WO2019113096A1 - Methods and compositions to prevent microbial infection - Google Patents
Methods and compositions to prevent microbial infection Download PDFInfo
- Publication number
- WO2019113096A1 WO2019113096A1 PCT/US2018/063880 US2018063880W WO2019113096A1 WO 2019113096 A1 WO2019113096 A1 WO 2019113096A1 US 2018063880 W US2018063880 W US 2018063880W WO 2019113096 A1 WO2019113096 A1 WO 2019113096A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- gene
- microorganism
- weeks
- synthetic
- promoter
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
- A61K35/741—Probiotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/24—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
- C07K14/245—Escherichia (G)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/305—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F)
- C07K14/31—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F) from Staphylococcus (G)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/20—Bacteria; Culture media therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/64—General methods for preparing the vector, for introducing it into the cell or for selecting the vector-containing host
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
- C12N15/77—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for Corynebacterium; for Brevibacterium
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
- C12N15/78—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for Pseudomonas
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K2035/11—Medicinal preparations comprising living procariotic cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K2035/11—Medicinal preparations comprising living procariotic cells
- A61K2035/115—Probiotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0014—Skin, i.e. galenical aspects of topical compositions
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/11—Antisense
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2820/00—Vectors comprising a special origin of replication system
- C12N2820/002—Vectors comprising a special origin of replication system inducible or controllable
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2820/00—Vectors comprising a special origin of replication system
- C12N2820/55—Vectors comprising a special origin of replication system from bacteria
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/55—Vector systems having a special element relevant for transcription from bacteria
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2840/00—Vectors comprising a special translation-regulating system
- C12N2840/002—Vectors comprising a special translation-regulating system controllable or inducible
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2840/00—Vectors comprising a special translation-regulating system
- C12N2840/55—Vectors comprising a special translation-regulating system from bacteria
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
- C12R2001/44—Staphylococcus
- C12R2001/445—Staphylococcus aureus
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/21—Endodeoxyribonucleases producing 5'-phosphomonoesters (3.1.21)
- C12Y301/21004—Type II site-specific deoxyribonuclease (3.1.21.4)
Definitions
- the present application includes a Sequence Listing in electronic format as a txt file entitled "Sequence-Listing,” which was created on 03 December 2018 and which has a size of 128,065 kilobytes (KB).
- the contents of txt file "Sequence-Listing" are incorporated by reference herein.
- Methods and compositions are provided for durably influencing microbiological ecosystems (microbiomes) in a subject in order to resist infection and reduce recurrence of infection by an undesirable microorganism by decolonizing and durably replacing with a synthetic microorganism.
- Synthetic microorganisms are provided that may durably replace an undesirable microorganism under dermal or mucosal conditions, and that contain molecular modifications designed to enhance safety, for example, by self- destructing when exposed to systemic conditions, by reducing the potential for acquisition of virulence or antibiotic resistance genes, and/or by producing a desirable product at the site of the ecosystem in a subject.
- the menagerie of microorganisms constitutes the "biome", a dynamic, structured, living system that in many cases, and in many ways, is essential for our health and wellness.
- a biomic structure is created by a vast combinatorial web of relationships between the host, the environment, and the components of the biome.
- the human microbiome is an ecosystem. It has a dynamic but persistent structure - it is “resilient” and has a“healthy” normal base state.
- a phenomenon called“recurrence” is at the heart of the process that creates antibiotic resistance. While methods to treat pathogenic infection exist, methods to prevent recurrence are effectively nonexistent.
- Bacterial infections are the home territory of the emerging“super bug” phenomenon.
- the overuse and misuse of antibiotics has caused many strains of pathogenic bacteria to evolve resistance to an increasing number of antibiotic therapies, creating a massive global public health problem.
- antibiotic therapies creating a massive global public health problem.
- the inevitable process of selecting for resistant strains begins anew, and resistant variants of the pathogen quickly develop.
- today bacteria are becoming resistant faster than new antibiotics can be developed.
- antibiotic treatments Beyond cultivating antibiotic resistance, and frequently causing adverse health effects in the recipients, antibiotic treatments also have the undesirable effect of disrupting the entire microbiome, including both good and bad bacteria. This often creates new problems such as opening the microbiome to colonization by adventitious pathogens after the treatment.
- microbiome The community of organisms colonizing the human body is referred to as the microbiome.
- the microbiome is often subdivided for analysis into sections of geography (i.e. the skin microbiome versus the gastrointestinal microbiome) or of phylogeny (i.e. bacterial microbiome versus the fungal or protist microbiome).
- Antibiotics are life-saving medicines, but they can also change, unbalance, and disrupt the microbiome.
- the microbiome is a community of naturally-occurring germs in and on the body— on skin, gut, mouth or respiratory tract, and in the urinary tracts. A healthy microbiome helps protect from infection. Antibiotics disrupt the microbiome, eliminating both“good” and“bad” bacteria.
- Drug-resistant bacteria— like MRSA, CRE, and C. difficile— can take advantage of this disruption and multiply. With this overgrowth of resistant bacteria, the body is primed for infection. Once subjects are colonized with resistant bacteria, the resistant bacteria can easily be spread to others. See “Antibiotic Resistance (AR) Solutions Initiative: Microbiome, CDC Microbiome Fact Sheet 2016”. www.cdc.gov/drugresistance/solutions-initiative/innovations-to-slow- AR.html.
- CDC Center for Disease Control
- the top drug-resistant threats to the United States include Neisseria gonorrhoeae , multi-drug resistant Acinetobacter, drug-resistant Campylobacter, fluconazole-resistant Candida, vancomycin-resistant Enterococcus (VRE), multi-drug resistant Pseudomonas
- Aeruginosa drug-resistant non-typhoidal Salmonella, drug-resistant Salmonella serotype typhi, methicillin-resistant Staphylococcus aureus (MRSA), drug-resistant Streptococcus pneumoniae , drug-resistant Tuberculosis, vancomycin-resistant
- Neisseria gonorrhoeae causes gonorrhea, a sexually transmitted disease that can result in discharge and inflammation at the urethra, cervix, pharynx, or rectum.
- Acinetobacter is a type of gram-negative bacteria that is a cause of pneumonia or bloodstream infections among critically ill patients. Many of these bacteria have become very resistant to antibiotics. There are about 12,000 Actinobacter infections per year, including about 7,300 multidrug-resistant Actinobacter infections and 500 deaths.
- Candida is a fungal infection caused by yeasts of the genus Candida.
- Candida yeasts There are more than 20 species of Candida yeasts that can cause infection in humans, the most common of which is Candida albicans.
- Candida yeasts normally live on the skin and mucous membranes without causing infection. However, overgrowth or invasion of these microorganisms can cause symptoms to develop.
- Symptoms of candidiasis vary depending on the area of the body that is infected.
- Candida is the fourth most common cause of healthcare-associated bloodstream infections in the United States. In some hospitals it is the most common cause. These infections tend to occur in the sickest patients. There are about 46,000 Candida infections per year, including about 3,400 fluconazole-resistant Candida infections, and 220 deaths.
- Staphylococcus aureus is a common type of bacteria that is found on the skin. During medical procedures when patients require catheters or ventilators or undergo surgical procedures, Staphylococcus aureus can enter the body and cause infections. Methicillin-resistant Staphylococcus aureus (MRSA) causes a range of illnesses, from skin and wound infections to pneumonia and bloodstream infections that can cause sepsis and death. Staph bacteria, including MRSA, are one of the most common causes of healthcare-associated infections. There are about 80,461 severe MRSA infections per year, and about 11,285 deaths from MRS A per year.
- MRSA Methicillin-resistant Staphylococcus aureus
- Streptococcus pneumoniae S . pneumoniae , or pneumococcus
- S . pneumoniae or pneumococcus
- pneumococcus pneumoniae is the leading cause of bacterial pneumonia and meningitis in the United States. It also is a major cause of bloodstream infections and ear and sinus infections. There are about 1,200,000 drug resistant infections per year, with about 19,000 excess hospitalizations, and 7,000 deaths.
- Group A Streptococcus causes many illnesses, including pharyngitis (strep throat), streptococcal toxic shock syndrome, necrotizing fasciitis (“flesh-eating” disease), scarlet fever, rheumatic fever, and skin infections such as impetigo.
- Group A Streptococcus is the leading cause of necrotizing fasciitis (“flesh-eating” disease).
- Strep throat infections peer year, including about 1,300 drug- resistant Group A Strep infections per year, and about 160 deaths.
- Group B Streptococcus is a type of bacteria that can cause severe illness in people of all ages, ranging from bloodstream infections (sepsis) and pneumonia to meningitis and skin infections.
- Group B Strep is the leading cause of serious microorganism infections in newborns. There were about 27,000 severe cases of GBS in 2011, including about 7,600 drug-resistant Group B Strep infections, and about 440 deaths.
- Prior art methods of preventing infection and transmission of drug-resistant microorganisms in colonized individuals include screening and isolation, decolonization of the drug-resistant microorganism, and/or recolonization with a drug-susceptible microorganism.
- MRSA methicillin-resistant Staphylococcus aureus
- Decolonization alone has been used in hospital patients in an attempt to reduce transmission and prevent disease in Staphylococcus aureus carriers.
- Decolonization may involve a multi-day regimen of antibiotic and/or antiseptic agents- for example, intranasal mupirocin and chlorhexidine bathing.
- Universal decolonization is a method employed by some hospitals where all intensive care unit (ICU) hospital patients are washed daily with chlorhexidine and intranasal mupirocin, but since its widespread use, MRSA infection rates in the U.S. have not significantly changed.
- microorganisms may develop resistance to chlorhexidine and mupirocin upon repeated exposure.
- Decolonization when used alone may not be durable because the vacated niche may become recolonized with pathogenic or drug-resistant microorganisms.
- Shinefield attempted to solve the problem by artificially colonizing newborns with staphylococcal strain 502a by nasal and/or umbilical inoculation.
- 502a is a coagulase positive strain of Staphylococcus aureus of low virulence, susceptible to penicillin, and incapable of being induced to produce beta-lactamase. It was shown that presence of other staphylococci interfered with acquisition of 502a. Persistence of colonization was at best 35% after 6 months to one year. [0030] Boris M. et al,.
- Recolonization with a drug-susceptible strain may not be safe because the drug- susceptible strain may still cause systemic infection.
- Co-colonization was found in 5/12 subjects at day 3, 2/12 subjects at day 10, and 1/12 subjects at day 35 and at day 70. [0034] Decolonization, followed by recolonization with a microorganism of the same genus, but a different species, may not be durable because the vacated niche is not adequately filled by the different species.
- W02009117310 A2 George Liu, assigned to Cedars-Sinai Medical Center, discloses methods for treatment and prevention of methicillin-resistant Staphylococcus aureus and methicillin-sensitive Staphylococcus aureus (MSSA) using a decolonization/recolonization method.
- MSSA methicillin-resistant Staphylococcus aureus
- mice are treated with antibiotics to eradicate existing flora, including MRSA, and newly cleared surface area is colonized with bacteria of the same genus, but of a different species, such as Staphylococcus epidermidis. No specific data regarding recurrence is provided.
- Administration of probiotics in an attempt to treat infection by pathogenic microorganisms may not be effective and may not be durable because the probiotic may not permanently colonize the subject.
- U.S. Pat. No. 6,660,262, Randy McKinney, assigned to Bovine Health Products, Inc. discloses broad spectrum antimicrobial compositions comprising certain minerals, vitamins, cobalt amino acids, kelp and a Lactobacillus species for use in treating microbial infection in animals. Field trials in cattle and horses were performed, but the infectious bacterial strain or other infectious agent was not identified.
- U.S. Pat. No. 6,905,692, Sean Farmer, assigned to Ganeden Biotech, Inc. discloses topical compositions containing certain combinations of probiotic Bacillus bacteria, spores and extracellular products for application to skin or mucosa of a mammal for inhibiting growth of certain bacterium, yeast, fungi, and virus.
- Compositions comprising Bacillus coagulens spores, or Bacillus species culture supernatants and Pseudomonas lindbergii culture supernatants in a vehicle such as emu oil are provided.
- the disclosure states since probiotics do not permanently colonize the host, they need to be ingested or applied regularly for any health-promoting properties to persist.
- U.S. Pat. No. 6,461,607 discloses lactic acid-producing bacteria, preferably strains of Bacillus coagulans , for the control of gastrointestinal tract pathogens in a mammal. Methods for selective breeding and isolation of probiotic, lactic acid-producing bacterial strains which possess resistance to an antibiotic are disclosed. Methods for treating infections with a composition comprising an antibiotic-resistant lactic-acid producing bacteria and an antibiotic are disclosed.
- U.S. Pat. No. 8,906,668, assigned to Seres Therapeutics provide cytotoxic binary combinations of 2 or more bacteria of different operational taxonomic units (OTUs) to durably exclude a pathogenic bacterium.
- OTUs are determined by comparing sequences between organisms, for example as sharing at least 95% sequence identity of 16S ribosomal RNA genes in at least in a hypervariable region.
- a better approach may be to manage the microbiome: to actively promote "good bugs" and their supporting system dynamics, while selectively suppressing the recurrence of specific pathogenic organisms.
- Improved methods to safely and durably prevent and reduce recurrence of infection by undesirable microorganisms, such as virulent, pathogenic and/or drug-resistant microorganisms, are desirable.
- microbiological ecosystems in a subject to perform a variety of functions, for example, including reducing the risk of infection by an undesirable microorganism such as virulent, pathogenic and/or drug-resistant microorganism.
- Methods are provided herein to prevent or reduce the risk of colonization, infection, recurrence of colonization, or recurrence of a pathogenic infection by an undesirable microorganism in a subject, comprising: decolonizing the undesirable microorganism on at least one site in the subject to reduce or eliminate the presence of the undesirable microorganism from the site; and durably replacing the undesirable microorganism by administering a synthetic microorganism to the at least one site in the subject, wherein the synthetic microorganism can durably integrate with a host microbiome by occupying the niche previously occupied by the undesirable microorganism; and optionally promoting colonization of the synthetic microorganism within the subject.
- the disclosure provides a method for eliminating and preventing the recurrence of a undesirable microorganism in a subject hosting a microbiome, comprising (a) decolonizing the host microbiome; and (b) durably replacing the undesirable microorganism by administering to the subject a synthetic microorganism comprising at least one element imparting a non-native attribute, wherein the synthetic microorganism is capable of durably integrating to the host microbiome, and occupying the same niche in the host microbiome as the undesirable microorganism.
- the decolonizing is performed on at least one site in the subject to substantially reduce or eliminate the detectable presence of the undesirable microorganism from the at least one site.
- the detectable presence of an undesirable microorganism or a synthetic microorganism is determined by a method comprising a phenotypic method and/or a genotypic method, optionally wherein the phenotypic method is selected from the group consisting of biochemical reactions, serological reactions, susceptibility to anti-microbial agents, susceptibility to phages, susceptibility to bacteriocins, and/or profile of cell proteins.
- the genotypic method is selected a hybridization technique, plasmids profile, analysis of plasmid polymorphism, restriction enzymes digest, reaction and separation by Pulsed-Field Gel Electrophoresis (PFGE), ribotyping, polymerase chain reaction (PCR) and its variants, Ligase Chain Reaction (LCR), and Transcription-based Amplification System (TAS).
- PFGE Pulsed-Field Gel Electrophoresis
- PCR polymerase chain reaction
- LCR Ligase Chain Reaction
- TAS Transcription-based Amplification System
- the niche is a dermal or mucosal environment that allows stable colonization of the undesirable microorganism at the at least one site in the subject.
- the ability to durably integrate to the host microbiome is determined by detectable presence of the synthetic microorganism at the at least one site for a period of at least two weeks, at least four weeks, at least six weeks, at least eight weeks, at least ten weeks, at least 12 weeks, at least 16 weeks, at least 26 weeks, at least 30 weeks, at least 36 weeks, at least 42 weeks, or at least 52 weeks after the administering step.
- the ability to durably replace the undesirable microorganism is determined by the absence of detectable presence of the undesirable microorganism at the at least one site for a period of at least two weeks, at least four weeks, at least six weeks, at least eight weeks, at least ten weeks, at least 12 weeks, at least 16 weeks, at least 26 weeks, at least 30 weeks, at least 36 weeks, at least 42 weeks, or at least 52 weeks after the administering step.
- the ability to occupy the same niche is determined by absence of co-colonization of the undesirable microorganism and the synthetic microorganism at the at least one site after the administering step.
- the absence of co-colonization is determined at least two weeks, at least four weeks, at least six weeks, at least eight weeks, at least ten weeks, at least 12 weeks, at least 16 weeks, at least 26 weeks, at least 30 weeks, at least 36 weeks, at least 42 weeks, or at least 52 weeks after the administering step.
- the synthetic microorganism comprises at least one element imparting the non-native attribute that is durably incorporated to the synthetic microorganism.
- the at least one element imparting the non-native attribute is durably incorporated to the host microbiome via the synthetic microorganism.
- the at least one element imparting the non-native attribute is a kill switch molecular modification, virulence block molecular modification, or nanofactory molecular modification.
- the synthetic microorganism comprises molecular modification that is integrated to a chromosome of the synthetic microorganism.
- the synthetic microorganism comprises a virulence block molecular modification that prevents horizontal gene transfer of genetic material from the undesirable microorganism.
- the measurable average cell death of the synthetic microorganism occurs within at least a preset period of time following induction of the first promoter after the change in state. In some embodiments, the measurable average cell death occurs within at least a preset period of time selected from the group consisting of within at least 1, 5, 15, 30, 60, 90, 120, 180, 240, 300, or 360 min minutes following the change of state. In some embodiments, the measurable average cell death is at least a 50% cfu, at least 70%, at least 80%, at least 90%, at least 95%, at least 99%, at least 99.5%, at least 99.8%, or at least 99.9% cfu count reduction following the preset period of time.
- the change in state is selected from one or more of pH, temperature, osmotic pressure, osmolality, oxygen level, nutrient concentration, blood concentration, plasma concentration, serum concentration, metal concentration, chelated metal concentration, change in composition or concentration of one or more immune factors, mineral concentration, and electrolyte concentration.
- the change in state is a higher concentration of and/or change in composition of blood, serum, or plasma compared to normal physiological (niche) conditions at the at least one site in the subject.
- the undesirable microorganism is a Staphyloccoccus aureus strain
- the detectable presence is measured by a method comprising obtaining a sample from the at least one site of the subject, contacting a chromogenic agar with the sample, incubating the contacted agar and counting the positive cfus of the bacterial species after a predetermined period of time.
- a method comprising a decolonizing step comprising topically administering a decolonizing agent to at least one site in the subject to reduce or eliminate the presence of the undesirable microorganism from the at least one site.
- the decolonizing step comprises topical administration of a decolonizing agent, wherein no systemic antimicrobial agent is simultaneously administered.
- no systemic antimicrobial agent is administered prior to, concurrent with, and/or subsequent to within one week, two weeks, three weeks, one month, two months, three months, six months, or one year of the first topical administration of the decolonizing agent or administration of the synthetic microorganism.
- the decolonizing agent is selected from the group consisting of a disinfectant, bacteriocide, antiseptic, astringent, and antimicrobial agent.
- Vaccinium spp. e.g., A-type proanthocyanidins
- Cassia fistula Linn Baekea frutesdens L.
- Melia azedarach L. Muntingia calabura
- Vitis vinifera L Terminalia avicennioides Guill & Perr.
- Phylantus discoideus muel. Muel-Arg. Ocimum gratissimum Linn.
- Acalypha wilkesiana Muell-Arg. Hypericum pruinatum Boiss.&Bak, Hypericum olimpicum L.
- Hypericum sabrum L. Hamamelis virginiana (witch hazel), Clove oil, Eucalyptus spp., rosemarinus officinalis spp. (rosemary), thymus spp. (thyme), Lippia spp. (oregano), lemongrass spp., cinnamomum spp., geranium spp., lavendula spp.), aminolevulonic acid, and topical antibiotic compounds (bacteriocins; mupirocin, bacitracin, neomycin, polymyxin B, gentamicin).
- the antimicrobial agent is selected from the group consisting of vancomycin, cefazolin, cepahalothin, cephalexin, linezolid, daptomycin, clindamycin, lincomycin, mupirocin, bacitracin, neomycin, polymyxin B, gentamicin, prulifloxacin, ulifloxacin, fidaxomicin, minocyclin, metronidazole, metronidazole, sulfamethoxazole, ampicillin, trimethoprim, ofloxacin, norfloxacin, tinidazole, norfloxacin, ornidazole, levofloxacin, nalidixic acid, ceftriaxone, azithromycin, cefixime, ceftriaxone, cefalexin, ceftriaxone, rifaximin, ciprofloxacin, norf
- the decolonizing comprises topically administering the decolonizing agent at least one, two, three, four, five or six or more times prior to the replacing step.
- the decolonizing step comprises administering the decolonizing agent to the at least one host site in the subject from one to six or more times or two to four times at intervals of between 0.5 to 48 hours apart, and wherein the replacing step is performed after the final decolonizing step.
- a method comprising decolonizing an undesirable microorganism, and replacing with a synthetic microorganism comprising topical administration of a composition comprising at least 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 , or at least 10 11 CFU of the synthetic strain and a pharmaceutically acceptable carrier to at least one host site in the subject.
- the initial replacing step is performed within 12 hours, 24 hours, 36 hours, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days or 10 days, or between 0.5- 10 days, 1-7 days, or 2 to 5 days of the decolonizing step.
- the replacing step is repeated at intervals of no more than once every two weeks to six months following the final decolonizing step. In some embodiments, the decolonizing step and the replacing step is repeated at intervals of no more than once every two weeks to six months, or three weeks to three months. In some embodiments, the replacing comprises administering the synthetic microorganism to the at least one site at least one, two, three, four, five, six, seven, eight, nine, or ten times. In some embodiments, the replacing comprises administering the synthetic microorganism to the at least one site no more than one, no more than two, no more than three times, or no more than four times per month.
- the method of decolonizing the undesirable microorganism and replacing with a synthetic microorganism further comprises promoting colonization of the synthetic microorganism in the subject.
- the promoting colonization of the synthetic microorganism in the subject comprises administering to the subject a promoting agent, optionally where the promoting agent is a nutrient, prebiotic, commensal, stabilizing agent, humectant, and/or probiotic bacterial species.
- the promoting comprises administering a probiotic species at from 10 5 to 10 10 cfu, 10 6 to 10 9 cfu, or 10 7 to 10 8 cfu to the subject after the initial decolonizing step.
- the nutrient is selected from sodium chloride, lithium chloride, sodium glycerophosphate, phenyl ethanol, mannitol, tryptone, peptide, and yeast extract.
- the prebiotic is selected from the group consisting of short-chain fatty acids (acetic acid, propionic acid, butyric acid, isobutyric acid, valeric acid, isovaleric acid ), glycerol, pectin-derived oligosaccharides from agricultural by- products, fructo-oligosaccarides (e.g., inulin-like prebiotics), galacto-oligosaccharides (e.g., raffmose), succinic acid, lactic acid, and mannan-oligosaccharides.
- short-chain fatty acids acetic acid, propionic acid, butyric acid, isobutyric acid, valeric acid, isovaleric acid
- pectin-derived oligosaccharides from agricultural by- products
- the probiotic is selected from the group consisting of Bifidobacterium breve, Bifidobacterium bifidum, Bifidobacterium lactis, Bifidobacterium infantis, Bifidobacterium breve, Bifidobacterium longum, Lactobacillus reuteri, Lactobacillus paracasei, Lactobacillus plantarum, Lactobacillus johnsonii, Lactobacillus rhamnosus, Lactobacillus acidophilus, Lactobacillus salivarius, Lactobacillus casei, Lactobacillus plantarum, Lactococcus lactis, Streptococcus thermophiles, and Enterococcus fecalis.
- the commensal is selected from the group consisting of Acinetobacter johnsonii, Acinetobacter baumannii, Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus lugdunensis, Staphylococcus warneri, Staphylococcus saprophyticus, Corynebacterium acnes, Corynebacterium striatum, Corynebacterium diphtheriae, Corynebacterium minutissimum, Cutibacterium acnes, Propionibacterium acnes, Propionibacterium granulosum, Streptococcus pyogenes, Streptococcus aureus, Streptococcus agalactiae, Streptococcus mitis, Streptococcus viridans, Streptococcus pneumoniae, Streptococcus anginosis, Steptococcus constellatus, Streptobacter johnsonii
- the undesirable microorganism is an antimicrobial agent- resistant microorganism.
- the antimicrobial agent-resistant microorganism is an antibiotic resistant bacteria.
- the antibiotic- resistant bacteria is a Gram-positive bacterial species selected from the group consisting of a Streptococcus spp., Cutibacterium spp., and a Staphylococcus spp.
- the Streptococcus spp. is selected from the group consisting of Streptococcus pneumoniae, Steptococcus mutans, Streptococcus sobrinus, Streptococcus pyogenes, and Streptococcus agalactiae.
- the Cutibacterium spp. is selected from the group consisting of Cutibacterium acnes subsp. acnes, Cutibacterium acnes subsp. defendens, and Cutibacterium acnes subsp. elongatum.
- the Staphylococcus spp. is selected from the group consisting of Staphylococcus aureus, Staphylococcus epidermidis, and Staphylococcus saprophyticus.
- the undesirable microorganism is a methicillin-resistant Staphylococcus aureus (MRSA) strain that contains a staphylococcal chromosome cassette (SCC mec types I-III), which encode one (SCC mec type I) or multiple antibiotic resistance genes (SCCwec type II and III), and/or produces a toxin.
- MRSA methicillin-resistant Staphylococcus aureus
- the toxin is selected from the group consisting of a Panton-Valentine leucocidin (PVL) toxin, toxic shock syndrome toxin-l (TSST-l), staphylococcal alpha- hemolysin toxin, staphylococcal beta-hemolysin toxin, staphylococcal gamma- hemolysin toxin, staphylococcal delta-hemolysin toxin, enterotoxin A, enterotoxin B, enterotoxin C, enterotoxin D, enterotoxin E, and a coagulase toxin.
- PVL Panton-Valentine leucocidin
- TSST-l toxic shock syndrome toxin-l
- the subject treated with a method according to the disclosure does not exhibit recurrence or colonization of the undesirable microorganism as evidenced by swabbing the subject at the at least one site for at least two weeks, at least two weeks, at least four weeks, at least six weeks, at least eight weeks, at least ten weeks, at least 12 weeks, at least 16 weeks, at least 24 weeks, at least 26 weeks, at least 30 weeks, at least 36 weeks, at least 42 weeks, or at least 52 weeks after the administering step.
- the disclosure provides a synthetic microorganism for durably replacing an undesirable microorganism in a subject.
- the synthetic microorganism comprises a molecular modification designed to enhance safety by reducing the risk of systemic infection.
- the molecular modification causes a significant reduction in growth or cell death of the synthetic microorganism in response to blood, serum, or plasma.
- the synthetic microorganism may be used in methods and compositions for preventing or reducing recurrence of dermal or mucosal colonization or recolonization of an undesirable microorganism in a subject.
- the disclosure provides a synthetic microorganism for use in compositions and methods for treating or preventing, reducing the risk of, or reducing the likelihood of colonization, or recolonization, systemic infection, bacteremia, or endocarditis caused by an undesirable microorganism in a subject.
- the disclosure provides a synthetic microorganism comprising a recombinant nucleotide comprising at least one kill switch molecular modification comprising a first cell death gene operatively associated with a first regulatory region comprising an inducible first promoter, wherein the first inducible promoter exhibits conditionally high level gene expression of the recombinant nucleotide in response to exposure to blood, serum, or plasma of at least three fold increase of basal productivity.
- the inducible first promoter exhibits, comprises, is derived from, or is selected from a gene that exhibits upregulation of at least 5-fold, at least lO-fold, at least 20-fold, at least 50-fold, or at least lOO-fold within at least 30 min, 60 min, 90 min, 120 min, 180 min, 240 min, 300 min, or at least 360 min following exposure to blood, serum, or plasma.
- the synthetic microorganism comprises a kill switch molecular modification comprising a first cell death gene operably linked to a first regulatory region comprising a inducible first promoter, wherein the first promoter is activated (induced) by a change in state in the microorganism environment in contradistinction to the normal physiological (niche) conditions at the at least one site in the subject.
- the synthetic microorganism further comprises an expression clamp molecular modification comprising an antitoxin gene specific for the first cell death gene or a product thereof, wherein the antitoxin gene is operably associated with a second regulatory region comprising a second promoter which is constitutive or active upon dermal or mucosal colonization or in a complete media, but is not induced, induced less than 1.5-fold, or is repressed after exposure to blood, serum or plasma for at least 30 minutes.
- the second promoter is active upon dermal or mucosal colonization or in TSB media, but is repressed by at least 2 fold upon exposure to blood, serum or plasma after a period of time of at least 30 min, 60 min, 90 min, 120 min, 180 min, 240 min, 300 min, or at least 360 min.
- the synthetic microorganism exhibits measurable average cell death of at least 50% cfu reduction within at least 1, 5, 15, 30, 60, 90, 120, 180, 240, 300, or 360 minutes following exposure to blood, serum, or plasma. In some embodiments, the synthetic microorganism exhibits measurable average cell death of at least 70%, at least 80%, at least 90%, at least 95%, at least 99%, at least 99.5%, at least 99.8%, or at least 99.9% cfu count reduction within at least 1, 5, 15, 30, 60, 90, 120, 180, 240, 300, or 360 minutes following exposure to blood, serum, or plasma.
- the synthetic microorganism comprises a kill switch molecular modification that reduces or prevents infectious growth of the synthetic microorganism under systemic conditions in a subject.
- the synthetic microorganism comprises at least one molecular modification that is integrated to a chromosome of the synthetic microorganism.
- the synthetic microorganism is derived from a target microorganism having the same genus and species as an undesirable microorganism.
- the target microorganism is susceptible to at least one antimicrobial agent.
- the target microorganism is selected from a bacterial, fungal, or protozoal target microorganism.
- the target microorganism is capable of colonizing a dermal and/or mucosal niche.
- the target microorganism has the ability to biomically integrate with the decolonized host microbiome.
- the synthetic microorganism is derived from a target microorganism isolated from the host microbiome.
- the target microorganism is selected from a bacterial, fungal, or protozoal target microorganism.
- the target microorganism that is a member of a genus selected from the group consisting of Acinetobacter, Corynebacterium, Cutibacterium, Staphylococcus, Streptococcus , Propionibacterium, and Pseudomonas.
- the target microorganism is a bacterial species capable of colonizing a dermal and/or mucosal niche and is a member of a genus selected from the group consisting of Acinetobacter, Corynebacterium, Cutibacterium, Staphylococcus, Streptococcus , Propionibacterium, and Pseudomonas.
- the target microorganism is selected from the group consisting of Acinetobacter johnsonii, Acinetobacter baumannii, Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus lugdunensis, Staphylococcus warneri, Staphylococcus saprophyticus, Corynebacterium acnes, Corynebacterium striatum, Corynebacterium diphtheriae, Corynebacterium minutissimum, Cutibacterium acnes, Propionibacterium acnes, Propionibacterium granulosum, Streptococcus pyogenes, Streptococcus aureus, Streptococcus agalactiae, Streptococcus mitis, Streptococcus viridans, Streptococcus pneumoniae, Streptococcus anginosis, Steptococcus constellatus, Streptoco
- a synthetic microorganism is provided that is derived from a Staphylococcus aureus strain.
- the target strain is a Staphylococcus aureus 502a strain or RN4220 strain.
- the synthetic microorganism comprises a kill switch molecular modification comprising a cell death gene selected from the group consisting of sprA /, sprA2, kpn I, smal, sprG, relF, rsaE, yoeB, mazF, yefhJ or lysostaphin toxin gene.
- the cell death gene comprises a nucleotide sequence selected from the group consisting of SEQ ID NOs: 122, 124, 125, 126, 127, 128, 274, 275, 284, 286, 288, 290, 315, and 317, or a substantially identical nucleotide sequence.
- the inducible first promoter is a blood, serum, and/or plasma responsive promoter.
- the first promoter is upregulated by at least 1.5 fold, at least 3-fold, at least 5-fold, at least lO-fold, at least 20-fold, at least 50-fold, or at least lOO-fold within a period of time selected from the group consisting of at least 30 min, 60 min, 90 min, 120 min, 180 min, 240 min, 300 min, and at least 360 min following exposure to human blood, serum or plasma.
- the first promoter is not induced, induced less than 1.5 fold, or is repressed in the absence of the change of state.
- the first promoter is induced at least 1.5, 2, 3, 4, 5 or at least 6 fold within a period of time in the presence of serum, blood or plasma. In some embodiments, the first promoter is not induced, induced less than 1.5 fold, or repressed under the normal physiological (niche) conditions at the at least one site.
- the inducible first promoter comprises or is derived from a gene selected from the group consisting of isdA (iron-regulated surface determinant protein A), isdB (iron-regulated surface determinant protein B), isdG (heme-degrading monooxygenase), hlgA (gamma-hemolysin component A), hlgAl (gamma-hemolysin), hlgA2 (gamma-hemolysin), hlgB (gamma-hemolysin component B), hrtAB (heme- regulated transporter), sbnC (luc C family siderophore biosyntheis protein), sbnD, sbnl, sbnE (lucA/lucC family siderophore biosynthesis protein), isdl, IrgA (murein hydrolase regulator A), IrgB (murein hydrolase regulator B), ear (Ear protein), fti
- isdA iron-regulated
- the inducible first promoter comprises a nucleotide sequence selected from the group consisting of SEQ ID NO: 114, 115, 119, 120, 121, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, and 163, or a substantially identical nucleotide sequence thereof.
- the synthetic microorganism comprises an expression clamp molecular modification comprising a second promoter operatively associated with an antitoxin gene that encodes an antisense RNA sequence capable of hybridizing with at least a portion of the first cell death gene.
- the antitoxin gene encodes an antisense RNA sequence capable of hybridizing with at least a portion of the first cell death gene.
- the antitoxin gene is selected from the group consisting of a sprAl antitoxin gene, sprA2 antitoxin gene, sprG antitoxin gene or sprF, holin antitoxin gene, l874ysK antitoxin gene, yefM antitoxin gene, lysostaphin antitoxin gene, or mazE antitoxin gene, kpnl antitoxin gene, smal antitoxin gene, relF antitoxin gene, rsaE antitoxin gene, or yoeB antitoxin gene, respectively.
- the antitoxin gene comprises a nucleotide sequence selected from the group consisting of SEQ ID NOs: 273, 306, 307, 308, 309, 310, 311, 312, 314, 319, or 322, or a substantially identical nucleotide sequence.
- the second promoter is a P C/ /B (clumping factor B) that comprises a nucleotide sequence of SEQ ID NO: 117, 118, 129 or 130, or a substantially identical nucleotide sequence thereof.
- the synthetic microorganism comprises a virulence block molecular modification, and/or a nanofactory molecular modification.
- the virulence block molecular modification prevents horizontal gene transfer of genetic material from the undesirable microorganism.
- the nanofactory molecular modification comprises an insertion of a gene that encodes, a knock out of a gene that encodes, or a genetic modification of a gene that encodes a product selected from the group consisting of an enzyme, amino acid, metabolic intermediate, and a small molecule.
- the disclosure provides a composition comprising an effective amount of a synthetic microorganism according to the disclosure and a pharmaceutically acceptable carrier, diluent, emollient, binder, excipient, lubricant, sweetening agent, flavoring agent, wetting agent, preservative, buffer, or absorbent, or a combination thereof.
- the composition further comprises a promoting agent.
- the promoting agent is selected from a nutrient, prebiotic, commensal, and/or probiotic bacterial species.
- the disclosure provides a single dose unit comprising a composition or synthetic microorganism of the disclosure.
- the single dose unit comprises at least at least about 10 5 , at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , at least 10 10 CFU, or at least 10 11 of the synthetic strain and a pharmaceutically acceptable carrier.
- the single dose unit is formulated for topical administration.
- the single dose unit is formulated for dermal or mucosal administration.
- the disclosure provides a synthetic microorganism, composition according to the disclosure for use in the manufacture of a medicament for use in a method eliminating, preventing, or reducing the risk of the recurrence of a undesirable microorganism in a subject.
- the disclosure provides a kit for preventing or reducing recurrence of dermal or mucosal colonization or recolonization of an undesirable microorganism in a subject, the kit comprising in at least one container, comprising a synthetic microorganism, composition, or single dose of the disclosure, and optionally one or more additional components selected from a second container comprising a decolonizing agent, a sheet of instructions, at least a third container comprising a promoting agent, and/or an applicator.
- FIG. 1 shows a diagram of a representative molecular modification inserted to a Staphyloccoccus aureus , e.g., BioPlx-Ol, to create a synthetic microorganism BioPlx strain.
- a cassette comprising the molecular modification comprises a kill switch and an expression clamp, including expression clamp (e.g., ClfB) promoter cloned to drive expression of the SprAl antisense (antitoxin) RNA wherein the cassette is incorporated into the same expression module from a kill switch comprising a serum-responsive promoter (e.g ⁇ Pw ⁇ ) operably associated with SprAl toxin gene.
- serum/blood exposure activates the toxin (e.g., up to 350-fold or more) but not the antitoxin, and growth in TSB or on the skin activates antitoxin but not toxin.
- FIG. 2 shows shuttle vector PCN51 used to clone genes into an E coli - Staphylococcus aureus pass-through strain (IM08B) for transfection of the vector into BioPlx-Ol for evaluation.
- IM08B E coli - Staphylococcus aureus pass-through strain
- FIGs. 3A-3C shows Table 4A with primer sequences for recombinant construction of synthetic Staphylococcus aureus from strain BioPlx-Ol.
- FIGs. 4A-4D shows Table 4Bwith primer sequences for CRISPR construction of synthetic Staphylococcus aureus from strain BioPlx-Ol.
- FIG. 5A shows a genetic map of a pKORl Integrative Plasmid depicting the repF( replication gene of pEl94ts), secY570 (N-terminal 570 nucleotides of secY including ribosome binding site), cat (chloramphenicol acetyltransferase), attP (page lambda attachment site), ori(-) (ColEl plasmid replication origin), and bla (b-lactamase). (+) or (-) indicates functions in gram positive (+) or gram negative (-) bacteria.
- the Pxyl/tetO promoter and the transcription direction of the promoter are indicated by an arrow.
- FIG. 5B shows a genetic map of a pIMAY Integrative Plasmid (accession number JQ62198).
- FIG. 6 shows fold-induction of the H IgA (gamma hemolysin) promoter candidate in a methicillin-susceptible Staphylococcus aureus strain BioPlx-Ol by incubation with human serum. Expression was normalized to a housekeeping gene (gyrB ) and was compared with that in cells growing logarithmically in liquid TSB media.
- H IgA gamma hemolysin
- FIG. 7 shows fold-induction of the S stA (iron transport) promoter candidate in a methicillin-susceptible Staphyococcus aureus strain BioPlx-Ol by incubation with human serum. Expression was normalized to a housekeeping gene ⁇ GyrB) and was compared with that in cells growing logarithmically in liquid TSB media.
- S stA iron transport
- FIG. 8 shows CRISPR gRNA target site intergenic region identified between 1, 102,100 and 1, 102,700 bp in the Staphylococcus aureus 502a genome, GenBank: CP007454.1.
- FIG. 9 shows a representative screen shot of CRISPRScan used to find putative gRNAs for use in CRISPR methods.
- FIG. 10 shows cassette for integration via CRISPR and layout of the pCasSA vector.
- CaplA is a constitutive promoter controlling gRNA transcription.
- Target seq is targeting sequence, for example, with 10 possible cutting targets (1.1, 1.2 etc.).
- sgRNA is single-strand guide RNA (provides structural component).
- Xbal and Xhol are two restriction sites used to add the HA’s to the pCasSA vector.
- HAs are homologous arms to use as templates for homology directed repair (typically 200 - 1000 bp).
- P 7 «/ .-mCherry is a constitutive promoter controlling the “optimized” mCherry.
- P, 7 «/ -Cas9 is a constitutive promoter controlling Cas9 protein expression.
- FIG. 11 shows vectors for use in the present disclosure.
- A is a vector used for promoter screen with fluorescence using pCN5 l .
- B is a vector for promoter screen with cell death gene.
- C is a vector for chromosomal integration using CRISPR.
- D is a vector for chromosomal integration using homologous recombination.
- Left & Right (or upstream and downstream) HA homology arms to genomic target locus
- CRISPR targeting RNA guide to genomic locus
- mCherry fluorescent reporter protein
- Cas9 protein CRISPR endonuclease
- kanR kanamycin resistance
- oriT origin of transfer (for integration)
- smal ⁇ representative kill gene (restriction endonuclease).
- FIG. 12A-12C shows nucleotide sequence (SEQ ID NO: 131) of pIMAY Integrative Plasmid (accession number JQ62198).
- FIG. 13 A shows activity of promoter candidates isdA, isdB, hlgA2, hrtAB, isdG, sbnE, lrgA, lrgB, fhuA, fhuB, ear, hlb, splF, splD, dps, and SAUSA300_26l7 at 1 min, 15 min and 45 min in serum and fold changes in gene expression vs. media by qPCR.
- FIG. 13B shows activity of promoter candidates isdA, isdB, hlgA2, hrtAB, isdG, sbnE, lrgA, lrgB, fhuA, fhuB, ear, hlb, splF, splD, dps, and SAETSA300_26l7 at 1 min, 15 min and 45 min in blood and fold changes in gene expression vs. media by qPCR.
- FIG. 14 shows inducible inhibition of cell growth of synthetic microorganism pTKl cells comprising a cell death toxin gene (sprAl) behind a cadmium promoter on a pCN5 l plasmid (pTKl) which had been transformed into Staphylococcus aureus RN4220 cells.
- OD 630 nm
- Wild-type 4220 cells showed good cell growth both in the absence of cadmium and in the presence of 500 nM and 1 uM cadmium.
- pTKl-l and pTKl-2 cells showed good growth in the absence of cadmium, but cell growth was significantly inhibited in presence of 500 nM and 1 uM cadmium at 2 hours post induction.
- FIG. 15A shows a plasmid map of pl74 (pRABl l Ptet- sprAl) zoomed view of the region of the plasmid containing the Ptet-sprA cassette.
- FIG. 15B shows the pl74 (pRABl l Ptet- sprAl) whole plasmid in its native circular form.
- FIG. 15C shows photographs of plate dilutions at 6 hours synthetic microorganism Staphylococcus aureus 502a pl74 cells comprising a cell death toxin gene (sprAl) behind an anhydrotetracycline promoter on a pRABl 1-2 plasmid (pl74) which had been transformed into Staphylococcus aureus 502a cells.
- Plate dilutions at l0e-5 are shown after 6 hours of induction for uninduced (left) and induced (right) 502a p 174 (tet-spralDas) cells on BHI chlorlO.
- the plate on the left (ETninduced) was uncountable at l0e-5 but at lOe- 6 counted ⁇ 720 colonies.
- the induced plate on the right at l0e-5 produced 16 colonies.
- the survival percentage of induced cells at 6 hours post induction was 0.22%.
- FIG. 16 shows cell growth pre- and post-induction of four synthetic strains derived from Staphylococcus aureus 502a having a plasmid based inducible expression system comprising four different cell death gene candidates sprAl, l87-lysK, Holin, and sprG.
- the candidate cell death genes had been cloned behind an tetracycline inducible promoter on pRABl 1 plasmids and transformed into Staphylococcus aureus 502a cells.
- BP 068 sprAl
- BP 069 l87lysK
- BP 070 holin
- BP 068 sprAl
- BP 069 l87lysK
- BP 070 hindered growth post- induction
- BP 068 exhibited the best inhibition of cell growth 240 min post-induction, so the sprAl gene was selected for initial further development of a kill switch in Staphylococcus aureus 502a.
- FIG. 18 shows GFP expression fold change of induced (+) and uninduced (-) subcultures of Staphylococcus aureus strains BP 001, BP 055 and BP 076.
- FIG. 19 shows a map of the genome for Strain BP 076 (SA 502a, AsprAl : :Ptet- GFP).
- FIG. 20 shows a map of plasmid constructed for making genomic integration in Staphylococcus aureus.
- FIG. 21 shows a map of PsbnA-sprAl kill switch in Staphylococcus aureus 502a genome.
- Serum and blood responsive promoter PisdB is operably linked to sprAl toxin cell death gene.
- FIG. 22 shows a map of a kill switch construction using serum and blood responsive promoter PisdB operably linked to sprAl toxin cell death gene and an expression clamp comprising a second promoter clfB operably linked to sprA AS to prevent leaky expression of the toxin in the absence of blood or serum.
- the kill switch is incorporated to the Staphylococcus aureus 502a genome.
- FIG. 23 shows a growth curve of three strains when exposed to human serum compared to TSB: 502a - Staphylococcus aureus wild type, Staphylococcus aureus BP_0l l - 502a AsprA 1 -sprA 1 (AS), and Staphylococcus aureus BP_084 - 502a APsprA: :PsbnA in which the kill switch is integrated to the genome of Staphylococcus aureus 502a.
- the dashed lines represent the strains grown in serum, and the solid lines represent the strains grown in TSB.
- the strain BP 084 with the integrated kill switch shows a growth curve that is significantly reduced compared to the wild type in serum and the kill switch in complex media.
- the Staphylococcus aureus BP 084 (502a APsprA: :PsbnA) cells exhibited 98.84% measurable average cell death compared to the same BP 084 cells in TSB.
- the present disclosure relies upon a principle known as "bacterial replacement”, or “niche exclusion”, where one microorganism replaces and excludes another.
- bacterial replacement or “niche exclusion”
- Gause competitive exclusion
- the microbiome is a dermal and/or mucosal microbiome (Exobiome). While methods to treat infection by a pathogenic microorganism exist, methods to prevent recurrence are effectively nonexistent.
- Staphylococcus aureus exists on the skin or inside the nostrils of 40-44% of healthy people. Staphylococcus aureus is also sometimes found in the mouth, gastrointestinal, genitourinary, and upper respiratory tracts.
- BioPlx-OlWT® A Staphylococcus aureus 502a WT strain called BioPlx-OlWT® is employed in example 1 and is a natural“wild-type” organism known to be relatively non- infectious, and which has no known side effects. It has been shown in BioPlx clinical studies to be highly effective in this intended application (occupying and blocking the required microbiomic niche to prevent the recurrence of MRS A).
- the present methods prevent infection by durably replacing the (typically virulent and antibiotic-resistant) colonizing undesirable Staphylococcus aureus strain with a“blocking" organism - in this study the BioPlxOl-WT Staphylococcus aureus 502a WT strain. This phenomenon is expected to be applied in a similar manner for any other pathogen replacement organism developed by BioPlx.
- Methicillin-resistant Staphylococcus aureus refers to a class of antibiotic resistant variants of this common human commensal and sometimes pathogenic bacteria. It varies from the wild-type strain (MSSA - Methicillin Sensitive Staphylococcus aureus) by its carriage of a mecA cassette that allows MRSA strains to produce an alternate penicillin binding protein (PBP2A) that renders them resistant to treatment with most beta lactam and many other first-line antibiotics.
- MSSA Methicillin-resistant Staphylococcus aureus
- MRSA Methicillin-Resistant Staphylococcus aureus
- vMSSA Virulent Methicillin-Susceptible Staphylococcus aureus
- the present disclosure uses a generally passive strain of Staphylococcus aureus to replace and exclude MRSA or vMSSA from its usual place in the dermal/mucosal microbiome.
- the wild type interfering Staphylococcus aureus used by BioPlx is known to be poor at causing systemic disease, however, regardless of the level of variance or invasiveness virtually any microorganism can become an "accidental pathogen" through natural or accidental inoculation. This is particularly true in the case of Staphylococcus aureus.
- Staphylococcus aureus infections are a severe problem in both hospitals and community health settings.
- Methicillin-resistant Staphylococcus aureus (MRSA) is genetically different from other strains of Staphylococcus aureus , with genetic elements conferring resistance to the antibiotic methicillin and other (usually beta-lactam) antibiotics typically used to treat Staphylococcus aureus infections.
- MRSA strains carry a mecA expression cassette that allows MRSA strains to produce an alternate penicillin binding protein (PBP2A), and it’s this mutation that confers resistance. Due to this resistance, MRSA is difficult to treat, making it a life-threatening problem in many cases.
- PBP2A penicillin binding protein
- MRS A is frequently contracted in hospitals or other types of healthcare settings (Hospital Associated [HA]). These infections typically occur at the time of an invasive procedure such as surgery, intravenous catheterization, intubation, or artificial joint placement.
- HA Hospital Associated
- CA Community-associated MRSA is typically spread by skin-to-skin contact, and the first symptoms tend to be large boils on the skin.
- the BioPlx method using BioPlx strains is not a treatment for invasive MRSA disease, and therefore is not intentionally applied to a patient during the invasive disease state.
- the benefits of the BioPlx method can be demonstrated in a patient group that: 1) is at high risk for invasive disease, 2) has high morbidity and mortality from this increased risk to show significant clinical benefit, and has no other effective options for the prevention of invasive Staphylococcus aureus disease.
- the surface of the human skin and mucosal layer where Staphylococcus aureus resides in the colonization state has a very different level of required nutrients as well as different environmental qualities than that inside the human body. It has been widely recognized that in order for bacteria to be successfully invasive, they must be able to adjust their needs and responses between the colonization and invasive states. This is accomplished by the bacterium sensing the changes between these environments and switching on or off certain gene cassettes allowing for the production of proteins more adapted to the new invasive state.
- BioPlx method and specifically BioPlxOl strains, take advantage of this requirement by rearranging molecular instructions leading to the death of the organism in the operons of one or more of these specific cassettes. This creates a“holding strain” of colonizing Staphylococcus aureus that is unable to cause disease in the patient to whom it is introduced, but also does not allow other circulating Staphylococcus aureus strains that may normally colonize the human population to colonize this patient. This occurs through the ecological premise of competitive exclusion.
- the current“Standard of Care” for patients colonized with MRSA is not uniform.
- MRSA disease and colonization is a complicated epidemiologic problem for both the United States and the rest of the world.
- the manifestations of MRSA are broad from asymptomatic colonization to invasive disease states conferring high mortality and cost to the system.
- MRSA patients that have experienced invasive disease is medically distinct. They have a higher mortality than any other MRSA subpopulation. They have a higher treatment failure rate. They have a much higher risk for another invasive MRSA incident than any other group of patients. This makes this group an appropriate orphan group toward which the BioPlx method should be directed, and which would benefit from its use.
- decolonization is largely ineffective in durably clearing MRSA colonization, and leads to a high rate of recurrence.
- decolonization in conjunction with active recolonization provides long term conversion from one organism (variant) to another.
- Another indication is“prevention of recurrent invasive MRSA.” Patients who have already experienced an episode of invasive MRSA infection have a greatly increased susceptibility to a subsequent invasive MRSA infection.
- the BioPlx technology provided herein works by occupying the niche in the microbiome that would normally have the potential to be occupied by a virulent form of MRS A.
- SA including the variant MRS A, can exist in harmless coexistence on the surface of the skin and mucous membranes of at least 40% of all civilization, so the bacterium itself is not descriptive of disease; rather, its clinical presentation is definitional.
- MRSA To create invasive infectious disease, MRSA must abandon its passive commensal status, and breach the dermal/mucosal barrier, entering into the subdermal interstitial (interstitial fluid) or circulatory (blood, serum, plasma) areas. This“state change” initiates a new disease state, with new organism behaviors and relationships to the host.
- Staphylococcus aureus bacteremia is an important instance of this type of infection with an incidence rate ranging from 20 to 50 cases/lOO, 000 population per year (ranging from 64,600 to 161,500 cases per year). Between 10% and 30% of these patients will die from SAB. Invasive systemic MRSA bacteremia has a mortality rate of around 20%. Comparatively, this accounts for a greater number of deaths than for AIDS, tuberculosis, and viral hepatitis combined.
- Staphylococcus aureus is a normal commensal organism permanently colonizing around one third of the human population, with transient colonization occurring in about one additional third of the population.
- MRSA variants of this organism occupy organism the microbiome niche, and have colonized approximately 2% of the population in the US (with a high degree of variability depending on location and occupation). MRSA colonization creates a standing reservoir of potentially infectious organisms located directly on the outer layer of our immune/defense system, and this poses an ongoing risk to the patient.
- MRSA or skin and soft tissue infection is the most common of the two major disease state categories. It typically starts as a swollen, pus or fluid filled, boil that can be painful and warm to the touch, and at times accompanied by a fever. If left untreated, these boils can turn into abscesses that require surgical intervention for draining. For MRSA that’s confined to the skin, surgical draining of abscesses may be the only necessary treatment, and antibiotics are not indicated. Skin and soft tissue infections are treated by surgically draining the boil and only administering antibiotics when deemed absolutely necessary.
- MRSA bacteremia is a systemic MRSA infection that is defined as the presence of MRSA in typically sterile sites, including the bloodstream, cerebrospinal fluid, joint fluid, bone, lower respiratory tract, and other body fluids. MRSA bacteremia has a far worse prognosis compared to MRSA infections confined to the skin, with 20% of cases resulting in death. The difference in prognosis, location of the infection, and clinical symptoms of the condition make it clinically distinct from skin and soft tissue infection MRSA infections. MRSA bacteremia causes multiple complications not seen in skin and soft tissue infections, including infective endocarditis, septic arthritis, and osteomyelitis.
- the BioPlx technology works by preventing the recurrence of an invasive MRSA infection in those who have been colonized (including those that have already experienced an invasive MRSA infection) and who have undergone a decolonization procedure.
- the BioPlx technology would not be administered to“treat” a patient while they had a systemic MRSA infection. It would be applied subsequent to the clearance of a systemic MRSA infection (and a full body decolonization).
- MRSA-mediated systemic bacteremia (or other designations of invasive systemic disease) is unambiguously distinct from the other superficial skin and mucosal conditions that may be caused by, or associated with, MRSA, or by other Staphylococcus aureus strains. Invasive systemic MRSA-mediated disease has a clearly distinct diagnosis, pathology, treatment, and prognosis profile.
- a clear definition of this disease is put forth by the Centers for Disease Control and Prevention (CDC) as it has been actively monitoring this condition in the United States since 2005. The agency performs this monitoring utilizing the Active Bacterial Core surveillance system via the Emerging Infections Program (EIP).
- EIP Emerging Infections Program
- a case in this context is defined by the isolation of MRSA from a normally sterile body site. Normally sterile sites included blood, cerebrospinal fluid, pleural fluid, pericardial fluid, peritoneal fluid Joint/ synovial fluid, bone, internal body site (lymph node, brain, heart, liver, spleen, vitreous fluid, kidney, pancreas, or ovary), or other normally sterile sites.
- the CDC also created the National Healthcare Safety Network (NHSN) as a tracking system for more than 16,000 US healthcare facilities to provide data to guide prevention efforts.
- NHSN National Healthcare Safety Network
- CMS Center for Medicare Services
- CMS payers use this data to determine financial incentives to healthcare facilities for performance.
- the system tracks MRSA bloodstream infections as a marker for invasive disease for epidemiologic purposes.
- the MRSA mediated invasive disease state is also codified in the ICD9 and ICD10 system by a grouping of conditions each with their own numeric code specific for the causative agent MRSA.
- MRSA causative agent
- sepsis due to MRSA is coded A41.02
- pneumonia due to MRSA is coded J 15.212.
- This further exemplifies the differential characterization that invasive MRSA disease is given in juxtaposition to superficial skin and soft tissue disease due to the same agent - code L03.114 (left upper limb example) with the follow code of B95.6 MRSA as the cause of disease classified elsewhere, which is attached to a variety of other infection codes to indicate MRSA as the cause of the disease condition.
- ECDC European Center for Disease Control
- the target orphan disease population targeted for the BioPlx non-recurrence method is the group of people previously invasively infected (systemic infection) with MRSA (a population known to be susceptible), and who continue to suffer ongoing recolonization with MRSA. CDC monitors all U.S. cases of invasive MRSA infection. Multiple researchers have described this medically distinct population - patients who have already suffered one defined episode of invasive MRSA infection. This group is at increased risk for life threatening invasive disease as a result of their demonstrated susceptibility and their continued colonization.
- a method for preventing recolonization, or preventing recurrence of MRSA-caused systemic invasive bacteremia comprising prevention of (or prevention of recurrence of) a prerequisite MRSA colonization by
- SA is present as part of the normal microbiome of more than 40% of the total human population.
- the MSSA colonization state is common.
- the MRSA variant is found on around 1-2% of the US population, but in certain areas or demographics this level can be considerably higher. It is thought that MRSA has the ability colonize anyone within the Staphylococcus aureus susceptible population. Staphylococcus aureus lives most commonly on the surface of the skin and in the anterior nasal vestibules, but can also be found in smaller amounts in the deep oropharynx and gastrointestinal tract and in normal vaginal flora in some individuals.
- Staphylococcus aureus usually remains a non- invasive commensal bacterium simply occupying an ecological niche and not causing disease. In a portion of those colonized however, this bacteria can cause disease either opportunistically or as a result of the increased likelihood of invasion due to some particular variant characteristics.
- MRSA was identified by British scientists in 1961 and the first American clinical case was documented in 1968. For the next 25 years, MRSA was regarded largely as an endemic hospital-based problem that was increasing in incidence, however starting in the mid to late l990s, an increase of incidence of community-associated MRSA was seen mostly manifesting in superficial skin and soft tissue infections. Of greatest concern to the medical community has been the increase in invasive infections caused by MRSA. The increasing trend in incidence of invasive MRSA disease was seen throughout the l990s and peaked in 2005.
- the CDC tracks the incidence of invasive MRSA disease through the NHSN and the Emerging Infections Program - Active Bacterial Core surveillance system also starting in 2005. As compared to 2005, 2015 data shows that the overall incidence for invasive MRSA disease has decreased almost 50% from an incidence rate of 37.56 to 18.8. Expensive and laborious infection control interventions enacted in hospitals in response to this public health crisis has been given much of the credit for the decreased incidence, as the majority of the gain was seen in health care associated cases as opposed to community associated ones. Despite the gains that have been made over the past decade, invasive MRSA infections continue to be a prioritized public health issue. These infections can be very difficult to treat and treatment failure has been shown in nearly 25% of patients on proper therapy. Predicting which health care experienced patients are at risk for invasive MRSA is a challenging problem. Risk factors such as MRSA colonization, the presence of chronic open wounds and the presence of invasive devices have been elucidated.
- MRSA Invasive MRSA and skin and soft tissue infection from MRSA are both caused by the same pathogen. However, orphan designations are awarded based on the dyad of drug and disease. MRSA is a pathogen, and not a disease state. However, it can cause infection, and it’s these different types of infectious disease that are being treated. Invasive MRSA comes with a far more severe prognosis as well as different clinical manifestations from MRSA confined to the skin or simply being colonized with MRSA. About 40% of the U.S. population is colonized with Staphylococcus aureus , typically found in the nose or on the skin.
- systemic MRSA infection will manifest as high grade fever, chills, dizziness, chest pain, swelling of the affected area, headache, rash, cough, and other systemic symptoms. These two conditions are treated differently, where skin and soft tissue infections are typically treated by incising and draining the boils commonly associated with skin and soft tissue infections. Antibiotics and decolonization are only employed if there are signs of systemic or severe disease that has spread to multiple sites.
- Invasive MRSA has an incidence rate of 20 to 50 cases/lOO, 000 people per year. 63 With a current U.S. population of 326,199,002 (accessed on November 2, 2017 from www.census.gov/popclock), this means there are 163, 100 cases of invasive MRSA infection in the U.S. per year conservatively, falling below the 200,000 patient criteria for FDA orphan designation. We searched for other sources of reported prevalence to confirm that we had calculated the most conservative estimate of this patient population. Hassoun et. al reported an incidence of 72,444 cases of invasive MRSA in the U.S. in 2014, which had decreased from 111,261 in 2005.
- BioPlxOl strains molecularly-altered strains of Staphylococcus aureus that are unable to cause disease but can reside in the microbiome niche that MRSA could take hold in.
- the lack of invasiveness of BioPlxOl strains is made possible by operons that are turned on upon contact with blood or plasma, triggering the death of the organism.
- a patient who has tested positive for MRSA and is experiencing systemic symptoms will undergo a full body decolonization before the BioPlxOl strain is administered, allowing it to occupy the niche that MRSA would have previously occupied in that patient’s microbiome.
- BioPlxOl strain is able to prevent recurrent systemic MRSA infections.
- a method for treatment of Staphylococcus aureus lung infections in patients with cystic fibrosis is provided.
- a method for treatment of Invasive Bacteremia is provided.
- Invasive Bacteremia is indicated by the isolation of bacteria from a normally sterile body site. These may include blood, CSF, joint fluid, bone samples, lower respiratory tract samples and other sterile body fluids. This condition is related to, but is clearly distinguished from, simple bacterial colonization and bacteria mediated skin and soft tissue infection. It is accepted that the colonization state is a prerequisite for invasive disease in the vast majority of cases.
- MRSA Invasive Bacterial Infection may also be referred to commonly or in the literature as: MRSA bacteremia or sepsis, Systemic MRSA infection, MRSA bloodstream infections, invasive MRSA infection.
- MRSA bacteremia or sepsis Mediated by Staphylococcus aureus , MRSA Invasive Bacterial Infection may also be referred to commonly or in the literature as: MRSA bacteremia or sepsis, Systemic MRSA infection, MRSA bloodstream infections, invasive MRSA infection.
- Specific MRSA induced systemic conditions range from osteomyelitis, septic arthritis, pneumonia, endocarditis, bacteremia, toxic shock syndrome, to septic shock.
- One objective of the present disclosure is to evaluate the BioPlx-Ol WT materiaTs ability to prevent the recurrence of MRSA in active healthy adult medical workers. This population is particularly at-risk for MRSA infection and has amongst the highest rates of MRSA colonization of any demographic. Successfully demonstrating a protective effect for this group would validate BioPlx-Ol WT’s efficacy in being able to prevent MRSA recurrence amongst effectively all those who are at risk.
- Recurrence simply means“the bug comes back”. Recurrence is of central importance to both disease evolution and control. With recurrence, the pathogen comes back again and again, and each time it goes through a survival cycle it“learns” to be more and more resistant to the antibiotics it has seen. Without this recurrence, once the pathogen is gone, it would stay gone, and that would be that. If there were no recurrence, there would be no pressure to evolve toward antibiotic resistance.
- the subject may be colonized with one or more pathogenic microorganisms.
- the undesirable microorganism is a drug-resistant pathogenic microorganism.
- the drug-resistant pathogenic microorganism may be selected from a Neisseria gonorrhoeae , fluconazole-resistant Candida, MRSA, drug-resistant Streptococcus pneumoniae, drug-resistant Tuberculosis, vancomycin-resistant Staphylococcus aureus , erythromycin-resistant Group A Streptococcus, and clindamycin-resistant Group B Streptococcus. https://www.cdc.gov/drugresistance/biggest_threats.html.
- the undesirable microorganism may be a drug- resistant pathogenic Staphylococcus aureus.
- Staphylococci are the most abundant skin-colonizing bacterial genus and the most important causes of nosocomial infections and community-associated skin infections.
- the species Staphylococcus aureus may cause fulminant infection, while infections by other staphylococcal species are mostly subacute. Colonization is usually a prerequisite for infection. Otto 2010, Expert Rev Dermatol 2010 Apr; 5(2): 183-195. However, not all invasive Staphylococcus aureus infections are preceded by detected colonization with identical strain.
- the non-correlative fraction may be explained either by the“direct inoculation” or“direct wound seeding” theory such as an intraoperative event from a second carrier, or incomplete detection of all of these patient’s Staphylococcus aureus strains in colonization or colonization with the invasive strain in the time since the initial colonization surveillance.
- SA is a common human commensal organism that is present (colonizes), typically without symptoms, in 30 to 50% of the (US) population.
- the asymptomatic carriage of Staphylococcus aureus by humans is the primary natural reservoir, although domestic animals, livestock, and fomites may serve as adjunctive reservoirs.
- Staphylococcus aureus There are many different strains of Staphylococcus aureus , many of which can also act as serious pathogens. Symptoms of Staphylococcus aureus infections can be diverse, ranging from none, to minor Skin and soft tissue infections, to invasive life-threatening systemic disease such as endovascular infections, pneumonia, septic arthritis, endocarditis, osteomyelitis, foreign-body infections, sepsis, toxic shock and endocarditis.
- the anterior nasal mucosa has traditionally been thought to be the most frequent site for the detection of colonization of healthy carriers with Staphylococcus aureus. Several sites may become asymptomatically colonized including the nares, throat, axilla, perineum, inguinal region, and rectum.
- MRSA isolates were once confined largely to hospitals, other health care environments, and patients frequenting these facilities. Since the mid- 1990s, however, there has been an explosion in the number of MRS A infections reported in populations lacking risk factors for exposure to the health care system. This increase in the incidence of MRS A infection has been associated with the recognition of new MRS A clones known as community-associated MRSA (CA-MRSA).
- CA-MRSA strains differ from the older, health care-associated MRSA strains; they infect a different group of patients, they cause different clinical syndromes, they differ in antimicrobial susceptibility patterns, they spread rapidly among healthy people in the community, and they frequently cause infections in health care environments as well. David, Michael et ah, 2010, Clin Microbiol Rev 23(3): 616-687.
- the pathogenic Staphylococcus aureus may be a drug-resistant Staphylococcus aureus , such as MRSA, or a vancomycin-resistant strain, such as VISA or VRSA.
- the pathogenic Staphylococcus aureus may be a virulent methicillin-susceptible Staphylococcus aureus (v-MSSA).
- v-MSSA is a high-virulence cause of life-threatening invasive infections. MRSA and v-MSSA are epidemic, and have a high human cost.
- MRSA has become a serious public health problem in hospitals, clinics, prisons, barracks, and even in gyms and health clubs around the world. MRSA is a common cause of hospital-acquired infections (500k US patients/year), and increasingly, of community acquired infections which can be serious. For systemically invasive disease - 20% of cases result in death. MRSA is one of the most significant of the new antibiotic-resistant "super-bugs". While methods to treat Staphylococcus aureus infection exist, methods to prevent recurrence are effectively nonexistent. Recurrence of MRSA skin infections is found in 31% to 45% of subjects.
- decolonization One effort to prevent recurrence includes decolonization.
- the first (and currently only) widely practiced step for preventing recurrence is decolonization.
- simple decolonization is poor at preventing recurrence.
- Doctors can initially treat the microbial colonization or infection-for example MRSA or v-MSSA colonization/infection- with topical chemicals (e.g. chlorhexidine) or antibiotics. In many cases treatment with antibiotics may“clinically” eliminate the disease.
- Antiseptics and astringents may be used for decolonization (i.e., suppression) including tea tree oil and chlorhexidine.
- Antibiotics used for suppression include topical antibiotics for nasal decolonization such as mupirocin.
- Systemic antibiotics most frequently used for MRSA include vancomycin, first generation antibiotics such as cefazolin, cepahalothin, or cephalexin; and new generation antibiotics such as linezolid or daptomycin.
- first generation antibiotics such as cefazolin, cepahalothin, or cephalexin
- new generation antibiotics such as linezolid or daptomycin.
- clindamycin or lincomycin may be employed. Nonetheless, with this decolonization alone the MRSA and v-MSSA pathogens typically recur-or grow back -nearly 1/2 of the time. This level of performance has naturally led to skepticism as to the efficacy of simple decolonization in preventing recurrence.
- the present disclosure provides methods and compositions focused on preventing recurrence through the effective and durable modification of microbiome populations.
- Methods for preventing or decreasing recurrence of a pathogenic microbial infection comprising suppressing a microbial infection or colonization.
- a method to decrease recurrence of a pathogenic infection or decrease colonization of a undesirable microorganism in a subject comprising decolonizing the undesirable microorganism on at least one site in the subject to significantly reduce or eliminate the presence of the undesirable microorganism from the site; and replacing the undesirable microorganism by administering to the subject a synthetic second microorganism having the same genus and species as the undesirable microorganism.
- the methods and compositions to prevent recurrence include replacement of the pathogenic microorganism by filling the biome niche occupied by the pathogen with a specially designed synthetic microorganism - or“good bug”. By occupying the same biome niche, the “good bug” crowds out the pathogen, preventing it from recolonizing, or moving into (or back into) its preferred ecological neighborhood.
- One way to ensure the same biome niche is filled is by designing a synthetic microorganism starting from the same genus and species as the pathogenic microorganism.
- the methods and compositions to prevent recurrence include promoting or supporting the synthetic microorganism - the“good bug” - by re-establishing key nutritional, chemical, or commensal environments that further promote the preferred organism and inhibit recolonization by the pathogen.
- a commensal cluster may provide further layered defense in preventing the pathogen from moving back into its old ecological niche - it may help prevent recurrence.
- BioPlx method is enabled by state of the art methods/technologies including microbiomics, systems & computational biology; environment interactions (clusters & signaling); proprietary organisms (selected & modified); and variant and strain substitution strategies.
- Replacement microorganisms are provided herein including (l)“BioPlx0l-WT® variant” - a Staphylococcus aureus 502a wild-type microorganism with an established history of non-virulence and passive colonization which has been isolated, verified, and prepared for field trials using this strain cluster as described in Example 1; (2)“BioPlxOl-KO® engineered variant”, a synthetic Staphylococcus aureus strain that enhances safety by knocking out specific virulence genes; and (3)“BioPlxOl- KS® engineered variant”, a synthetic Staphylococcus aureus strain that embeds a molecular programmed cell death trigger to prevent invasive virulence.
- the synthetic microorganism acts purely as a substitution for the pathogenic strain, without“new” infection or colonization.
- Methods for Computational Microbiology are also being developed including Machine Learning; Modeling of complex dynamic microbiomic systems; Genome/Transcriptome/Proteome (Phenotypic) relationships; Virulence factor genetics and promoters; Modeling resilience and changes over time/condition; n-dimensional niche-forming relationships; and High dimensional cluster relationships.
- non-co-colonization Central to the present model anti -recurrence method is the principle of “non-co-colonization”, meaning that only one species, and one variant of that species, can occupy the relevant skin or mucosal biome ecological niche at any one time. Underlying this simple and testable phenomenon are a host of deeper generative principles that combine to shape the emerging science of Microbiomics. Although widely generalizable, discussion of non-co-colonization in this section refers specifically to Staphylococcus aureus colonizations.
- non-co-colonization also known as "bacterial replacement” states that only one variant/strain of one species can occupy any given niche within the biome at any given time.
- Sustained species-to-species niche occupation is suspect because careful reading of the literature indicates that durability is low, and in vivo evidence is rare. A transient occupation may occur, but is not considered to be an important outcome, as we are only interested in durable outcomes.
- Non-co-colonization occurs in nature, for example, in the vast majority of cases only one variant of Staphylococcus aureus is detected within a single biome (over 95% of cases, with the balance likely caused by "transient conditions").
- cases 2 & 4 can be eliminated, because co-colonization occurs in under 5% (in literature), and even in these cases the vast majority of co- colonization instances observed involve only one other organism. Case 3 can be considered as possible in a low number of cases (less than 5%) potentially relating to incomplete or non-overlapping footprints of the niche vs replacement organism.
- a variant cluster may be used to "fill the slots" with alternatives so that the co-colonization favors a synthetic replacement microorganism rather than the original pathogen. While this may involve the use of a different replacement microorganism, this is not recurrence - this is further blocking of recurrence.
- Staphylococcus aureus colonization is a dynamic process with low prevalence of multiple Staphylococcus aureus strains vying for presence in the same niche over time.
- a simple calculation can establish that the observed results are not simply the independent occupation of a non-specific niche. In this instance, 1000 patients were screened and 360 were found to be Staphylococcus aureus positive. In a non specific niche scenario, .36 x .36, or 13%, (130 persons), would be expected to display co-colonization; however only 3.9% of the 360 carriers, (14 persons) at that primary point were in fact co-colonized, demonstrating the strain specificity of the microbiome niche for Staphylococcus aureus.
- a small percentage of Staphylococcus aureus carriers may be transiently colonized with two different strains of Staphylococcus aureus at any incident time point.
- Votintseva et al looked at all variants within MSSA and MRSA and reported point incidences of this phenomenon to be in the range of 3.4 - 5.8%.
- the paper looking only at mixtures of MRSA and MSSA (would only find species that differ at the mecA site) is predictably lower at 2.3%. If co-colonization was a stable state, mixtures of Staphylococcus aureus species would be expected in virtually all samples. This is not observed.
- Methods and compositions are provided to durably and safely prevent recurrence of a pathogenic microbial infection in a subject, comprising suppression of a pathogenic microorganism, replacement with a synthetic microorganism capable of occupying the same niche to durably exclude the pathogenic microorganism, and promotion of the synthetic microorganism for durable residence within the niche.
- This method is termed the BioPlx® method, as discussed above.
- the subject is found to be colonized with the pathogenic microorganism prior to the suppression step.
- a non-co-colonization model has been developed to provide context and establish target product characteristics.
- the rationale for the present technology rests on the Microbiomic paradigm (biome/ecosystem/niche), and on the Microbiome having certain persistent and verifiable characteristics.
- the key discoverable metric rests on co- colonization statistics in literature modified by specifics on decolonization, testing, and other relevant conditions, followed by direct observations from the clinical study of example 1.
- the skin microbiome in the subject is an entity, a persistent identifiable thing. Over 10,000 different species of microorganisms make up the skin microbiome.
- the skin biome is an ecosystem which may be defined as a system, or group of interconnected elements, formed by the interaction of a community of organisms with their environment.
- the skin microbiome ecosystem has a“healthy”, or“normal” base state.
- the biome can be “healthy” or“sick” (dysbiosis), and can be invaded by pathogenic organisms - in other words the Microbiome can be invaded by a“Bad Bug” - such as MRSA - it can also become infected or contaminated by undesirable organisms or variants (dysbiosis).
- Dysbiosis is a term for a microbial imbalance or maladaptation on or inside the body, such as an impaired microbiota.
- the skin microbiome has a structure created by a vast combinatorial web of relationships between the host and all of the components of the biome.
- the microbiome, or biome is a dynamically structured complex system and is an "elastically resilient" ecosystem.
- the skin microbiome has a dynamic but persistent structure - it is“resilient”, for example, even under conditions of massive cell death (e.g. washing, using ethanol, hand sanitizer, etc.) the biome regenerates in a similar form.
- the human microbiome has the quality of resilience meaning that mild perturbations tend to re-correct toward a previous established baseline of species mixture and concentration.
- members of each niche can be successfully challenged for their place in that stable mixture either as a result of an acute external disruptive event (i.e. an antimicrobial medication or an antiseptic application) or as a slow competitive replacement.
- resilience is the capacity of an ecosystem to respond to a perturbation or disturbance by resisting damage and recovering quickly.
- Resilience refers to ecosystem's stability and capability of tolerating disturbance and restoring itself.
- the microbiome operates in many ways like a multi -attractor complex system - it can changes its states or basins, but then the resilience associated with that attractor stabilizes that state.
- Ecological resilience is defined as the capacity of a system to absorb disturbance and reorganize while undergoing change so as to still retain essentially the same function, structure, identity and feedbacks.
- The“competitive exclusion principle” provides that complete competitors cannot exist.
- The“axiom of inequality” states that no two things or processes in a real world are precisely equal.
- long-term durability should only be achieved by close variant substitution, but would not likely be available with respect to species substitution.
- MRSA and MSSA can co colonize briefly - just like any other variants of Staphylococcus aureus can co-colonize in transient fashion. See DalT Antonia, M.
- Resilience may create recurrence - an observed natural phenomenon - as the existing (MRSA contaminated) biome tries to preserve itself.
- Commensal microflora normal microflora, indigenous microbiota
- the inventors have designed a method for obtaining a“passive" version of an organism or pathogen (same species) that is to be "replaced” or "excluded”.
- a biome ecosystem has a dynamic but “stable elastoplastic equilibrium”. Once perturbed the biome“tries” to return to equilibrium. At any given moment the biome ecosystem has an equilibrium "base state”. Even under conditions of stress or massive cell death (e.g. washing, using ethanol, hand sanitizer, etc.) the biome is observed to typically regenerate in a similar form.
- Microbiome ecosystems have“niches” defined by structure and internal and external interactions. One "fact” or “principal” of any biome structure is that different organisms occupy different "niches" in the biome, as defmed/allowed by the structure of relationships.
- An ecological“niche” is the role and position a species has in its environment; how it meets its needs for food and shelter, how it survives, and how it reproduces.
- a species’ niche includes all of its interactions with the biotic and abiotic factors of its environment.
- a biome“niche” has specific environmental factors and conditions including, for example, pH, temperature, osmotic pressure, osmolality, oxygen level, nutrient concentration, blood concentration, plasma concentration, serum concentration, and electrolyte concentration.
- the Hutchinsonian niche is an n-dimensional hypervolume, where the dimensions are environmental conditions and resources, that define the requirements of an individual or a species to practice "its" way of life, more particularly, for its population to persist.
- the "hypervolume” defines the multi-dimensional space of resources (e.g., light, nutrients, structure, etc.) available to (and specifically used by) organisms, and "all species other than those under consideration are regarded as part of the coordinate system.”
- a niche is a very specific segment of ecospace occupied by a single species. On the presumption that no two species are identical in all respects (i.e., Hardin's 'axiom of inequality') and the competitive exclusion principle, some resource or adaptive dimension will provide a niche specific to each species.
- Niches are exclusive. Each organism competes with similar organisms for that niche, and the successful organism fills that niche. Two organisms do not/cannot fill the same niche because one will out-compete the other over time. Therefore, the coexistence of two organisms in the same biome over extended time periods means they do not fill the same niche.
- Partial competition for a single niche can occur.
- One organism can “narrow” the“niche width” of another by partial competition. This might be the case with Staphylococcus epidermidis vs. Staphylococcus aureus.
- S. epidermidis is a commensal bacterium that secretes a serine protease capable of disassembling preformed Staphylococcus aureus biofilms, when used in high enough concentrations. Sugimoto et al, J Bacteriol, 195(8) 1645-1655.
- Interspecies co-colonization is a different phenomenon than the ability to durably fill and block an ecological niche.
- SCFA short chain fatty acids
- C . acnes Cutibacterium acnes
- CA- MRSA methicillin-resistant Staphylococcus aureus
- a method is provided to prevent or decrease recurrence of a pathogenic infection of a undesirable microorganism in a subject, comprising the steps of (i) suppressing (decolonizing) the undesirable microorganism on at least one site in the subject to reduce or eliminate the presence of the undesirable microorganism from the site; and (ii) replacing the undesirable microorganism by administering to the subject at the at least one site a synthetic second microorganism having the same genus and species as the undesirable microorganism.
- the method further comprises (iii) promoting colonization of the synthetic microorganism, for example, at the site of administration.
- the undesirable microorganism is a pathogenic microorganism and the term suppress (S) refers to a process of suppressing, reducing or eliminating the pathogenic microorganism at one or more, two or more, three or more, four or more sites in a subject.
- the undesirable microorganism may be subject to nasal, mucosal, and/or dermal decolonization protocols.
- the term replace (R) refers to replacing the pathogenic microorganism with a synthetic microorganism that is benign, drug-susceptible, and/or incapable of causing systemic or pathogenic infection in the subject.
- the replacement microorganism may be a molecularly modified synthetic microorganism of the same species as the pathogenic microorganism.
- the synthetic microorganism may be a molecularly modified microorganism of the same species, different strain, as the pathogenic microorganism, such that the synthetic microorganism is able to colonize the site on the subject, but is unable to cause systemic infection in the subject.
- the synthetic microorganism By filling the vacated niche of the pathogenic microorganism, the synthetic microorganism is able to eliminate re- colonization by the pathogenic microorganism in the subject and thereby decrease or eliminate recurrence of pathogenic infection.
- promote refers to methods and compositions to promote replacement synthetic microorganism in the subject, for example, by employing prebiotics and biome management, for example, by employing a biome modulator in order to promote and support the new biome comprising the synthetic microorganism.
- SRP platform technology
- a method is provided to decrease recurrence or chance of systemic infection of a pathogenic microorganism in a subject, the method comprising suppressing the pathogenic microorganism on the subject to significantly reduce or eliminate the detectable presence of the pathogenic microorganism; and replacing the pathogenic microorganism by administering a synthetic microorganism to the subject, wherein the synthetic microorganism is capable of occupying the same niche as the pathogenic microorganism as evidenced by (1) having the same genetic background, or genus and species, as the pathogenic microorganism, and/or by (2) exhibiting durable detectable presence on the subject for at least 60 days following replacement.
- the method may include promoting the colonization of the synthetic microorganism on at least one site in the subject. In some cases, the subject may have been found to be colonized by the pathogenic microorganism.
- systemic infection of a subject with a pathogenic microorganism is preceded by colonization of the pathogenic microorganism in the subject.
- a substantial proportion of cases of Staphylococcus aureus bacteremia appear to be of endogenous origin since they may originate from colonies in the nasal mucosa.
- the blood isolates were identical to those from the anterior nares in 180 of 219 patients (82.2%).
- 14 of 1278 patients who had nasal colonization with Staphylococcus aureus subsequently had Staphylococcus aureus bacteremia.
- the subject is found to be colonized with the pathogenic strain of the microorganism prior to systemic infection.
- the subject may have been colonized or infected by a nosocomial (hospital-acquired) strain or community-acquired strain of a pathogenic microorganism.
- the pathogenic microorganism may be a wild-type microorganism, and/or a pathogenic microorganism that may be colonized or detectably present in at least one site in the subject.
- the site may be a dermal or mucosal site in the subject.
- the one or sites of colonization may include skin and soft tissue including, but are not limited to, nares, throat, perineum, inguinal region, vagina, nasal, groin, perirectal area, finger webs, forehead, pharynx, axillae, hands, chest, abdomen, head, and/or toe webs.
- the pathogenic microorganism may be a drug resistant microorganism.
- the undesirable microorganism is selected from Neisseria gonorrhoeae , fluconazole-resistant Candida, methicillin-resistant Staphylococcus aureus (MRSA), vancomycin-resistant Staphylococcus aureus , drug-resistant Streptococcus pneumoniae and drug-resistant tuberculosis, erythromycin-resistant Group A Streptococcus, and clindamycin-resistant Group B Streptococcus.
- MRSA methicillin-resistant Staphylococcus aureus
- MRSA methicillin-resistant Staphylococcus aureus
- vancomycin-resistant Staphylococcus aureus drug-resistant Streptococcus pneumoniae and drug-resistant tuberculosis
- erythromycin-resistant Group A Streptococcus and clindamycin-resistant Group B Streptococcus.
- the pathogenic microorganism is a MRSA.
- the synthetic microorganism (a) must be able to fill the ecological niche in the at least one site in the subject so as to durably exclude the undesirable microorganism following suppression; and (b) must have at least one molecular modification comprising a first cell death gene operably linked to a first regulatory region comprising a first promoter that is activated (induced) by a change in state in the environment compared to the normal physiological conditions in at least one site in the subject.
- the synthetic microorganism may be of the same genus and species as the undesirable microorganism, in order to enhance the ability to fill the niche and durably exclude the undesirable microorganism in at least one site in the subject.
- the disclosure provides a synthetic microorganism that is not a pathogen and cannot become an accidental pathogen because it does not have the ability to infect the subject upon change in state, e.g., upon exposure to blood or serum.
- the synthetic microorganism comprises at least one molecular modification comprising a first cell death gene operably linked to a first regulatory region comprising a first promoter that is activated (induced) by a change in state in the environment compared to the normal physiological conditions in at least one site in the subject. For example, if the site in the subject is a dermal or mucosal site, then exposure to blood or serum is a change in state resulting in cell death of the synthetic microorganism.
- average cell death of the synthetic microorganism may occur within 6 hours, 5 hours, 4 hours, 2 hours, 90 minutes, 60 minutes, 45 minutes, 30 minutes, 20 minutes, 15 minutes, 10 minutes, 5 minutes, 2 minutes or 1 minute following change of state.
- the change in state may be a change in one or more of the following conditions: pH, temperature, osmotic pressure, osmolality, oxygen level, nutrient concentration, blood concentration, plasma concentration, serum concentration, and/or electrolyte concentration from that in at least one site in a subject.
- the change in state is a higher concentration of blood, serum, or plasma compared to normal physiological conditions at the at least one site in the subject.
- the pathogenic microorganism is a MRSA.
- MRSA is a variant subgroup of Staphylococcus aureus.
- MRSA strains typically include a mecA cassette that allows production of an alternate penicillin binding protein that render them resistant to treatment with most beta-lactam and other first-line antibiotics.
- Staphylococcus aureus as a whole is present as part of the normal microbiome of approximately 30% of the total human population.
- Staphylococcus aureus lives most commonly on the surface of the skin and in the anterior nasal vestibules, but can also be found in smaller amounts in the deep oropharynx and gastrointestinal tract and as part of the normal vaginal flora in some individuals.
- pathogenic microorganism refers to a microorganism that is capable of causing disease.
- a pathogenic microorganism may colonize a site on a subject and may subsequently cause systemic infection in a subject.
- the pathogenic microorganism may have evolved the genetic ability to breach cellular and anatomic barriers that ordinarily restrict other microorganisms. Pathogens may inherently cause damage to cells to forcefully gain access to a new, unique niche that provides them with less competition from other microorganisms, as well as with a ready new source of nutrients. Falkow, Stanley, 1998 Emerging Infectious Diseases, Vol. 4, No. 3, 495-497.
- the pathogenic microorganism may be a drug-resistant microorganism.
- the term“virulent” or“virulence” is used to describe the power of a microorganism to cause disease.
- the term "suppress” or“decolonize” means to substantially reduce or eliminate the original undesired pathogenic microorganism by various means (frequently referred to as “decolonization”). Substantially reduce refers to reduction of the undesirable microorganism by greater than 90%, 95%, 98%, 99%, or greater than 99.9% of original colonization by any means known in the art.
- replace refers to replacing the original pathogenic microorganism by introducing a new microorganism (frequently referred to as “recolonization”) that “crowds out” and occupies the niche(s) that the original microorganism would ordinarily occupy, and thus preventing the original undesired microorganism from returning to the microbiome ecosystem (frequently referred to as “interference” and“non-co-colonization”).
- the term“durably replace”,“durably exclude”,“durable exclusion”, or “durable replacement”, refers to detectable presence of the new synthetic microorganism for a period of at least 30 days, 60 days, 84 days, 120 days, 168 days, or 180 days after introduction of the new microorganism to a subject, for example, as detected by swabbing the subject.
- “durably replace”, “durably exclude”, “durable exclusion”, or“durable replacement” refers to absence of the original pathogenic microorganism for a period of at least 30 days, 60 days, 84 days, 120 days, 168 days, or 180 days after introduction of the new synthetic microorganism to the subject, for example, absence as detected over at least two consecutive plural sample periods, for example, by swabbing the subject.
- the term“promote”, or“promoting”, refers to activities or methods to enhance the colonization and survival of the new organism, for example, in the subject.
- promoting colonization of a synthetic bacteria in a subject may include administering a nutrient, prebiotic, and/or probiotic bacterial species.
- prevention refers to a course of action (such as administering a compound or pharmaceutical composition of the present disclosure) initiated prior to the onset of a clinical manifestation of a disease state or condition so as to prevent or reduce such clinical manifestation of the disease state or condition.
- preventing and suppressing need not be absolute to be useful.
- treatment refers a course of action (such as administering a compound or pharmaceutical composition) initiated after the onset of a clinical manifestation of a disease state or condition so as to eliminate or reduce such clinical manifestation of the disease state or condition.
- Such treating need not be absolute to be useful.
- the term "in need of treatment” as used herein refers to a judgment made by a caregiver that a patient requires or will benefit from treatment. This judgment is made based on a variety of factors that are in the realm of a caregiver's expertise, but that includes the knowledge that the patient is ill, or will be ill, as the result of a condition that is treatable by a method, compound or pharmaceutical composition of the disclosure.
- the term "in need of prevention” as used herein refers to a judgment made by a caregiver that a patient requires or will benefit from prevention.
- the term "individual”, “subject” or “patient” as used herein refers to any animal, including birds or mammals, such as mice, Norway rats, cotton rats, gerbils, cavies, hamsters, other rodents, rabbits, dogs, cats, swine, cattle, sheep, goat, horses, or primates, and humans.
- the term may specify male or female or both, or exclude male or female.
- the patient is an adult human.
- the patient is a non-neonate human infant.
- the patient is a human toddler, child, or adolescent.
- the subject is found to be colonized with a pathogenic strain of a microorganism prior to a systemic infection, or the subject may have been colonized or infected by a nosocomial (hospital-acquired) strain or community-acquired strain of a pathogenic microorganism.
- the term“neonate”, or newborn, refers to an infant in the first 28 days after birth.
- the term“non-neonate” refers to an animal older than 28 days.
- an effective amount refers to an amount of an agent, either alone or as a part of a pharmaceutical composition, that is capable of having any detectable, positive effect on any symptom, aspect, or characteristics of a disease state or condition. Such effect need not be absolute to be beneficial.
- the term“measurable average cell death” refers to the inverse of survival percentage for a microorganism determined at a predefined period of time after introducing a change in state compared to the same microorganism in the absence of a change in state under defined conditions.
- nucleotide sequence identity indicates that, when optimally aligned with appropriate nucleotide insertions or deletions with another nucleotide (or its complementary strand), there is nucleotide sequence identity in at least about 95%, and more preferably at least about 96%, 97%, 98% or 99% of the nucleotide bases, as measured by any well-known algorithm of sequence identity, such as FASTA, BLAST or Gap, as discussed below.
- a nucleotide molecule having substantial identity to a reference nucleotide molecule may, in certain instances, encode a polypeptide having the same or substantially similar amino acid sequence as the polypeptide encoded by the reference nucleotide molecule.
- the term“derived from” when made in reference to a nucleotide or amino acid sequence refers to a modified sequence having at least 50% of the contiguous reference nucleotide or amino acid sequence respectively, wherein the modified sequence causes the synthetic microorganism to exhibit a similar desirable atttribute as the reference sequence of a genetic element such as promoter, cell death gene, antitoxin gene, virulence block, or nanofactory, including upregulation or downregulation in response to a change in state, or the ability to express a toxin, antitoxin, or nanofactory product, or a substantially similar sequence, the ability to transcribe an antisence RNA antitoxin, or the ability to prevent or diminish horizontal gene transfer of genetic material from the undesirable microorganism.
- a genetic element such as promoter, cell death gene, antitoxin gene, virulence block, or nanofactory
- upregulation or downregulation in response to a change in state or the ability to express a toxin, antitoxin, or nano
- derived from in reference to a nucleotide sequence also includes a modified sequence that has been codon optimized for a particular microorganism to express a substantially similar amino acid sequence to that encoded by the reference nucleotide sequence.
- substantially similarity means that two peptide or protein sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 95% sequence identity, even more preferably at least 98% or 99% sequence identity. Preferably, residue positions which are not identical differ by conservative amino acid substitutions.
- conservative amino acid substitution refers to wherein one amino acid residue is substituted by another amino acid residue having a side chain (R group) with similar chemical properties, such as charge or hydrophobicity. In general, a conservative amino acid substitution will not substantially change the functional properties of the, e.g., toxin or antitoxin protein.
- Examples of groups of amino acids that have side chains with similar chemical properties include (1) aliphatic side chains: glycine, alanine, valine, leucine and isoleucine; (2) aliphatic-hydroxyl side chains: serine and threonine; (3) amide-containing side chains: asparagine and glutamine; (4) aromatic side chains: phenylalanine, tyrosine, and tryptophan; (5) basic side chains: lysine, arginine, and histidine; (6) acidic side chains: aspartate and glutamate, and (7) sulfur-containing side chains are cysteine and methionine.
- Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, glutamate-aspartate, and asparagine-glutamine.
- Polypeptide sequences may be compared using FASTA using default or recommended parameters, a program in GCG Version 6.1.
- FASTA e.g., FASTA2 and FASTA3
- FASTA3 provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences (see, e.g, Pearson, W.R., Methods Mol Biol 132: 185-219 (2000), herein incorporated by reference).
- Another preferred algorithm when comparing a sequence of the disclosure to a database containing a large number of sequences from different organisms is the computer program BLAST, especially BLASTP or TBLASTN, using default parameters. See, e.g, Altschul et al,
- nucleotide sequences provided herein are presented in the 5’ - 3’ direction.
- systemic administration refers to a route of administration into the circulatory system so that the entire body is affected.
- Systemic administration can take place through enteral administration (absorption through the gastrointestinal tract, e.g. oral administration) or parenteral administration (e.g., injection, infusion, or implantation).
- topical administration refers to application to a localized area of the body or to the surface of a body part regardless of the location of the effect. Typical sites for topical administration include sites on the skin or mucous membranes. In some embodiments, topical route of administration includes enteral administration of medications or compositions.
- undesirable microorganism refers to a microorganism which may be a pathogenic microorganism, drug-resistant microorganism, antibiotic-resistant microorganism, irritation-causing microorganism, odor-causing microorganism and/or may be a microorganism comprising an undesirable virulence factor.
- the term“synthetic microorganism” refers to an isolated microorganism modified by any means to comprise at least one element imparting a non-native attribute.
- the synthetic microorganism may be engineered to include a molecular modification comprising an addition, deletion and/or modification of genetic material to incorporate a non-native attribute.
- the synthetic microorganism is not an auxotroph.
- the term“detectable presence” of a microorganism refers to a confirmed positive detection in a sample of a microorganism genus, species and/or strain by any method known in the art. Confirmation may be a positive test
- microbiome or“microbiomic” or“microbiota” as used herein refers to microbiological ecosystems. These ecosystems are a community of commensal, symbiotic and pathogenic microorganisms found in and on all animals and plants.
- microorganism refers to an organism that can be seen only with the aid of a microscope and that typically consists of only a single cell. Microorganisms include bacteria, protozoans and fungi.
- the term“niche” and“niche conditions” as used herein refers to the ecological array of environmental and nutritional requirements that are required for a particular species of microorganism. The definitions of the values for the niche of a species defines the places in the particular biomes that can be physically occupied by that species and defines the possible microbial competitors.
- colonization refers to the persistent detectable presence of a microorganism on a body surface, e.g., a dermal or mucosal surface, without causing disease in the individual.
- co-colonization refers to simultaneous colonization of a niche in a site on a subject by two or more strains, or variants within the same species of microorganisms.
- co-colonization may refer to two or more strains or variants simultaneously and non-transiently occupying the same niche.
- non-transiently refers to positive identification of a strain or variant at a site in a subject over time at two or more time subsequent points in a multiplicity of samples obtained from the subject at least two weeks apart.
- kill switch refers to an intentional molecular modification of a synthetic microorganism, the molecular modification comprising a cell death gene operably linked to a regulatory region comprising an inducible promoter, genetic element or cassette, wherein induced expression of the cell death gene in the kill switch causes cell death, arrest of growth, or inability to replicate, of the microorganism in response to a specific state change such as a change in environmental condition of the microorganism.
- the inducible first promoter may be activated by the presence of blood, serum, plasma, and/or heme, wherein the upregulation and transcription/expression of the operably associated cell death gene results in cell death of the microorganism or arrested growth of the microorganism so as to improve the safety of the synthetic microorganism.
- cell death gene refers to a gene that when induced causes a cell to enter a state where it either ceases reproduction, alters regulatory mechanisms of the cell sufficiently to permanently disrupt cell viability, induces senescence, or induces fatal changes in the genetic or proteomic systems of the cell.
- the cell death gene may be a toxin gene encoding a toxin protein or toxin peptide.
- antitoxin gene refers to a gene encoding an antitoxin RNA antisense molecule or an antitoxin protein or another antitoxin molecule specific for a cell death gene or a product encoded thereby
- V-block refers to a molecular modification of a microorganism that results in the organism have decreased ability to accept foreign DNA from other strains or species effectively resulting in the organism having decreased ability to acquire exogenous virulence or antibiotic resistance genes.
- nanofactory refers to the molecular modification of a microorganism that results in the production of a product - either primary protein, polypeptide, amino acid or nucleic acid or secondary products of these modifications to beneficial effect.
- toxin protein or“toxin peptide” as used herein refers to a substance produced internally within a synthetic microorganism in an effective amount to cause deleterious effects to the microorganism without causing deleterious effects to the subject that it colonizes.
- molecular modification or“molecularly engineered” as used herein refers to an intentional modification of the genes of a microorganism using any gene editing method known in the art, including but not limited to recombinant DNA techniques as described herein below, NgAgo, mini-Cas9, CRISPR-Cpfl, CRISPR- C2c2, Target-AID, Lambda Red, Integrases, Recombinases, or use of phage techniques known in the art.
- the DNA may be sequenced and manipulated chemically or by using molecular biology techniques, for example, to arrange one or more elements, e.g., regulatory regions, promoters, toxin genes, antitoxin genes, or other domains into a suitable configuration, or to introduce codons, delete codons, optimize codons, create cysteine residues, modify, add or delete amino acids, etc.
- Molecular modifcation may include, for example, use of plasmids, gene insertion, gene knock-out to excise or remove an undesirable gene, frameshift by adding or subtracting base pairs to break the coding frame, exogenous silencing, e.g., by using inducible promoter or constitutive promoter which may be embedded in DNA encoding, e.g.
- RNA antisense antitoxin production of CRISPR-cas9 or other editing proteins to digest, e.g., incoming virulence genes using guide RNA, e.g., linked to an inducible promoter or a constitutive promoter, or a restriction modification/methylation system, e.g., to recognize and destroy incoming virulence genes to increase resistance to horizontal gene transfer.
- the molecular modification e.g. kill switch, expression clamp, and/or v-block
- the synthetic microorganism may further comprise additional molecular modifications, (e.g., a nanofactory), which may be incorporated directly into the bacterial genome, or into plasmids, in order to tailor the duration of the effect of, e.g., the nanofactory production, and could range from short term (with non-replicating plasmids for the bacterial species,) to medium term (with replicating plasmids without addiction dependency) to long term (with direct bacterial genomic manipulation).
- additional molecular modifications e.g., a nanofactory
- a nanofactory may be incorporated directly into the bacterial genome, or into plasmids, in order to tailor the duration of the effect of, e.g., the nanofactory production, and could range from short term (with non-replicating plasmids for the bacterial species,) to medium term (with replicating plasmids without addiction dependency) to long term (with direct bacterial genomic manipulation).
- the molecular modifications may confer a non-native attribute desired to be durably incorporated into the host microbiome, may provide enhanced safety or functionality to organisms in the microbiome or to the host microbiome overall, may provide enhanced safety characteristics, including kill switch(s) or other control functions.
- the safety attributes so embedded may be responsive to changes in state or condition of the microorganism or the host microbiome overall.
- the molecular modification may be incorporated to the synthetic microorganism in one or more, two or more, five or more, 10 or more, 30 or more, or 100 or more copies, or no more than one, no more than three, no more than five, no more than 10, no more than 30, or in no more than 100 copies.
- recurrence refers to re-colonization of the same niche by a decolonized microorganism.
- pharmaceutically acceptable refers to compounds, carriers, excipients, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- pharmaceutically acceptable carrier refers to a carrier that is physiologically acceptable to the treated subject while retaining the integrity and desired properties of the synthetic microorganism with which it is administered.
- Exemplary pharmaceutically acceptable carriers include physiological saline or phosphate-buffered saline.
- Other physiologically acceptable carriers and their formulations are provided herein or are known to one skilled in the art and described, for example, in Remington's Pharmaceutical Sciences, (20th edition), ed. A. Gennaro, 2000, Lippincott, Williams & Wilkins, Philadelphia, Pa.
- Numerical ranges as used herein are intended to include every number and subset of numbers contained within that range, whether specifically disclosed or not. Further, these numerical ranges should be construed as providing support for a claim directed to any number or subset of numbers in that range. For example, a disclosure of from 1 to 10 should be construed as supporting a range of from 2 to 8, from 3 to 7, from 5 to 6, from 1 to 9, from 3.6 to 4.6, from 3.5 to 9.9, and so forth.
- vectors comprising polynucleotide molecules, as well as target cells transformed with such vectors.
- Polynucleotide molecules described herein may be joined to a vector, which include a selectable marker and origin of replication, for the propagation host of interest.
- Target cells are genetically engineered to include these vectors and thereby transcribe RNA and express
- Vectors herein include polynucleotides molecules operably linked to suitable transcriptional or translational regulatory sequences, such as those for microbial target cells.
- suitable transcriptional or translational regulatory sequences include transcriptional promoters, operators, or enhancers, mRNA ribosomal binding sites, and appropriate sequences which control transcription and translation.
- Nucleotide sequences as described herein are operably linked when the regulatory sequences herein functionally relate to, e.g., a cell death gene encoding polynucleotide.
- Typical vehicles include plasmids, shuttle vectors, baculovirus, inactivated adenovirus, and the like.
- the vehicle may be a modified pIMAY, pIMAYz, or pKOR integrative plasmid, as di cussed herein.
- a target microorganism may be selected from any microorganism having the ability to durably replace a specific undesirable microorganism after decolonization.
- the target microorganism may be a wild-type microorganism that is subsequently engineered to enhance safety by methods described herein.
- the target microorganism may be selected from a bacterial, fungal, or protozoal target microorganism.
- the target microorganism may be a strain capable of colonizing a dermal and/or mucosal niche in a subject.
- the target microorganism may be a wild- type microorganism, or a synthetic microorganism that may be subjected to further molecular modification.
- the target microorganism may be selected from a genus selected from the group consisting of Acinetobacter, Corynebacterium, Cutibacterium, Staphylococcus, Streptococcus , Propionibacterium, and Pseudomonas.
- the target microorganism may be selected from the group consisting of Acinetobacter johnsonii, Acinetobacter baumannii, Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus lugdunensis, Staphylococcus warneri, Staphylococcus saprophyticus, Corynebacterium acnes, Corynebacterium striatum, Corynebacterium diphtheriae, Corynebacterium minutissimum, Cutibacterium acnes, Propionibacterium acnes, Propionibacterium granulosum, Escherichia coli, Streptococcus pyogenes,
- Streptococcus aureus Streptococcus agalactiae, Streptococcus mitis, Streptococcus viridans, Streptococcus pneumoniae, Streptococcus anginosis, Steptococcus constellatus, Streptococcal intermedius, Streptococcus agalactiae, Streptococcus mutans, Pseudomonas aeruginosa, Pseudomonas oryzihabitans, Pseudomonas stutzeri, Pseudomonas putida , and Pseudomonas fluorescens.
- the target microorganism may be of the same genus and species as the undesirable microorganism, but of a different strain.
- the undesirable microorganism may be an antibiotic-resistant Staphylococcus aureus strain, such as an
- the antibiotic-resistant Staphylococcus aureus stain may be a pathogenic strain, which may be known to be involved in dermal infection, mucosal infection, bacteremia, and/or endocarditis.
- the undesirable microorganism is a Staphylococcus aureus strain, e.g., an MRSA
- the target microorganism may be, e.g., a less pathogenic strain which may be an isolated strain such as Staphylococcus aureus target cell such as an RN4220 or 502a strain, and the like.
- the target cell may be of the same strain as the undesirable microorganism.
- the undesirable microorganism is an Escherichi coli strain, for example, a
- the undesirable strain is a Cutibacterium acnes strain, for example a strain involved in acnes vulgaris, bacteremia, and/or endocarditis.
- the undesirable microorganism is a Streptococcus mutans strain, for example, a strain involved in S. mutans endocarditis, dental caries.
- the target microorganism may be an antibiotic-susceptible microorganism of the same species as the undesirable microorganism.
- the undesirable microorganism is an MRSA strain and the replacement target microorganism is an antibiotic susceptible Staphylococcus aureus strain.
- the antibiotic susceptible microorganism may be Staphylococcus aureus strain 502a (“502a”).
- 502a is a coagulase positive, penicillin sensitive, nonpenicillinase producing staphylococcus, usually lysed by phages 7, 47, 53, 54, and 77.
- Serologic type (b)ci is a coagulase positive, penicillin sensitive, nonpenicillinase producing staphylococcus, usually lysed by phages 7, 47, 53, 54, and 77.
- Unusual disc antibiotic sensitivity pattern is exhibited by 502a because this strain is susceptible to low concentrations of most antibiotics except tetracycline; resistant to 5 pg, but sensitive to 10 pg of tetracycline.
- the 502a strain may be purchased commercially as Staphylococcus aureus subsp. Aureus Rosenbach ATCC®272l7TM.
- the target microorganism is subjected to molecular modification to incorporate regulatory sequences including, e.g., an inducible first promoter for expression of the cell death gene, v-block, or nanofactory, in order to enhance safety and reduce the likelihood of pathogenic infection as described herein.
- regulatory sequences including, e.g., an inducible first promoter for expression of the cell death gene, v-block, or nanofactory
- the target microorganism and/or the synthetic microorganism comprises (i) the ability to durably colonize a niche in a subject following decolonization of the undesirable microorganism and administering the target or synthetic microorganism to a subject, and (ii) the ability to prevent recurrence of the undesirable microorganism in the subject for a period of at least two weeks, at least four weeks, at least six weeks, at least eight weeks, at least ten weeks, at least 12 weeks, at least 16 weeks, at least 24 weeks, at least 26 weeks, at least 30 weeks, at least 36 weeks, at least 42 weeks, or at least 52 weeks after the administering step.
- Selection of the target microorganism may be performed by
- MRSA Methicillin-Resistant Staphylococcus aureus
- Staphylococcus aureus is regarded as a required precondition for most invasive infections.
- decolonization with standard antiseptic regimens has been studied as a method for reducing MRSA colonization and infections with mixed results.
- the feasibility and durability of a novel decolonization approach to undesirable microorganism MRSA by using intentional recolonization with a different Staphylococcus aureus strain as a candidate target microorganism was performed in hopes of improving duration of effect versus standard decolonization.
- Example 1 discloses the study in which a total of 765 healthy volunteers were screened for Staphylococcus aureus colonization. The overall MRSA rate for the screened population was 8.5%.
- the test group employing the BioPlx- Ol WT protocol showed 0% MRSA recurrence at the 8 week primary endpoint and continued to show no evidence of MRSA recurrence out to 26 weeks. Instead these participants exhibited surprising persistence of colonization with MSSA likely indicating ongoing colonization with the Staphylococcus aureus 502a BioPlx-OlWT strain product out to 26 weeks.
- the components of the BioPlx-OlWT in a phosphate buffered saline composition used in the decolonization/recolonization therapy showed no evidence of dermal irritation in a separate cohort of 55 participants. Therefore, target strain Staphylococcus aureus 502a BioPlx-OlWT
- decolonization/recolonization protocol provides longer durability of decolonization from MRSA strains than standard decolonization and shows no observed negative dermal effects.
- Any method known in the art may be employed for determination of the detectable presence of a microorganism genus, species and strain. An overview of methods may be found in Aguilera-Arreola MG. Identification and Typing Methods for the Study of Bacterial Infections: a Brief Review and Mycobacterial as Case of Study. Arch Clin Microbiol. 2015, 7: 1, which is incorporated herein by reference.
- the detectable presence of a genus, species and/or strain of a bacteria may be determined by phenotypic methods and/or genotypic methods.
- Phenotypic methods may include biochemical reactions, serological reactions, susceptibility to anti-microbial agents, susceptibility to phages, susceptibility to bacteriocins, and/or profile of cell proteins.
- One example of a biochemical reaction is the detection of extracellular enzymes. For example, staphylococci produce many different
- extracellular enzymes including DNAase, proteinase and lipases.
- Gould, Simon et ah, 2009 The evaluation of novel chromogenic substrates fro detection of lipolytic activity in clinical isolates of Staphylococcus aureus and MRSA from two European study groups. FEMS Microbiol Let 297; 10-16.
- Chomogenic substrates may be employed for detection of extracellular enzymes.
- CHROMagerTM MRSA chromogenic media CHROMagar, Paris, France
- MRSA Methicillin Resistant Staphylococcus aureus
- Samples are obtained from, e.g., nasal, perineal, throat, rectal specimens are obtained with a possible enrichment step. If the agar plate has been refrigerated, it is allowed to warm to room temperature before inoculation. The sample is streaked onto plate followed by incubation in aerobic conditions at 37 °C for 18-24 hours. The appearance of the colonies is read, wherein MRSA colonies appear as rose to mauve colored,
- Methicillin Susceptible Staphylococcus aureus (MSS A) colonies are inhibited, and other bacteria appear as blue, colorless or inhibited colonies.
- MRSA Methicillin Susceptible Staphylococcus aureus
- Definite identification as MRSA requires, in addition, a final identification as Staphylococcus aureus.
- CHROMagarTM Staph aureus chromogenic media may be employed where S. aurues appears as mauve, S. saprophyticus appears turquoise blue, E. coli, C. albicans and E.faecalis are inhibited.
- G BS Group B Streptococcus
- CHROMagarTM StrepB plates may be employed, wherein Streptococcus agalactiae (group B) appear mauve, Enterococcus spp. and E.faecalis appear steel blue, Lactobacilli, leuconostoc and lactococci appear light pink, and other
- Candida chromogenic media may be employed.
- Candida species are involved in superficial oropharyngeal and urogenital infections.
- C. albicans remains a major species involved, other types such as C. tropicalis, C. krusai, or C. glabrata have increased as new antifungal agents have worked effectively against C. albicans.
- Genotypic methods for genus and species identification may include hybridization, plasmids profile, analysis of plasmid polymorphism, restriction enzymes digest, reaction and separation by Pulsed-Field Gel Electrophoresis (PFGE), ribotyping, polymerase chain reaction (PCR) and its variants, Ligase Chain Reaction (LCR), Transcription-based Amplification System (TAS), or any of the methods described herein.
- PFGE Pulsed-Field Gel Electrophoresis
- PCR polymerase chain reaction
- LCR Ligase Chain Reaction
- TAS Transcription-based Amplification System
- Identification of a microbe can be performed, for example, by employing GalileoTM Antimicrobial Resistance (AMR) detection software (Arc Bio LLC, Menlo Park, CA and Cambridge, MA) that provides annotations for gram negative bacterial DNA sequences.
- AMR GalileoTM Antimicrobial Resistance
- the microbial typing method may be selected from genotypic methods including Multilocus Sequence Typing (MLST) which relies on PCR amplification of several housekeeping genes to create allele profiles; PCR-Extragenic Palindromic Repetitive Elements (rep-PCR) which involves PCR amplification of repeated sequences in the genome and comparison of banding patterns; AP-PCR which is Polymerase Chain Reaction using Arbitrary Primers; Amplified Fragment Length
- AFLP Polymorphism
- RFLP Polymorphism of DNA Restriction Fragments
- RAPD Random Amplified Polymorphic DNA
- MLVA Multilocus Tandem Repeat Sequence Analysis
- PFGE Pulsed-Fields Gel Electrophoresis
- PFGE method of electrophoresis is capable of separating fragments of a length higher than 50 kb up to 10 Mb, which is not possible with conventional electrophoresis, which can separate only fragments of 100 bp to 50 kb.
- This capacity of PFGE is due to its multidirectional feature, changing continuously the direction of the electrical field, thus, permitting the re-orientation of the direction of the DNA molecules, so that these can migrate through the agarose gel, in addition to this event, the applied electrical pulses are of different duration, fostering the reorientation of the molecules and the separation of the fragments of different size.
- One PFGE apparatus may be the Contour Clamped Homogeneous Electric Fields (CHEF, BioRad).
- Pulsed-filed gel electrophoresis is considered a gold standard technique for MRSA typing, because of its high discriminatory power, but its procedure is complicated and time consuming.
- the spa gene encodes a cell wall component of Staphylococcus aureus protein A, and exhibits polymorphism.
- the sequence based-.s/3 ⁇ 4/ typing can be used as a rapid test screen. Narukawa et al 2009 Tohoku J Exp Med 2009, 218, 207-213.
- methods are provided to prevent colonization, prevent infection, decrease recurrence of colonization, or decrease recurrence of a pathogenic infection of a undesirable microorganism in a subject, comprising decolonization and administering a synthetic strain comprising a molecular modification that decreases the ability of the synthetic microorganism to cause disease to the subject relative to the wild type target strain where the microorganism is selected from the group consisting of Acinetobacter johnsonii, Acinetobacter baumannii, Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus lugdunensis, Staphylococcus warneri, Staphylococcus saprophyticus, Corynebacterium acnes, Corynebacterium striatum, Corynebacterium diphtheriae, Corynebacterium minutissimum, Cutibacterium acnes, Propionibacterium acnes, Propionibacterium acnes, Propionibacterium
- a method is provided to prevent transmission by a subject, or recurrence of colonization or infection, of a pathogenic microorganism in a subject, comprising suppressing the pathogenic microorganism in the subject, and replacing the pathogenic microorganism by topically administering to the subject a composition comprising a benign microorganism of the same species, different strain.
- the method may further comprise promoting the colonization of the benign microorganism.
- the benign microorganism is a synthetic microorganism having at least one molecular modification comprising a first cell death gene operably linked to a first regulatory region comprising a first promoter, wherein the first promoter is activated in the presence of human serum or blood.
- the first promoter is not activated during colonization of dermal or mucous membranes in a human subject.
- method is provided to prevent transmission by a subject, or recurrence of colonization or infection, of a methicillin-resistant Staphylococcus aureus (MRS A) in a subject, comprising suppressing the MRS A in the subject, and replacing the MRSA by topically administering to the subject a methicillin susceptible Staphylococcus aureus (MSS A) of the same species, different strain.
- the method may further comprise promoting the colonization of the MSSA in the subject.
- a method is provided to prevent transmission by a subject, or recurrence of colonization or infection, of a undesirable microorganism in a subject, comprising suppressing the undesirable microorganism in the subject, and replacing the undesirable microorganism by administering to the subject a second microorganism of the same species, different strain.
- the method may further comprise promoting the colonization of the second microorganism.
- the undesirable microorganism is a drug-resistant pathogenic microorganism.
- the second microorganism is a drug-susceptible microorganism.
- the second microorganism is a synthetic microorganism.
- An undesirable microorganism may be supressed, or decolonized, by topically applying a disinfectant, antiseptic, or biocidal composition directly to the skin or mucosa of the subject, for example, by spraying, dipping, or coating the affected area, optionally the affected area and adjacent areas, or greater than 25%, 50%, 75%, or greater than 90% of the external or mucosal surface area of the subject with the disinfectant, antiseptic, or biocidal composition.
- the affected area, or additional surface areas are allowed to air dry or are dried with an air dryer under gentle heat, or are exposed to ultraviolet radiation or sunlight prior to clothing or dressing the subject.
- the suppression comprises exposing the affected area, and optionally one or more adjacent or distal areas of the subject, with ultraviolet radiation.
- any commonly employed disinfectant, antiseptic, or biocidal composition may be employed.
- a disinfectant comprising chlorhexidine or a pharmaceutically acceptable salt thereof is employed.
- Suppression of the undesirable microorganism also may be performed by using photosensitizers instead of or in addition to, e.g., topical antibiotics.
- photosensitizers instead of or in addition to, e.g., topical antibiotics.
- Photosensitizers such as dye molecules, become excited when illuminated with light. The photosensitizers convert oxygen into reactive oxygen species that kill the microbes, such as MRSA.
- hybrid photosensitizers were developed by Zhang et al., comprising noble metal nanoparticles decorated with amphiphilic polymers to entrap molecular photosensitizers.
- the hybrid photosensitizers may be applied to a subject, for example, on a dermal surface or wound, in the form of a spray, lotion or cream, then illuminated with red or blue light to reduce microbial growth.
- a decolonizing composition may be in the form of a topical solution, lotion, or ointment form comprising a disinfectant, biocide photosensitizer or antiseptic compound and one or more pharmaceutically acceptable carriers or excipients.
- a disinfectant biocide photosensitizer or antiseptic compound
- an aerosol disinfectant spray is employed comprising chlorhexidine gluconate (0.4%), glycerin (10%), in a pharmaceutically acceptable carrier, optionally containing a dye to mark coverage of the spray.
- the suppressing step comprises administration to one or more affected areas, and optionally one or more surrounding areas, with a spray disinfectant as disclosed in U.S. Pat. Nos.
- the disinfectant spray may be commercially available, for example, Fight Bac®, Deep Valley Farm, Inc., Brooklyn, CT.
- Other disinfectant materials may include chlorhexidine or salts thereof, such as chlorhexidine gluconate, chlorhexidine acetate, and other diguanides, ethanol, SD alcohol, isopropyl alcohol, /i-chloro-o-benzyl phenol, o-phenylphenol, quaternary ammonium compounds, such as n-alkyl/dimethyl ethyl benzyl ammonium chloride/n-alkyl dimethyl benzyl ammonium choride, benzalkonium chloride, cetrimide, methylbenzethonium chloride, benzethonium chloride, cetalkonium chloride, cetylpyridinium chloride, dofanium chloride, domiphen bromide, peroxides
- GRAS Generally Recognized As Safe
- glycerin and glycerides, for example but not limited to mono- and diglycerides of edible fat-forming fatty acids, diacetyl tartaric acid esters of mono- and diglycerides, triacetin, acettooleins, acetostearins, glyceryl lactopalmitate, glyceryl lactooleate, and oxystearins.
- the suppression step -or decolonization- may be performed comprising administering 1-3 times daily, over a period of from 1 to 10 days; for example, on one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen or fourteen days.
- the suppression step may be administered from two, three, four, five, or six times, each administration from 6 to 48 hours, 8 to 40 hours, 18 to 36 hours, or about 20 to 28 hours apart.
- the suppression step is administered once per day from one to five, or three to four consecutive days.
- the suppression step does not include systemic administration of antimicrobial agents.
- the suppression step does not include systemic administration of antibiotic, antiviral, or antifungal agents. In other embodiments, the suppression step includes systemic administration of antimicrobial agents. In some embodiments, the suppression step may include systemic administration of one or more antibiotic, antiviral, or antifungal agents.
- an undesirable microorganism is durably replaced with a synthetic microorganism.
- the synthetic microorganism has the ability to fill the same ecological niche and/or may be of the same species, different strain, as the pathogenic microorganism. By using same species, different strain, (or even the same strain) the environmental niche of the pathogenic microorganism may be filled, or durably replaced, with the benign synthetic microorganism.
- the undesirable pathogenic microorganism is replaced with a synthetic microorganism.
- the replacement strain may be a synthetic microorganism that is a molecularly modified strain of the same species as the undesirable or pathogenic microorganism or the same strain as the undesirable or pathogenic microorganism.
- a synthetic microorganism comprising a“kill switch” is provided exhibiting rapid and complete cell death on exposure to blood or serum, but exhibits normal metabolism and colonization function in other environments.
- the synthetic microorganism comprises stable and immobile kill switch genes.
- the minimal kill switch (KS) components include a regulatory region (RR) containing operator, promoter and translation signals, that is strongly activated in response to blood or serum exposure, a kill switch gene expressing a toxic protein or RNA, and a means of transcription termination. Chromosomal integration of the KS is preferred.
- the chromosomal locus may be in a transcriptionally inactive region, for example, an intergenic region (IR) between a seryl-tRNA synthetase and an amino acid transporter. Insertions here do not affect transcription of flanking genes (Lei et ah, 2012). Preferably, no known sRNAs are present in the IR. Any other inert loci may be selected.
- IR intergenic region
- the synthetic microorganism comprising a kill switch
- the pathogenic microorganism is an antimicrobial-resistant microorganism
- the replacement microorganism is a synthetic microorganism of the same species as the pathogenic microorganism.
- the synthetic microorganism may be a molecularly-modified, antibiotic-susceptible microorganism.
- the synthetic microorganism may comprise one or more, two or more, or three or more molecular modifications comprising a first cell death gene operably linked to a first regulatory region comprising an inducible first promoter.
- the synthetic microorganism further comprises a second cell death gene operably linked to the first regulatory region comprising the first promoter or a second regulatory region comprising an inducible second promoter.
- the first promoter, and optionally the second promoter is activated (induced) by a change in state in the microorganism environment compared to the normal physiological conditions at the at least one site in the subject.
- the change in state may be selected from one or more changes in pH, temperature, osmotic pressure, osmolality, oxygen level, nutrient concentration, blood concentration, plasma concentration, serum concentration, and electrolyte concentration.
- the change in state is a higher concentration of blood, serum, or plasma compared to normal physiological conditions at the at least one site in the subject.
- the pathogenic microorganism is a MRSA and the replacement microorganism is a synthetic microorganism that is a molecularly modified Staphylococcus aureus coagulase positive strain.
- the synthetic microorganism may be a molecularly modified Staphylococcus aureus 502a, as described herein.
- the synthetic microorganism is molecularly engineered to comprise a "kill switch” (KS) and an inducible promoter that induces rapid bacterial death upon exposure to whole blood or serum.
- the kill switch may be composed of DNA encoding 3 main components: i) "control region", containing a promoter and other regulatory sequences, that is strongly activated by blood or serum; ii) a toxic RNA or polypeptide, whose expression is driven by the control region, and; iii) a transcription terminator.
- a cassette composed of these elements maybe integrated into the Staphylococcus aureus chromosome at a site(s) amenable to alteration without adversely affecting bacterial function.
- a synthetic microorganism which comprises a recombinant nucleotide comprising at least one molecular modification (e.g., a kill switch) comprising (i) a cell death gene operatively associated with (ii) a first regulatory region comprising a first inducible promoter which is induced by a change in state in the environment of the synthetic microorganism.
- a molecular modification e.g., a kill switch
- the synthetic microorganism may further comprises at least a second molecular modification (expression clamp) comprising (iii) an antitoxin gene specific for the first cell death gene, wherein the antitoxin gene is operably associated with (iv) a second regulatory region comprising a second promoter which is active (e.g., constitutive) upon dermal or mucosal colonization or in a media, and preferably is downregulated by change in state of the environment of the synthetic microorganism.
- expression clamp comprising (iii) an antitoxin gene specific for the first cell death gene, wherein the antitoxin gene is operably associated with (iv) a second regulatory region comprising a second promoter which is active (e.g., constitutive) upon dermal or mucosal colonization or in a media, and preferably is downregulated by change in state of the environment of the synthetic microorganism.
- a synthetic microorganism comprising at least one molecular modification (e.g., a kill switch) comprising a first cell death gene operably linked to a first regulatory region comprising a first promoter, wherein the first promoter is activated (induced) by a change in state in the microorganism environment compared to the normal physiological conditions at the at least one site in the subject, optionally wherein cell death of the synthetic microorganism occurs within 30, 60, 90, 120, 180, 360 or 240 minutes following change of state.
- a molecular modification e.g., a kill switch
- the change in state may be selected from one or more conditions of pH, temperature, osmotic pressure, osmolality, oxygen level, nutrient concentration, blood concentration, plasma concentration, serum concentration, heme concentration, sweat concentration, sebum concentration, metal concentration, chelated metal concentration, change in composition or concentration of one or more immune factors, mineral concentration, and electrolyte concentration.
- the change in state is a higher concentration of blood, serum, or plasma compared to normal physiological conditions at the at least one site in the subject.
- a synthetic microorganism which may comprise a recombinant nucleotide comprising at least one molecular modification (e.g., a kill switch) comprising (i) a cell death gene operatively associated with (ii) a first regulatory region comprising a first inducible promoter which exhibits conditionally high level gene expression of the recombinant nucleotide in response to exposure to blood, serum, or plasma, of at least two fold, at least three fold, at least lO-fold, at least 20 fold, at least 50 fold, at least lOO-fold increase of basal productivity.
- a recombinant nucleotide comprising at least one molecular modification (e.g., a kill switch) comprising (i) a cell death gene operatively associated with (ii) a first regulatory region comprising a first inducible promoter which exhibits conditionally high level gene expression of the recombinant nucleotide in response to exposure to blood, serum, or plasma, of at least
- the inducible first promoter may be activated (induced) upon exposure to an increased concentration of blood, serum, plasma, or heme after a period of time, e.g., after 15 minutes, 30 minutes, 45 minutes, 90 minutes, 120 minutes, 180 minutes, 240 minutes, 360 minutes, or any time point in between, to increase transcription and/or expression at least 5-fold, at least lO-fold, at least 20-fold, at least 50-fold, at least 100- fold, at least 300-fold, or at least 600-fold compared to transcription and/or expression in the absence of blood, serum, plasma or heme (non-induced).
- Iron ABC transporter gene CH52 05145 was upregulated (l9-fold) after 30 min of exposure to serum compared to 30 min in TSB.
- Threonine dehydratase gene CH52 11880 was upregulated (l4-fold) after 30 min of exposure to serum compared to 30 min in TSB.
- Iron ABC transporter gene CH52_05 l45 (44- fold)
- isdA gene CH52 00240 (44-fold)
- siderophore ABC transporter gene CH52 05150 33-fold
- Iron ABC transporter gene CH52 05145 (47-fold)
- siderophore ABC transporter gene CH52_05 l50 (37-fold)
- SAM dep Metrans gene CH52_04385 25- fold
- the blood or serum inducible first promoter genes for use in a Staphylococcus aureus synthetic microorganism may be selected from or derived from a gene selected from isdA (iron-regulated surface determinant protein A), isdB (iron- regulated surface determinant protein B), isdG (heme-degrading monooxygenase), hlgA (gamma-hemolysin component A), hlgAl (gamma-hemolysin), hlgA2 (gamma- hemolysin), hlgB (gamma-hemolysin component B), hrtAB (heme-regulated transporter), sbnC (luc C family siderophore biosynthesis protein), sbnE (lucA/lucC family siderophore biosynthesis protein), lrgA (murein hydrolase regulator A), lrgB (murein hydrolase regulator B), ear (Ear protein), fhuA (ferrA (fer
- the first promoter genes also may be selected from the group consisting of SAUSA300 0119 (Ornithine cyclodeaminase family protein), lrgA (Murein hydrolase transporter), and bioA (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase), or a substantially identical gene.
- the blood or serum blood or serum inducible first promoter genes for use in a Staphylococcus aureus synthetic microorganism may be selected from or derived from a gene selected from isdB gene CH52 00245, sbnD gene CH52 05125, heme ABC transporter gene CH52_00230, sbnE gene CH52_05 l20, srtB gene CH52_002l5, isdC gene CH52_00235, sbnC gene CH52_05 l30, diaminopimelate decarboxylase gene CH52_05 l05, heme ABC transporter 2 gene CH52_00225, sbnB gene CH52_05 l35, sbnF gene CH52 05115, bnG gene CH52 05110, isd ORF3 gene CH52 00220, isdl gene CH52_002l0, HarA gene CH52_l0455, isdA gene CH52_00240, s
- Staphylococcus aureus synthetic microorganism may be derived from or comprise a nucleotide sequence selected from 114, 115, 119, 120, 121, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, and 163, or a substantially identical sequence.
- the synthetic microorganism is a molecularly modified Staphylococcus aureus 502a.
- Raw sequences of first ORF in the operon that follows each regulatory region, from start codon to stop codon, used for design of real time PCR probes are shown in Table 2.
- the synthetic microorganism may include an expression clamp molecular modification that prevents expression of the cell death gene, wherein the expression clamp comprises an antitoxin gene specific for the cell death gene operably associated with a second promoter which is active upon dermal or mucosal colonization or in TSB media, and is preferably downregulated in blood, serum or plasma, for example, the second promoter may comprise a clfli gene (clumping factor B), for example as shown in Table 3.
- the synthetic microorganism may contain a kill switch molecular modification comprising cell death gene operably associated with an inducible first promoter, as described herein.
- the cell death gene may be selected from any gene, that upon overexpression results in cell death or significant reduction in the growth of the synthetic microorganism within a predefined period of time, preferably within 15 minutes, 30 minutes, 60 minutes, 90 minutes, 120 minutes, 240 minutes, or 360 minutes of induction.
- WO 2016/210373 discloses a recombinant bacterial cell that is an auxotroph engineered for biosafety, for example, that comprises a repression based kill switch gene that comprises a toxin, an anti-toxin and an arabinose inducible promoter and depends on the presence of an inducer (e.g., arabinose) to keep cells alive.
- an auxotroph engineered for biosafety for example, that comprises a repression based kill switch gene that comprises a toxin, an anti-toxin and an arabinose inducible promoter and depends on the presence of an inducer (e.g., arabinose) to keep cells alive.
- an inducer e.g., arabinose
- US 8,975,061, Bielinski discloses regulation of toxin and antitoxin genes for biological containment for preventing unintentional and/or uncontrolled spread of the microorganisms in the environment.
- WO 1999/058652, Gerdes discloses cytotoxin based biological containment and kill systems including E. coli relBE locus and similar systems found in Gram-negative and Gram-positive bacteria and Archae.
- WO 2017/023818 and WO 2016/210384, Falb disclose bacteria engineered to treat disorders involving propionate metabolism.
- synthetic microorganisms comprise one or more of SprAl (, Staphylococcus aureus ), Smal ( Serratia marcescens ), RelF ⁇ E. coli), Kpnl (K. pneumoniae) and/or RsaE (, Staphylococcus aureus) toxin genes.
- various cell death toxin genes were tested in combinations with previously identified optimal control regions: i) a 30 amino acid peptide (PepAl) that forms pores in the cell membrane, impairing its function; ii) a restriction enzyme (Kpnl or other) that rapidly digests the bacterial chromosome; iii) a small RNA (RsaE) that impairs central biochemical metabolism by inhibiting translation of 2 essential genes; iv) a restriction endonuclease (Smal) derived from Serratia marcescens ; and v) a toxin gene derived from E. coli (RelF).
- Some toxins are more potent than others and the ideal combination of control region induction strength and toxin potency may result in a strain that is healthy at baseline and that rapidly dies in the circulatory system.
- sprAl Staphylococcus aureus toxin gene (encoding PepAl peptide) is described in WO 2013/050590, Felden, B, and Sayed, N, disclosing use of PepAl as an antimicrobial, but the focus is on using the peptide as purified exogenous therapeutic to be delivered into the body.
- relF (E. coli ) toxin gene is described in EP 20090168998, Gerdes, disclosing kill switches for the purpose of biocontainment and focuses on revolve around killing of Gram-negative bacteria.
- relF toxin gene is described in US 8852916, Hyde and Roderick, disclosing mechanisms of triggering cell death of microorganisms (programmed cell death).
- the main application is to use RelF in environmental biocontainment.
- relF is described in US 8682619, Amodei, prophetically discloses RelF to regulate bacterial population growth.
- the synthetic microorganism may be derived from a Staphylococcus aureus target microorganism by insertion of a kill switch molecular modification comprising a regulatory region comprising an inducible promoter operably linked to a cell death gene which may be a toxin gene.
- the cell death gene may be selected from or derived from a sprAl gene (encoding a peptide toxin that forms pores in cell membrane), sprA2 gene, sprG gene, smal gene (a restriction endonuclease), kpnl gene (restriction enzyme that rapidly digests bacterial chromosome), rsaE gene (a small RNA that impairs central metabolism by inhibiting translation of 2 essential genes), a relF gene ( E . coli ), yoeB gene, mazF gene, yejM gene, or lysostaphin toxin gene.
- a sprAl gene encoding a peptide toxin that forms pores in cell membrane
- sprA2 gene a restriction endonuclease
- kpnl gene restriction enzyme that rapidly digests bacterial chromosome
- rsaE gene a small RNA that impairs central metabolism by inhibiting translation of 2
- the synthetic Staphylococcus aureus may include a kill switch molecular modification comprising a cell death gene having a nucleotide sequence selected from SEQ ID NOs: 122, 124, 125, 126, 127, 128, 274, 275, 284, 286, 288, 290, 315, or 317, or a substantially identical nucleotide sequence.
- a synthetic Staphylococcus aureus having a molecular modification comprising a blood or serum inducible first promoter operably associated with a cell death gene comprising or derived from a SprAl gene.
- One KS may be sufficient to equip the synthetic microorganism with the desired characteristics, but more than one KS may further enhance the strain by: i) dramatically reducing the rate of KS-inactivating mutations, and; ii) killing the cell by more than one pathway, which could cause faster cell death (a product-enhancing feature).
- the cell death gene may comprise one or more of the DNA sequences (7) downstream of promoters that are shown below. Base pair numbers correspond to pCN51 vector location.
- Sequence was synthesized by DNA 2.0(Atum) and ligated into a vector that can be transformed into E. coli cells for replication. Smal gene was restriction cut at Pstl and EcoRI sites and isolated by gel electrophoresis. Full sequence between restriction sites with start and stop sites italicized. C TGCAGATGAG
- RNA sequence was synthesized by DNA 2.0(Atum) and ligated into a vector that can be transformed into E. coli cells for replication.
- RsaE small regulatory RNA (sRNA) was restriction cut at Pstl and EcoRI sites and isolated by gel electrophoresis. This contains a 5' run-in and the mature RNA is processed out starting at the bold GAAATTAA and ending at the stretch of Ts after the ACG.
- a variant can be used for RsaE sRNA which may express the sRNA more highly which may work more effectively. This variant would start with the GAAATTAA at the 5’ end.
- a synthetic Staphylococcus aureus 502a comprising at least one molecular modification (kill switch) comprising a first cell death gene operably linked to a first regulatory region comprising a first promoter, optionally wherein the first cell death gene comprises a nucleotide sequence selected from SEQ ID NO: 122, 124, 125, 126, 127, 128, 274, 275, 284, 286, 288, 290, 315, and 317, or a substantially identical nucleotide sequence
- kill switches have been described for other purposes, the present KS has the unique features: i) it responds to being exposed to blood or serum; ii) it is endogenously regulated, meaning that the addition or removal of small molecules is not needed to activate or tune the KS (not an auxotroph); and iii) useful combinations of control region/toxin, and of multiple such cassettes may be used to achieve superior performance.
- a synthetic microorganism which comprises kill switch molecular modification comprising (i) a cell death gene operatively associated with (ii) a first regulatory region comprising a first inducible promoter which is induced by exposure to blood or serum.
- the kill switch preferably should be silent (not expressed) in the absence of blood or serum.
- the synthetic microorganism may further comprise at least a second molecular modification
- expression clamp comprising (iii) an antitoxin gene specific for the cell death gene, wherein the antitoxin gene is operably associated with (iv) a second regulatory region comprising a second promoter which is active (e.g., constitutive) upon dermal or mucosal colonization or in a media (e.g., TSB), and preferably is downregulated by exposure to blood, serum or plasma.
- a second regulatory region comprising a second promoter which is active (e.g., constitutive) upon dermal or mucosal colonization or in a media (e.g., TSB), and preferably is downregulated by exposure to blood, serum or plasma.
- the basal level of gene expression (the expression observed when cells are not exposed to blood or serum, e.g., in TSB (tryptic soy broth)) in the KS strain should ideally be very low because producing the toxin prior to contact with serum would kill or weaken the strain prematurely. Even moderate cell health impairment is unacceptable because: 1) escape mutations in the KS would accumulate (KS instability) - a known phenomenon that must be avoided, and/or; 2) the natural efficacy observed with our strain in preliminary trials could be reduced or lost. To understand if leaky expression is a problem, both the absolute level of baseline expression and the fold change in serum are being measured and closely considered in the selection of the optimal control region to drive the KS.
- an "expression clamp” is employed in which the KS cassette contains not only the serum-responsive control region that drives toxin expression, but also encodes a "translation blocking" RNA under control of a Staphylococcus aureus promoter (Pd / n etc) that is normally strongly active in Staphylococcus aureus during colonization of the skin, and in downregulated in blood.
- the clfli gene promoter (P ⁇ // «) will be cloned to drive expression of the sprAlsprAlks, RNA and the cassette will be incorporated into the same expression module as is used for expression of the sprAl toxin from a serum-responsive promoter (eg, P isdB, P higA etc).
- serum/blood exposure activates the toxin (e.g., up to 350-fold or more) but not the antitoxin, and growth in TSB or on the skin activates antitoxin but not toxin.
- FIG. 1 An alternate approach to a synthetic microorganism: KO method
- An alternative way to create a kill-switch-like phenotype in the synthetic microorganism is to disrupt ("knock-out") one or more genes that are required for survival in blood and/or for infection of organs but that are not required (or important) for growth in media or on the skin.
- one or more, or two or more, of the 6 genes shown in Table 5 may be employed in the KO method.
- Table 5 Candidates for gene knockout to create an attenuated strain:
- a synthetic microorganism comprising replacement of one or more of the genes in Table 5 with unmodified or expression- clamped KS, using allelic exchange. This may further enhance the death rate of the synthetic microorganism in blood. Alternatively, the need to integrate two KSs is diminished by having one KO and one KS. In a further embodiment, a synthetic microorganism may comprise a combination of more than one KO that may have synergistic effects.
- a synthetic microorganism comprising a kill switch is provided.
- the kill switch comprises a cell death gene operably linked to a regulatory region (RR) comprising an inducible promoter, as described herein.
- RRs optimal regulatory regions
- This important phase of KS strain construction involves identifying genes that are strongly upregulated in response to human serum and/or whole heparinized blood. Once the genes are identified, their RRs, which contain the promoter and other upstream elements, are identified and annotated. In one approach, any known serum- and blood-responsive gene in Staphylococcus aureus may be employed that is known in the literature.
- a RR includes the upstream regulatory sequences needed for activation (or repression) of mRNA transcription in response to stimuli.
- the motifs include "up” elements, -35, and -10 consensus elements, ribosome binding sites ("shine-dalgarno sequence") and "operator” sequences which bind protein factors that strongly influence transcription.
- harnessing a 200 bp region of DNA sequence upstream of the start codon is usually adequate to capture all of these elements. However, it is preferred to deliberately identify these sequences to ensure their inclusion.
- Table 6 Identification of candidate RRs and serum or blood inducible promoters to drive kill switch o ⁇ components for driving the toxin.
- the entire collection may be assessed for expression in a single standardized assay system with quantitative gene expression measurements made by using real time PCR.
- the basal "leaky” level of gene expression should be very low because producing the toxin prior to contact with serum would kill/weaken the BioPlx-XX strain (synthetic microorganism comprising a kill switch) prematurely.
- the synthetic microorganism having a kill switch may further comprise an "expression clamp" in which the KS cassette contains not only the serum-responsive RR that drives toxin expression, but also encodes a "translation blocking" RNA antitoxin under control of a promoter that is normally active on the skin or nasal mucosa during colonization.
- the kill switch may encode an antitoxin that is capable of suppressing the negative effects of the cell death toxin gene.
- the synthetic microorganism is a Staphylococcus aureus having a molecular modification comprising a kill switch which further comprises an "expression clamp" in which the KS cassette contains not only the serum-responsive RR that drives toxin expression, but also encodes a "translation blocking" RNA antitoxin under control of a Staphylococcus aureus promoter (Pd / n etc.) that is normally active on the skin during colonization, for example, as shown in Table 7.
- a Staphylococcus aureus promoter Pd / n etc.
- RRs with the best mix of low basal expression and high response to serum/blood may be selected to drive KS expression. These RRs may be paired with 3 different KS genes as described herein, generating a panel of KS candidate strains for testing. The panel will include an "expression clamp" candidate as described next.
- the synthetic microorganism may comprise an expression clamp. Genes involved in Staphylococcus aureus colonization of human nares are shown in Table 7 may be employed as a second promoter for use in an expression clamp further comprising an antitoxin gene to block leaky toxin expression when the synthetic strain is colonized on skin or mucosal environments.
- the second promoter may be a constituitive promoter, such as a houskeeping gene.
- the second promoter or may be preferably downregulated in the presence of blood or serum.
- a synthetic microorganism having a molecular modification comprising a kill switch and further comprising an expression clamp comprising an antitoxin gene driven by a second promoter that is normally active on the skin or nasal mucosa during colonization, optionally wherein the second promoter is selected from a gene selected from or derived from clumping factor B (ctfB), autolysin ( sceD ; exoprotein D), walKR (virulence regulator), all A (Major autolysin), and oatA (O- acetyltransferase A), as shown in Table 7.
- clumping factor B clumping factor B
- sceD autolysin
- exoprotein D exoprotein D
- walKR viralulence regulator
- all A Major autolysin
- oatA O- acetyltransferase A
- the constitutive second promoter may alternatively be selected from or derived from a housekeeping gene, for example, gyrB, sigB, or rho, optionally wherein the second promoter comprises a nucleotide sequence of SEQ ID NO: 324, 325, or 326, respectively, or a substantially identical sequence.
- the second promoter for use in the expression clamp may be selected from a gene identified in the target microorganism that has been recognized as being downregulated upon exposure to blood or serum.
- the second promoter for use in an expression clamp molecular modification should be a constitutive promoter that is preferably downregulated upon exposure to blood or serum after a period of time, e.g., after 15 minutes, 30 minutes, 45 minutes, 90 minutes, 120 minutes, 180 minutes, 240 minutes, 360 minutes, or any time point in between, to decrease transcription and/or expression of the cell death gene, by at least 2-fold, 3-fold, 4-fold, 5-fold, or at least lO-fold, compared to transcription and/or expression in the absence of blood or serum.
- the second promoter may be selected from or derived from phosphoribosylglycinamide formyltransferase gene CH52 00525, trehalose permease IIC gene CH52 03480, DeoR foily transcriptional regulator gene CH52 02275, phosphofructokinase gene CH52 02270, or PTS fructose transporter subunit IIC gene CH52_02265.
- the second promoter may be a P ⁇ // « (clumping factor B) gene; optionally wherein the second promoter comprises a nucleotide sequence of SEQ ID NO: 7, 117, 118, 129 or 130, or a substantially identical sequence.
- one of the KS constructs ( sprAl ) is equipped with an expression clamp comprising an antitoxin ⁇ sprAl AS) driven from the Clumping factor B ⁇ clfB) promoter.
- This promoter is one choice to drive the clamp because it is strongly expressed in TSB and during nasal/skin colonization (10 fold higher than the abundant housekeeping gene gyrA ) (Burian 2010). This is directly relevant to manufacturing and use of the product, respectively.
- the Clumping factor B (ctfB) promoter is also downregulated 3 fold in blood (Malachowa 2011), favoring clamp inactivity when. Complete inactivity in blood may not be needed because the serum- responsive promoters driving is so robustly activated in the blood.
- the Clumping factor B (ctfB) promoter is also stably expressed over at least 12 months during nasal colonization in humans and was also identified in rodent and in vitro models of colonization (Burian 2010).
- clfli is selected as a constitutive promoter for use in an expression clamp after confirmation of strong expression in TSB, and lower levels of expression in blood or serum (real time PCR), to determine its characteristics in target strain Staphylococcus aureus 502a.
- the clfli regulatory region is cloned to drive expression of the sprAl antisense (antitoxin) RNA (see Table 3, first entry), and the cassette is incorporated into the same expression shuttle vector as is used for expression of the sprAl toxin gene from a serum-responsive promoter.
- the serum/blood exposure may strongly activate the toxin but not the antitoxin, and TSB or skin/nasal epithelial exposure activates antitoxin but not toxin.
- This concept may be applied to the other KS genes in Table 3 below.
- An alternative possibility for using the clamp is for the restriction enzyme Kpnl (toxin) approach for which the antitoxin may be an RNA aptamer that was recently developed as a potent inhibitor of this enzyme (Mondragon, 2015) as a means of imparting metabolic stability to the aptamer.
- the expression clamp comprises a second promoter operably linked to an antitoxin gene.
- the antitoxin gene is specific for the cell death toxin gene in the kill switch in order to be effective.
- the expression clamp acts to prevent leaky expression of the cell death gene.
- the second promoter operably linked to the antitoxin is downregulated, allowing expression of the cell death gene.
- the synthetic microorganism may contain an expression clamp comprising an antitoxin gene which is specific for silencing the cell death gene.
- the antitoxin may be selected or derived from any antitoxin specific for the cell death gene in the kill switch molecular modification that is known in the art.
- the antitoxin gene may encode an antisense RNA specific for the cell death gene or an antitoxin protein specific for the cell death gene.
- the antitoxin gene may be a sprAl antitoxin gene, or sprAl (AS).
- the sprAl antitoxin gene may comprise a nucleotide sequence of TATAATTGAGATAA CGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGA GGGGATTT (SEQ ID NO: 311), or a substantially identical sequence, or
- the antitoxin gene may be a sprA2 antitoxin, or sprA2(AS), and may comprise a nucleotide sequence of
- the antitoxin gene may be a sprG antitoxin gene, also known as sprF, and may comprise a nucleotide sequence of (5’ -3’) ATATATAGAAAAAGGG
- the antitoxin gene may be a yefM antitoxin gene which is specific for silencing yoeB toxin gene.
- the yefM antitoxin gene may comprise a nucleotide sequence of
- MIITSPTEARKDFYQLLKNVNNNHEPIYISGNNAENNAVIIGLEDWKSIQETIYLE STGTMDKVREREKDN SGTTNIDDIDWDNL SEQ ID NO: 314.
- the antitoxin gene may be a lysostaphin antitoxin gene specific for a lysostaphin toxin gene.
- the lysostaphin antitoxin may comprise a nucleotide sequence of
- the antitoxin gene may be a mazE antitoxin gene that targets mazF.
- the mazE toxin gene may comprise a nucleotide sequence of
- the antitoxin gene may alternatively be designed as follows.
- Staphylococcus aureus there are two main methods used for gene silencing.
- gene silencing which is exemplified by sprAl
- antisense RNA binds to the 5’ UTR of the targeted gene, blocking translation of the gene and causing premature mRNA degradation.
- Another style of gene silencing is used for genes that do not have a transcriptional terminator located close to the stop codon. Translation can be controlled for these genes by an antisense RNA that is complementary (-3-10 bases) to the 3’ end of the targeted gene.
- the antisense RNA will bind to the mRNA transcript covering the sequence coding for the last couple codons and creating double stranded RNA which is then targeted for degradation by RNaselll.
- the antitoxin for a cell death gene may be designed to involve antisense binding to 5’ UTR of targeted gene.
- the toxin gene may be inserted into the PepAl reading frame, and the l2bp in the endogenous sprAl antisense is swapped out for a sequence homologous to l2bp towards the beginning of the heterologous toxin gene.
- Holin inserted into the sprAl location can be controlled by the antisense RNA fragment encoded by (12 bp Holin targeting sequence in
- l87-lysK inserted into the sprAl location can be controlled by the antisense RNA fragment encoded by (12 bp l87-lysK targeting sequence in BOLD) TATAATTGAGAT TTTAGGCAGTGC TATTTACTTATACACCAA TCCCCTCA CTATTTGCGGT
- AGT GAGGGGATTTTT (SEQ ID NO: 309).
- the antitoxin specific for the cell death gene may involve antisense binding to the 3’ UTR of the toxin gene. This method involves inserting the
- heterologous toxin in the place of sprG in the genome of Staphylococcus aureus, and adding an additional lysine codon (AAA) before the final stop codon.
- AAA additional lysine codon
- the sprF RNA is transcribed at a rate of 2.5 times greater than the heterologous toxin gene, it will form a duplex with the 3’UTR region of the toxin transcript, initiating degradation by RNaselll and blocking the formation of a functional peptide.
- the sequence of the antitoxin will remain the same for all three of these toxin genes.
- the sprG antitoxin gene may comprise the nucleotide sequence ATATATAGAAAAA
- the antitoxin gene may comprise a nucleotide sequence selected from any of SEQ ID NOs: 273, 306, 307, 308, 309, 310, 311, 312, 314, 319, or 322, or a substantially identical sequence thereof.
- the antitoxin gene may or may not encode an antitoxin peptide.
- the antitoxin peptide may be specific for the toxin peptide encoded by the cell death gene.
- the toxin gene is a yoeB toxin gene, e.g., encoding a toxin peptide comprising an amino acid sequence of SEQ ID NO: 316
- the antitoxin gene may encode a yefM antitoxin protein comprising the amino acid sequence of
- the antitoxin gene is a mazF toxin gene, e.g., encoding a toxin peptide comprising an amino acid sequence of SEQ ID NO: 321
- the antitoxin gene may be an mazE antitoxin gene, e.g., encoding an antitoxin protein comprising an amino acid sequence of MLSFSQNRSHSLEQSLKEGYSQ
- the synthetic microorganism comprises one or more, two or more or each of sprAl , kpnl or rsaE to achieve maximal death rates as early data instruct.
- the sprAl mechanism of action is a loss of plasma membrane integrity/function by expression of a pore-forming peptide the kpnl mechanism of action involves destruction of the Staphylococcus aureus genome with a restriction enzyme.
- the rsaE mechanism of action involves impairment of central metabolism including TCA cycle and tetrahydrfolate biosynthesis.
- the synthetic microorganism comprises regulatory region comprising a first promoter operably linked to a cell death gene, wherein the cell death gene encodes a toxin peptide or protein, and wherein the first promoter is upregulated upon exposure to blood or serum.
- the cell death gene may be a sprAl gene.
- SprAl encodes toxin peptide PepAl as described in Sayed et al., 2012 JBC VOL. 287, NO. 52, pp. 43454-43463, December 21, 2012. PepAl induces cell death by membrane permeabilization.
- PepAl has amino acid sequence:
- Related antimicrobial peptides include MMLIF VHII AP VI S GC AIAFF S YWL SRRNTK (SEQ ID NO: 105), AIAFF S YWL SRRNTK (SEQ ID NO: 106), IAFFS YWL SRRNTK (SEQ ID NO: 107), AFF S YWL SRRNTK (SEQ ID NO: 108), FFSYWLSRRNTK (SEQ ID NO: 109),
- S YWLSRRNTK (SEQ ID NO: 1 10), SYWLSRRNTK (SEQ ID NO: 1 1 1), or
- the cell death gene may be an sprA2 gene.
- the sprA2 gene may encode a toxin
- the cell death gene may be a Staphylococcus aureus yoeB gene which may encode a yoeB toxin having the amino acid sequence of
- the cell death gene may be a Staphylococcus simulans gene which may encode a metallopeptidase toxin gene having an amino acid sequence of
- the cell death gene may be a mazF toxin gene that encodes a mazF toxin comprising an amino acid sequence of
- the cell death gene may encode a toxin peptide or protein comprising an amino acid sequence of SEQ ID NO: 104, 105, 106, 107, 108, 109, 110, 111, 112, 285, 287, 289, 291, 305, 316, 318, or 321, or a substantially similar amino acid sequence.
- the first promoter is silent, is not active, or is minimally active, in the absence of blood or serum.
- PepAl is a toxic pore forming peptide that causes Staphylococcus aureus death by altering essential cell membrane functions. Its natural role is unknown but speculated to be altruistic assistance to the Staphylococcus aureus population/culture by killing of cells that are adversely affected by environmental conditions. By over expressing this gene a rapid and complete cell death occurs in the presence of serum.
- sprAl mRNA translation is repressed by an antisense RNA called sprAl l (SprAl antisense).
- the cis-encoded SprAl AS RNA operates in trans to downregulate the sprAl- encoded peptide expression in vivo , as described in WO 2013/050590, which is incorporated herein by reference.
- the antisense RNA may in fact be a convenient safeguard to minimize "leaky” toxicity. It will be driven from a promoter that is expressed in Staphylococcus aureus on the human skin and nasal epithelia during colonization. Advantages of sprAl include the expression of a small peptide, having known structure and activity.
- a synthetic microorganism comprising a first cell death gene sprAl operably linked to a first regulatory region comprising a blood and/or serum inducible first promoter comprising a nucleotide sequence of any one of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 114, 115, 119, 120, 121, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, or 163.
- the first promoter may be upregulated greater than 5-fold, greater than lO-fold, greater than 50-fold, greater than lOO-fold, greater than 300-fold, or greater than 600-fold after 15, 30, 45, 60, 90, 120, 180 or 240 minutes of incubation in blood or serum.
- the first promoter may be upregulated greater than 5-fold after 90 minutes of inclubation in serum and may be selected from fhuA, fhuB, isdl, isdA, srtB, isdG, sbnE, sbnA, sbnC, and isdB.
- the first promoter may be upregulated greater than lOO-fold after 90 minutes of incubation in serum and may be selected from isdA, srtB, isdG, sbnE, sbnA, sbnC, and isdB.
- the cell death gene may encode an antimicrobial peptide comprising an amino acid sequence of SEQ ID NO: 104, 105, 106, 107, 108, 109, 110, 111, 112, 285, 287, 289, 291, 305, 316, 318, or 321, or a substantially similar amino acid sequence thereof.
- the cell death gene may be selected from any known Staphylococcus spp. toxin gene.
- the cell death gene may be selected from a sprAl toxin gene, sprA2 toxin gene, 187-lysK toxin gene, holin toxin gene, sprG toxin gene, yoeB toxin gene, lysostaphin toxin gene, metallopeptidase toxin gene, or mazF toxin gene, or a substantially identical toxin gene.
- the toxin gene may comprise a nucleotide sequence of SEQ ID NO: 274, 275, 284, 286, 288, 290, 304, 315, 317, or 320, or a substantially identical nucleotide sequence thereof.
- the cell death gene may be sprAl which encodes the antimicrobial peptide PepAl .
- the synthetic microorganism further comprises an antitoxin gene SprAl -AS operably linked to a second regulatory region comprising a second promoter comprising a nucleotide sequence of clfli comprising a nucleotide sequence of SEQ ID NO: 7, 117, 118, 129 or 130, or a substantially identical sequence.
- the synthetic microorganism comprises a restriction enzyme Kpnl ⁇ Klebsiella pnemoniae) gene.
- Kpnl protects bacterial genomes against invasion by foreign DNA.
- High-level expression of (eg) 6-bp recognition restriction enzyme Kpnl will efficiently cleave the Staphylococcus aureus genome.
- the expression vector (below) will be engineered to lack cleavage recognition sites by (eg) adjustment of codon usage.
- the 6-base recognition sequence occurs once every 4096 bp, cutting the 2.8 MB genome of Staphylococcus aureus into -684 fragments.
- Kpnl has the advantage of rapid activity.
- "leaky" expression problem may be managed by expressing an RNA aptamer as the clamp as described above for sprAl.
- the synthetic microorganism comprises a rsaE gene.
- the rsaE gene is a small RNA (93 nt) that coordinately inhibits 2 different metabolic pathways by targeting translation initiation of certain housekeeping mRNAs encoding enzymes of THF biosynthesis pathway and citric acid cycle; high-level expression is toxic.
- RseE growth impairment occurs due to inhibition of essential housekeeping enzymes. This occurs by binding to the Opp3A and OppB mRNAs in the ribosome-binding site and start codon region, preventing translation.
- Both genes encode components of the ABC peptide transporter system and affect the supply of essential nitrogen/amino acids in the cell, impairing central biochemical metabolism directly and indirectly.
- Advantages include severe growth inhibition (10,000 fold over empty vector controls), and efficient multifunctionality because a single sRNA impairs expression of multiple essential biochemical pathways.
- Geissman et al. 2009 and Bohn et al. 2010 report on the natural function of RsaE.
- KS serum-activated kill switch
- E. coli strain DC10B may be employed.
- DC10B is an E. coli strain that is only DCM minus (BEI product number NR-49804). This is one way to generate DNA that can be readily transfected into most Staphylococcus aureus strains.
- KS strain candidates are performed including a functional test of strain death in vivo ; and a functional test of colonization-skin discs.
- a method for preparing a synthetic Staphylococcus aureus strain from BioPlx-Ol comprising (1) producing a shuttle vector pCN5 l in mid-scale in E. coli , (2) cloning cell death genes into pCN5 l in E.
- a method for performance testing a synthetic Staphylococcus aureus strain from BioPlx-Ol comprising (1) growing in TSB plus antibiotic as selective pressure for plasmid, (2) comparing growth to WT BioPlx-Ol optionally generating a growth curve, (3a) for Cd-promoter variants, washing and shifting cells to Cd-medium (control is BioPlx-Ol containing empty vector with no cell death gene) - or - (3b) for KS variants, washing and shifting cells to serum (control is WT BioPlx-Ol containing empty vector with no cell death gene), and (4) monitoring growth using OD 630 nm with plate reader , optionally for extended period with monitoring for escape mutants.
- CFUs colony forming units
- Methods for evaluation of cell death induction comprises recombinant construction of the synthetic microorganism comprising cloning the genes into an E. coli- SA shuttle vector and transfecting this vector into BioPlx-Ol for evaluation.
- Step 1 Request Shuttle Vector PCN51
- a commercially available shuttle vector is obtained such as PCN51
- a schematic of commercially available shuttle vector pCN5 l (BEI cat # NR-46149) is shown in FIG. 2. Genetic elements shown of pCN5 l shuttle plasmid are shown in Table 8
- Promoter sequences (7) used in development are shown below, the base pair numbers in leu A, hlgA and Cadmium promoters correspond to pCN5 l vector location.
- Pstl This promoter is used for controls and is part of the original pCN5l vector from BEI Resources (https://www.beiresources.org/).
- Pstl [00502] 4. clfB promoter (P C IJB) to drive the antisense regulatory RNA sprA / AS.
- the isdA promoter (P/ Vi/,i ). This sequence was taken 300 base pairs upstream of the SstA start site as shown underlined below from the NCBI 502a complete genome.
- a plasmid, vector, or synthetic microorganism comprising a molecular modification comprising a cell death gene operably linked to an inducible blood or serum responsive first promoter comprising a nucleotide sequence selected from the group consisting of SEQ ID NO: 114, 115, 119, 120, 121, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, and 163, or a substantially identical nucleotide sequence.
- the molecular modification further comprises an expression clamp comprising an antitoxin gene operably linked to a second promoter comprising a nucleotide sequence selected from SEQ ID NO: 7, 117, 118, 129 or 130
- Step 2 Cloning best two serum-responsive RRs into the shuttle vector (E. coli host)
- Cloning of candidate serum-responsive RRs into the shuttle vector comprises: (a) PCR amplification of the best two preferred serum-responsive RRs from BioPlx-Ol genomic DNA (gDNA); and (b) replacing the Cadmium-inducible promoter with these RR fragments in pCN51 to create two new plasmids (RR1 and RR2), and (3) selecting clones in E. coli DH10B (or DH5 alpha) and sequencing of insertions.
- KS genes are obtained from Staphylococcus aureus gDNA or by de novo synthesis: (i) sprA I !spr A / AS: synthetic; (ii) RsaE: Staphylococcus aureus genomic DNA. And (iii) Kpnl: synthetic.
- PCR primers are used with relevant restriction enzymes for cloning.
- the cloning sites will be included at synthesis and any undesirable sites removed during construction. For example, Kpnl sites will be removed from the kpnl cassette to prevent auto digestion.
- the KS genes are inserted downstream of serum-responsive RRs in plasmids RR1 and RR2, generating all constructs listed below. Insert the KS genes downstream of Cd-inducible promoter in pCN5l to create positive control constructs. See additional relevant sequences and primer sequences provided herein useful for these steps, for example, Tables 2, 3 and 4. Sequencing of promoters and inserts of all constructs is performed to ensure that mutations have not accumulated in the construction process
- Step 3 Transfect plasmids into intermediate Staphylococcus aureus RN4220 (to obtain correct DNA methylation pattern). There is no need to transfect reverse orientation constructs; but transfection of pCN5l empty vector is performed as follows: A. Electroporate into RN4220;
- Step 4 Transfect into BioPlx-Ol
- Step 5 Test KS expression and extent and rate of death in response to serum and blood exposure
- Step 6 Measure the rate of KS mutation
- Step 7 Analysis and interpretation
- KS strain(s) are those with unaffected growth rates (and colonization potential); and that show rapid and complete death in response to blood and/or serum; and that have stable molecular modifications.
- Step 8 Determine need for inserting multiple KS cassettes
- the optimal serum/blood responsive KS construct(s) will be integrated into the chromosome precisely at a pre-selected location known to tolerate insertions without notably altering the cell's biology.
- Step 1 Obtain an Integrative vector for use in Staphylococcus aureus.
- plasmids pKORl or pIMAY may be employed because they provide the ability to choose the integration site, allowing us to avoid perturbing biologically critical regions of the genome that can occur with other methods. Both vectors possess a convenient means for counter- selection ( secY) so that the plasmid backbone and its markers can be excised from the genome after the KS has been integrated.
- a genetic map of pKORl is shown in FIG. 5A and the features are described in Bae et al. 2006 Plasmid 55, pp. 58-63, and briefly described in Table 9.
- An advantage of pKOR is the ability to clone inserts without the limits of specific restriction enzymes.
- FIG. 12A-12C shows nucleotide sequence (SEQ ID NO: 131) of pIMAY Integrative Plasmid (accession number JQ62198).
- the A. colU staphylococcal temperature-sensitive plasmid pIMAYz comprises the low-copy- number A. coli origin of replication (pl5A), an origin of transfer for conjugation (oriT), the pBluescript multiple cloning site (MCS), and the highly expressed cat gene (P help- cat ' ) derived from pIMC.
- the temperature-sensitive replicon for Gram-positive bacteria (, repBCAD ) and the anhydrotetracycline-inducible antisense secY region ( anti-secY ) may be amplified from pVE6007 and pKORl, respectively.
- the restriction sites listed are unique.
- Primers (IM151/152) bind external to the MCS of pIMAY and are used to screen clones in E. coli (amplify 283 bp without a cloned insert) and to determine the presence of a replicating plasmid in staphylococci.
- Advantages of pIMAYz are smaller size, blue white screening, and a lower nonpermissive temperature, which has been reported to avoid mutations that can occur in the integration process.
- the plasmid may be made by de novo gene synthesis at a contract vendor firm.
- BioPlx-Ol is sensitive to ampicillin (50 pg/mL and 100 pg/mL), chloramphenicol (10 pg/mL), and erythromycin (Drury 1965).
- the chloramphenicol (cat+) gene is used to select for transformants on chloramphenicol plates during the integration process.
- Step 3 Generate the DNA fragment to be integrated.
- [00543] Prepare a plasmid in shuttle vector pTKl that contains the following elements in tandem: [aTTB2]-[l Kb of sequence upstream of target region to be replaced]-[KS cassette- AmpR]-[l Kb of sequence downstream of target region] ATTB1 according to a modification of Bae et al., 2006. Drop the fragment out of this plasmid with restriction enzymes and isolate it.
- the "KS cassette” may actually be one or two copies of a KS, pending the outcome of genetic stability testing.
- Step 4. Insert KS cassette(s) to pKOR plasmid.
- Step 5 Obtain the KS strain-containing integration plasmid in BioPlx-Ol
- Step 6 Plasmid integration to chromosome.
- Step 7 Counter selection to evict plasmid backbone
- step 6 grow the colony isolate from step 6 at the permissive temperature (30°C) to favor plasmid excision and plate on 2 pg/mL and 3 pg/mL anhydrotetracycline (aTc) agar to obtain colonies in which the target gene has integrated and the plasmid has been excised and lost (the counterselection step). Any colonies that grow on plates containing >2 pg/mL aTc do not contain the plasmid because the plasmid backbone contains the lethal aTc-derepressible SecY antisense gene.
- aTc anhydrotetracycline
- Step 9 Check serum-induced cell death
- Step 10 Verify expression of KS mRNA
- BioPlx- XX Animal studies may be performed with synthetic microorganisms BioPlx- XX created by these methods. In vivo functional studies to test kill switch strain function may be performed. Possible studies include a mouse study to show difference in pathogenicity of intravenous or intraperitoneal injection of wt BioPlx-Ol vs. KS strain. An in vitro skin colonization test may also be performed. Additional tests may include, in mouse: LDso test, BioPlx-Ol vs. BioPlx-XX is performed. As another example, in rat or other: colonization test, BioPlx-Ol vs. BioPlx-XX is performed.
- a method for preparing a synthetic Staphylococcus aureus strain from BioPlx-Ol comprising use of CRISPR-Cas induced homology directed repair to direct insertion of optimal KS candidates for long-term stable expression.
- a method for preparing a synthetic Staphylococcus aureus strain from BioPlx-Ol comprising (1) obtaining competent cells, (2) design and testing of CRISPR guide RNA (gRNA) sequences and simultaneously testing pCasSA, (3) designing and testing homology dependent repair templates using a fluorescent reporter controlled by a constitutive reporter, (4) checking KS promoters with fluorescent reporter, (5) inserting KS into BioPlx-Ol and verifying incorporation, and (6) testing for efficacy and longevity.
- inserting additional KS cassettes in alternative locations within BioPlx-Ol genome is performed.
- FIG. 10 shows cassette for integration via CRISPR and layout of the pCasSA vector.
- ?cap I A is a constitutive promoter controlling gRNA transcription.
- Target seq is targeting sequence, for example, with 10 possible cutting targets (1.1, 1.2 etc.).
- gRNA is single-strand guide RNA (provides structural component).
- Xbal and Xhol are two restriction sites used to add the homology arms (HAs) to the pCasSA vector. HAs are homology arms to use as templates for homology directed repair (200 - 1000 bp).
- P /-/t/ .-mCherry is a constitutive promoter controlling the“optimized” mCherry.
- Pr /wi -Cas9 is a constitutive promoter controlling Cas9 protein expression.
- FIG. 11 shows vectors for various uses in the present disclosure.
- A is a vector used for promoter screen with fluorescence using pCN5 l .
- B is a vector for promoter screen with cell death gene.
- C is a vector for chromosomal integration using CRISPR.
- D is a vector for chromosomal integration using homologous recombination.
- L & R HA homology arms to genomic target locus
- CRISPR targeting RNA guide to genomic locus
- mCherry fluorescent reporter protein
- Cas9 protein CRISPR endonuclease
- kanR kanamycin resistance
- oriT origin of transfer (for integration)
- Smal representative kill gene (restriction endonuclease).
- compositions comprising a synthetic microorganism and an excipient, or carrier.
- the compositions can be administered in any method suitable to their particular immunogenic or biologically or immunologically reactive characteristics, including oral, intravenous, buccal, nasal, mucosal, dermal or other method, within an appropriate carrier matrix.
- compositions are provided for topical administration to a dermal site, and/or a mucosal site in a subject. Another specific embodiment involves the oral administration of the composition of the disclosure.
- the replacing step comprises topically administering of the synthetic strain to the dermal or mucosal at least one host subject site and optionally adjacent areas in the subject no more than one, no more than two, or no more than three times.
- the administration may include initial topical application of a composition comprising at least 10 6 , at least 10 7 , at least 10 8 , at least 10 9 , or at least 10 10 CFU of the synthetic strain and a pharmaceutically acceptable carrier to the at least one host site in the subject.
- the initial replacing step may be performed within 12 hours, 24 hours, 36 hours, 48 hours, 72 hours, 4 days, 5 days, 6 days, 7 days, 8 days, or 9 days of the final suppressing step.
- composition comprising a synthetic microorganism may be administered to the dermal and/or mucosal at least one site in the subject, and optionally adjacent sites at least once, for example, from one to 30 times, one to 20 times, one to ten times, one to six times, one to five times, one to four times, one to three times, or one to two times, or no more than once, twice, three times, 4 times, 5 times, 6 times, 8 times per month, 10 times, or no more than 12 times per month.
- Subsequent administration of the composition may occur after a period of, for example, one to 30 days, two to 20 days, three to 15 days, or four to 10 days after the first administration.
- Colonization of the synthetic microorganism may be promoted in the subject by administering a composition comprising a promoting agent selected from a nutrient, prebiotic, stabilizing agent, humectant, and/or probiotic bacterial species.
- the promoting agent may be administered to a subject in a separate promoting agent composition or may be added to the microbial composition.
- the promoting agent may be a nutrient, for example, selected from sodium chloride, lithium chloride, sodium glycerophosphate, phenyl ethanol, mannitol, tryptone, and yeast extract.
- the prebiotic is selected from the group consisting of short-chain fatty acids (acetic acid, propionic acid, butyric acid, isobutyric acid, valeric acid, isovaleric acid), glycerol, pectin-derived oligosaccharides from agricultural by-products, fructo-oligosaccarides (e.g., inulin-like prebiotics), galacto-oligosaccharides (e.g., raffmose), succinic acid, lactic acid, and mannan-oligosaccharides.
- short-chain fatty acids acetic acid, propionic acid, butyric acid, isobutyric acid, valeric acid, isovaleric acid
- pectin-derived oligosaccharides from agricultural by-products
- fructo-oligosaccarides e.g., inulin-like prebiotics
- galacto-oligosaccharides e.g., raffmose
- the promoting agent may be a probiotic.
- the probiotic may be any known probiotic known in the art.
- Probiotics are live microorganisms that provide a health benefit to the host.
- probiotics may be applied topically to dermal and mucosal microbiomes, and/or probiotics may be orally administered to provide dermal and mucosal health benefits to the subject.
- Several strains of Lactobacillus have been shown to have systemic anti inflammatory effects. Studies have shown that certain strains of Lactobacillus reuteri induce systemic anti-inflammatory cytokines, such as interleukin (IL)-lO.
- IL interleukin
- Soluble factors from Lactobacillus reuteri inhibit production of pro-inflammatory cytokines. Lactobacillus paracasei strains have been shown to inhibit neutrogenic inflammation in a skin model Kober at ah, 2015, Int J Women’s Dermatol 1(2015) 85-89. In human dermal fibroblasts and hairless mice models, Lactobacillus Plantarum has been shown to inhibit UVB-induced matrix metalloproteinase 1 (MMP-l) expression to preserve procollagen expression in human fibroblasts. Oral administration of L. plantarum in hairless mice histologic samples demonstrated that L. plantarum inhibited MMP-13, MMP-2, and MMP-9 expression in dermal tissue.
- MMP-l matrix metalloproteinase 1
- the probiotic may be a topical probiotic or an oral probiotic.
- the probiotic may be, for example, a different genus and species than the undesirable microorganism, or of the same genus but different species, than the undesirable microorganism.
- the probiotic species may be a different genus and species than the target microorganism.
- the probiotic may or may not be modified to comprise a kill switch molecular modification.
- the probiotic may be selected from a Lactobacillus spp, Bifidobacterium spp. Streptococcus spp., or Enterococcuss spp.
- the probiotic may be selected from Bifidobacterium breve, Bifidobacterium bifidum, Bifidobacterium laciis, Bifidobacterium infantis, Bifidobacterium breve, Bifidobacterium longum, Lactobacillus reuteri, Lactobacillus paracasei, Lactobacillus plantarum, Lactobacillus johnsonii, Lactobacillus rhamnosus, Lactobacillus acidophilus, Lactobacillus salivarius, Lactobacillus casei, Lactobacillus plantarum, Lactococcus lactis, Streptococcus thermophiles, Streptococcus salivarius, or Enterococcus fecalis.
- the promoting agent may include a protein stabilizing agent such as those disclosed in an incorporated by reference from U.S. Pat. No. 5,525,336 is included in the composition.
- a protein stabilizing agent such as those disclosed in an incorporated by reference from U.S. Pat. No. 5,525,336 is included in the composition.
- Non-limiting examples include glycerol, trehelose, ethylenediaminetetraacetic acid, cysteine, a cyclodextrin such as an alpha-, beta-, or gamma-cyclodextrin, or a derivative thereof, such as a 2-hydroxypropyl beta- cyclodextrin, and proteinase inhibitors such as leupeptin, pepstatin, antipain, and cystatin.
- the promoting agent may include a humectant.
- humectants include glycerin, sorbitol, sodium 2-pyrrolidone-5-carboxylate, soluble collagen, and dibutylphthalate.
- compositions comprising a synthetic microorganism and a pharmaceutically acceptable carrier, diluent, emollient, binder, excipient, lubricant, sweetening agent, flavoring agent, buffer, thickener, wetting agent, or absorbent.
- compositions are selected from the group consisting of water, saline, phosphate buffered saline, or a solvent.
- the solvent may be selected from, for example, ethyl alcohol, toluene, isopropanol, n-butyl alcohol, castor oil, ethylene glycol monoethyl ether, diethylene glycol monobutyl ether, diethylene glycol monoethyl ether, dimethyl sulphoxide, dimethyl formamide and tetrahydrofuran.
- the carrier or diluent may further comprise one or more surfactants such as i) Anionic surfactants, such as metallic or alkanolamine salts of fatty acids for example sodium laurate and triethanolamine oleate; alkyl benzene sulphones, for example triethanolamine dodecyl benzene sulphonate; alkyl sulphates, for example sodium lauryl sulphate; alkyl ether sulphates, for example sodium lauryl ether sulphate (2 to 8 EO); sulphosuccinates, for example sodium dioctyl sulphonsuccinate; monoglyceride sulphates, for example sodium glyceryl monostearate monosulphate; isothionates, for example sodium isothionate; methyl taurides, for example Igepon T; acylsarcosinates, for example sodium myristyl sarcosinate; acyl peptides,
- the composition may include a buffer component to help stabilize the pH.
- the pH is between 4.5-8.5.
- the pH can be approximately 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9 or 8.0, including any value in between.
- the pH is from 5.0 to 8.0, 6.0 to 7.5, 6.8 to 7.4, or about 7.0.
- Non-limiting examples of buffers can include ACES, acetate, ADA, ammonium hydroxide, AMP (2-amino-2-methyl-l -propanol), AMPD (2-amino- 2-methyl- 1,3 -propanediol), AMPSO, BES, BICINE, bis-tris, BIS-TRIS propane, borate, CABS, cacodylate, CAPS, CAPSO, carbonate (pKl), carbonate (pK2), CHES, citrate (pKl), citrate (pK2), citrate (pK3), DIPSO, EPPS, HEPPS, ethanolamine, formate, glycine (pKl), glycine (pK2), glycylglycine (pKl), glycylglycine (pK2), HEPBS, HEPES, HEPPSO, histidine, hydrazine, imidazole, malate (pKl), malate (pK2),
- Excipients may include a lactose, mannitol, sorbitol, microcrystalline cellulose, sucrose, sodium citrate, dicalcium phosphate, phosphate buffer, or any other ingredient of the similar nature alone or in a suitable combination thereof.
- the microbial composition may include a binder may, for example, a gum tragacanth, gum acacia, methyl cellulose, gelatin, polyvinyl pyrrolidone, starch or any other ingredient of the similar nature alone or in a suitable combination thereof; excipients selected from the group consisting of agar-agar, calcium carbonate, sodium carbonate, silicates, alginic acid, corn starch, potato tapioca starch, primogel or any other ingredient of the similar nature alone or in a suitable combination thereof; lubricants selected from the group consisting of a magnesium stearate, calcium stearate, talc, solid polyethylene glycols, sodium lauryl sulfate or any other ingredient of the similar nature alone; glidants selected from the group consisting of colloidal silicon dioxide or any other ingredient of the similar nature alone or in a suitable combination thereof; a stabilizer selected from the group consisting of such as mannitol, sucrose, trehalose
- the microbial composition may comprise one or more emollients.
- emollients include stearyl alcohol, glyceryl monoricinoleate, glyceryl mono stearate, propane- l,2-diol, butane-l,3-diol, mink oil, cetyl alcohol, isopropyl isostearate, stearic acid, isobutyl palmitate, isocetyl stearate, oleyl alcohol, isopropyl laurate, hexyl laurate, decyl oleate, octadecan-2-ol, isocetyl alcohol, cetyl palmitate, dimethylpolysiloxane, di-n-butyl sebacate, isopropyl myristate, isopropyl palmitate, isopropyl stearate, butyl stearate, polyethylene glycol, triethylene glycol,
- the microbial composition may include a thickener, for example, where the thickener may be selected from hydroxyethylcelluloses (e.g. Natrosol), starch, gums such as gum arabic, kaolin or other clays, hydrated aluminum silicate, fumed silica, carboxyvinyl polymer, sodium carboxymethyl cellulose or other cellulose derivatives, ethylene glycol monostearate and sodium alginates.
- the microbial composition may include preservatives, antiseptics, pigments or colorants, fragrances, masking agents, and carriers, such as water and lower alkyl, alcohols, such as those disclosed in an incorporated by reference from U.S. Pat. No. 5,525,336 are included in compositions.
- the microbial compositions for topical administration may be provided in liquid, solution, suspension, cream, lotion, ointment, gel, or in a solid form such as a powder, tablet, or troche for suspension immediately prior to administration.
- the compositions for topical use may also be provided as hard capsules, or soft gelatin capsules, wherein the benign and/or synthetic microorganism is mixed with water or an oil medium, for example, peanut oil, liquid paraffin, or olive oil.
- Powders and granulates may be prepared using the ingredients mentioned above under tablets and capsules for dissolution in a conventional manner using, e.g., a mixer, a fluid bed apparatus, lyophilization or a spray drying equipment.
- a dried microbial composition may administered directly or may be for suspension in a carrier.
- the powders may include chalk, talc, fullers earth, colloidal silicon dioxide, sodium polyacrylate, tetra alkyl and/or trialkyl aryl ammonium smectites and chemically modified magnesium aluminum silicate in a carrier.
- the powders may include chalk, talc, fullers earth, colloidal silicon dioxide, sodium polyacrylate, tetra alkyl and/or trialkyl aryl ammonium smectites and chemically modified magnesium aluminum silicate
- the microbial composition may exhibit a stable CFU losing less than 30%, 20%, 10% or 5% cfu over at least one, two, three months, six months, 12 months 18 months, or 24 months when stored at frozen, refrigerated or preferrably at room temperature.
- kits comprises a container housing live bacteria or a container housing freeze-dried live bacteria.
- Kits can include a second container including media.
- Kits may also include one or more decolonizing agents.
- Kits can also include instructions for administering the composition.
- instructions are provided for mixing the bacterial strains with other components of the composition.
- a kit further includes an applicator to apply the microbial composition to a subject.
- composition for topical administration that is a solution composition, or for reconstitution to a solution composition.
- composition may include from about 1 x 10 5 to 1 x 10 12 cfu/ml, 1 x 10 6 to 1 x 10 10 cfu/ml, or 1.2 x 10 7 to 1.2 x 10 9 CFU/mL of the synthetic microorganism in an aqueous solution, such as phosphate buffered saline (PBS). Lower doses may be employed for preliminary irritation studies in a subject.
- PBS phosphate buffered saline
- the subject does not exhibit recurrence of the undesirable microorganism as evidenced by swabbing the subject at the at least one site after at least 2, 3, 4, 6, 10, 15, 22, 26, 30 or 52 weeks after performing the initial administering step.
- methods are provided to create production of a desired substance at the site of the microbiome (nanofactory).
- Synthetic microorganisms are provided that may comprise a nanofactory molecular modification.
- nanofactory refers to a molecular modification of a target microorganism that results in the production of a product - either a primary product such as a protein, enzyme, polypeptide, amino acid or nucleic acid, or a secondary product such as a small molecule to produce a beneficial effect.
- the product may be secreted from the synthetic microorganism or may be in the form of an inclusion body.
- Such nanofactory bacterial strains have the potential to provide to the host subject a wide range of durable benefits including: (i) the acquisition of cellular products and enzymes for which the host was previously deficient and; (ii) the acquisition of a delivery system of a microbially manufactured small molecule, polypeptide or protein pharmaceuticals for diverse therapeutic and prophylactic benefit.
- Such nanofactory bacterial strains when durably integrated into the biome as described herein would provide a useful durable alternative steady state production of product than direct product application.
- Methods and synthetic microorganisms are provided herein to replace existing colonization by an undesirable microorganism with a synthetic bacterial strain comprising a nanofactory molecular modification for the production or consumption of a primary or secondary product, where the target microorganism may be a strain of Acinetobacter johnsonii, Acinetobacter baumannii, Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus lugdunensis, Staphylococcus warneri, Staphylococcus saprophyticus, Corynebacterium acnes, Corynebacterium striatum, Corynebacterium diphtheriae, Corynebacterium minutissimum, Cutibacterium acnes, Propionibacterium acnes, Propionibacterium granulosum, Streptococcus pyogenes, Streptococcus aureus, Streptococcus agalactiae
- the nanofactory molecular modification in a synthetic microorganism may be used to assist its host subject, i.e., a patient with a deficit of some primary (anabolic or catabolic) or secondary metabolic pathway or any other ailment stemming from the over or under abundance of some small molecule or macromolecule such as an enzyme.
- the nanofactory molecular modification may encode an enzyme, amino acid, metabolic intermediate, or small molecule.
- the nanofactory molecular modification may confer a new production (synthesis) or metabolic function into the host
- microbiome such as the ability to endogenously synthesize or metabolize specific compounds, or synthesize enzymes or other active molecules to operate within the exogenous microbiome.
- the microorganism will carry a nanofactory selected from a biosynthetic gene, biosynthetic gene cluster, or gene(s) coding for one or multiple enzymes under the control of a differentially regulated, inducible or constitutively regulated promoter.
- the synthetic microorganism comprising a nanofactory is to be administered to at the at least one site of the body be it dermal, mucosal, or other site as a singular agent or in conjunction with a second, third or fourth synthetic microorganism that help the first synthetic microorganism restore the loss of function on or in the host subject.
- a synthetic microorganism comprising a nanofactory may be used for restoration of function by the production of intercellularly active factors, for example, microbial supplementation of digestive enzymes in patients with exocrine pancreatic insufficiency by secreted recombinant enzymes in the small intestine.
- the pancreas is a vital organ and plays a key role in digestion.
- Exocrine pancreatic insufficiency (EPI) is caused by prolonged damage to the pancreas, which leads to the reduction or absence of quintessential digestive enzymes in the small intestine that primarily breakdown fats and carbohydrates. The loss of these enzymes can lead to a wide breadth or symptoms and depends on the severity of the EPI.
- the small intestine’s pH level in the proximal small intestine (duodenum) is lower than that of the distal region. This shift in environment leads to microbial niche occupation that is pH dependent. This pH dependency has naturally selected for duodenum commensal bacteria that could be molecularly modified to become synthetic microorganisms, which would intrinsically localize themselves to that region of the gastrointestinal tract.
- the stomach and upper two-thirds of the small intestine contain acid tolerant Lactobacilli and Streptococci (Hao, Wl, Lee YK. Microflora of the gastrointestinal tract: a review. Methods Mol. Biol. 2004, 268, 491-502) and could be isolated from healthy donors. By knocking in recombinant lipases, amylases and/or proteases with secretory signaling sequences, the colonization of the duodenum by the synthetic microorganisms could restore digestive function in patients suffering from EPI.
- a synthetic microorganism comprising a nanofactory may be used for restoration of function by the production of intracellularly active factors. For example, protecting a subject suffering from phenylketonuria (PKU) by eliminating phenylalanine in the gastrointestinal tract. Phenylalanine is an essential amino acid, meaning that the human body cannot produce it and must acquire it through nourishment. Once in the body, the breakdown of phenylalanine is carried out by one protein, phenylalanine hydroxylase (PAH).
- PKU phenylketonuria
- PAH phenylalanine hydroxylase
- phenylketonuria The inheritable genetic disorder known as phenylketonuria (PKU) is caused by mutations in the gene coding for PAH, which results in the build up of phenylalanine in the body.
- PKU phenylketonuria
- a synthetic microorganism that has been molecularly modified to breakdown phenyalanine intracellularly can be introduced into the gastrointestinal tract. This synthetic microorganism constitutes a PAH nanofactory, breaking down phenyalanine before it has a chance to enter the body of the host with PKU.
- a synthetic bacteria may be derived from a target commensal bacteria from the skin microbiota may comprising a nanofactory molecular modification.
- the target commensal skin or mucosal bacterium may be, e.g., a Staphylococcus spp., Streptococcus spp., or a Cutibacterium spp.
- Staphylococcus epidermidis may be the target microorganism because it is found in multiple dermal or mucosal environmental types.
- Engineering a synthetic S. epidermidis, given its ability to persist in different environments, would allow for the development and optimization of multiple kinds of delivery techniques and locations.
- a synthetic S. epidermidis strain may comprise a nanofactory molecular modification to produce testosterone for men suffering from male hypogonadism.
- the production of testosterone could be accomplished by: (i) introduction of the entire sterol biosynthetic pathway with the additional enzymes necessary to generate testosterone, or (ii) introduction of the partial sterol biosynthetic pathway and having the necessary precursor molecules in the carrying medium, i.e., farnysel, squalene, cholesterol etc, so that testosterone could be assembled in the synthetic bacterium.
- epidermidis strain could comprise a nanofactory molecular modification for production of nicotine; this synthetic strain could be applied as a transdermal therapy to help with smoking cessation.
- This synthetic strain may include a molecular modification to include one or more biosynthetic pathways found in the Solanaceae family of plants, and optionally further include a molecular modification for the enhancement of intrinsic pathways of precursor molecules, i.e., aspartic acid, ornithine etc.
- a synthetic S. epidermidis strain may comprise a nanofactory molecular modification for the production of scopolamine.
- Scopolamine is currently delivered via an extended release transdermal patch for treatment of motion sickness and postoperative prophylaxis. This strain would need to carry the biosynthetic pathways found in the Solanaceae family of plants and possibly the enhancement of intrinsic pathways of precursor molecules.
- a synthetic S. epidermidis strain may comprise a nanofactory molecular modification for the production of capsaicin to alleviate pain stemming from post-herpetic neuralgia, psoriasis or other skin related disorders.
- the target microorganism is a Streptococcus mutans strain, which may have one or more of a kill switch, V-block, or nanofactory molecular modification.
- Dental caries and dental plaque are among the most common diseases worldwide, and are caused by a mixture of microorganisms and food debris. Specific types of acid-producing bacteria, especially Streptococcus mutans, colonize the dental surface and cause damage to the hard tooth structure in the presence of fermentable carbohydrates e.g., sucrose and fructose.
- Dental caries and dental plaque are among the most common diseases worldwide, and are caused by a mixture of microorganisms and food debris.
- the target microorganism is S. mutans having a KS and/or a nanofactory knock out for reducing acid production in presence of sucrose, fructose, or other fermentable carbohydrates.
- nanofactory molecular modifications in a synthetic microorganism to address dermatological and cosmetic uses include: (i) hyaluronic acid production in Staphylococcus epidermidis for atopic dermatitis or dry skin, (ii) alpha- hydroxy acid production in Staphylococcus epidermidis to reduce fine lines and wrinkles as well as lessen irregular pigmentation, (iii) salicylic acid production in Cutibacterium acnes to reduce acne, (iv) arbutin production in Staphylococcus epidermidis (arbutin and its metabolite hydroquinone function as skin lightening agents by melanin suppression, (v) Kojic acid (produced by several fungi including Aspergillus oryzae ) in Staphylococcus epidermidis to lighten skin pigmentation, (vi) Retinoid production by Staphylococcus epidermidis for the reduction of fine lines and wrinkles, (vii) L-ascorbic acid
- Cutibacterium acnes is a dominant bacteria living on the skin, and has been associated with both healthy skin and various diseases. This is another organism and niche available for enhancing and strengthening with modern molecular biology techniques. Studies have shown that the levels of C. acnes are similar between healthy skin and skin laden with acne. Dreno, B., et al. "Cutibacterium acnes (Propionibacterium acnes) and acne vulgaris: a brief look at the latest updates.” Journal of the European Academy of Dermatology and Venereology 32 (2016): 5-14. This indicates that just lowering the number of viable C. acnes on a person’s skin will not help to alleviate the disease or symptoms. Instead, other strains of C.
- acnes or other members of the dermal and subcutaneous microbiome can be altered to mitigate the mechanisms that certain C. acnes strains use to cause disease.
- the isolates that showed to have the greatest association with increased acne severity also have been shown to produce higher quantities of propionic and butyric acid.
- Beylot, C., et al. "Propionibacterium acnes: an update on its role in the pathogenesis of acne.” Journal of the European Academy of Dermatology and Venereology 28.3 (2014): 271-278.
- nanofactory molecular modification includes another strain of C. acnes that is modified to have an increased appetite for short chain fatty acids, such as propionic and butyric acid, thereby removing the inflammatory chemical secretions from the virulent strain rendering it less toxic.
- the carbon rich fatty acids could be used to induce a heterologous pathway and used as precursors for vitamin synthesis or other organic compounds beneficial for the skin or microbiome that inhabits that location.
- lipoteichoic acid has shown to help mitigate the inflammatory response of Propionibacterium acnes (i.e., Cutibacterium acnes) by inducing miR-l43.
- Propionibacterium acnes i.e., Cutibacterium acnes
- Xia, Xiaoli, et al. "Staphylococcal LTA-induced miR-l43 inhibits Propionibacterium acnes-mediated inflammatory response in skin.” Journal of Investigative Dermatology 136.3 (2016): 621-630.
- a synthetic microorganism comprising a nanofactory molecular modification producing lipoteichoic acid which inhibits C. acnes-induced inflammation via induction of miR-l43 may be employed.
- the nanofactory may be used to modulate inflammatory responses by S. epidermidis at the site of acne vulgaris for management of C. acnes-induced inflammation.
- This pathway is just one example of a useful product that could be made from short chain fatty acids that when left alone cause inflammation and skin irritation.
- inflammation and an increase in temperature are factors involved in the disease caused by C. acnes , they could be used as signals to induce previously silent heterologous pathways in an engineered strain.
- a temperature increase (signalling a sealed pore and progressing localized disease state) could induce in the virulent strain or another commensal microbe, the transcription and translation of a non- immune stimulating lipase (or other enzyme) that is capable of degrading the sebum to the point of reopening a clogged pore allowing the location to resume its normal growth conditions.
- a synthetic Lactobacillus spp. such as Lactobacillus crispatus , Lactobacillus gasseri, Lactobacillus jensenii or Lactobacillus iners - which are common dominant species present in the female vaginal vault may be engineered to comprises a nanocatory molecular modification that produces estradiol in the vaginal vault of post-menopausal women.
- Methods and synthetic microorganisms are provided herein to replace existing colonization by an undesirable microorganism with a synthetic bacterial strain comprising a nanofactory molecular modification for the production or consumption of a primary or secondary product, for example, selected from an enzyme, nicotine, aspartic acid, ornithine, propionic acid, butyric acid, hyaluronic acid, an alpha-hydroxy acid, L- ascorbic acid, a copper peptide, alpha-lipoic acid, salicylic acid, arbutin, Kojic acid, scopolamine, capsaicin, a retinoid, dimethylaminoethanol, lipoteichoic acid, testosterone, estradiol, and progesterone.
- a primary or secondary product for example, selected from an enzyme, nicotine, aspartic acid, ornithine, propionic acid, butyric acid, hyaluronic acid, an alpha-hydroxy acid, L- ascorbic acid, a copper peptide, alpha
- the durable integration of a synthetic bacterial strain that is able to produce by means of a nanofactory molecular modification or synthetic addition to its genome, a substance, material, or product, or products, that are beneficial to the host at the site of the microbiome integration or at distant sites in the host following absorption may be tailored to the desired indication.
- the duration of the effect of the nanofactory production could range from short term (with non-replicating plasmids for the bacterial species,) to medium term (with replicating plasmids without addiction dependency) to long term (with direct bacterial genomic manipulation).
- methods are provided to replace existing colonization with a synthetic bacterial strain which cannot accept genetic transfer of undesired virulence or antibiotic resistance genes.
- Synthetic microorganisms are provided that may comprise a“virulence block” or“V-block”.
- the term“virulence block”, or“V-block” refers to a molecular modification of a microorganism that results in the organism have decreased ability to accept foreign DNA from other strains or species effectively resulting in the organism having decreased ability to acquire exogenous virulence or antibiotic resistance genes.
- Methods are provided herein to replace existing colonization by an undesirable microorganism with a synthetic bacterial strain comprising a V-block molecular modification which cannot accept genetic transfer of undesired virulence or antibiotic resistance genes, where the target microorganism may be a strain of Acinetobacter johnsonii, Acinetobacter baumannii, Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus lugdunensis, Staphylococcus warneri, Staphylococcus saprophyticus, Corynebacterium acnes, Corynebacterium striatum, Corynebacterium diphtheriae, Corynebacterium minutissimum, Cutibacterium acnes, Propionibacterium acnes, Propionibacterium granulosum, Streptococcus pyogenes, Streptococcus aureus, Streptococcus agalactiae,
- Such a“virulence block” manipulated strain would be able to be integrated into the microbiome after a decolonization event and then through the process of competitive exclusion, remain for a time as the dominant strain within that particular niche without reacquiring undesired virulence or antibiotic resistance characteristics.
- Such a concept carried out on potential pathogens within the microbiome would result in a stable microbiome which could acquire neither virulence nor antimicrobial resistance genes in the horizontal transfer manner, rendering the totality of the microbiome more robust and with lowered conversion potential.
- the V-block is a molecular modification that may be employed in a synthetic microorganism in order to suppress virulence or horizontal gene transfer from an undesirable microorganism.
- the V-block molecular modification may be created in a target microorganism by: (i) gene knockout (excise or remove) of one or more known virulence genes, (ii) frameshift of a virulence region (adding or subtracting base pairs to ‘break’ the coding frame), (iii) exogenous silencing of virulence regions using inducible promoter or constitutive promoter (embedded in the DNA genome, but functions in RNA) - like antitoxin strategy, production of CRISPR-CAS9 or other editing proteins to digest incoming virulence genes using guide RNA which may be linked to an inducible promoter or constitutive promoter, or (iv) by a restriction modification (RM) such as a methylation system to turn the organism’s‘innate immune system’ to recognize and
- Gene editing methods for constructing a V-block may include NgAgo, mini- Cas9, CRISPR-Cpfl, CRISPR-C2c2, Target- AID, Lambda Red, Integrases,
- the virulence block may be operably linked to a constituitive promoter in the synthetic microorganism.
- the virulence block molecular modification may prevent horizontal gene transfer of genetic material from a virulent microorganism.
- Staphylococcus aureus may be integrated into the recipient cell’s genome at a particular site. This site could be deleted or changed in a cells genome, making the landing site no longer available for the incoming DNA sequence. This has been shown not to interfere with SA’s ability to grow, and would make the acquisition of the resistance cassette by the organism much less likely to occur
- V-block molecular modifications may cause the removal or neutralization of virulence factors, resistance loci or cassettes, toxins or toxigenic functions, or other undesired attributes of the biomically integrated microorganism.
- a virulence block in the form of Cas9 recognition system for sequences consistent with known virulence factors or antibiotic resistance genes in Staphylococcus aureus may be used to protect strains of Staphylococcus aureus Live Biotherapeutic Products from acquiring additional virulence factors and resistances to antibiotic classes, thus rendering them as safe as initially approved and manufactured.
- CRISPR is a native adaptive immune system for prokaryotic cells that has evolved over time to help defend against phage attacks.
- the system uses short DNA sequences complementary to phage DNA (or any target DNA) sequences to target incoming DNA and digest the strand before it can be incorporated into the genome of the living cell.
- This same technology may be engineered to target DNA sequences that are non threatening to the bacterial cell, but once acquired allow the organism to cause disease and persist in environments that were previously less habitable.
- Cas-9 enzyme into the genome, or harnessing the endogenous Cas-9 if available, it is possible to introduce into the genome constitutively expressed guide RNAs that target antibiotic resistance genes. If the targeted sequences are ever introduced to the cell through horizontal gene transfer or otherwise, the incoming DNA will be cut up and unable to integrate into the genome or produce a functional peptide.
- the engineered CRISPR-Cas system will find it in the genome and cut the sequences at the targeted location, thus producing a non-viable cell and stopping the spread of antibiotic resistance cassettes.
- the CRISPR system can also be used to target RNA sequences with the result of silencing gene expression.
- the recognition sequences can be designed to target mRNA. If Cas9 and the targeting guide RNAs are constitutively expressed in a cell that receives the abxR or virulence genes, the translation will be interrupted by the engineered CRISPR system impeding protein formation and the ability of the cell to use the targeted genes.
- RNAs that target the mRNA transcript, usually at the RBS. These would be integrated into and constitutively expressed from the genome to create a synthetic organism.
- the regulatory RNA is a short sequence (>l00bp) and is complementary to the 5’ untranslated region (UTR) of the mRNA transcript of the abxR or virulence gene.
- the constitutive expression of the short sequences should not be metabolically taxing for the organism, and will have the result of blocking translation of the targeted mRNA into a protein.
- DNA methylation plays many important roles in prokaryotes and eukaryotes.
- One feature of DNA methylation allows a cell to distinguish its own DNA from foreign DNA. This makes editing and studying many wild type strains very difficult, because the organism’s methylase systems recognize transformed plasmid DNA as foreign, and chew it up before it can be transcribed or integrated.
- Horizontal gene transfer can occur between organisms that have very similar methylation patterns because the incoming DNA looks very similar to the recipient’s own DNA and it is not digested.
- a V-Block in the form of a molecular disruption of one or more bacterial genomic cassette insertion sites in the synthetic microorganism can render the synthetic microorganism unable to acquire antibiotic class resistance genes from resident bacteria species that are cohabitating the biome. Such manipulation will also prevent the acquisition of virulence genes that could increase the possibility of invasive events across the bowel wall.
- the gene cassette conferring antibiotic resistance to strains of Staph aureus (SA) may be integrated into the recipient cell’s genome at a particular site. This site could be deleted or changed in a cells genome, making the landing site no longer available for the incoming DNA sequence. So long as the V-block is shown not to interfere with the synthetic microorganisms ability to grow, and would make the acquisition of the resistance cassette by the organism much less likely to occur.
- MRS A positive subjects suppress the MRSA strain
- MSSA 502a Bioplx-Ol
- the study population was largely drawn from Meerut area Medical Personnel and Medical Students. No symptomatic subjects were enrolled in the study.
- Staphylococcus aureus positive participants were selected for the irritation study by the study supervisor.
- a complete decolonization is performed on participants first. Following is confirmation of MRSA eradication in key sites. The total body decolonization is done with chlorhexidine, nasal decolonization is done with mupirocin, and gargling with Listerine original antiseptic as per the“Decolonization Protocol” section. After complete course of decolonization procedure (five days), a confirmation MRSA test will be administered to verify that no MRSA is present in key areas, and an Staphylococcus aureus test will be administered to gather information about post-colonization Staphylococcus aureus levels. Participants underwent five-day decolonization process, which was administered and observed by study personnel.
- Dermal decolonization was performed by study personnel and included (1) full body spray application of chlorhexadine (4%), (2) nasal (mucosal) decolonization with mupriocine (2%), and (3) throat (mucosal) decolonization by application of Listerine, each once per day over 5 days. Participants undergo five-day decolonization process, administered and observed by BioPlx Pvt Ltd personnel.
- Successful decolonization is characterized by a negative MRSA result for nose, throat, and axilla (armpit). With successful decolonization only nasal follow-up testing is required at downstream timepoints. MRSA positive in nose or throat require second full round of decolonization procedure. Patients in this category do not proceed to next phase of study until decolonized. MRSA positive in axilla does not require second full round of decolonization and may proceed to next phase of study. Axilla site must now be included in all downstream MRSA testing.
- Post decolonization negative controls n 15; ID#s: 0021, 0022, 0060, 0512, 0704, 0724, 0731, 0218, 0234, 0239, 0249, 0302, 0327, 0037, 0221.
- Treatment Groups 1, 2, 3. Decolonized / Recolonized (8 L 10 cell concentration): 34.
- MRSA positive participants were selected for the Efficacy Study by the study supervisor (Dr. Garg).
- Staphylococcus aureus positive participants were selected for the Irritation Study by the study supervisor.
- MRSA patients require a lot of effort to screen for, so an attempt was made to preserve them for the main efficacy evaluation of the study.
- Non-MRSA positive colonization rates are about 33%- 66% of all screened participants, so there was a more plentiful supply of them. Because MRSA is an antibiotic resistant strain of Staphylococcus aureus , testing for irritation in Staphylococcus aureus positive participants is equivalent to testing for irritation in MRSA positive participants.
- Irritation studies were performed on 55 Staphylococcus aureus positive subjects by topically administering about 5 mL of BioPlx-Ol (502a), at 1.2 x 10 7 CFU/mL in PBS, to the right forearm.
- the left arm served as a negative control.
- Forearms were observed and photographed by study personnel at day 1, day 4 and day 7 post-application for redness or pustule development. No suppression step was performed during the irritation study. No irritation or adverse events were observed.
- CFU colony forming units
- Example 2 Selection of one or more inducible promoters
- promoter candidates were evaluated.
- the fold-induction and basal expression of 6 promoter candidates in a MSS A strain BioPlx-Ol were evaluated by incubation with human whole blood and serum. Expression was normalized to a housekeeping gene ( gyrB ) and was compared with that in cells growing logarithmically in liquid tryptic soy broth (TSB) media.
- gyrB housekeeping gene
- BioPlx-Ol was grown to mid log phase (2 OD/mL) and then washed in large volume and shifted to freshly collected serum and heparinized blood from donor TK.
- RNA isolation was prepared from RNA and target gene expression evaluated by real time PCR (Taqman) in an ABI 7500 Fast instrument.
- RNA levels were determined by interpolation against a standard curve run on a common cDNA sample that was serially diluted and tested with primer/probes specific for ORFs driven by each of 5 putative serum-responsive promoters (P hi g A, P/TMi, Psv/ i, PV , P ISCIA) and one probe for a candidate gene that is upregulated in Staphylococcus aureus on the skin during colonization, but not reported to be upregulated in blood, for use in an expression clamp strategy (P C/ B).
- Ct was determined by it PCR.
- Ct PCR threshold cycle, is the cycle number at a given fluorescence; the higher the gene (mRNA) quantity, the lower the Ct.
- FIG. 6 The time course of induction of promoter candidate P higA in human serum is shown in FIG. 6 showing a hlgAlgyrB ratio in TSB of 0.19, favorable for use in kill switch construct“no RT”: cDNA made from 75 min timepoint RNA was diluted into a reaction at same dilution as all other samples; if RNA preperation is devoid of gDNA, no signal should be visible.
- FIG. 7 The time course of sstA in human serum is shown in FIG. 7 showing sst/gyrB ratio in TSB was 0.33.
- P u g A and P « i were selected as preliminary preferred candidates for further evaluation.
- hlgA levels in TSB were only l/5 th of housekeeping gene gyrB , or lower, in TSB so this promoter became a lead candidate.
- RNA Samples were treated with the turbo DNAse kit following the kit protocol for treatment with and inactivation of Dnase.
- the “No Reverse Transcription” control (No RT control) - with DNAse was at bkg/baseline level, thus acceptable.
- P isdA, Pvv/ i, RL7,- I were eliminated based on data shown in Table 13.
- Pw/ i was eliminated because of significant basal expression, and it was not induced in whole blood.
- P sirA was also eliminated because of significant basal expression, and low magnitude induction in serum, and was not induced in whole blood, as well as exhibiting induction that was not sustained.
- P i eU A was selected as one preferred promoter because it exhibited very high upregulation in serum, very low basal expression in TSB, and was not upregulated during colonization.
- An expression clamp may be employed, but may be optional when using VieuA as a promoter.
- P/TM i also exhibited strong activation by blood or serum exposure in Malachawa 2011 (microarrays) and in the present example.
- leuA is part of a nine-gene Operon: ilvDBHC , leuABCD, ilvA..
- Cody binds the RR to repress transcription when it is bound to branched chain amino acids (leucine, isoleucine and valine), so when free amino acid levels are above a threshold, the promoter is silent.
- amino acid biosynthetic operons including leu were not upregulated, and the authors propose that amino acids are present in sufficient quantity during colonization to prevent upregulation of these pathways (Tulinski et al., 2014).
- leuA is activated very strongly in blood and serum and has low basal expression, so further understanding is important.
- leuA is within the second of two cassettes in a nine-gene operon; the regulatory region driving it may be immediately upstream of ilvD or upstream of leuA.
- One way to understand is to test and compare both variants.
- P higA was selected as another preferred promoter because it exhibited high upregulation in serum and blood, and downregulation during nasal colonization.
- One drawback of P*3 ⁇ 4 is basal expression in TSB; which may be addressed by including an expression clamp for hlgA.
- the peptide HlgA is a subunit of a secreted, pore-forming toxin that lyses host red blood cells and leukocytes.
- HlgA (class S) associates with HlgB (class F) thus forming an AB toxin in strains producing both gamma-hemolysins and leukocidins (HlgA and LukF-PV can also form a complex).
- HlgA operon Transcription of the HlgA operon is upregulated in TSB by quorum sensing agr activation, but agr is downregulated in serum while hlgA is upregulated, so hlgA upregulation is independent of the agr pathway in serum.
- the hemolysins were downregulated 5.7 fold compared with TSB during colonization, specifically, porcine nasal explants colonized with MRSA ST398; see Tulinski et al 2014. However, in these experiments, no evidence of expression of hlgA was seen during colonization.
- a synthetic microorganism comprises at least one molecular modification comprising a first cell death gene operably linked to a first regulatory region comprising a multiplicity of promoters that are activated by serum or blood, but exhibits little to no expression in human skin, mucosa, or in TSB.
- a synthetic microorganism comprises at least one molecular modification comprising a first cell death gene operably linked to a first regulatory region comprising a multiplicity of promoters that are activated by serum or blood, but exhibits little to no expression in human skin, mucosa, or in TSB.
- cell death gene candidates are evaluated for preparing a synthetic microorganism having at least one molecular modification comprising a first cell death gene operably linked to a first regulatory region comprising a first inducible promoter.
- Relative potencies of death genes are unknown. What appears to be the best death gene is not necessarily the most potent one because of leaky expression. Diversity of mechanism of action could result in killing synergy for two or more death gene combinations.
- Death gene candidates include: SprAl : membrane disruption; smal genome destruction; and rsaE : blocks central metabolism.
- Various combinations of death genes are shown in Table 14. These plasmids are created and sequenced plasmids for testing ofP/e ⁇ and P/, 3 ⁇ 4,i -driven KS variants.
- Death genes may be obtained commercially (Atum) and vector may also be obtained commercially (BEI). Combinations comprising two death genes are constructed after results of single death genes are obtained. Synthetic plasmids, vectors and synthetic microorganisms are prepared based on Table 14.
- Steps in creating a synthetic strain comprising a cell death gene are as follows.
- Steps in testing a synthetic microorganism strains having at least one molecular modification comprising a first cell death gene operably linked to a first regulatory region comprising a first promoter are as follows.
- KS variants Wash and shift cells to serum (control is WT Bioplx-Ol containing empty vector with no death gene).
- Plasmids may be prepared from commercially available products.
- pCN5l (6430 bp) is the commercial plasmid for modification.
- pCN5l is an E. coli- SA shuttle vector, with ampR for E. coli selection and ermC for Staphylococcus aureus selection. This is a rT181 based low copy rolling circle plasmid, containing a Cadmium inducible promoter and BLA terminator.
- BEI product number NR-46149 Combinations of KS variants are possible in one plasmid. It is possible to insert more than one KS into the MCS of a shuttle vector plasmid.
- Atum/DNA2.0 with restriction suites placed strategically at ends of each gene for directional cloning.
- pCN5l shuttle vector (BEI NR-46149), RN4220 Staphylococcus aureus (BEI NR-45946), and DC10B E. coli (BEI NR-49804) are ordered from BEI Resources.
- Example 3A CONSTRUCTING pTKl and pTK2
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Communicable Diseases (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Tropical Medicine & Parasitology (AREA)
- Virology (AREA)
- Cell Biology (AREA)
- Dermatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201880088486.5A CN111918960B (zh) | 2017-12-05 | 2018-12-04 | 预防微生物感染的方法和组合物 |
| MX2020005875A MX2020005875A (es) | 2017-12-05 | 2018-12-04 | Métodos y composiciones para prevenir la infección microbiana. |
| CA3084954A CA3084954A1 (en) | 2017-12-05 | 2018-12-04 | Methods and compositions to prevent microbial infection |
| CN202510007125.5A CN119875972A (zh) | 2017-12-05 | 2018-12-04 | 预防微生物感染的方法和组合物 |
| EP18886851.7A EP3720458A4 (en) | 2017-12-05 | 2018-12-04 | METHODS AND COMPOSITIONS FOR PREVENTING MICROBIAL INFECTION |
| JP2020550034A JP7460531B2 (ja) | 2017-12-05 | 2018-12-04 | 微生物感染を防ぐための方法および組成物 |
| AU2018379996A AU2018379996A1 (en) | 2017-12-05 | 2018-12-04 | Methods and compositions to prevent microbial infection |
| PH12020550941A PH12020550941A1 (en) | 2017-12-05 | 2020-06-05 | Methods and compositions to prevent microbial infection |
| JP2024044541A JP2024075688A (ja) | 2017-12-05 | 2024-03-21 | 微生物感染を防ぐための方法および組成物 |
| AU2025234199A AU2025234199A1 (en) | 2017-12-05 | 2025-09-18 | Methods and compositions to prevent microbial infection |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762594943P | 2017-12-05 | 2017-12-05 | |
| US62/594,943 | 2017-12-05 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019113096A1 true WO2019113096A1 (en) | 2019-06-13 |
Family
ID=66658442
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/063880 Ceased WO2019113096A1 (en) | 2017-12-05 | 2018-12-04 | Methods and compositions to prevent microbial infection |
Country Status (9)
| Country | Link |
|---|---|
| US (2) | US12163135B2 (https=) |
| EP (1) | EP3720458A4 (https=) |
| JP (2) | JP7460531B2 (https=) |
| CN (2) | CN119875972A (https=) |
| AU (2) | AU2018379996A1 (https=) |
| CA (1) | CA3084954A1 (https=) |
| MX (1) | MX2020005875A (https=) |
| PH (1) | PH12020550941A1 (https=) |
| WO (1) | WO2019113096A1 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023023560A1 (en) * | 2021-08-17 | 2023-02-23 | Contrafect Corporation | New uses |
| JP2023528476A (ja) * | 2020-06-02 | 2023-07-04 | バイオピーエルエックス,インコーポレイティド | 組み換え微生物においてゲノムに安定に組み込むための方法 |
| EP3996510A4 (en) * | 2019-07-08 | 2023-08-09 | BioPlx, Inc. | LIVING BIOTHERAPEUTIC COMPOSITIONS AND PROCESSES |
Families Citing this family (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104805066B (zh) * | 2015-05-18 | 2018-04-24 | 武汉菲吉乐科生物科技有限公司 | 一种葡萄球菌裂解酶及其应用 |
| TWI718402B (zh) * | 2018-08-16 | 2021-02-11 | 葡萄王生技股份有限公司 | 副乾酪乳酸桿菌gks6之活性物質、含其之組合物及其促進長壽之用途 |
| US20220211872A1 (en) * | 2019-05-15 | 2022-07-07 | Universidad De Granada | Gene therapy with the genes hokd and ldrb for cancer treatments |
| WO2021163223A1 (en) * | 2020-02-10 | 2021-08-19 | The Research Foundation For The State University Of New York | Using resilient systems inference for estimating hospital acquired infection prevention infrastructure performance |
| EP4110269A4 (en) * | 2020-02-28 | 2024-01-17 | Emory University | PENTAGALLOYL GLUCOSE FROM SCHINUS PLANTS AND METHOD OF USE |
| CN111926048B (zh) * | 2020-07-20 | 2023-09-26 | 广东省微生物研究所(广东省微生物分析检测中心) | 烯丙基硫醚在制备促进铜绿假单胞菌叶酸生物合成制剂中的应用 |
| US12535933B2 (en) | 2021-11-16 | 2026-01-27 | Benuka Health, Llc | Systems, methods and devices for aiding in the decolonization of bacteria |
| CN114015622A (zh) * | 2021-12-14 | 2022-02-08 | 塔里木大学 | 无乳链球菌培养基及其制备方法 |
| CN114214354A (zh) * | 2021-12-31 | 2022-03-22 | 天津科技大学 | 一种双载体表达体系及其构建方法与应用 |
| CN116617373A (zh) * | 2022-02-14 | 2023-08-22 | 菲吉乐科(南京)生物科技有限公司 | 一种高效葡萄球菌噬菌体粉剂及其制备方法 |
| CN116179654B (zh) * | 2022-12-30 | 2023-09-15 | 军事科学院军事医学研究院环境医学与作业医学研究所 | 一种检测水中镉离子的滚环扩增检测体系及其应用 |
| CN117106674B (zh) * | 2023-10-23 | 2024-03-08 | 新益(天津)生物科技有限责任公司 | 一株能够降低尿酸、修复女性私处微生态平衡的植物乳杆菌opb15和应用 |
| CN119055779B (zh) * | 2024-07-31 | 2025-11-21 | 中国科学技术大学 | 金黄色葡萄球菌毒素蛋白相关基因sa1833/sa1832在治疗金黄色葡萄球菌感染中的应用 |
Citations (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5733540A (en) * | 1995-03-08 | 1998-03-31 | Lee; Peter Poon-Hang | Protection from viral infection via colonization of mucosal membranes with genetically modified bacteria |
| WO2002015896A2 (en) | 2000-08-25 | 2002-02-28 | Trustees Of Tufts College | Methods and compositions for potentiating antibiotic action against persistent/tolerant pathogenic microorganisms |
| US6461607B1 (en) | 1998-08-24 | 2002-10-08 | Ganeden Biotech, Inc. | Probiotic, lactic acid-producing bacteria and uses thereof |
| US6660262B2 (en) | 2001-09-28 | 2003-12-09 | Bovine Health Products, Inc. | Broad spectrum antimicrobial compound and treatment |
| US6905692B2 (en) | 1997-04-18 | 2005-06-14 | Ganeden Biotech, Inc. | Topical compositions containing probiotic bacillus bacteria, spores, and extracellular products and uses thereof |
| US20060019291A1 (en) * | 2000-06-28 | 2006-01-26 | Robin Clark | Cloning system for construction of recombinant expression vectors |
| WO2009117310A2 (en) | 2008-03-17 | 2009-09-24 | Cedars-Sinai Medical Center | Methods for treatment and prevention of mrsa/mssa |
| US20130023035A1 (en) * | 2011-06-30 | 2013-01-24 | Exxonmobil Research And Engineering Company | Regulation of toxin and antitoxin genes for biological containment |
| US8906668B2 (en) | 2012-11-23 | 2014-12-09 | Seres Health, Inc. | Synergistic bacterial compositions and methods of production and use thereof |
| US20160243175A1 (en) * | 2013-10-03 | 2016-08-25 | The Trustees Of The University Of Pennsylvania | Compositions and methods comprising a defined microbiome and methods of use thereof |
| WO2016210373A2 (en) | 2015-06-24 | 2016-12-29 | Synlogic, Inc. | Recombinant bacteria engineered for biosafety, pharmaceutical compositions, and methods of use thereof |
| WO2017008018A1 (en) | 2015-07-09 | 2017-01-12 | Massachusetts Institute Of Technology | Genetically engineered sensors for in vivo detection of bleeding |
| WO2017059245A2 (en) | 2015-09-30 | 2017-04-06 | Trustees Of Boston University | Deadman and passcode microbial kill switches |
| WO2017103593A1 (en) * | 2015-12-15 | 2017-06-22 | University Of Southampton | Meningococcal infection and modified neisseria lactamica |
| WO2017123676A9 (en) * | 2016-01-11 | 2017-09-14 | Synlogic, Inc. | Recombinant bacteria engineered to treat diseases and disorders associated with amino acid metabolism and methods of use thereof |
Family Cites Families (124)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4133875A (en) | 1978-02-23 | 1979-01-09 | Forsyth Dental Infirmary For Children | Method of controlling dental caries with streptococcus mutans mutant strains |
| WO1987005932A1 (en) | 1986-03-26 | 1987-10-08 | Genexpress Aps | Biological containment |
| US4716032A (en) | 1983-08-03 | 1987-12-29 | Geoffrey J. Westfall | Aerosol spray composition for mastitis prevention |
| US4548807A (en) | 1983-08-03 | 1985-10-22 | Geoffrey J. Westfall | Mastitis prevention |
| DE69310339T2 (de) | 1993-02-19 | 1997-08-21 | Philippe Djian | Präparate, die Corneozyt Proteine enthalten |
| US5607672A (en) | 1995-06-07 | 1997-03-04 | University Of Florida Research Foundation, Inc. | Replacement therapy for dental caries |
| CA2222761A1 (en) | 1995-06-07 | 1996-12-19 | Washington University | Recombinant bacterial system with environmentally limited viability |
| US6593114B1 (en) * | 1996-01-05 | 2003-07-15 | Human Genome Sciences, Inc. | Staphylococcus aureus polynucleotides and sequences |
| US6737248B2 (en) | 1996-01-05 | 2004-05-18 | Human Genome Sciences, Inc. | Staphylococcus aureus polynucleotides and sequences |
| GB9604045D0 (en) | 1996-02-26 | 1996-04-24 | Smithkline Beecham Plc | Novel compounds |
| AUPN880996A0 (en) | 1996-03-20 | 1996-04-18 | Arnott's Biscuits Limited | Selection and/or enhancement of resident microorganisms in the gastrointestinal tract |
| AU766257C (en) | 1998-05-07 | 2004-06-03 | Universite Libre De Bruxelles | Cytotoxin-based biological containment |
| CA2360865A1 (en) | 1999-02-03 | 2000-08-10 | Biogal Gyogyszergyar Rt. | Process for the preparation of pseudomonic acid a antibiotic by microbiological method |
| US6417002B1 (en) * | 1999-02-11 | 2002-07-09 | Pharmacopeia, Inc. | Method for maintenance and selection of episomes |
| CA2430501A1 (en) | 2000-01-11 | 2001-07-19 | Intralytix, Inc. | Method for produce sanitation using bacteriophages |
| US6719991B2 (en) | 2000-06-09 | 2004-04-13 | Baylor College Of Medicine | Combination of antimicrobial agents and bacterial interference to coat medical devices |
| AUPQ899700A0 (en) | 2000-07-25 | 2000-08-17 | Borody, Thomas Julius | Probiotic recolonisation therapy |
| EP1358479A4 (en) | 2000-09-25 | 2006-05-10 | Acuabiotec Llc | METHOD, SYSTEM AND COMPUTER PROGRAM PRODUCT FOR THE TECHNICAL MANAGEMENT AND BIO CONTROL OF DISEASES IN ANIMAL PRODUCTION SYSTEMS |
| US20020192741A1 (en) | 2000-09-28 | 2002-12-19 | Mckillip John L. | Selective medium for gram-positive bacteria |
| EP1465990B1 (en) * | 2001-12-21 | 2011-07-13 | Biosynexus Incorporated | Truncated lysostaphin molecule with enhanced staphylolytic activity |
| US20040241150A1 (en) | 2002-12-19 | 2004-12-02 | Hargis Billy M. | Defined competitive exclusion cultures for food borne pathogens |
| US7482023B2 (en) | 2003-01-03 | 2009-01-27 | Sca Hygiene Products Ab | Hygiene tissue with lactic acid producing bacterial strains |
| ATE516024T1 (de) | 2004-05-14 | 2011-07-15 | Optimer Pharmaceuticals Inc | Behandlung von krankheiten im zusammenhang mit der anwendung von antibiotika |
| US8729013B2 (en) | 2004-08-26 | 2014-05-20 | The University Of Western Ontario | Methods of inhibiting staphylobactin-mediated iron uptake in S. aureus |
| US7627437B2 (en) | 2005-01-14 | 2009-12-01 | Idaho Research Foundation | Categorization of microbial communities |
| US20060257373A1 (en) | 2005-05-10 | 2006-11-16 | National Chung Hsing University | Antifungal formulation containing Streptomyces s.p.p., method for preparing the composition and relevant use |
| KR100844581B1 (ko) * | 2005-05-17 | 2008-07-09 | 주식회사 뉴젝스 | 혈청반응성 프로모터를 가진 리포터 아데노바이러스를 이용한 고속생리활성 물질의 검색 방법 |
| US8682619B2 (en) * | 2005-12-14 | 2014-03-25 | The Invention Science Fund I, Llc | Device including altered microorganisms, and methods and systems of use |
| US8852916B2 (en) | 2010-01-22 | 2014-10-07 | The Invention Science Fund I, Llc | Compositions and methods for therapeutic delivery with microorganisms |
| US20100260794A1 (en) | 2006-03-20 | 2010-10-14 | Vrije Universiteit Brussel | Live attenuated salmonella vaccine |
| US20080107699A1 (en) | 2006-10-25 | 2008-05-08 | Mark Spigelman | Method of using topical probiotics for the inhibition of surface contamination by a pathogenic microorganism and composition therefor |
| GB0624340D0 (en) | 2006-12-06 | 2007-01-17 | Nature Therapeutics Ltd | Antimicrobial composition |
| CA2673195C (en) | 2006-12-22 | 2012-05-29 | Bio-K Plus International Inc. | Growth inhibition and elimination of methicillin-resistant staphylococcus aureus by lactic acid bacteria |
| CA2672640A1 (en) | 2006-12-22 | 2008-07-03 | Francois-Marie Luquet | Growth inhibition of microorganisms by lactic acid bacteria |
| WO2009030040A1 (en) | 2007-09-05 | 2009-03-12 | Institut National De La Recherche Scientifique | Antimicrobial activity of bacteriocin-producing lactic acid bacteria |
| MX353908B (es) | 2008-06-13 | 2018-02-02 | Oragenics Inc | Uso de bacteria productora de peroxido de hidrogeno para blanquear dientes. |
| WO2009152298A1 (en) | 2008-06-13 | 2009-12-17 | Zeus Scientific, Inc. | Methods, compositions and and diagnostic kits for the detection and treatment for staphylococcal nasal decolonization using achromopeptidase |
| US9700611B2 (en) | 2008-06-23 | 2017-07-11 | Mississippi State University | Live attenuated catfish vaccine and method of making |
| KR101631335B1 (ko) | 2008-08-01 | 2016-06-16 | 온딘 인터내셔널 리미티드. | Mrsa 치료용 조성물 및 방법 |
| EP2337569A4 (en) | 2008-09-25 | 2013-04-03 | Univ New York | COMPOSITIONS AND METHODS FOR CHARACTERIZING AND RESTORING THE STOMACH DARM, SKIN AND NOSE MICROBIOTA |
| WO2010123599A2 (en) | 2009-01-23 | 2010-10-28 | The Board Of Trustees Of The University Of Illinois | Anti-bacterial compositions and methods including targeting virulence factors of staphylococcus aureus |
| US9464284B2 (en) | 2009-03-09 | 2016-10-11 | Bioatla, Llc | Mirac proteins |
| GB0909909D0 (en) | 2009-06-09 | 2009-07-22 | Chrisal Nv | Microcapsules containing microrgnisms |
| WO2011005756A1 (en) | 2009-07-06 | 2011-01-13 | Puretech Ventures, Llc | Delivery of agents targeted to microbiota niches |
| WO2011082218A1 (en) | 2009-12-31 | 2011-07-07 | Ira Milton Trachtman | Compositions and method for treatment and prophylaxis of inflammatory bowel disease |
| WO2011085367A2 (en) | 2010-01-11 | 2011-07-14 | Oragenics, Inc. | Non-replicating microorganisms as post-biotics |
| WO2013052174A2 (en) | 2011-06-06 | 2013-04-11 | The Trustees Of The University Of Pennsylvania | Methods for preventing and treating staphylococcus aureus colonization, infection, and disease |
| US9107938B2 (en) | 2010-09-30 | 2015-08-18 | The Board Of Trustees Of The University Of Arkansas | Methods of selecting and using therapeutic and prophylactic probiotic cultures to reduce bacterial pathogen loads |
| MX340019B (es) | 2010-11-23 | 2016-06-22 | Pantheryx Inc | Composiciones y metodos para el tratamiento en aplicaciones clinicas de amplio espectro, no diferenciadas o combinadas. |
| US10010568B2 (en) | 2011-02-04 | 2018-07-03 | Katherine Rose Kovarik | Method and system for reducing the likelihood of a spirochetes infection in a human being |
| US10111913B2 (en) | 2011-02-04 | 2018-10-30 | Joseph E. Kovarik | Method of reducing the likelihood of skin cancer in an individual human being |
| US10314865B2 (en) | 2011-02-04 | 2019-06-11 | Katherine Rose Kovarik | Method and system for treating cancer and other age-related diseases by extending the healthspan of a human |
| US9140698B2 (en) | 2011-04-06 | 2015-09-22 | The Board Of Regents Of The University Of Texas System | Modulating bacterial MAM polypeptides in pathogenic disease |
| PL2704704T3 (pl) | 2011-05-03 | 2019-04-30 | Dupont Nutrition Biosci Aps | Bakterie probiotyczne do miejscowego leczenia zaburzeń skóry |
| MX357938B (es) | 2011-06-19 | 2018-07-31 | Univ New York | Metodos para tratar y prevenir infecciones por staphylococcus aureus y afecciones asociadas. |
| US20140219995A1 (en) | 2011-07-13 | 2014-08-07 | Microbiotix, Inc. | Inhibitors of bacterial type iii secretion system |
| CN102887952A (zh) | 2011-07-21 | 2013-01-23 | 广州瑞博奥生物科技有限公司 | 具有双重结合活性的抗MRSA-PBP 2a的单克隆抗体 |
| CN103998056B (zh) | 2011-07-22 | 2017-09-12 | 诺瓦蒂格姆疗法有限公司 | 用于接种抗金黄色葡萄球菌疫苗的方法和组合物 |
| WO2013050590A1 (en) * | 2011-10-07 | 2013-04-11 | Universite De Rennes 1 | Spra1 antimicrobial peptides and uses thereof |
| CN104105470A (zh) | 2012-02-14 | 2014-10-15 | 宝洁公司 | 皮肤共生益生元剂和包含其的组合物的局部使用 |
| EP2822582B1 (en) | 2012-03-05 | 2017-09-13 | University of Maryland, Baltimore | Multivalent vaccine protection from staphylococcus aureus infection |
| GB201206599D0 (en) | 2012-04-13 | 2012-05-30 | Univ Manchester | Probiotic bacteria |
| EP2841101B1 (en) | 2012-04-26 | 2019-08-07 | University Of Chicago | Compositions and methods related to antibodies that neutralize coagulase activity during staphylococcus aureus disease |
| EP3241902B1 (en) * | 2012-05-25 | 2018-02-28 | The Regents of The University of California | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
| WO2014107619A1 (en) | 2013-01-04 | 2014-07-10 | Second Genome, Inc. | Microbiome modulation index |
| CA2899925A1 (en) | 2013-02-04 | 2014-08-07 | Seres Therapeutics, Inc. | Compositions and methods for inhibition of pathogenic bacterial growth |
| US10660943B2 (en) | 2013-02-07 | 2020-05-26 | The Rockefeller University | Sequence specific antimicrobials |
| US10413577B2 (en) | 2013-02-22 | 2019-09-17 | The Regents Of The University Of California | Compositions and methods for promoting growth of beneficial microbes to treat or prevent disease or prolong life |
| US20140256582A1 (en) | 2013-03-05 | 2014-09-11 | Intelligent Medical Devices, Inc. | Optimized probes and primers and methods of using same for the detection, screening, isolation and sequencing of mrsa, mssa, staphylococcus markers, and the antibiotic resistance gene mec a |
| WO2014159287A1 (en) | 2013-03-14 | 2014-10-02 | Second Genome, Inc. | Microbial ecology shift assay |
| US9101597B2 (en) | 2013-03-14 | 2015-08-11 | The Administration Of The Tulane Educational Fund | Immunoprotective primary mesenchymal stem cells and methods |
| EP2967077A4 (en) | 2013-03-15 | 2016-09-14 | Seres Therapeutics Inc | NETWORK-BASED MICROBIAL COMPOSITIONS AND METHOD |
| US9511100B2 (en) | 2013-06-05 | 2016-12-06 | Rebiotix, Inc. | Microbiota restoration therapy (MRT), compositions and methods of manufacture |
| WO2014205127A2 (en) | 2013-06-18 | 2014-12-24 | New York University | Cellular factors involved in the cytotoxicity of staphylococcus aureus leukocidins: novel therapeutic targets |
| WO2015024855A1 (en) | 2013-08-19 | 2015-02-26 | Syngulon Sa | Controlled growth of microorganisms |
| US9834775B2 (en) | 2013-09-27 | 2017-12-05 | President And Fellows Of Harvard College | Recombinant cells and organisms having persistent nonstandard amino acid dependence and methods of making them |
| US10752906B2 (en) | 2013-11-05 | 2020-08-25 | President And Fellows Of Harvard College | Precise microbiota engineering at the cellular level |
| EP3074027B1 (en) | 2013-11-25 | 2024-12-18 | Seres Therapeutics, Inc. | Synergistic bacterial compositions and methods of production and use thereof |
| MX2016007533A (es) | 2013-12-09 | 2016-12-14 | Univ New York | Composiciones y metodos para el suministro fagocitico de agentes anti-estafilococicos. |
| WO2015106175A1 (en) | 2014-01-10 | 2015-07-16 | The Regents Of The University Of California | Skin probiotic |
| KR102607213B1 (ko) | 2014-04-15 | 2023-11-30 | 에이오바이오미 엘엘씨 | 암모니아-산화 니트로소모나스 유트로파 균주 d23 |
| US20170081707A1 (en) | 2014-05-06 | 2017-03-23 | Phylagen, Inc. | Monitoring and managing a facility microbiome |
| EP3139939B1 (en) | 2014-05-07 | 2023-09-06 | The Regents of The University of California | Compositions and methods for treating skin and mucous membrane diseases |
| US10702558B2 (en) | 2014-05-30 | 2020-07-07 | Azitra Inc | Therapeutic treatment of skin disease with recombinant commensal skin microorganisms |
| JP2017519035A (ja) | 2014-06-27 | 2017-07-13 | ケーン バイオテク インコーポレーテッド | 抗微生物性−抗バイオフィルム性組成物及び該組成物のパーソナルケア製品のための使用 |
| US9760676B2 (en) | 2014-10-21 | 2017-09-12 | uBiome, Inc. | Method and system for microbiome-derived diagnostics and therapeutics for endocrine system conditions |
| EP3212661A1 (en) * | 2014-10-31 | 2017-09-06 | INSERM - Institut National de la Santé et de la Recherche Médicale | Cyclic antimicrobial pseudopeptides and uses thereof |
| SG10201903823QA (en) | 2014-10-31 | 2019-05-30 | Whole Biome Inc | Methods and compositions relating to microbial treatment and diagnosis of disorders |
| US9688967B2 (en) | 2014-12-05 | 2017-06-27 | Synlogic, Inc. | Bacteria engineered to treat diseases associated with hyperammonemia |
| SG11201704543XA (en) * | 2014-12-05 | 2017-07-28 | Synlogic Inc | Bacteria engineered to treat diseases associated with hyperammonemia |
| US10610546B2 (en) | 2015-05-13 | 2020-04-07 | Synlogic Operating Company Inc. | Bacteria engineered to reduce hyperphenylalaninemia |
| US20160206666A1 (en) | 2014-12-22 | 2016-07-21 | Synlogic, Inc. | Bacteria engineered to treat diseases that benefit from reduced gut inflammation and/or tighten gut mucosal barrier |
| EP3064072A1 (en) | 2015-02-11 | 2016-09-07 | AB-Biotics S.A. | Probiotic lactobacillus strains for use in treating urinary tract infections |
| BR112017018656B1 (pt) | 2015-03-02 | 2021-11-30 | Synlogic, Inc | Bactéria geneticamente modificada, composição farmaceuticamente aceitável compreendendo a dita bactéria e uso da dita composição para tratar ou prevenir uma doença ou condição associada à inflamação intestinal e/ou função da barreira intestinal comprometida |
| EP3285872A4 (en) | 2015-04-20 | 2019-02-20 | S-Biomedic NV | METHOD AND COMPOSITIONS FOR CHANGING THE COMPOSITION OF SKIN MICROBIOMA WITH COMPLEX MIXTURES OF BACTERIAL BARS |
| US11406671B2 (en) | 2015-04-24 | 2022-08-09 | The Translational Genomics Research Institute | Compositions and methods for augmenting the nasal microbiome |
| CN107667173A (zh) | 2015-05-06 | 2018-02-06 | 斯尼普技术有限公司 | 改变微生物种群和改善微生物群 |
| EP3294757B1 (en) | 2015-05-13 | 2023-12-27 | Synlogic Operating Company, Inc. | Bacteria engineered to treat a disease or disorder |
| AU2016274311A1 (en) | 2015-06-10 | 2018-01-18 | Synlogic Operating Company, Inc. | Bacteria engineered to treat diseases associated with hyperammonemia |
| CA3012607A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Crispr enzymes and systems |
| WO2016210384A2 (en) | 2015-06-25 | 2016-12-29 | Synlogic, Inc. | Bacteria engineered to treat metabolic diseases |
| EP3328988A1 (en) | 2015-07-31 | 2018-06-06 | Synlogic, Inc. | Bacteria engineered to treat disorders involving propionate catabolism |
| BR112018008358A2 (pt) | 2015-10-26 | 2019-04-24 | Crestovo Holdings Llc | ?composições e métodos para terapia relacionada à microbiota fecal? |
| WO2017091753A1 (en) | 2015-11-25 | 2017-06-01 | Memorial Sloan-Kettering Cancer Center | Methods and compositions for reducing vancomycin-resistant enterococci infection or colonization |
| RU2662310C9 (ru) | 2015-12-04 | 2018-09-21 | Виктор Вениаминович Тец | Средство (варианты) и способы восстановления микрофлоры |
| LT6463B (lt) | 2015-12-10 | 2017-10-10 | Uab "Probiosanus" | Probiotinių bakterijų (pb) gyvybingumo ir stabilumo padidinimas detergentų turinčiuose asmens higienos ir buities priežiūros produktuose |
| US11542466B2 (en) | 2015-12-22 | 2023-01-03 | North Carolina State University | Methods and compositions for delivery of CRISPR based antimicrobials |
| US10689644B2 (en) | 2016-03-17 | 2020-06-23 | Duke University | Systems and methods for genetic analysis of intractable microbes |
| WO2017184601A1 (en) | 2016-04-19 | 2017-10-26 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Use of gram negative species to treat atopic dermatitis |
| CN110545828A (zh) | 2016-04-19 | 2019-12-06 | 基因组研究有限公司 | 细菌疗法 |
| EP3448398A4 (en) | 2016-04-21 | 2019-12-18 | Naked Biome, Inc. | COMPOSITIONS AND METHODS FOR TREATING SKIN DISEASES |
| CN109803534A (zh) | 2016-06-01 | 2019-05-24 | 克雷斯顿沃控股公司 | 用于治疗炎性肠病(ibd)和其他疾病的组合物和方法 |
| WO2017220708A1 (en) | 2016-06-22 | 2017-12-28 | Prodigest Bvba | Microbial carotenoids affecting gut microbial composition |
| WO2018049556A1 (en) | 2016-09-13 | 2018-03-22 | The Procter & Gamble Company | Methods of increasing microbial diversity of a skin microbiota |
| EA201990599A1 (ru) | 2016-09-27 | 2019-10-31 | Способ и система для получения и секвенирования библиотеки на основе crispr | |
| US11571446B2 (en) | 2016-11-18 | 2023-02-07 | Sanford Bumham Prebys Medical Discovery Institute | Gut microbiota and treatment of cancer |
| US11674128B2 (en) | 2016-12-12 | 2023-06-13 | Tsinghua University | Engineering of a minimal SaCas9 CRISPR/Cas system for gene editing and transcriptional regulation optimized by enhanced guide RNA |
| WO2018112194A1 (en) | 2016-12-15 | 2018-06-21 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods for modulating growth of a genetically modified gut bacterial cell |
| WO2018109018A1 (fr) | 2016-12-16 | 2018-06-21 | Nestle Skin Health Sa | Capsule comprenant un microorganisme probiotique pour utilisation dans un dispositif de production et de distribution de compositions |
| EP3358015A1 (en) | 2017-02-03 | 2018-08-08 | Eligo Bioscience | Optimized vector for delivery in microbial populations |
| US20200268813A1 (en) | 2017-02-15 | 2020-08-27 | President And Fellows Of Harvard College | Modulation of host immune cell populations using gut microbiota |
| US20180250222A1 (en) | 2017-02-27 | 2018-09-06 | Continuum Group Llc | Sunscreen |
| WO2018182515A1 (en) | 2017-03-27 | 2018-10-04 | Agency For Science, Technology And Research | Methods of modifying fungi and uses thereof |
| JP2020516318A (ja) | 2017-04-17 | 2020-06-11 | ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア | 操作された共生細菌及び使用方法 |
-
2018
- 2018-12-04 JP JP2020550034A patent/JP7460531B2/ja active Active
- 2018-12-04 CN CN202510007125.5A patent/CN119875972A/zh active Pending
- 2018-12-04 US US16/209,706 patent/US12163135B2/en active Active
- 2018-12-04 EP EP18886851.7A patent/EP3720458A4/en active Pending
- 2018-12-04 AU AU2018379996A patent/AU2018379996A1/en not_active Abandoned
- 2018-12-04 CN CN201880088486.5A patent/CN111918960B/zh active Active
- 2018-12-04 MX MX2020005875A patent/MX2020005875A/es unknown
- 2018-12-04 CA CA3084954A patent/CA3084954A1/en active Pending
- 2018-12-04 WO PCT/US2018/063880 patent/WO2019113096A1/en not_active Ceased
-
2020
- 2020-06-05 PH PH12020550941A patent/PH12020550941A1/en unknown
-
2024
- 2024-03-21 JP JP2024044541A patent/JP2024075688A/ja active Pending
- 2024-12-09 US US18/973,546 patent/US20250346910A1/en active Pending
-
2025
- 2025-09-18 AU AU2025234199A patent/AU2025234199A1/en active Pending
Patent Citations (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5733540A (en) * | 1995-03-08 | 1998-03-31 | Lee; Peter Poon-Hang | Protection from viral infection via colonization of mucosal membranes with genetically modified bacteria |
| US6905692B2 (en) | 1997-04-18 | 2005-06-14 | Ganeden Biotech, Inc. | Topical compositions containing probiotic bacillus bacteria, spores, and extracellular products and uses thereof |
| US6461607B1 (en) | 1998-08-24 | 2002-10-08 | Ganeden Biotech, Inc. | Probiotic, lactic acid-producing bacteria and uses thereof |
| US20060019291A1 (en) * | 2000-06-28 | 2006-01-26 | Robin Clark | Cloning system for construction of recombinant expression vectors |
| WO2002015896A2 (en) | 2000-08-25 | 2002-02-28 | Trustees Of Tufts College | Methods and compositions for potentiating antibiotic action against persistent/tolerant pathogenic microorganisms |
| US6660262B2 (en) | 2001-09-28 | 2003-12-09 | Bovine Health Products, Inc. | Broad spectrum antimicrobial compound and treatment |
| WO2009117310A2 (en) | 2008-03-17 | 2009-09-24 | Cedars-Sinai Medical Center | Methods for treatment and prevention of mrsa/mssa |
| US20130023035A1 (en) * | 2011-06-30 | 2013-01-24 | Exxonmobil Research And Engineering Company | Regulation of toxin and antitoxin genes for biological containment |
| US8906668B2 (en) | 2012-11-23 | 2014-12-09 | Seres Health, Inc. | Synergistic bacterial compositions and methods of production and use thereof |
| US20160243175A1 (en) * | 2013-10-03 | 2016-08-25 | The Trustees Of The University Of Pennsylvania | Compositions and methods comprising a defined microbiome and methods of use thereof |
| WO2016210373A2 (en) | 2015-06-24 | 2016-12-29 | Synlogic, Inc. | Recombinant bacteria engineered for biosafety, pharmaceutical compositions, and methods of use thereof |
| WO2017008018A1 (en) | 2015-07-09 | 2017-01-12 | Massachusetts Institute Of Technology | Genetically engineered sensors for in vivo detection of bleeding |
| WO2017059245A2 (en) | 2015-09-30 | 2017-04-06 | Trustees Of Boston University | Deadman and passcode microbial kill switches |
| WO2017103593A1 (en) * | 2015-12-15 | 2017-06-22 | University Of Southampton | Meningococcal infection and modified neisseria lactamica |
| WO2017123676A9 (en) * | 2016-01-11 | 2017-09-14 | Synlogic, Inc. | Recombinant bacteria engineered to treat diseases and disorders associated with amino acid metabolism and methods of use thereof |
Non-Patent Citations (2)
| Title |
|---|
| LINZER, DI ET AL.: "Transcriptional regulation of proliferin gene expression in response to serum in transfected mouse cells", THE EMBO JOUMAL, vol. 6, no. 8, August 1987 (1987-08-01), pages 2281 - 2288, XP55615277 * |
| See also references of EP3720458A4 |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3996510A4 (en) * | 2019-07-08 | 2023-08-09 | BioPlx, Inc. | LIVING BIOTHERAPEUTIC COMPOSITIONS AND PROCESSES |
| JP2023528476A (ja) * | 2020-06-02 | 2023-07-04 | バイオピーエルエックス,インコーポレイティド | 組み換え微生物においてゲノムに安定に組み込むための方法 |
| EP4158010A4 (en) * | 2020-06-02 | 2025-02-19 | BioPlx, Inc. | METHOD FOR STABLE GENOMIC INTEGRATION INTO RECOMBINANT MICROORGANISMS |
| WO2023023560A1 (en) * | 2021-08-17 | 2023-02-23 | Contrafect Corporation | New uses |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2021505197A (ja) | 2021-02-18 |
| EP3720458A4 (en) | 2021-12-08 |
| EP3720458A1 (en) | 2020-10-14 |
| US20250346910A1 (en) | 2025-11-13 |
| AU2025234199A1 (en) | 2026-01-22 |
| JP7460531B2 (ja) | 2024-04-02 |
| JP2024075688A (ja) | 2024-06-04 |
| CA3084954A1 (en) | 2019-06-13 |
| US20190169623A1 (en) | 2019-06-06 |
| AU2018379996A1 (en) | 2020-06-25 |
| CN111918960B (zh) | 2025-01-28 |
| CN119875972A (zh) | 2025-04-25 |
| PH12020550941A1 (en) | 2021-05-17 |
| US12163135B2 (en) | 2024-12-10 |
| CN111918960A (zh) | 2020-11-10 |
| MX2020005875A (es) | 2020-10-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250346910A1 (en) | Methods and compositions to prevent microbial infection | |
| O’Neill et al. | Identification of a human skin commensal bacterium that selectively kills Cutibacterium acnes | |
| US20220288135A1 (en) | Live biotherapeutic compositions and methods | |
| Redanz et al. | Pyruvate secretion by oral streptococci modulates hydrogen peroxide dependent antagonism | |
| Yu et al. | Characterization of the Streptococcus pneumoniae NADH oxidase that is required for infection | |
| JP7624219B2 (ja) | ニキビの治療のためのプロピオニバクテリウム・アクネスに対する細菌療法 | |
| US20220025364A1 (en) | Methods for stable genomic integration in recombinant microorganisms | |
| Borralho et al. | Inhibition of pneumococcal growth and biofilm formation by human isolates of Streptococcus mitis and Streptococcus oralis | |
| US20230407241A1 (en) | A novel probiotic streptococcus salivarius strain and its uses | |
| CA3060503A1 (en) | Lantibiotics, lantibiotic-producing bacteria, compositions and methods of production and use thereof | |
| Reimundo et al. | dltA gene mutation in the teichoic acids alanylation system of Lactococcus garvieae results in diminished proliferation in its natural host | |
| MAMMAN | Identification and antibiotic susceptibility profile of methicillin and erythromycin resistant Staphylococcus aureus from clinical and environmental samples in Minna, Nigeria | |
| Onuigbo et al. | Evaluating Indigenous Lytic Bacteriophages for Activity Against Multi-Resistant Enterobacteriaceae | |
| Antezana | Horizontal Transfer of Antibiotic Resistance in Streptococcus pneumoniae | |
| Mahmoud | Identification of Enterococcus faecium genes involved in resistance to oxidative stress and virulence | |
| Cinthi | ISOLATION AND MOLECULAR CHARACTERIZATION OF LINEZOLID-RESISTANT ENTEROCOCCI OF HUMAN, ANIMAL AND ENVIRONMENTAL ORIGIN | |
| Baía | Mechanisms Shaping Intra-Species Interactions in Streptococcus pneumoniae | |
| Hernández‐Zulueta et al. | Antibacterial Activity of Staphylococcus epidermidis CS05 and Pseudomonas fluorescens CS83 Isolated From the Human Conjunctival Sac Against Pathogenic Bacterial Reference Strains | |
| Mutuku | Molecular Characterization And Antimicrobial Resistance Patterns Of Enterococcus Species Isolated From Patients Attending Aga Khan Hospital, Nairobi, Kenya. | |
| Ibrahim | Stress response proteins in Streptococcus pneumoniae | |
| Rogers | Class III phase variation in Staphylococcus epidermidis: Staphylococcus epidermidis icaADBC (+) and icaADBC (-) human skin colonization: The Staphylococcus epidermidis two-component regulatory system sae | |
| Morgan | Molecular analysis of genes encoding resistance to cationic biocides in staphylococci | |
| dos Santos | Efflux Pump Activity in Drug Resistance of Staphylococcus Aureus | |
| Mwangi | Correction: The Mechanism of Heterogeneous Beta-Lactam Resistance in MRSA: Key Role of the Stringent Stress Response |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18886851 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3084954 Country of ref document: CA Ref document number: 2020550034 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018379996 Country of ref document: AU Date of ref document: 20181204 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018886851 Country of ref document: EP Effective date: 20200706 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 201880088486.5 Country of ref document: CN |