556A (zh) * 2013-09-25 2016-11-23 西托姆克斯治疗公司 基质金属蛋白酶底物和其它可切割部分及其使用方法

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12240906B2 (en) 2017-05-19 2025-03-04 Wuxi Biologics (Shanghai) Co., Ltd. Monoclonal antibodies to cytotoxic T-lymphocyte-associated protein 4 (CTLA-4)
US11242395B2 (en) 2017-08-21 2022-02-08 Adagene Inc. Anti-CD137 molecules and use thereof
US11859003B2 (en) 2017-08-21 2024-01-02 Adagene Inc. Method for treating cancer using anti-CD137 antibody
US12378319B2 (en) 2017-08-21 2025-08-05 Adagene Inc. Anti-CD137 molecules and use thereof
US11952681B2 (en) 2018-02-02 2024-04-09 Adagene Inc. Masked activatable CD137 antibodies
US12384845B2 (en) 2018-12-26 2025-08-12 Xilio Development, Inc. Activatable masked anti-CTLA4 binding proteins
US12435142B2 (en) 2018-12-26 2025-10-07 Xilio Development, Inc. Anti-CTLA4 antibodies and methods of use thereof
WO2021227156A1 (en) * 2020-05-13 2021-11-18 Adagene Ag Compositions and methods for treating cancer
WO2021226883A1 (en) * 2020-05-13 2021-11-18 Adagene Ag Compositions and methods for treating cancer submission of sequence listing on ascii text file

Also Published As

Publication number Publication date
AU2019214189A1 (en) 2020-09-17
KR20200128011A (ko) 2020-11-11
MX2025005685A (es) 2025-06-02
AU2024219607A1 (en) 2024-10-03
US20240150749A1 (en) 2024-05-09
US11952681B2 (en) 2024-04-09
IL276285A (en) 2020-09-30
SG11202007166XA (en) 2020-08-28
EP3746461A4 (en) 2021-11-17
JP2025037964A (ja) 2025-03-18
IL276285B1 (en) 2026-03-01
US20210207126A1 (en) 2021-07-08
KR20250106739A (ko) 2025-07-10
JP7596450B2 (ja) 2024-12-09
WO2019149282A1 (en) 2019-08-08
CN112771066A (zh) 2021-05-07
CN121046961A (zh) 2025-12-02
BR112020015380A2 (pt) 2020-12-22
EP3746461A1 (en) 2020-12-09
JP2023134458A (ja) 2023-09-27
CN112771066B (zh) 2025-08-08
AU2019214189B2 (en) 2024-06-27
US20190241886A1 (en) 2019-08-08
ZA202005260B (en) 2024-12-18
MX2020008180A (es) 2020-10-19
JP2021512122A (ja) 2021-05-13
IL326606A (en) 2026-04-01
KR102828375B1 (ko) 2025-07-03
CA3090027A1 (en) 2019-08-08

Similar Documents

Publication Publication Date Title
US20240150749A1 (en) Activatable antibodies and methods of making and using thereof
US20240141046A1 (en) Anti-ctla4 antibodies and methods of making and using the same
WO2024213110A1 (en) Anti-ctla4 antibodies and methods of making and using the same
TWI888925B (zh) 抗ctla4抗體及其製備及使用方法
BR122023018935B1 (pt) Anticorpo, polinucleotídeo, vetor, célula hospedeira bacteriana, método de produção de um anticorpo, composição farmacêutica e uso do anticorpo

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18903998

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 18903998

Country of ref document: EP

Kind code of ref document: A1

122 Ep: pct application non-entry in european phase

Ref document number: 18903998

Country of ref document: EP

Kind code of ref document: A1