WO2019089755A1 - Platform oncolytic vector for systemic delivery - Google Patents
Platform oncolytic vector for systemic delivery Download PDFInfo
- Publication number
- WO2019089755A1 WO2019089755A1 PCT/US2018/058456 US2018058456W WO2019089755A1 WO 2019089755 A1 WO2019089755 A1 WO 2019089755A1 US 2018058456 W US2018058456 W US 2018058456W WO 2019089755 A1 WO2019089755 A1 WO 2019089755A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- virus
- oncolytic
- nucleic acid
- modified
- exogenous nucleic
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/76—Viruses; Subviral particles; Bacteriophages
- A61K35/768—Oncolytic viruses not provided for in groups A61K35/761 - A61K35/766
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/47—Hydrolases (3) acting on glycosyl compounds (3.2), e.g. cellulases, lactases
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
- C07K14/7158—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for chemokines
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2474—Hyaluronoglucosaminidase (3.2.1.35), i.e. hyaluronidase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01035—Hyaluronoglucosaminidase (3.2.1.35), i.e. hyaluronidase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/24011—Poxviridae
- C12N2710/24111—Orthopoxvirus, e.g. vaccinia virus, variola
- C12N2710/24132—Use of virus as therapeutic agent, other than vaccine, e.g. as cytolytic agent
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/24011—Poxviridae
- C12N2710/24111—Orthopoxvirus, e.g. vaccinia virus, variola
- C12N2710/24141—Use of virus, viral particle or viral elements as a vector
- C12N2710/24143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- One aspect of the present disclosure provides a modified oncolytic virus, comprising an exogenous nucleic acid that codes for a chemokine receptor, a membrane associated protein that can be capable of degrading hyaluronan, a microbial protein that is capable of degrading hyaluronan, or any combinations thereof.
- the chemokine receptor can comprise at least one of CXCR4 and CCR2.
- the modified oncolytic virus can comprise the exogenous nucleic acid that can code for the membrane associated protein.
- the exogenous nucleic acid that codes for the membrane associated protein can code for a hyaluronidase.
- the hyaluronidase can be PH-20.
- the PH-20 can be GPI-anchored.
- the modified oncolytic virus can comprise the exogenous nucleic acid that can code for the microbial protein.
- the microbial protein comprises a secreted hyaluronidase.
- the secreted hyaluronidase comprises at least one of HysA, lin, sko, rv, or any combinations thereof.
- the microbial protein comprises HysA.
- the modification can enhance production of enveloped extracellular form (EEV) of the virus.
- the modified oncolytic virus can comprise the modification in the genome of the virus.
- the modification can comprise a mutation or a deletion of the B5R gene, wherein said deletion is a partial deletion.
- the modification can comprise a mutation or a deletion in a SCR region of the B5R gene, wherein said SCR region comprises SCR1, SCR3, SCR4, or any combinations thereof, and wherein the SCR region does not comprise SCR2.
- the modified oncolytic virus can comprise the deletion of the B5R gene, and the deletion can be a partial deletion of the B5R gene.
- the modified oncolytic virus can comprise a modification in the genome of the virus, wherein the modification can comprise a mutation or a deletion of the A52R gene. In some embodiments, the modification can comprise the deletion of the A52R gene.
- the modified oncolytic virus can further comprise at least one additional modification in the genome of the virus, wherein the additional modification can comprise a mutation or a deletion of a further viral gene.
- the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, and NIL, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can further comprise at least one additional exogenous nucleic acid.
- the at least one additional exogenous nucleic acid can comprise a nucleic acid sequence that codes for a protein or a fragment thereof that: modulates NFKB (NF-kappaB) signaling, promotes reduction of interstitial fluid pressure (IFP) in a tumor, modulates STAT3 -mediated gene activation, promotes T cell activation, promotes attraction of NK cells to virus-infected cells, modulates metabolic program of virus-infected cells, modulates fatty acid uptake by virus-infected cells, promotes therapeutic targeting of MDSCs, or any combinations thereof.
- NFKB NF-kappaB
- IFP interstitial fluid pressure
- the at least one additional exogenous nucleic acid can comprise a nucleic acid coding for at least one ofHMGBl, PIAS3, IL15, IL15-Ra, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof .
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; and (b) the exogenous nucleic acid that codes for a hyaluronidase.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; and (b) the mutation or the deletion of B5R gene.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for a hyaluronidase; and (b) the mutation or the deletion of B5R gene.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the exogenous nucleic acid that codes for a hyaluronidase; and (c) the mutation or the deletion of B5R gene.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; and (b) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for a hyaluronidase; and (b) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the exogenous nucleic acid that codes for a hyaluronidase; and (c) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the mutation or the deletion of B5R gene; and (c) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for a hyaluronidase; (b) the mutation or the deletion of B5R gene; and (c) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2 ; (b) the exogenous nucleic acid that codes for a hyaluronidase ; (c) the mutation or the deletion of B5R gene; and (d) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; and (b) the at least one additional exogenous nucleic acid that codes for at least one of HMGB1, PIAS3, IL15, IL15- Ra, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for a hyaluronidase; and (b) the at least one additional exogenous nucleic acid that codes for at least one of HMGB1, PIAS3, IL15, IL15-Ra, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the exogenous nucleic acid that codes for a hyaluronidase; and (c) the at least one additional exogenous nucleic acid that codes for at least one of HMGB1, PIAS3, IL15, IL15-Ra, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the mutation or the deletion of B5R gene; and (c) the at least one additional exogenous nucleic acid that codes for at least one of HMGB1, PIAS3, IL15, IL15-Ra, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for ahyaluronidase; (b) the mutation or the deletion of B5R gene; and (c) the at least one additional exogenous nucleic acid that codes for at least one of HMGB1, PIAS3, IL15, IL15-Ra, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the exogenous nucleic acid that codes for a hyaluronidase; (c) the mutation or the deletion of B5R gene; and (d) the at least one additional exogenous nucleic acid that codes for at least one of HMGB1, PIAS3, IL15, IL15-Ra, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the exogenous nucleic acid that codes for a hyaluronidase; (c) the mutation or the deletion of B5R gene; (d) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, and a functional domain or fragment or variant thereof, or any combinations thereof; and (e) the at least one additional exogenous nucleic acid that codes for at least one of HMGB1, PIAS3, IL15, IL15- Ra, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the hyaluronidase comprises PH-20. In some embodiments, the hyaluronidase comprises HysA. In some embodiments, the modified oncolytic virus can further comprise an exogenous nucleic acid that codes for a viral VH1 protein.
- the modified oncolytic virus can comprise the exogenous nucleic acid coding for the viral VH1 protein, wherein the exogenous nucleic acid can be from a genome of a poxvirus, wherein the poxvirus can be not vaccinia virus.
- the poxvirus can comprise a measles virus, a poliovirus, a poxvirus, a vaccinia virus, an adenovirus, an adeno associated virus, a herpes simplex virus, a vesicular stomatitis virus, a reovirus, a Newcastle disease virus, a senecavirus, a lentivirus, a mengovirus, or a myxomavir.
- the viral genome can comprise a thymidine kinase gene.
- a thymidine kinase gene can be deleted from the viral genome.
- the modified oncolytic virus can further comprise a thymidine kinase gene from a herpes simplex virus.
- the modified oncolytic virus exhibits enhanced intratumoral and intertumoral spreading, enhanced immune evasion, enhanced tumor-specific replication, enhanced tumor-targeted delivery, compared to an otherwise identical oncolytic virus that does not comprise the modifications as disclosed herein.
- the modified oncolytic virus can comprise a vaccinia virus, an adeno associated virus, an adenovirus, a reovirus, a lentivirus, a herpes simplex virus, a vesicular stomatitis virus, a mengovirus, or a myxomavir.
- the modified oncolytic virus can be a vaccinia virus.
- an oncolytic vaccinia virus that can comprise at least two of the following: (a) a modification that enhances intratumoral and intertumoral spreading of the virus; (b) a modification that enhances systemic delivery of the virus; (c) a modification that enhances tumor-specific replication of the virus; and (d) a modification that enhances immune evasion of the virus.
- an oncolytic vaccinia virus that can comprise an exogenous nucleic acid that codes for a protein, or a fragment thereof, that enhances degradation of an extracellular matrix (ECM) of a tumor.
- ECM extracellular matrix
- the protein or the fragment thereof that enhances degradation of the ECM can be a hyaluronidase.
- the hyaluronidase can be a membrane associated hyaluronidase, such as PH-20.
- the PH-20 can be GPI-anchored.
- the hyaluronidase can be a microbial hyaluronidase, such as HysA.
- the oncolytic vaccinia virus can comprise at least one of the following: (a) a modification that enhances intratumoral and intertumoral spreading of the virus; (b) a modification that enhances systemic delivery of the virus; (c) a modification that enhances tumor-specific replication of the virus; and (d) a modification that enhances immune evasion of the virus.
- Yet another aspect of the present disclosure provides an oncolytic vaccinia virus that can comprise an exogenous nucleic acid that codes for a chemokine receptor, wherein expression of the chemokine receptor from the virus enhances systemic delivery of the virus.
- the chemokine receptor can comprise at least one of CXCR4 and CCR2.
- the oncolytic vaccinia virus can comprise the exogenous nucleic acid that codes for the chemokine receptor, and can further comprise at least one of the following: (a) a modification that enhances degradation of an ECM of a tumor; and (b) a modification that enhances production of EEV form of the virus;
- an oncolytic vaccinia virus that can comprise a first modification in the genome of the virus that enhances production of EEV form of the virus, and at least one of the following further modifications: (a) a modification that enhances intratumoral and intertumoral spreading of the virus; (b) a modification that enhances systemic delivery of the virus; (c) a modification that enhances tumor-specific replication of the virus; and (d) a modification that enhances immune evasion of the virus.
- the first modification can comprise a mutation or a deletion of the B5R gene.
- the oncolytic vaccinia virus can comprise a mutation or a deletion of a further viral gene, wherein the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R SPI-1, SPI-2, B15R VGF, E3L, K3L, A41L, K7R, NIL, and A52R, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can further comprise a nucleic acid sequence that codes for a protein or a fragment thereof that: modulates NFKB signaling, promotes reduction of interstitial fluid pressure (IFP), modulates ST AT3 -mediated gene activation, promotes T cell activation, promotes attraction of K cells to virus-infected cells, modulates metabolic program of virus-infected cells, modulates fatty acid uptake by virus- infected cells, promotes therapeutic targeting of MDSCs, or any combinations thereof.
- IFP interstitial fluid pressure
- the at least one additional exogenous nucleic acid can comprise a nucleic acid coding for at least one of HMGB1, PIAS3, IL15, IL15-Ra, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; and (b) the exogenous nucleic acid that codes for a hyaluronidase.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; and (b) the mutation or the deletion of B5R gene.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for a hyaluronidase; and (b) the mutation or the deletion of B5R gene.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the exogenous nucleic acid that codes for a hyaluronidase; and (c) the mutation or the deletion of B5R gene.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; and (b) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, A52R, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for a hyaluronidase; and (b) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, A52R, and a functional domain or fragment or variant thereof, or any combinations thereof a functional domain thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the exogenous nucleic acid that codes for a hyaluronidase; and (c) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, A52R, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the mutation or the deletion of B5R gene; and (c) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, A52R, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for a hyaluronidase; (b) the mutation or the deletion of B5R gene; and (c) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, A52R, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2 ; (b) the exogenous nucleic acid that codes for a hyaluronidase ; (c) the mutation or the deletion of B5R gene; and (d) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, A52R, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; and (b) the at least one additional exogenous nucleic acid that codes for at least one of HMGB1, PIAS3, IL15, IL15- R, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for the hyaluronidase; and (b) the at least one additional exogenous nucleic acid that codes for at least one of HMGBl, PIAS3, IL15, IL15-R, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the exogenous nucleic acid that codes for the hyaluronidase; and (c) the at least one additional exogenous nucleic acid that codes for at least one of HMGBl, PIAS3, IL15, IL15-R, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the mutation or the deletion of B5R gene; and (c) the at least one additional exogenous nucleic acid that codes for at least one of HMGBl, PIAS3, IL15, IL15-R, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for the hyaluronidase; (b) the mutation or the deletion of B5R gene; and (c) the at least one additional exogenous nucleic acid that codes for at least one of HMGBl, PIAS3, IL15, IL15-R, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the exogenous nucleic acid that codes for the hyaluronidase; (c) the mutation or the deletion of B5R gene; and (d) the at least one additional exogenous nucleic acid that codes for at least one of HMGBl, PIAS3, IL15, IL15-R, LIGHT, ITAC, fractalkine, CCL5, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the oncolytic vaccinia virus can comprise: (a) the exogenous nucleic acid that codes for at least one of CXCR4 and CCR2; (b) the exogenous nucleic acid that codes for the hyaluronidase; (c) the mutation or the deletion of B5R gene; (d) the mutation or the deletion of the further viral gene can comprise at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, A52R, and a functional domain or fragment or variant thereof, or any combinations thereof; and (e) the at least one additional exogenous nucleic acid that codes for at least one of HMGB1, PIAS3, IL15, IL15-Ra, LIGHT, IT AC, fractalkine, CCL5, and a functional fragment or domain or variant thereof, or any combinations thereof.
- One aspect provides an oncolytic vaccinia virus, comprising an exogenous nucleic acid that can code for a chemokine receptor, a protein that is capable of degrading hyaluronan, or any combinations thereof.
- the protein that is capable of degrading hyaluronan wherein the protein comprises PH-20 or HysA.
- One aspect provides a modified oncolytic virus that can comprise a mutation or a deletion of A52R gene.
- the modified oncolytic virus can comprise the deletion of A52R gene.
- the modified oncolytic virus can comprise an exogenous nucleic acid that can code for a chemokine receptor, a protein that is capable of degrading hyaluronan, or any combinations thereof.
- the modified oncolytic virus can comprise the exogenous nucleic acid that can code for the chemokine receptor, wherein the chemokine receptor can comprise CXCR4 or CCR2.
- the modified oncolytic virus can comprise the exogenous nucleic acid that codes for the protein that is capable of degrading hyaluronan, wherein the protein can comprise a membrane associated hyaluronidase or a secreted hyaluronidase.
- the modified oncolytic virus can comprise the exogenous nucleic acid that can code for the membrane associated hyaluronidase, wherein the membrane associated hyaluronidase can be PH-20. In some embodiments, the PH-20 can be GPI-anchored. In some embodiments, the modified oncolytic virus can comprise the exogenous nucleic acid that can code for the secreted hyaluronidase, wherein the secreted hyaluronidase can be HysA.
- modified oncolytic virus that can comprise a mutation or a deletion of K7R gene.
- the modified oncolytic virus can comprise the deletion of the K7R gene.
- the modified oncolytic virus can further comprise at least one of an exogenous nucleic acid that can code for a cytokine, an exogenous nucleic acid that can code for a cytokine receptor, and an exogenous nucleic acid that can code for a chemokine.
- the modified oncolytic virus comprises the exogenous nucleic acid that can code for the cytokine, wherein the cytokine can comprise IL15.
- the modified oncolytic virus can comprise the exogenous nucleic acid that can code for the cytokine receptor, wherein the cytokine receptor can comprise IL15-Ra. In some embodiments, the modified oncolytic virus can comprise exogenous nucleic acid that can code for the chemokine, wherein the chemokine can comprise CCL5. In some embodiments, the modified oncolytic vims can further comprise an exogenous nucleic acid that codes for at least one of HMGBl, PIAS3, LIGHT, ITAC, a fractalkine, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the modified oncolytic virus can further comprise a mutation or a deletion of a further viral gene comprising at least one of F13L, A36R, A34R, A33R, B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, NIL, A52R, and a functional domain or fragment or a variant thereof, or any combinations thereof.
- One aspect provides a modified oncolytic virus that can comprise exogenous nucleic acids that can code for IL15 and IL15-Ra.
- One aspect provides a modified oncolytic virus that can comprise exogenous nucleic acids that can code for IL15 and CCL5.
- One aspect provides a modified oncolytic virus that can comprise an exogenous nucleic acid that can code for at least one of: IL15, IL15-Ra, ITAC, fractalkine, and a functional domain or fragment or variant thereof, or any combinations thereof.
- the virus can exhibit enhanced activation and attraction of natural killer cells.
- the modified oncolytic virus can exhibit enhanced intratumoral and intertumoral spreading, enhanced immune evasion, enhanced tumor-specific replication, enhanced tumor-targeted delivery, compared to an otherwise identical oncolytic virus that does not comprise the modifications as disclosed herein.
- the modified oncolytic virus can comprise a poxvirus, an adeno associated virus, an adenovirus, a reovirus, a lentivirus, a herpes simplex virus, a vesicular stomatitis virus, a mengovirus, or a myxomavir.
- the modified oncolytic virus can comprise the poxvirus.
- the poxvirus can be a vaccinia virus.
- the modified oncolytic virus can be suitable for systemic delivery.
- the oncolytic vaccinia virus can exhibit enhanced intratumoral and intertumoral spreading, enhanced immune evasion, enhanced tumor-specific replication, enhanced tumor-targeted delivery, compared to an otherwise identical vaccinia virus that does not comprise the modifications as disclosed herein.
- the oncolytic vaccinia virus can be suitable for systemic delivery.
- the oncolytic vaccinia virus may be capable of immune evasion.
- the systemic delivery can comprise oral administration, parenteral administration, intranasal administration, sublingual administration, rectal administration, transdermal administration, or any combinations thereof.
- the parenteral delivery can comprise an intravenous injection.
- the oncolytic vaccinia virus can be suitable for intratumoral delivery.
- the oncolytic vaccinia virus can comprise an exogenous nucleic acid that codes for a viral VH1 protein.
- the exogenous nucleic acid can be from a genome of a poxvirus, wherein the poxvirus can be not vaccinia virus.
- the poxvirus can comprise a betaentomopoxvirus, a yatapoxvirus, a cervidpoxvirus, a
- gammaentomopoxvirus a leporipoxvirus, a suipoxvirus, a molluscipoxvirus, a
- crocodylidpoxvirus a alphaentomopoxvirus, a capripoxvirus, a avipoxvirus, a parapoxvirus.
- the viral genome can comprise a thymidine kinase gene.
- a thymidine kinase gene can be deleted from the viral genome.
- the oncolytic vaccinia virus can comprise a thymidine kinase gene from a herpes simplex virus.
- a pharmaceutical composition can comprise a modified oncolytic virus as disclosed herein or an oncolytic vaccinia virus as disclosed herein.
- the pharmaceutical composition can comprise a solubilizing agent and an excipient.
- the excipient can comprise one or more of a buffering agent, a stabilizer, an antioxidant, a binder, a diluent, a dispersing agent, a rate controlling agent, a lubricant, a glidant, a disintegrant, a plasticizer, a preservative, or any combinations thereof.
- the excipient can comprise di-sodium hydrogen phosphate dihydrate, sodium dihydrogen phosphate dihydrate, sodium chloride, myo-inositol, sorbitol, or any combinations thereof.
- the pharmaceutical composition does not comprise a preservative.
- the pharmaceutical composition can comprise one or more of a preservative, a diluent, and a carrier.
- the pharmaceutical composition can comprise an additional active ingredient or a salt thereof.
- the solubilizing agent can be sterile water.
- the pharmaceutical composition can comprise an additional active ingredient, wherein the additional active ingredient can be a further oncolytic virus.
- Yet another aspect of the present disclosure provides a method of enhancing therapeutic effect of an oncolytic virus upon systemic delivery of the virus to a subject, comprising a systemic administration of a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein.
- the systemic administration can comprise oral administration, parenteral administration, intranasal administration, sublingual administration, rectal administration, transdermal administration, or any combinations thereof.
- the parenteral administration can comprise intravenous injection.
- Yet another aspect of the present disclosure provides a process for engineering a modified oncolytic virus can comprise: (i) obtaining a modified oncolytic virus DNA backbone vector, the modified oncolytic virus DNA backbone vector can comprise one or more modifications as disclosed herein; (ii) further modifying the modified oncolytic virus DNA vector to produce an engineered DNA vector; (iii) transfecting mammalian cells with the engineered DNA vector; (iv) culturing the mammalian cells under conditions suitable for viral replication; and (v) harvesting the viral particles.
- Yet another aspect of the present disclosure provides a process for engineering an oncolytic vaccinia virus can comprise: (i) obtaining an oncolytic vaccinia virus DNA backbone vector, the oncolytic vaccinia virus DNA backbone vector can comprise one or more modifications as disclosed herein; (ii) further modifying the oncolytic vaccinia virus DNA vector to produce an engineered DNA vector; (iii) transfecting mammalian cells with the engineered DNA vector; (iv) culturing the mammalian cells under conditions suitable for viral replication; and (v) harvesting the viral particles.
- Yet another aspect of the present disclosure provides a process for producing a modified oncolytic virus as disclosed herein, comprising: (i) generating a modified oncolytic virus DNA vector, the modified oncolytic virus DNA vector can comprise the modifications as disclosed herein; (ii) transfecting mammalian cells with the modified oncolytic virus DNA vector; (iii) culturing the mammalian cells under conditions suitable for viral replication; and (iv) harvesting the viral particles.
- Yet another aspect of the present disclosure provides a process for producing an oncolytic vaccinia virus as disclosed herein, comprising: (i) generating an oncolytic vaccinia virus DNA vector, the oncolytic vaccinia virus DNA vector can comprise the modifications as disclosed herein; (ii) transfecting mammalian cells with the oncolytic vaccinia virus DNA vector; (iii) culturing the mammalian cells under conditions suitable for viral replication; and (iv) harvesting the viral particles.
- the mammalian cells comprise HeLa cells, 293 cells, or Vero cells.
- kits can comprise: a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, and instruction for administering the modified oncolytic virus, the oncolytic vaccinia virus, or a pharmaceutical composition; and instructions for administering said pharmaceutical composition to a subject to treat a disorder associated with pathological angiogenesis.
- kits comprising: a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, and instruction for administering the modified oncolytic virus, the oncolytic vaccinia virus, or a pharmaceutical composition; a container; and instructions for administering said pharmaceutical composition to a subject to treat a disorder associated with pathological angiogenesis.
- kits for treating a cancer comprising: a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, and instruction for administering the modified oncolytic virus, the oncolytic vaccinia virus, or the pharmaceutical composition; and instructions for administering said pharmaceutical composition to a subject to treat a disorder associated with pathological angiogenesis.
- kits for treating a cancer comprising: a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, and instruction for administering the modified oncolytic virus, the oncolytic vaccinia virus, or the pharmaceutical composition; a container; and instructions for administering said pharmaceutical composition to a subject to treat a disorder associated with pathological angiogenesis.
- the cancer can be a solid tumor, a leukemia, or a lymphoma.
- kits for treating a tumor comprising: a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, and instruction for administering the modified oncolytic virus, the oncolytic vaccinia virus, or the pharmaceutical composition; and instructions for administering said pharmaceutical composition to a subject to treat a disorder associated with pathological angiogenesis.
- kits for treating a tumor comprising: a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, and instruction for administering the modified oncolytic virus, the oncolytic vaccinia virus, or the pharmaceutical composition; a container; and instructions for administering said pharmaceutical composition to a subject to treat a disorder associated with pathological angiogenesis.
- the tumor can be a solid tumor, a leukemia, or a lymphoma.
- the subject can be in need of the treatment.
- the subject can be human.
- the instructions for administering can comprise instructions for a systemic administration.
- the systemic administration can comprise oral administration, parenteral administration, intranasal administration, sublingual administration, rectal administration, transdermal administration, or any combinations thereof.
- the parenteral administration can comprise intravenous injection.
- Yet another aspect of the present disclosure provides a method of treating a tumor, comprising: administering to a subject a therapeutically effective amount of a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein.
- the method of treating a tumor can comprise administering to a subject a therapeutically effective amount of a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, wherein the tumor can be a solid tumor, a leukemia, or a lymphoma.
- Yet another aspect of the present disclosure provides a method of treating a cancer, comprising administering to a subject a therapeutically effective amount of a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein.
- the method of treating a cancer can comprise administering to a subject a therapeutically effective amount of a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, wherein the cancer can be a solid tumor, a leukemia, or a lymphoma.
- the method of treating a cancer can comprise administering to a subject a therapeutically effective amount of a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, wherein the method further can comprise administration of a further therapy.
- the further therapy can comprise chemotherapy, radiation, oncolytic viral therapy with an additional virus, treatment with immunomodulatory proteins, a CAR T cellular therapy (chimeric antigen receptor T cell therapy), an anti-cancer agent, or any combinations thereof.
- the further therapy can comprise administration of an immunomodulatory agent can comprise anti-CD33 antibody and variable region thereof, an anti-CD 1 lb antibody and variable region thereof, a COX2 inhibitor, a cytokine, a chemokine, an anti-CTLA4 antibody or an antigen binding fragment thereof, an anti-PD-1 antibody or an antigen binding fragment thereof, an anti-PD-Ll antibody or an antigen binding fragment thereof, or a TLR agonist.
- the method of treating a cancer can comprise administration of the further therapy, wherein the further therapy can comprise administration of the anticancer agent, wherein the anti-cancer agent can be a chemotherapeutic agent.
- the chemotherapeutic agent can be a prodrug.
- the prodrug upon administration of the prodrug in combination with the oncolytic vaccinia virus, the modified vaccinia virus, or a pharmaceutical composition can comprise the same, the prodrug can be converted to an active form.
- the prodrug can comprise ganciclovir.
- the method of treating a cancer can comprise administration of the further therapy, wherein the further therapy can be administered concurrently or sequentially.
- the method of treating a cancer can comprise sequential administration of the further therapy, wherein the further therapy can be administered prior to administering the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or the pharmaceutical composition as disclosed herein.
- the method of treating a cancer can comprise sequential administration of the further therapy, wherein the further therapy can be administered after administering the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or the pharmaceutical composition as disclosed herein.
- Yet another aspect of the present disclosure provides a method of producing a toxic effect in a cancer cell, comprising: administering to a cancer cell a therapeutically effective amount of a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein.
- the cancer cell can be present in a subject.
- the subject can be in need of the method that producing the toxic effect in the cancer cell.
- Yet another aspect of the present disclosure provides a method of treating a subject, comprising: producing a toxic effect in a cancer cell that can be present in the subject by administering to the cancer cell a therapeutically effective amount of a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein.
- the subject can be in need of the treatment.
- Yet another aspect of the present disclosure provides a method of treating cancer in a subject, comprising, infecting a cancer cell of the subject by administration of a therapeutically effective amount of a modified oncolytic virus as disclosed herein, an oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, wherein the administration can be a systemic administration.
- Yet another aspect of the present disclosure provides a method of treating cancer in a subject, comprising administering cells infected with a modified oncolytic virus as disclosed herein or an oncolytic vaccinia virus as disclosed herein.
- the cancer can comprise melanoma, hepatocellular carcinoma, breast cancer, lung cancer, peritoneal cancer, prostate cancer, bladder cancer, ovarian cancer, leukemia, lymphoma, renal carcinoma, pancreatic cancer, epithelial carcinoma, gastric cancer, colon carcinoma, duodenal cancer, pancreatic adenocarcinoma, mesothelioma, glioblastoma multiforme, astrocytoma, multiple myeloma, prostate carcinoma, hepatocellular carcinoma, cholangiosarcoma, pancreatic adenocarcinoma, head and neck squamous cell carcinoma, colorectal cancer, intestinal-type gastric adenocarcinoma, cervical squamous-cell carcinoma, osteosarcoma, epithelial ovarian carcinoma, acute lymphoblastic lymphoma, myeloproliferative neoplasms, or sarcoma.
- the cancer cell can be present in an organ of the subject selected from the group consisting of: the bladder, blood, bone, bone marrow, brain, breast, colon, esophagus, gastrointestine, gum, head, kidney, liver, lung, nasopharynx, neck, ovary, prostate, skin, stomach, testis, tongue, or uterus.
- the cancer can be metastatic.
- Yet another aspect of the present disclosure provides a method of treating a cancer in a subject, comprising: administering a modified oncolytic virus as disclosed herein or pharmaceutical composition can comprise the same in combination with a chemotherapeutic prodrug.
- Yet another aspect of the present disclosure provides a method of treating a cancer in a subject, comprising: administering an oncolytic vaccinia virus as disclosed herein or a pharmaceutical composition can comprise the same in combination with a chemotherapeutic prodrug.
- Yet another aspect of the present disclosure provides a method of treating a cancer in a subject, comprising: (i) administering a modified oncolytic virus as disclosed herein or a pharmaceutical compositions can comprise the same; (ii) assaying a viral titer in a first and a second biological sample isolated from the subject, wherein the first biological sample can comprise a cancer cell and the second biological sample can comprise a non-cancer cell; and (iii) administering a chemotherapeutic prodrug if the viral titer can be equal to or higher in the second sample than the first sample, wherein administration of the chemotherapeutic prodrug results in inhibition of replication of the modified oncolytic virus in the subject.
- Yet another aspect of the present disclosure provides a method of treating a cancer in a subject, comprising: (i) administering an oncolytic vaccinia virus as disclosed herein or a pharmaceutical compositions can comprise the same; (ii) assaying a viral titer in a first and a second biological sample isolated from the subject, wherein the first biological sample can comprise a cancer cell and the second biological sample can comprise a non-cancer cell; and (iii) administering a chemotherapeutic prodrug if the viral titer can be equal to or higher in the second sample than the first sample, wherein administration of the chemotherapeutic prodrug results in inhibition of replication of the oncolytic vaccinia virus in the subject.
- the method of treating a cancer in a subject can increase efficacy of oncolytic virus based cancer therapy.
- the method of treating a cancer in a subject can comprise the administration of the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or the pharmaceutical composition as disclosed herein, wherein the modified oncolytic virus, the oncolytic vaccinia virus, or a pharmaceutical composition can be administered at a dosage that can comprise about 10 6 PFU/mL to about 10 10 PFU/mL of the oncolytic vaccinia virus.
- the method of treating a cancer in a subject can comprise the administration of the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or the pharmaceutical composition as disclosed herein, wherein the modified oncolytic virus, the oncolytic vaccinia virus, or a pharmaceutical composition can be administered at a dosage that can comprise about 5 x 10 9 PFU/mL of the oncolytic vaccinia virus.
- the method of treating a cancer in a subject can comprise the administration of the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or the pharmaceutical composition as disclosed herein, wherein the modified oncolytic virus, the oncolytic vaccinia virus, or a pharmaceutical composition can be administered, independently, in an initial dose for a first period of time, an intermediate dose for a second period of time, and a high dose for a third period of time.
- the method of treating a cancer in a subject can comprise administration of the initial, the intermediate, and the high dose, independently, wherein the initial dose can be lower than the intermediate dose and the intermediate dose can be lower than the high dose.
- the method of treating a cancer in a subject can comprise administering the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or the pharmaceutical composition as disclosed herein, wherein the modified oncolytic virus, the oncolytic vaccinia virus, and a pharmaceutical composition independently can comprise a liquid dosage form that can be administered at a volume of about 1 mL to about 5 mL, about 5 mL to 10 mL, about 15 mL to about 20 mL, about 25 mL to about 30 mL, about 30 mL to about 50 mL, about 50 mL to about 100 mL, about 100 mL to 150 mL, about 150 mL to about 200 mL, about 200 mL to about 250 mL, about 250 mL to about 300 mL, about 300 mL to about 350
- the method of treating a cancer in a subject can comprise administering the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or the pharmaceutical composition as disclosed herein, wherein the modified oncolytic virus, the oncolytic vaccinia virus, or a pharmaceutical composition can be administered in a liquid dosage form, a solid dosage form, an inhalable dosage form, an intranasal dosage form, a liposomal formulation, a dosage form can comprise nanoparticles, a dosage form can comprise microparticles, a polymeric dosage form, or any combinations thereof.
- the method of treating a cancer in a subject can comprise administering the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or the pharmaceutical composition as disclosed herein, wherein the modified oncolytic virus, the oncolytic vaccinia virus, or the pharmaceutical composition can be administered for a duration of about 1 week, about 2 week, about 3 weeks, about 4 weeks, about 6 weeks, about 7 weeks, about 8 weeks, about 9 weeks, about 10, weeks, or about 12 weeks.
- the method of treating a cancer in a subject can comprise administering the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, wherein the modified oncolytic virus, the oncolytic vaccinia virus, or the pharmaceutical composition can be administered once daily, twice daily, once every week, once every two weeks, or once every three weeks.
- the method of treating a cancer in a subject can comprise administering the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, wherein the modified oncolytic virus, the oncolytic vaccinia virus, or a pharmaceutical composition can be administered intravenously, intraperitoneally, or by an intratumoral injection.
- the method of treating a cancer in a subject can comprise administering the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, wherein the modified oncolytic virus, the oncolytic vaccinia virus, or a pharmaceutical composition can be administered as a bolus injection or a slow infusion.
- the method of treating a cancer in a subject can comprise administering the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein, wherein the administration of the modified oncolytic virus, the oncolytic vaccinia virus, or the pharmaceutical composition results in a first peak viral load after about 1 hour to about 3 days and a second peak viral load after about 3 days to about 10 days from administration of a first dose.
- the method of treating a cancer in a subject can comprise administration of the further therapy, wherein the further therapy can be administered for a duration of about 1 week, about 2 week, about 3 weeks, about 4 weeks, about 6 weeks, about 7 weeks, about 8 weeks, about 9 weeks, about 10, weeks, or about 12 weeks.
- the method of treating a cancer in a subject can comprise administration of the further therapy, wherein the further therapy can be administered once daily, once every week, once every two weeks, or once every three weeks.
- the method of treating a cancer in a subject can comprise administration of the further therapy, wherein the further therapy can be administered in a liquid dosage form, a solid dosage form, an inhalable dosage form, an intranasal dosage form, a liposomal formulation, a dosage form can comprise nanoparticles, a dosage form can comprise microparticles, a polymeric dosage form, or any combinations thereof.
- the method of treating a cancer in a subject can comprise administration of the further therapy, wherein the further therapy can be administered orally, intravenously, by an intratumoral injection, or by radiation.
- the method of treating a cancer in a subject can comprise the administration of the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or the pharmaceutical composition as disclosed herein to a subject in need thereof, wherein the subject can be human.
- the method of treating a cancer in a subject can comprise the administration of the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or the pharmaceutical composition as disclosed herein to the subject in need thereof, wherein prior to administration of the modified oncolytic virus, the oncolytic vaccinia virus, or the pharmaceutical composition the subject has been diagnosed with a cancer.
- the method of treating a subject can comprise the administration of the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or the pharmaceutical composition as disclosed herein to the subject in need thereof, wherein prior to administration of the modified oncolytic virus, the oncolytic vaccinia virus, or the pharmaceutical composition the subject has been diagnosed with a tumor.
- the method of treating a cancer in a subject can comprise the administration of the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein to the subject in need thereof in combination with the further therapy, wherein prior to administration of the modified oncolytic virus, the oncolytic vaccinia virus, or the pharmaceutical composition or the further therapy the subject has been diagnosed with a cancer or a tumor.
- the method of treating a subject can comprise the administration of the modified oncolytic virus as disclosed herein, the oncolytic vaccinia virus as disclosed herein, or a pharmaceutical composition as disclosed herein to the subject in need thereof in combination with the further therapy, wherein prior to administration of the modified oncolytic virus, the oncolytic vaccinia virus, or the pharmaceutical composition or the further therapy the subject has been diagnosed with a tumor.
- FIG. 1 shows the effect of an exemplary modified vaccinia virus of this disclosure, containing an exemplary mutation in B5R gene, on tumor growth.
- the graph quantifies the relative tumor size over the days post implantation in BALB/c mice bearing subcutaneous RENCA tumors, which were treated with a single dose of a control vaccinia virus injected intravenously (Control (IV)), a modified WR.TK-GMCSF vaccinia virus, where TK gene was deleted and an exogenous nucleic acid encoding GMCSF was added, injected intratumorally (WR.TK-GMCSF (IT)), or the exemplary modified vaccinia virus
- TK- TK gene was deleted and a mutation was introduced in B5R gene, injected intravenously (WR.B5Rmut.TK-(IV)) or intratumorally (WR.B5Rmut.TK-(IT)).
- FIGS. 2A-2B show the effects of an exemplary mutation in B5R gene on the delivery and spreading of an exemplary modified vaccinia virus (WR.B5RmutTK- virus) (referred to as B5R in FIG. 2 A and 2B), in tumors.
- FIG. 2 A and FIG. 2B are graphs showing the quantification of the viral genomes per gram of tumor collected from non- immunized and immunized C57/BL6 mice bearing B 16 tumors, respectively.
- mice treated with a single injection of the WR.B5RmutTK- virus were compared with mice treated with another modified vaccinia virus WR.TK-A34R K151E, where TK was deleted and the viral A34R gene was mutated with an amino acid change, K151 to E (referred to as WI in FIG. 2A and 2B)
- FIGS. 3A-3B show the effect of an exemplary mutation in B5R gene on the replication of an exemplary modified vaccinia virus (WR.B5RmutTK- virus) (referred to as B5R in FIG. 3 A and 3B), in tumors.
- FIG. 3A and FIG. 3B are graphs quantifying the plaque forming capability of the viruses, WR.TK-A34R K151E, where TK was deleted and the viral A34R gene was mutated with an amino acid change, K151 to E (referred to as WI in FIG. 3A and 3B) and B5R, per gram of collected tumor (PFU/g) in an in vitro plaque assay.
- FIG. 4 shows the effect of exemplary modified vaccinia viruses having an exogenous nucleic acid that codes for CXCR4 or CCR5 on viral expression of luciferase in tumors.
- the graph quantifies the luciferase-mediated photon intensity in the tumors by bioluminescence imaging in mice bearing orthotopic (mammary fat pad) 4T1 tumors.
- mice were treated with a single dose of a modified vaccinia virus where TK gene was deleted and an exogenous nucleic acid encoding mouse CCR5 was added (mCCR5/TK- virus), a modified vaccinia virus where TK gene was deleted and an exemplary exogenous nucleic acid encoding mouse CXCR4 was added (mCXCR4/TK- virus), or a TK- virus, where TK gene was deleted. All viruses were engineered to express luciferase.
- FIGS. 5A-5B show the effects of exemplary modified vaccinia viruses containing an exogenous nucleic acid that codes for CXCR4 or CCR5 on tumor growth and animal survival.
- FIG. 5A includes a graph showing the relative tumor size over the days post implantation in mice bearing orthotopic (mammary fat pad) 4T1 tumors, which were treated with a single dose a modified vaccinia virus where TK gene was deleted and an exogenous nucleic acid encoding mouse CCR5 was added (CCR5 - virus), a modified vaccinia virus where TK gene was deleted and an exemplary exogenous nucleic acid encoding mouse CXCR4 was added (CXCR4 - virus), or a TK- virus, where TK gene was deleted.
- FIG. 5A also includes a chart listing statistic difference for each pair of comparison.
- FIG. 5B shows the survival curves of these mice.
- FIGS. 6A-6B show the effects of expression of an exemplary exogenous nucleic acid coding for CXCR4 or CCR5 on viral expression of luciferase in tumors.
- FIG. 6A is a graph quantifying the luciferase-mediated photon intensity in the tumors during
- FIG. 6B is a representative picture showing the luminescence signal from the bioluminescence imaging of the mice treated with the viruses on day 1 post injection. All viruses were engineered to express luciferase.
- FIG. 7 shows the effects of expression of an exemplary exogenous nucleic acid coding for CXCR4 or CCR5 on tumor growth.
- the graph quantifies the tumor volume in C57/BL6 mice bearing B 16 tumors subcutaneously over the days post vaccinia virus treatment. The mice were treated with a single dose of a modified vaccinia virus where TK gene was deleted and an exogenous nucleic acid encoding mouse CCR5 was added
- mCCR5/TK- virus a modified vaccinia virus where TK gene was deleted and an exemplary exogenous nucleic acid encoding mouse CXCR4 was added (mCXCR4/TK- virus), or a TK- virus, where TK gene was deleted, or PBS.
- FIGS. 8A-8D show the effects of expression of an exemplary exogenous nucleic acid coding for CCR5 on viral replication in tumors.
- FIG. 8A and FIG. 8B are graphs showing quantification of plaque-forming capability of three different viruses (mCCR5/TK- virus, mCXCR4/TK- virus, and TK- virus) in tumor cell line 4T1, starting at multiplicity of infection of 0.1 (4T1-MOI0.1) and 1 (4T1-MOI1), respectively.
- FIGS. 9A-9C show the effects of B cells depletion on the increased viral expression of luciferase in tumors treated with an exemplary modified vaccinia virus having an exemplary exogenous nucleic acid that codes for CXCR4.
- FIGS. 9C are graphs quantifying the luciferase-mediated photon intensity in tumors measured at 24 h, 48h, and 72 hours post viral injection, respectively.
- Balb/C mice are wild type mice having B cells, while JH mice are B cell-depleted mice.
- the mice were injected with a single dose of a modified vaccinia virus where TK gene was deleted and an exogenous nucleic acid encoding mouse CCR5 was added (mCCR5/TK- virus), a modified vaccinia virus where TK gene was deleted and an exemplary exogenous nucleic acid encoding mouse CXCR4 was added (mCXCR4/TK- virus), or a TK- virus, where TK gene was deleted.
- FIGS. lOA-lOC show the effects of an exemplary modified vaccinia virus having an exemplary exogenous nucleic acid that codes for CXCR4 on B cell accumulation in tumors.
- the mice were treated with a single dose of a modified vaccinia virus where TK gene was deleted and an exemplary exogenous nucleic acid encoding mouse CXCR4 was added (mCXCR4/TK- virus), a TK- virus, where TK gene was deleted, or PBS.
- FIGS. 11A-11B show the effects of an exemplary modified vaccinia virus having an exemplary exogenous nucleic acid coding for CXCR4 on T cell activation.
- FIG. 11A and FIG. 11B are graphs quantifying IFNgamma release by T cells in response to tumor cell 4T1 lysate and inactivated vaccinia virus (VV) mixed with tumor cell 4T1 lysate, respectively.
- VV inactivated vaccinia virus
- T cells were collected from mice bearing 4T1 tumors treated with a single dose of a modified vaccinia virus where TK gene was deleted and an exemplary exogenous nucleic acid encoding mouse CXCR4 was added (mCXCR4/TK- virus), or a TK- virus, where TK gene was deleted, or PBS. T cells were recovered from spleens after 14 days.
- FIGS. 12A-12B show the effects of exemplary modified vaccinia viruses having an exemplary exogenous nucleic acid that encodes hyaluronidase PH-20 or
- FIG. 12A is a representative picture showing the luminescence signal in three BALB/c mice bearing RENCA tumors, which were treated with a single dose of an unmodified vaccinia virus (WR), a modified vaccinia virus having an exemplary exogenous nucleic acid that codes for MMP8 (WR MMP8), or a modified vaccinia virus having an exemplary exogenous nucleic acid that codes for PH-20 (WR PH20 virus), respectively.
- FIG. 12B is a graph quantifying the photon intensity in the mice on day 2 after viral injection.
- FIGS. 13A-13C show the therapeutic effects of an exemplary modified vaccinia virus having an exemplary exogenous nucleic acid that encodes hyaluronidase PH-20.
- FIG. 13A is a graph quantifying the luciferase-mediated photon intensity over the days after the viral injection in BALB/c mice bearing 4T1 tumors treated with either a modified vaccinia virus where the TK gene was deleted (TK-), or a modified vaccinia virus where the TK gene was deleted and which has an exemplary exogenous nucleic acid that codes for PH-20 TK- PH20DCK virus.
- FIG. 13A is a graph quantifying the luciferase-mediated photon intensity over the days after the viral injection in BALB/c mice bearing 4T1 tumors treated with either a modified vaccinia virus where the TK gene was deleted (TK-), or a modified vaccinia virus where the TK gene was deleted and which has an exemplary exogenous nucleic acid that codes for
- FIG. 13B is a graph quantifying the relative tumor volume over the days after the viral injection in mice treated with a PBS, gemcitabine alone, TK- PH20 DCK virus alone, TK- virus alone, TK- virus combined with gemcitabine, or TK-PH20 DCK virus combined with gemcitabine, and FIG. 13C shows the survival curves for these mice.
- FIG. 14 shows the therapeutic effects 45 days after the viral injection of an exemplary modified vaccinia virus having an exemplary exogenous nucleic acid that encodes, in various combinations or individually, hyaluronidase PH-20, and GMCSF.
- the graph quantifies the tumor volume in the mice treated with a control sham, a modified vaccinia virus where the TK gene was deleted and which has an exemplary exogenous nucleic acid that codes for PH-20 (WR.
- TK-PH20 virus where the PH-20 was with or without a GPI- anchor, a modified vaccinia virus where the TK gene was deleted and which has an exemplary exogenous nucleic acid that codes for GMCSF (WR.TK-GMCSF), either intratum orally (IT) or intravenously (IV), 45 days after the viral injection.
- WR.TK-GMCSF exemplary exogenous nucleic acid that codes for GMCSF
- I intratum orally
- IV intravenously
- FIG. 15 shows the effects of an exemplary modified vaccinia virus having a modified VH1 gene on tumor growth.
- the graph quantifies the relative tumor volume in the mice treated with a control sham intravenously (IV), a modified vaccinia virus where the TK gene was deleted and which has an exemplary exogenous nucleic acid that codes for GMCSF (WR.TK-GMCSF) intratumorally (IT), or a modified vaccinia virus where the TK gene was deleted and which has a modified VH1 gene (WR.TK-.VHlmut) intratumorally, over the days after the tumor implantation.
- IV a control sham intravenously
- IT exemplary exogenous nucleic acid that codes for GMCSF
- WR.TK-.VHlmut modified VH1 gene
- FIG. 16 shows the effect of deletion of A52R and insertion of an exogenous nucleic acid encoding mouse CXCR4 on the delivery of modified vaccinia virus to tumors.
- BALB/c mice bearing RENCA tumors subcutaneously were treated with a single intravenous injection (1 x 10 7 PFU) of one of the four modified viruses. Tumors were harvested 24 hours later, and the number of viral genomes per milligram of tissue quantified by qPCR.
- FIG. 17 shows the effect of a modified vaccinia vims having a deletion of A52R and an insertion of an exogenous nucleic acid encoding mouse CXCR4 on tumor growth.
- mice bearing RENCA tumors subcutaneously were treated with intravenous injections (1 x 10 7 PFU) of one of the same four modified viruses on day 1 and 4, and tumor volume was monitored.
- FIGS. 18A-18D show that modified vaccinia viruses having a deletion of TK and an insertion of an exogenous nucleic acid encoding either HysA or MMP8 infect cultures of MC38 cancer cells, replicate, spread, and prevent expansion of the cancer cells.
- MC38 cells were seeded in a 96-well plate at a density of 5 x 10 3 cells per well. The following day, cells were infected with different GFP-expressing viruses at a MOI of 0.002 and imaged using IncuCyte to measure phase confluence (FIG. 18 A), GFP area (FIG. 18B), GFP intensity (FIG. 18C), and virus infectivity (FIG. 18D).
- FIGS. 19A-19D show that modified vaccinia viruses having a deletion of TK and an insertion of an exogenous nucleic acid encoding either HysA or MMP8 infect cultures of HCT116 cancer cells, replicate, spread, and prevent expansion of the cancer cells.
- HCT116 cells were seeded in a 96-well plate at a density of 5 x 10 3 cells per well. The following day, cells were infected with different GFP-expressing viruses at a MOI of 0.002 and imaged using IncuCyte to measure phase confluence (FIG. 19 A), GFP area (FIG. 19B), GFP intensity (FIG. 19C), and virus infectivity (FIG. 19D).
- FIG. 20 shows the effect of expression of HysA on delivery of modified vaccina virus to tumors.
- the viruses used were: (i) the TK-HysA modified virus (ii) the TK-MMP8 modified virus, (iii) the TK-PH20-expressing modified virus, (iv) the TK- modified virus without an exogenous enzyme added, and (v) vehicle formulated buffer (VFB).
- BALB/c mice bearing RENCA tumors subcutaneously were treated with a single intravenous injection (1 x 10 7 PFU) of one of the viruses. Tumors were harvested 24 hours later, and the number of viral genomes per milligram of tissue quantified by qPCR.
- FIG. 21 shows the effect of a modified vaccinia virus having a deletion of TK- and an insertion of an exogenous nucleic acid encoding HysA, MMP8, or PH20 (labeled in FIG. 21 as SPAMl) on tumor growth.
- BALB/c mice bearing RENCA tumors subcutaneously were treated with one intratumoral injection (1 x 10 7 PFU) of the TK-HysA, TK-MMP8, TK- PH20, or TK- modified virus, and tumor volume was monitored.
- FIGS. 22A-22D shows that modified vaccinia viruses having a deletion of TK or A52R and an insertion of an exogenous nucleic acid encoding HysA infect cultures of MC38 and LLC cancer cells, replicate, spread, and prevent expansion of the cancer cells. LLC or MC38 cells were seeded in a 96-well plate at a density of 5 x 10 3 cells per well. The following day, cells were infected with different GFP-expressing viruses at a MOI of 1 and imaged using IncuCyte to measure phase confluence (FIG. 22A and FIG. 22C) and GFP area (FIG. 22B and FIG. 22D)
- FIG. 23 shows that exemplary vaccinia viruses with exemplary mutations to promote NK cell activity show enhanced therapeutic effects in murine tumor models.
- mice bearing RENCA tumors subcutaneously were treated with a single
- FIG. 24 shows that exemplary vaccinia viruses with exemplary mutations to promote NK cell activity show enhanced therapeutic effects in murine tumor models.
- BALB/c mice bearing RENCA tumors subcutaneously were treated with a single intratumoral injection (1 x 10 7 PFU) of TK-LIGHT+, TK-GMCSF+, TK-ITAC+ fractalkine (CX3CL1)+, A52R- IL15+ IL15A+, TK- ITAC+ LIGHT+ A52R- IL15+IL15A+, or a vehicle formulated buffer, termed VFB, and tumor volume was monitored over time.
- VFB vehicle formulated buffer
- FIGS. 25A-25B shows that an exemplary vaccinia virus with exemplary exogenous nucleic acids encoding a chemokine receptor and an extracellular-matrix-degrading enzyme show spread between and killing of cancer cells. LLC cells were seeded in a 96-well plate at a density of 5 x 10 3 cells per well. The next day, cells were infected with different viruses at a MOI of 1 and imaged using IncuCyte to measure phase confluence (FIG. 25A) and GFP area (FIG. 25B)
- FIGS. 26A-26D show that an exemplary modified high EEV-producing vaccinia virus having an exemplary deletion of SCR1 shows spread between and killing of cancer cells.
- a modified HTDJ virus was developed wherein the neutralizing antibody binding site on the surface of the EEV (B5R SCR1) was deleted (IHDJ-B5RcoASCRl).
- MC38 or HCT116 cells were seeded in a 96-well plate at a density of 5 x 10 3 cells per well. The following day, cells were infected with different viruses at a MOI of 0.002 and imaged using IncuCyte to measure phase confluence, as shown in FIG. 26A (MC38 cells) and FIG. 26B (HCT116 cells).
- results of a plaque assay demonstrating the ability of the HTDJ and HfDJ- B5RcoASCRl viruses to spread between and kill cancer cells is shown in FIG. 26C.
- Results of a comet tail assay demonstrating the ability of the WR HTDJ and IHDJ-B5RcoASCRl viruses to spread between and kill cancer cells is shown in FIG. 26D.
- the term “about” or “approximately” can mean within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, e.g., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the given value. Where particular values are described in the application and claims, unless otherwise stated the term “about” should be assumed to mean an acceptable error range for the particular value, such as ⁇ 10% of the value modified by the term "about”.
- the terms "individual,” “patient,” or “subject” can be used interchangeably. None of the terms require or are limited to situation characterized by the supervision (e.g. constant or intermittent) of a health care worker (e.g. a doctor, a registered nurse, a nurse practitioner, a physician's assistant, an orderly, or a hospice worker). In some embodiments, patients, subjects, or individuals can be under the supervision of a health care worker.
- a health care worker e.g. a doctor, a registered nurse, a nurse practitioner, a physician's assistant, an orderly, or a hospice worker.
- patients, subjects, or individuals can be under the supervision of a health care worker.
- heterologous nucleic acid sequence or “exogenous nucleic acid sequence,” or “transgenes,” as used herein, in relation to a specific virus can refer to a nucleic acid sequence that originates from a source other than the specified virus.
- mutation can refer to a deletion, an insertion of a heterologous nucleic acid, an inversion or a substitution, including an open reading frame ablating mutations as commonly understood in the art.
- gene can refer to a segment of nucleic acid that encodes an individual protein or RNA (also referred to as a "coding sequence” or “coding region”), optionally together with associated regulatory regions such as promoters, operators, terminators and the like, which may be located upstream or downstream of the coding sequence.
- mutant virus and “modified virus,” as used interchangeably herein, can refer to a virus comprising one or more mutations in its genome, including but not limited to deletions, insertions of heterologous nucleic acids, inversions, substitutions or combinations thereof.
- naturally-occurring can indicate that the virus can be found in nature, i.e., it can be isolated from a source in nature and has not been intentionally modified.
- inhibiting can include any measurable decrease or complete inhibition to achieve a desired result.
- a "promoter,” as used herein, can be a control sequence that is a region of a nucleic acid sequence at which initiation and rate of transcription are controlled.
- a promoter may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors.
- the terms "operatively positioned,” “operatively linked,” “under control” and “under transcriptional control” can mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence to control transcriptional initiation and/or expression of that sequence.
- a promoter may or may not be used in conjunction with an "enhancer,” which refers to a cis-acting regulatory sequence involved in the transcriptional activation of a nucleic acid sequence.
- the percent homology between the two sequences may be a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the length of a sequence aligned for comparison purposes may be at least about: 30%, 40%, 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 95%, of the length of the reference sequence.
- a BLAST® search may determine homology between two sequences. The homology can be between the entire lengths of two sequences or between fractions of the entire lengths of two sequences.
- the two sequences can be genes, nucleotides sequences, protein sequences, peptide sequences, amino acid sequences, or fragments thereof.
- the actual comparison of the two sequences can be accomplished by well-known methods, for example, using a mathematical algorithm.
- a non-limiting example of such a mathematical algorithm may be described in Karlin, S. and Altschul, S., Proc. Natl. Acad. Sci. USA, 90- 5873-5877 (1993). Such an algorithm may be incorporated into the NBLAST and XBLAST programs (version 2.0), as described in Altschul, S. et al., Nucleic Acids Res., 25 :3389-3402 (1997).
- any relevant parameters of the respective programs can be used.
- Other examples include the algorithm of Myers and Miller, CABIOS (1989), ADVANCE, ADAM, BLAT, and FASTA.
- the percent identity between two amino acid sequences can be accomplished using, for example, the GAP program in the GCG software package (Accelrys, Cambridge, UK).
- subject can refer to an animal, including, but not limited to, a primate (e.g., human), cow, sheep, goat, horse, dog, cat, rabbit, rat, or mouse.
- primate e.g., human
- cow, sheep, goat horse
- dog cat
- rabbit rat
- patient are used interchangeably herein in reference, for example, to a mammalian subject, such as a human subject.
- treat can be meant to include alleviating or abrogating a disorder, disease, or condition; or one or more of the symptoms associated with the disorder, disease, or condition; or alleviating or eradicating the cause(s) of the disorder, disease, or condition itself.
- Desirable effects of treatment can include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishing any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state and remission or improved prognosis.
- terapéuticaally effective amount can refer to the amount of a compound that, when administered, can be sufficient to prevent development of, or alleviate to some extent, one or more of the symptoms of the disorder, disease, or condition being treated.
- therapeutically effective amount can also refer to the amount of a compound that is sufficient to elicit the biological or medical response of a cell, tissue, system, animal, or human that is being sought by a researcher, veterinarian, medical doctor, or clinician.
- pharmaceutically acceptable carrier can refer to a pharmaceutically-acceptable material, composition, or vehicle, such as a liquid or solid filler, diluent, excipient, solvent, or encapsulating material.
- a component can be “pharmaceutically acceptable” in the sense of being compatible with the other ingredients of a pharmaceutical formulation. It can also be suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity, or other problems or complications, commensurate with a reasonable benefit/risk ratio.
- composition can refer to a mixture of a compound disclosed herein with other chemical components, such as diluents or carriers.
- compositions can facilitate administration of the compound to an organism. Multiple techniques of administering a compound exist in the art including, but not limited to, oral, injection, aerosol, parenteral, and topical administration. Pharmaceutical compositions can also be obtained by reacting compounds with inorganic or organic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid,
- methanesulfonic acid methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid and the like.
- An anti-cancer agent can refer to an agent or therapy that is capable of negatively affecting cancer in a subject, for example, by killing cancer cells, inducing apoptosis in cancer cells, reducing the growth rate of cancer cells, reducing the incidence or number of metastases, reducing tumor size, inhibiting tumor growth, reducing the blood supply to a tumor or cancer cells, promoting an immune response against cancer cells or a tumor, preventing or inhibiting the progression of cancer, or increasing the lifespan of a subject with cancer.
- Non-limiting examples of anti-cancer agents can include biological agents (biotherapy), chemotherapy agents, and radiotherapy agents.
- oncolytic can refer to killing of cancer or tumor cells by an agent, such as an oncolytic pox virus, such as an oncolytic vaccinia virus, e.g. , through the direct lysis of said cells, by stimulating immune response towards said cells, apoptosis, expression of toxic proteins, autophagy and shut-down of protein synthesis, induction of anti-tumoral immunity, or any combinations thereof.
- an agent such as an oncolytic pox virus, such as an oncolytic vaccinia virus, e.g.
- the direct lysis of the cancer or tumor cells infected by the agent, such as an oncolytic vaccinia virus can be a result of replication of the virus within said cells.
- the term “oncolytic pox virus such as an oncolytic vaccinia virus
- oncolytic can refer to killing of cancer or tumor cells without lysis of said cells.
- oncolytic virus can refer to a virus that preferentially infects and kills tumor cells. Under certain non-limiting circumstances, it is understood that oncolytic viruses can promote anti-tumor responses through dual mechanisms dependent on not only the selective killing of tumor cells, but also the stimulation of host anti -tumor immune responses.
- the oncolytic viruses can include, but are not limited to, (i) viruses that naturally replicate preferentially in cancer cells and are non-pathogenic in humans often due to elevated sensitivity to innate antiviral signaling or dependence on oncogenic signaling pathways; and (ii) viruses that are genetically-manipulated for use.
- the oncolytic virus can be a measles virus, a poliovirus, a poxvirus, a vaccinia virus, an adenovirus, an adeno associated virus, a herpes simplex virus, a vesicular stomatitis virus, a reovirus, a Newcastle disease virus, a senecavirus, a lentivirus, a mengovirus, or a myxomavir.
- the oncolytic virus can be a pox virus.
- the oncolytic virus can be a vaccinia virus.
- modified oncolytic virus can refer to an oncolytic virus that comprises a modification to its constituent, such as, but not limited to, a modification in the native genome ("backbone") of the virus like a mutation or a deletion of a viral gene, introduction of an exogenous nucleic acid, a chemical modification of a viral nucleic acid or a viral protein, and introduction of a exogenous protein or modified viral protein to the viral capsid.
- oncolytic viruses may be modified (also known as "engineered") in order to gain improved therapeutic effects against tumor cells.
- the modified oncolytic vims can be a modified pox vims.
- the modified oncolytic vims can be a modified pox vims.
- systemic delivery and “systemic administration,” used interchangeably herein, in some cases can refer to a route of administration of medication, oncolytic vims or other substances into the circulatory system.
- the systemic administration may comprise oral administration, parenteral administration, intranasal administration, sublingual
- a modified oncolytic vims that can have one or more modifications that can result in a greater therapeutic effect against tumor cells, as compared to an otherwise identical vims that does not comprises the modifications.
- Some non-limiting examples of the greater therapeutic effect may include each or any combinations of: enhanced immune evasion of the vims, enhanced tumor-targeted systemic delivery of the vims, enhanced intratumoral and intertumoral spreading of the vims, and enhanced tumor- specific replication of the vims.
- the modified oncolytic vims of this disclosure in some instances, can be utilized as a platform vector for systemic delivery.
- a modified oncolytic vims having one or more modifications that can, in some embodiments, result in enhanced immune evasion of the vims, enhanced tumor- targeted systemic delivery of the vims, enhanced intratumoral and intertumoral spreading of the vims, and enhanced tumor-specific replication of the vims.
- a modified oncolytic vims comprising a modification that can enhance immune evasion of the vims.
- Vims infection very often can induce immune responses from the host body against the viral invasion, which may consequently, deplete the inoculated vimses or diminish the toxic effect the vims is expected to produce against the tumor cells in therapeutic settings. Appropriate immune evasion therefore may significantly increase the efficacy of the therapeutic application of oncolytic vimses.
- a modified oncolytic vims comprising a modification that can enhance tumor-targeted systemic delivery of the vims.
- oncolytic vimses can be either be (a) administered systemically or (b) inoculated topically over the tumor or, in many cases, injected directly into the tumor ("intratumoral delivery"). It is believed that systemic delivery of the oncolytic vims can afford the opportunity to treat both the primary tumor and any overt or undiagnosed metastatic deposits simultaneously.
- this method of delivery can be a very attractive option for the treatment of patients with advanced/metastatic disease or patients with inaccessible disease such as those with pancreatic cancer or brain cancer, where access is difficult for example due to physiological barriers, such as blood-brain barrier.
- barriers can exist for successful systemic delivery of many oncolytic viruses.
- host defense limits most oncolytic viruses' ability to infect tumors after systemic administration.
- Blood cells, complement, antibodies, and antiviral cytokines, as well as nonspecific uptake by other tissues such as the lung, liver and spleen, tissue-resident macrophages, and additionally poor virus escape from the vascular compartment are among the main barriers to systemic delivery of oncolytic viruses.
- the oncolytic virus may need to persist in the circulation without depletion or degradation while selectively infecting tumor cells.
- disclosed oncolytic viruses can comprise a modification that can promote the persistent existence of the virus in the circulation system, at least through, as abovementioned, enhancement of immune evasion.
- enhanced tumor-targeted delivery of the virus can also be desirable under certain circumstances, as it may not only increase therapeutic efficacy against cancer, but may also alleviate the safety concerns around virus-mediated oncotherapy as the non-tumor infection can be limited, avoiding the undesired side effects of viral infection.
- Certain embodiments herein relate to an oncolytic virus comprising a modification that can promote the tumor-targeted delivery of the virus.
- a modified oncolytic virus comprising a modification that can enhance intratumoral and intertumoral spreading of the virus.
- Enhanced spreading of the oncolytic virus within and between tumors may be an effective manner to boost the therapeutic efficacy by increasing the number of the cancer cells that are infected by the virus.
- a modified oncolytic virus comprising a modification that can enhance tumor-specific replication of the virus.
- a modified oncolytic virus that can comprise an exogenous nucleic acid.
- a modified oncolytic virus that can comprise a modification to in the genome of the virus.
- a modified oncolytic virus that can comprise an exogenous nucleic acid as well as a modification in the genome of the virus.
- a modified oncolytic virus comprising an exogenous nucleic acid, also referred to herein as a transgene, that can code for a chemokine receptor.
- the exogenous nucleic acid can be a therapeutic transgene.
- a modified oncolytic virus comprising an exogenous nucleic acid that can code for a membrane associated protein that can degrade hyaluronan, such as a hyaluronidase.
- a modified oncolytic virus comprising exogenous nucleic acids that can code for both a chemokine receptor and a hyaluronidase.
- Chemokines are chemotactic cytokines that regulate the trafficking and positioning of cells by activating the seven-transmembrane spanning chemokine receptors.
- chemokines can be divided into four subfamilies based on the position of the first two N-terminal cysteine residues, including the CC, CXC, CX3C and XC subfamilies.
- chemokine receptors on leukocytes may result in selective recruitment of specific cell types under particular conditions, providing appropriate and efficient immune responses tailored to the infecting pathogen or foreign insult. Beyond their pivotal role in the coordinated migration of immune cells to the site of inflammation, in many cases, chemokines may also play important roles in the development of lymphoid tissues, in the maturation of immune cells, and in the generation and delivery of adaptive immune responses.
- Tumors are increasingly recognized as a complex microenvironment made up of many different cell types that cohabit and communicate with each other in a complicated signaling network.
- Chemokines are essential coordinators of cellular migration and cell-cell interactions and therefore have great impact on tumor development. In the tumor
- chemokines in many cases, are also involved in other tumor-related processes, including tumor cell growth, angiogenesis and metastasis.
- Tumor cells have been shown to acquire the ability to produce growth-promoting chemokines.
- melanoma has been found to express a number of chemokines, including CXCL1, CXCL2, CXCL3, CXCL8, CCL2 and CCL5, which have been implicated in tumor growth and progression.
- CCL2 level can be found increased in neuroblastoma cell lines and primary tumor cells isolated from human patients.
- Immunostaining studies also suggest an elevated expression level of CXCL12 in a variety of cancers, including breast cancer, carcinoid, cervical cancer, colorectal cancer, endometrial cancer, liver cancer, lung cancer, lymphoma, melanoma, ovarian cancer, pancreatic cancer, prostate cancer, stomach cancer.
- Chemokine receptors are cytokine receptors found on the surface of certain cells that interact with chemokines. There have been 20 distinct chemokine receptors discovered in humans. Each has a 7-transmembrane structure and couples to G-protein for signal transduction within a cell, making them members of a large protein family of G protein- coupled receptors. Following interaction with their specific chemokine ligands, chemokine receptors may trigger a flux in intracellular calcium (Ca 2+ ) ions (calcium signaling). This may cause cell responses, including the onset of a process known as chemotaxis that traffics the cell to a desired location within the organism.
- the term "chemokine receptor” as used herein can refer to a membrane associated protein that selectively binds to a chemokine ligand and induces the chemotaxis toward the chemokine ligand.
- the chemokine receptor as disclosed herein in some cases can refer to not only the naturally occurring chemokine receptors identified in human bodies, but also include chemokine receptors from other sources, such as, but not limited to: (1) naturally occurring chemokine receptors identified in animals, like pigs, dogs, cows, sheep; (2) non- naturally occurring chemokine receptors, like mutant proteins, chimeric receptors, design proteins with binding affinity to a certain type(s) of chemokines.
- a fragment of a naturally occurring chemokine receptor can be also considered a chemokine receptor, if the function of binding and responding to the corresponding chemokine and directing the chemotaxis of the cell is retained in the fragment.
- the virus that comprises the exogenous nucleic acid coding for the chemokine receptor may force a virus-infected cell to express the chemokine receptor as the virus hijacks the host cell' s gene expression machinery.
- the modified oncolytic viruses can comprise exogenous nucleic acid that can code for a cytokine receptor whose cognate cytokine can be expressed in tumor microenvironments (e.g., IL15-R can have a cognate cytokine IL15 expressed in a tumor microenvironment).
- the modified oncolytic viruses can express selected chemokine receptors whose cognate chemokines are likely to be expressed on tumors (e.g., CXCR4 can have a cognate chemokine CXCL12 expressed on a tumor; CCR2 can have a target CCL2 expressed on a tumor) and can be delivered systemically as a naked virus.
- the viruses can infect lymphocytes, such as B -cells, and can re-direct the infected B- cells to the tumor, resulting in significantly increased viral load in the tumor.
- the increased viral load in the tumor can be achieved soon after the systemic delivery.
- Ability to deliver the modified oncolytic viruses disclosed herein, in a systemic manner can provide an advantage over traditional intratumoral delivery methods for oncolytic viruses. While intratumoral delivery can be helpful in treating easily accessible tumors, in some instances, it is critical to treat inaccessible or metastatic cancer which is allegedly the predominant cause of death from the disease.
- Chemokine receptors can be divided into different families. Non-limiting examples of chemokine receptors, as described herein can include CXC chemokine receptors, CC chemokine receptors, CX3C chemokine receptors and XC chemokine receptors that correspond to the 4 distinct subfamilies of chemokines they bind.
- CXCR1 and CXCR2 are closely related, while CXCR1 binds to CXCL8 and CXCL6, and CXCR2 binds to CXCL1 and CXCL7; CXCR3 binds to CXCL9, CXCL10, and CXCL11; CXCR4 binds to CXCL12 (or SDF-1); CXCR5 binds to CXCL13; CXCR6 binds to CXCL16.
- CCRl 's ligands include CCL4, CCL5, CCL6, CCL14, CCL15, CCL16, CCL23;
- CCR2's ligands include CCL2, CCL8, and CCL16;
- CCR3's ligands include CCLl l, CCL26, CCL7, CCL13, CCL15, CCL24, CCL5, CCL28, and CCL18;
- CCR4's ligands include CCL3, CCL5, CCL17, and CCL22;
- CCR5's ligands include CCL3, CCL4, CCL5, CCL8, CCLl l, CCL13, CCL14, and CCL16;
- CCR6's ligands include CCL20;
- CCR7's ligands include CCL19 and CCL21.
- CX3C chemokine receptor CX3CR1 has a ligand CXCL1.
- XC chemokine receptor XCR1 binds to both XCL1 and XCL2.
- Non-limiting embodiments of the present disclosure provide a modified oncolytic virus that comprises an exogenous nucleic acid that can code for a chemokine receptor.
- the chemokine receptor can be a CXC chemokine receptor, a CC chemokine receptor, a CX3C chemokine receptor, a XC chemokine receptor, or any combinations thereof.
- the chemokine receptor can be CXCR1, CXCR2, CXCR2, CXCR3, CXCR4, CXCR5, CXCR6, CXCR7, CCR1, CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, CX3CR1, XCR1, or any combinations thereof.
- the modified oncolytic virus comprises an exogenous CXCR4-expressing nucleic acid.
- the modified oncolytic virus comprises an exogenous CCR2-expressing nucleic acid.
- Certain embodiments disclose a modified oncolytic virus comprising an exogenous nucleic acid that codes for both CXCR4 and CCR2, and both chemokines are expressed form the same virus.
- CXCL12 and/or CCL2 typically expressed in the tumor microenvironment may attract the CXCR4 and/or CCR2-expressing lymphocytes or other migrating cells that are infected by the modified oncolytic virus, thereby enhancing the tumor-targeted delivery of the modified oncolytic virus.
- the modification of the oncolytic virus can result in at least about 1.1, 1.2, 1.5, 1.8, 2, 2.2, 2.5, 2.8, 3, 3.2, 3.5, 3.8, 4, 4.2, 4.5, 4.8, 5, 5.2, 5.5, 5.8, 6, 6.2, 6.5, 6.8, 7, 7.2, 7.5, 7.8, 8, 8.2, 8.5, 8.8, 9, 9.2, 9.5, 9.8, 10, 12, 14, 15, 16, 18, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 500, 800, 1000, 2500, 5000, 10 4 , 2.5 x 10 4 , 5 x 10 4 , 7.5 x 10 4 , 2.5 x 10 5 , 5 xlO 5 , 7.5 xlO 5 , 10 6 , 2.5 xlO 6 , 5 xlO 6 , 7.5 xlO 6 , 10 7 , 2.5 x 10 7 , 5 x 10 7 , 5 x 10 7
- the efficacy of tumor-targeted systemic delivery of the virus can be measured by quantifying the viruses infecting the tumor cells, and optionally, in contrast with the viruses infecting non-tumor cells in the body.
- the quantification of the virus can be performed by staining the viral particles in tissue sections, or blood smear in the cases of leukemia, lymphoma, or myeloma.
- such quantification can be performed by reporter molecule(s) that is/are engineered to be expressed by the viruses, e.g., luciferase, and fluorescent proteins.
- such quantification can be performed by quantifying the viral genome in the tumor.
- the oncolytic virus comprises an exogenous nucleic acid that can code for CXCR4, CCR2, or both, and the presence of the exogenous nucleic acid can result in about 5 to 10 folds increase in the efficacy of tumor-target systemic delivery of the virus, as compared to an otherwise identical oncolytic virus that does not comprise the exogenous nucleic acid.
- a modified oncolytic virus that comprises an exogenous nucleic acid that can code for a chemokine receptor, and the forced expression of chemokine receptor by the modified oncolytic virus can result in boosted immune responses against the infected tumor.
- the modified oncolytic viruses can replicate in the tumor cells and result in the expression of the chemokine receptors on the surface of the tumor cells.
- These membrane receptors may function as decoy receptors, binding and sequestering the immunosuppressive chemokines within the tumor (e.g., CXCL12 and/or CCL2).
- the immunosuppressive microenvironment in the tumor can be altered, leading to enhanced immunotherapeutic activity of the modified oncolytic virus, as compared to an otherwise identical virus that does comprise the nucleic acid coding for the chemokine receptor.
- immunotherapeutic activity can be at least about 1.1, 1.1, 1.2, 1.5, 1.8, 2, 2.2, 2.5, 2.8, 3, 3.2, 3.5, 3.8, 4, 4.2, 4.5, 4.8, 5, 5.2, 5.5, 5.8, 6, 6.2, 6.5, 6.8, 7, 7.2, 7.5, 7.8, 8, 8.2, 8.5, 8.8, 9, 9.2, 9.5, 9.8, 10, 12, 14, 15, 16, 18, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 500, 800, 1000, 2500, 5000, 10 4 , 2.5 x 10 4 , 5 x 10 4 , 7.5 x 10 4 , 2.5 x 10 5 , 5 x 10 5 , 10 6 or even higher folds.
- the increased immunotherapeutic activity can be reflected by increased B cell accumulation in the tumor, increased T cell response to tumor-related immunogens, or both.
- B cell accumulation can be measured, for example, by quantifying the B cells in the tumor, and T cell immuno-activity may be measured by, for example, interferon- ⁇ (interferon-gamma) secretion in ELISPOT assays.
- interferon- ⁇ interferon-gamma
- a modified oncolytic virus that comprises an exogenous nucleic acid that can code for a chemokine receptor, and the forced expression of chemokine receptor by the modified oncolytic virus can result in increased replication of the virus in tumor cells, as compared to an otherwise identical virus that does not comprise the nucleic acid coding for the chemokine receptor.
- the modified oncolytic virus can comprise an exogenous CCR2-expressing nucleic acid, which can increase the tumor-specific replication of the virus.
- the modified oncolytic virus can comprise an exogenous CCR5-expressing nucleic acid, which can increase the tumor-specific replication of the virus.
- the increase in tumor-specific replication can be at least about 1.1, 1.1, 1.2, 1.5, 1.8, 2, 2.2, 2.5, 2.8, 3, 3.2, 3.5, 3.8, 4, 4.2, 4.5, 4.8, 5, 5.2, 5.5, 5.8, 6, 6.2, 6.5, 6.8, 7, 7.2, 7.5, 7.8, 8, 8.2, 8.5, 8.8, 9, 9.2, 9.5, 9.8, 10, 12, 14, 15, 16, 18, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 500, 800, 1000, 2500, 5000, 10 4 , 2.5 x 10 4 , 5 x 10 4 , 7.5 x 10 4 , 2.5 x 10 5 , 5 x 10 5 , 10 6 or even higher folds.
- Exemplary methods for measuring the increase in viral delivery and spread in tumors can include, but are not limited to, fluorescence or
- bioluminescence based imaging of expression of a reporter gene quantitative PCR for detection of tumor concentrations of viral genomes or plaque determination of plaque forming units or immunohistochemistry of viral proteins.
- the modified oncolytic virus comprises an exogenous nucleic acid that can code for a chemokine receptor that is a chimeric protein. At least part of its extracellular domain can be from a chemokine receptor that promotes the tumor-targeted delivery of the virus, and at least part of its intracellular domain can be from a chemokine receptor that promotes the tumor-specific replication, inhibits immunosuppressive activity, or conveys some other beneficial effects, or vice versa.
- the modified oncolytic virus can comprise a nucleic acid that codes for a protein having an intracellular GTPase domain of CCR5, and an extracellular chemokine-binding domain of CXCR4 or CCR2.
- the modified oncolytic virus can comprise exogenous nucleic acids that can code for at least one chemokine receptor.
- the modified oncolytic virus can comprise exogenous nucleic acids that can code for two or more different chemokine receptors, which may be expressed simultaneously by the virus.
- Exemplary chemokine receptors that can be expressed simultaneously from the modified oncolytic viruses described herein can include CXCR4 and CCR2.
- modified oncolytic viruses expressing more than one chemokine receptors a combinatorial or synergistic effect against tumor cells may be achieved as to the therapeutic application of the oncolytic virus.
- therapeutic effects of oncolytic viruses can often be limited by their ineffective spreading in and between the solid tumors, at least in part due to the high amounts of extracellular matrix (ECM) and high interstitial fluid pressure (IFP) that exist in tumor.
- ECM extracellular matrix
- IFP interstitial fluid pressure
- Certain embodiments of the present disclosure relate to a modified oncolytic virus that comprises an exogenous nucleic acid that can code for a protein that degrades ECM of a tumor.
- Exemplary proteins that can degrade ECM can be a membrane associated protein.
- the membrane associated protein can comprise a glycosylphosphatidylinisotol (GPI) anchor.
- Hyaluronan is an important structural element of ECM and a high molecular weight linear glycosaminoglycan consisting of repeating disaccharide units. It can be distributed widely throughout connective, epithelial, and neural tissues, and its expression level can be significantly elevated in many types of tumors.
- Hyaluronidases are a family of enzymes that catalyze the degradation of HA. There are at least five functional
- hyaluronidases identified so far in human: HYALl, HYAL2, HYAL3, HYAL4 and HYAL5 (also known as PH-20 or SPAMl), among which PH-20 is the only one known so far to be functional at relatively neutral pH.
- combining hyaluronidase with other tumor-targeting therapeutic agents can promote the therapeutic effect of the modified oncolytic virus at least by diminishing the ECM and enhancing the transportation of the therapeutic agent inside and between the tumors.
- a modified oncolytic virus that can comprise an exogenous nucleic acid coding for a membrane associated protein that is capable of degrading hyaluronan, such as a hyaluronidase. It should be noted that the term
- hyaluronidase as used herein can refer to any enzyme or a fragment thereof that catalyzes the degradation of HA in a tumor, including, but not limited to, PH-20 and its homologs from other species, as well as other engineered/design proteins with similar enzymatic function. As used herein, hyaluronidase can refer to a class of hyaluronan degrading enzymes.
- Hyaluronidases can include bacterial hyaluronidases (EC 4.2.2.1 or EC 4.2.99.1),
- Hyaluronidases from leeches, other parasites, and crustaceans (EC 3.2.1.36), and mammalian- type hyaluronidases (EC 3.2.1.35).
- Hyaluronidases can be of any non-human origin including, but not limited to, murine, canine, feline, leporine, avian, bovine, ovine, porcine, equine, piscine, ranine, bacterial, and any from leeches, other parasites, and crustaceans.
- Exemplary non-human hyaluronidases include, hyaluronidases from cows, yellow jacket wasp, honey bee, white-face hornet, paper wasp, mouse, pig, rat, rabbit, sheep, chimpanzee, Rhesus monkey, orangutan, cynomolgus monkey, guinea pig, Arthrobacter sp. (strain FB24), Bdellovibrio bacteriovorus, Propionibacterium acnes, Streptococcus agalactiae,
- Staphylococcus aureus strain MRSA252, Streptococcus pneumoniae, Streptococcus pyogenes, Streptococcus suis, Vibrio fischeri, and the Streptomyces hyaluronolyticus hyaluronidase enzyme, which is specific for hyaluronic acid and does not cleave chondroitin or chondroitin sulfate.
- the modified oncolytic virus can comprise an exogenous nucleic acid that can code for PH-20.
- the modified oncolytic virus can comprise an exogenous nucleic acid that can code for PH-20, and the PH-20 can comprise a GPI-anchor.
- the modified oncolytic virus can comprise an exogenous nucleic acid that can code for PH-20, and the PH-20 may lack a GPI-anchor.
- GPI can function as an anchor of the protein to a cell membrane, therefore, generally, GPI- containing PH-20 may be anchored to the cell membrane, while PH-20 that does not have GPI may be in secretory form.
- exemplary amino acid sequences for the PH-20 can be SEQ ID NO: 36, SEQ ID NO: 130, or sequences that can be about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identical to SEQ ID NO: 36 or SEQ ID NO: 130.
- the present disclosure identifies that retention of the C-terminal GPI anchor, unexpectedly, improves the spread of oncolytic viruses expressing the GPI-anchor containing PH-20, within a tumor microenvironment.
- the modified oncolytic virus comprising an exogenous nucleic that can code for a GPI-anchored PH-20 can unexpectedly degrade tumor ECM and promote viral spreading to a greater extent, as compared to an otherwise identical virus that can comprise an exogenous nucleic acid that can code for a PH- 20 lacking a GPI-anchor.
- the modified oncolytic virus can comprise nucleic acids that can code for both a GPI-anchored PH-20 and secretory PH-20 without the GPI-anchor.
- expression of the GPI-anchored PH-20 from the modified oncolytic vaccinia virus can have at least one of the following effect: (i) the PH-20 can be incorporated into the EEV outer envelope, and thereby may allow the EEV to spread more effectively, (ii) the viral infection may result in movement of infected cells, which may be enhanced if they express PH20 on their surface.
- Some embodiments of this disclosure identify that the secreted form of the PH-20, without the GPI-anchor can be less active in promoting production of the EEV form of the virus.
- hyaluronidase-encoding nucleic acid can be derived from other sources than human beings.
- Hyaluronidases in different species can hydrolyze tumor HA in different manners, with different efficiencies, combinations thereof.
- Some embodiments herein relate to a modified oncolytic virus that can comprise an exogenous nucleic acid coding for multiple hyaluronidases from different species. The combination may provide a greater ECM degrading capability and subsequently lead to enhanced therapeutic effects.
- the oncolytic virus can comprises an exogenous nucleic acid that can code for a hyaluronidase of microbial origin.
- the hyaluronidase of microbial origin can be HysA from Staphylococcus aureus, lin from Loxosceles intermedia, sko from Streptomyces koganeiensis, rv from Mycobacterium tuberculosis.
- the hyaluronidase of microbial origin can be a secreted hyaluronidase.
- the exogenous nucleic acid hysA can comprise a sequence as set forth in GenBank: CP020020.1, ⁇ Staphylococcus aureus subsp. aureus strain ATCC 6538
- the exogenous nucleic acid hysA can code for a protein that comprises an amino acid sequence as set forth in SEQ ID NO: 122. In some cases, the exogenous nucleic acid hysA can code for a protein that comprises an amino acid sequence as set forth in UniProtKB Accession No. Q59801 (HYAS STAA8) (SEQ ID NO: 123). In some embodiments, expression of a secreted hyaluronidase, such as HysA, enhances replication, spread, therapeutic activity ⁇ e.g., cancer cell killing potential) of a modified oncolytic virus as described herein.
- the exogenous nucleic acid lin can code for a protein that comprises an amino acid sequence as set forth in SEQ ID NO: 124 or SEQ ID NO: 127.
- the exogenous nucleic acid rv can code for a protein that comprises an amino acid sequence as set forth in SEQ ID NO: 125 or SEQ ID NO: 128.
- the exogenous nucleic acid sko can code for a protein that comprises an amino acid sequence as set forth in SEQ ID NO: 126 or SEQ ID NO: 129.
- exemplary amino acid sequences for the microbial hyaluronidase can be SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128, or SEQ ID NO: 129, or sequences that can be about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identical to S SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128, or SEQ ID NO: 129.
- the modified oncolytic virus can comprise exogenous nucleic acids that can code for both a hyaluronidase and a matrix metalloprotease.
- matrix metalloproteases are capable of degrading all kinds of ECM proteins.
- the addition of a matrix metalloprotease may further enhance the ECM degradation effect and promote virus spreading.
- matrix metalloproteases can be MMP8.
- the modified oncolytic virus that comprises the nucleic acid that can code for a hyaluronidase may have increased virus spreading in and between tumors as compared to an otherwise identical virus that does not comprise the hyaluronidase- encoding nucleic acid.
- such increase can be at least about 1.1, 1.1, 1.2, 1.5, 1.8, 2, 2.2, 2.5, 2.8, 3, 3.2, 3.5, 3.8, 4, 4.2, 4.5, 4.8, 5, 5.2, 5.5, 5.8, 6, 6.2, 6.5, 6.8, 7, 7.2, 7.5, 7.8, 8, 8.2, 8.5, 8.8, 9, 9.2, 9.5, 9.8, 10, 12, 14, 15, 16, 18, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 500, 800, 1000, 2500, 5000, 10 4 , 2.5 x 10 4 , 5 x 10 4 , 7.5 x 10 4 , 2.5 x 10 5 , 5 x 10 5 , 10 6 or even higher folds.
- the modified oncolytic virus comprises an exogenous nucleic acid coding PH-20
- the viral spreading within tumor can be increased at least about 100 folds, as compared to an otherwise identical virus that does not comprise the PH-20-encoding nucleic acid.
- Exemplary methods for measuring the increase in viral spread can include, but are not limited to, fluorescence or bioluminescence based imaging of expression of a reporter gene, quantitative PCR for detection of tumor concentrations of viral genomes or plaque determination of plaque forming units or immunohistochemistry of viral proteins.
- VHl is a viral protein, identified as a dual specificity phosphatase against both phosphoserine- and phosphotyrosine-containing substrates.
- VHl can inhibit phosphorylation and nuclear translocation of STAT1, a transcription factor responsive to a number of immune factors, such as interferon alpha and interferon gamma, suppressing immune response against virus-infected cells, at least in part through reduction in antigen presentation. More active VHl expressed by the virus may have better immunosuppressive effect as to the virus-infected cells.
- the modified oncolytic virus can comprise an exogenous nucleic acid that can code for a viral VHl protein.
- the exogenous nucleic acid coding for the viral VHl protein can be from a genome of poxvirus that is a different species than the modified oncolytic virus.
- the poxvirus can comprise a betaentomopoxvirus, a yatapoxvirus, a cervidpoxvirus, a gammaentomopoxvirus, a leporipoxvirus, a suipoxvirus, a molluscipoxvirus, a crocodylidpoxvirus, an
- the modified oncolytic virus can comprise a partial or a complete deletion of the native VHl gene, and can comprise an exogenous VHl -encoding nucleic acid.
- the VHl protein can also be a chimeric/fusion protein that has components from different species, artificially designed/engineered, or only a functional fragment of a naturally occurring VHl protein that can retains the phosphatase activity.
- the VHl protein encoded by the exogenous nucleic acid may be more active than the native VHl protein of the backbone oncolytic virus.
- the modified oncolytic virus can comprise a vaccinia virus, wherein its native VHl gene can be deleted from the genome, and a VHl gene from other poxviruses can be inserted in its genome.
- a more active VHl protein may lead to a lower toxicity of the virus.
- it may lead to a greater therapeutic benefit, at least partially due to the adaptive immune response more actively targeting the tumor antigens, and less potently targeting viral antigens.
- the modified oncolytic virus can comprise an exogenous nucleic acid that can code for a therapeutic protein.
- therapeutic proteins that can be coded by the exogenous nucleic acid contained with the modified oncolytic vaccinia virus described herein, can include, but are not limited to, antibodies or antigen binding fragments thereof, cytokines, growth factors, peptide hormones, cytokines, coagulation factors, plasma proteins, fusion proteins.
- the modified oncolytic virus can comprise an exogenous nucleic acid that codes for proteins or fragment thereof that are immune checkpoint inhibitors, T-cell activators, therapeutic nanobodies, chemokines and immune activators, prodrug converting enzymes, directly cytotoxic compounds, or any combinations thereof.
- proteins or fragment thereof that are immune checkpoint inhibitors, T-cell activators, therapeutic nanobodies, chemokines and immune activators, prodrug converting enzymes, directly cytotoxic compounds, or any combinations thereof.
- Each or any combinations of these proteins may contribute to a greater therapeutic benefit of the backbone oncolytic virus.
- the exogenous nucleic acid in some cases, can code for a transgene comprising a humanized anti-CD20 monoclonal antibody (e.g., Gazyva), a VEGFR Fc-fusion (e.g., Eylea), a CTLA-4 Fc-fusion (e.g., Nulojix), a glucagon-like peptide-1 receptor agonist Fc-fusion (e.g., Trulicity), VEGFR Fc-fusion (e.g., Zaltrap), a recombinant factor IX Fc fusion (e.g., Alprolix), a recombinant factor VIII Fc-fusion (e.g., Eloctate), a GLP-1 receptor agonist- albumin fusion (e.g., Tanzeum), a recombinant factor IX albumin fusion (e.g., Idelvion), a PEGylated IFNP-la (e.g., Plegridy),
- the modified oncolytic virus can comprise an exogenous nucleic acid coding for a protein or a fragment thereof that: can modulate FKB signaling, can promote reduction of interstitial fluid pressure (IFP) in a tumor, can modulate ST AT3 -mediated gene activation, can promote T cell activation, can promote attraction of K cells to virus-infected cells, can modulate metabolic program of virus-infected cells, can modulate fatty acid uptake by virus-infected cells, can promote therapeutic targeting of MDSCs, or any combinations thereof.
- FKB signaling can promote reduction of interstitial fluid pressure (IFP) in a tumor
- IFP interstitial fluid pressure
- ST AT3 -mediated gene activation can promote T cell activation
- can promote attraction of K cells to virus-infected cells can modulate metabolic program of virus-infected cells
- can modulate fatty acid uptake by virus-infected cells can promote therapeutic targeting of MDSCs, or any combinations thereof.
- the modified oncolytic virus can comprise an exogenous nucleic acid that can code for at least one of FDVIGB l, PIAS3, IL15, CCL5, a fragment thereof, or any combinations thereof. Each or any combinations of these proteins may contribute to a greater therapeutic benefit of the backbone oncolytic virus.
- the modified oncolytic virus can comprise an exogenous nucleic acid that codes for a fractalkine (such as CX3CL1), ITAC (such as CXCL1 1), LIGHT (such as tumor necrosis factor superfamily member 14, or TNFSF 14), a fragment thereof, or any combinations thereof.
- fractalkine such as CX3CL1
- ITAC such as CXCL1 1
- LIGHT such as tumor necrosis factor superfamily member 14, or TNFSF 14
- TNFSF 14 tumor necrosis factor superfamily member 14
- the immune checkpoint inhibitors can refer to inhibitors of immune checkpoint molecules such as, but not limited to, PD-1, PD-L1, PD-L2, CTLA4, TEVI-3, LAG-3, CEACAM-1, CEACAM-5, VISTA, BTLA, TIGIT, LAIR1, CD 160, 2B4, TGFR-beta, and any combinations thereof.
- immune checkpoint molecules such as, but not limited to, PD-1, PD-L1, PD-L2, CTLA4, TEVI-3, LAG-3, CEACAM-1, CEACAM-5, VISTA, BTLA, TIGIT, LAIR1, CD 160, 2B4, TGFR-beta, and any combinations thereof.
- the T-cell activators can include, but not limited to, interleukin-1, interleukin-2, interleukin-4, interleukin-5, interleukin-6, interleukin-7, interleukin-1 1, interleukin-12, interleukin-13, interleukin-15 (IL15/IL-15), IL15-a (IL15- alpha), IL15-receptor (IL15-R), IL15-Ra (IL 15 -receptor alpha), interferon-alpha, interferon- gamma, tumor necrosis factors, anti-CD3 antibodies, anti-CD28 antibodies, anti-CTLA4 antibodies, anti-TGF-beta antibodies, anti-4-lBB antibodies, cell-based vaccines peptide vaccines, DNA vaccines, growth factors, phytohemagglutinin, concanavalin-A, phorbol esters, and any combinations thereof.
- IL15/IL-15 interleukin-15
- IL15-a IL15- alpha
- the therapeutic nanobody can refer to an antibody fragment consisting of a single monomelic variable antibody domain and having therapeutic effects against a tumor cell or a tumor.
- the other cytokines, chemokines, and immune activators can refer to any other proteins belonging to the corresponding category that may have therapeutic effects against a tumor cell or a tumor.
- the prodrug converting enzyme can refer to an enzyme that converts a molecule with less activity against a target into a molecule with more activity against a target.
- the target can be a tumor cell or a tumor.
- the prodrug converting enzyme can include, but not limited to, cytosine deaminase, uracil
- phosphoribosyltransferase thymidine kinase, and any combinations thereof.
- the directly cytotoxic compounds can refer to any molecules that are directly cytotoxic to the tumor cell without effecting through other cells or compounds.
- the directly cytotoxic compound can include, but not limited to, proteins, peptides, mRNAs, or oligomers that may be expressed from the exogenous nucleic acids that are added to the modified oncolytic virus.
- the modified oncolytic virus can comprise one or more of exogenous nucleic acids described above, that can code for proteins, as described above, wherein the proteins can be the full-length proteins, truncated versions of the full-length proteins, functional domains of the full-length proteins, fragments of the full-length proteins, or variants of the full-length proteins, truncated versions, functional domains, or fragments.
- Variants can comprise, in some examples, amino acid substitutions (conservative or non- conservative), deletions, additions, modifications, or any combinations thereof.
- Some embodiments of this disclosure can include a modified oncolytic virus that can comprise a modification in the genome of the virus.
- the modified oncolytic virus can comprise at least one modification in the genome of the virus.
- the modified oncolytic virus can comprise at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, or even more modifications in the genome of the virus.
- the modification of the viral genome can comprise a mutation, a deletion, or both of a viral gene.
- a deletion of a viral gene may include a partial or a complete deletion of the viral gene.
- "partial deletion” or “mutation” may refer to an in situ partial deletion or mutation of an endogenous viral gene, respectively. Alternatively, they may refer to replacing the endogenous viral gene with an otherwise identical exogenous nucleic acid that lacks a portion of the gene (“partial deletion") or has one or more nucleotide change in the gene (“mutation”).
- vaccinia virus which is a large DNA virus that may replicate entirely within the cytoplasm of an infected cell.
- vaccinia virus has a complex morphogenic pathway that culminates in the formation of two distinct infectious virions that are surrounded by different numbers of membranes.
- the first virion produced which is called intracellular mature virus (EVIV)
- EVIV intracellular mature virus
- the other virion is surrounded by a second membrane and is exported from the cell before cell death.
- This virion is called cell-associated enveloped virus (CEV) if it is retained on the cell surface and extracellular enveloped virus (EEV) if it is released from the cell surface.
- CEV cell-associated enveloped virus
- EEV extracellular enveloped virus
- the second membrane of the virion in its EEV form may significantly reduce the virus' sensitivity to neutralizing antibodies and complement that exist in the circulating system and other tissue environments, as compared to single membrane-wrapped EVIV.
- administration of EEV may make it easier for the virus to spread within and between tumors, thereby increasing the chance of infecting tumor cells. Therefore, increasing the production of EEV may result in greater therapeutic benefits when oncolytic viruses, such as poxviruses, e.g., oncolytic vaccinia viruses, other oncolytic poxviruses, or other similar viruses are used at clinical settings.
- Some embodiments herein disclose a modified oncolytic virus that can comprise a modification in the viral genome that can enhance production of the EEV form of the virus and thereby the spreading of the virus within and between tumors.
- the modified oncolytic virus can comprise a modification in the viral B5R gene, provided that said modification is not in the SCR2 domain.
- the B5R protein includes the following regions: (Signal peptide)-(Short Consensus Repeat (SCR) regions 1 to 4 (Transmembrane domain)-(Cytoplasmic Tail).
- SCR1 domain can contain a neutralizing antibody epitope found on the EEV.
- SCR3 can contain a P189S mutation site that can result in increased EEV release.
- a modified oncolytic virus of this disclosure in some examples, can comprise modifications in at least one of the SCR1, SCR3 and SCR4 domains of the B5R gene.
- the modification can be a partial deletion of the B5R gene.
- the modification of the B5R gene e.g., deletions in the SCR3 and SCR4 domains, can, at least partially, disrupt binding of neutralizing antibodies to B5R.
- a modified oncolytic virus according to this disclosure can be at least partially resistant to neutralization.
- B5R SCR regions are also included in this disclosure, such that the modified oncolytic viruses may be optimized for EEV release, replication and antibody evasion.
- the B5R mutations e.g., removal of antibody binding site in B5R SCR1
- other EEV enhancing mutations e.g., random mutagenesis in A34R. In some cases, such combinations of modifications can result in increased EEV production.
- the modification comprises a deletion or mutation in B5R.
- the deletion may be a complete or partial deletion.
- the modified oncolytic virus can comprise a modification in the viral gene B5R, F13L, A36R, A34R, A33R, or any combinations thereof that increases production of EEV.
- the modified oncolytic virus can comprise one or more of the following mutations: partial deletion of A33R, A34R Lysl51 to Glu (K 151 E); complete or partial deletion of B5R; and/or mutation/deletion of A36R.
- the modified oncolytic virus can comprise a mutation or a deletion of a further viral gene.
- the further viral gene can comprise genes encoding certain secreted cytokine binding proteins, e.g., B8R or B18R. Or it can comprise genes that may be responsible for immune suppressive activity, e.g., NIL or A41L. It can also comprise genes coding for proteins with NFKB (NF-kappaB) inhibitory functions, e.g., K7R, B15R, A52R.
- NFKB NF-kappaB
- the modified oncolytic virus comprises a mutation or a deletion of any one or combination of the genes that can code for B8R, B18R, SPI-1, SPI-2, B15R, VGF, E3L, K3L, A41L, K7R, NIL, or A52R.
- the protein B8R can, in some embodiments, refer to a secreted viral protein with homology to the IFN-gamma receptor, which in some cases can inhibit the interaction between host IFN-gamma and its receptor, thereby counteracting the antiviral effects of host IFNy.
- the protein B 18R can, in some embodiments, refer to a viral ankyrin-like protein that is secreted and, in some cases, can bind to type 1 interferon.
- the protein SPI-1 can, in some embodiments, refer to a viral serine proteinase inhibitor 1 and SPI-2 can refer to a viral serine proteinase inhibitor 2.
- the protein B15R also referred to as B14R in Vaccinia virus strain Copenhagen
- the protein VGF can, in some
- the protein E3L in some embodiments, can refer to a viral protein that, in some cases, can bind to and sequester double- stranded RNA (dsRNA) synthesized during viral infection, thereby preventing recognition of the dsRNA by and subsequent activation of EIF2AK2/PKR.
- the protein K3L can, in some embodiments, refer to a viral protein that, in some cases, can act as a pseudosubstrate of EIF2AK2/PKR, thereby inhibiting eIF2a activation by PKR kinase and preventing translation shutoff in host cell.
- the protein A41L can, in some embodiments, refer to a secreted viral chemokine binding protein that, in some cases, can interact with certain cellular chemokines to interfere with chemokine- glycosaminoglycan (GAG) interactions at the cell surface to alter chemotaxis of nearby responsive cells.
- the protein K7R can, in some embodiments, refer to a viral Bcl-2-like protein that, in some cases, can bind to Toll-like receptor-adaptor proteins and the DEAD- box RNA helicase DDX3, thereby inhibiting the activation of NFKB and interferon regulatory factor 3.
- the protein NIL can, in some embodiments, refer to another viral Bcl-2-like protein that, in some cases, can bind to BH3 peptides of pro-apoptotic Bcl-2 family proteins. In some cases, NIL can inhibit NFKB activation and host cell apoptosis.
- the protein A52R can, in some embodiments, refer to another viral Bcl-2 -like protein, which, in some cases can target host toll-like receptor signaling complexes to suppress innate immune response, in some cases can interact with host TRAF6 to activate p38 and subsequently induce the expression of several cytokines such as IL-10, and in some cases can interact with host IRAK2 to inhibit NF-kappa-B signaling.
- a deletion in the NIL gene can, in some embodiments, result in increased memory T-cell response, upon administration of the modified oncolytic virus. Additional effects can, in some embodiments, include one or more of the following: deletion of A41L can, in some embodiments, result in increased CTL response; K7R deletion can, in some embodiments, lead to increased natural killer and T-cell response, modified B15R can, in some embodiments, reduce NFKB activation and a deletion of the B15R gene can, in some embodiments, enhance immune response, modified A52R can, in some embodiments, reduce NFKB activation and a deletion of the A52R gene can, in some embodiments, enhance immune response.
- the modified oncolytic virus can comprise an exogenous nucleic acid that can code for LIGHT. In some embodiments, the modified oncolytic virus can comprise an exogenous nucleic acid that can code for IL15. In some embodiments, the modified oncolytic virus can comprise an exogenous nucleic acid that can code for IL15, and exogenous nucleic acid that can code for CCL5. In some embodiments, the modified oncolytic virus can comprise an exogenous nucleic acid that can code for IL15, and exogenous nucleic acid that can code for IL15-Ra.
- the modified oncolytic virus can comprise an exogenous nucleic acid that can code for ITAC (CXCL11), and an exogenous nucleic acid that can code for a fractalkine (CX3CL1).
- the modified oncolytic virus can comprise an exogenous nucleic acid that can code for ITAC (CXCL11), an exogenous nucleic acid that can code for a fractalkine
- CX3CL1 an exogenous nucleic acid that can code for IL15
- exogenous nucleic acid that can code for IL15-Ra exogenous nucleic acid that can code for IL15
- the modified oncolytic virus can comprise a mutation or deletion of the K7R gene, and can further comprise an exogenous nucleic acid that can code for a cytokine, e.g., IL15.
- the modified oncolytic virus can comprise a mutation or deletion of the K7R gene, and can further comprise an exogenous nucleic acid that can code for a chemokine, e.g., IL15, and an exogenous nucleic acid that can code for a chemokine, e.g., CCL5.
- the modified oncolytic virus can comprise a mutation or deletion of the K7R gene, and can further comprise an exogenous nucleic acid that can code for a cytokine, e.g., IL15, and an exogenous nucleic acid that can code for a receptor for the cytokine, e.g., IL15Ra.
- the modified oncolytic virus can comprise a mutation or deletion of the K7R gene, and can further comprise exogenous nucleic acid that can code for LIGHT.
- the modified oncolytic virus can comprise a mutation or deletion of the K7R gene, and can further comprise an exogenous nucleic acid that can code for ITAC (CXCL11).
- the modified oncolytic virus can comprise a mutation or deletion of the K7R gene, and comprise an exogenous nucleic acid that can code for a fractalkine (CX3CL1).
- the modified oncolytic virus can comprise a mutation or deletion of the K7R gene, and can further comprise an exogenous nucleic acid that can code for ITAC (CXCL11), and an exogenous nucleic acid that can code for a fractalkine (CX3CL1).
- the modified oncolytic virus can comprise a mutation or deletion of the A52R gene, and can further comprise an exogenous nucleic acid that can code for a cytokine, e.g., IL15.
- the modified oncolytic virus can comprise a mutation or deletion of the A52R gene, and can further comprise an exogenous nucleic acid that can code for a chemokine, e.g., IL15, and an exogenous nucleic acid that can code for a chemokine, e.g., CCL5.
- the modified oncolytic virus can comprise a mutation or deletion of the A52R gene, and can further comprise an exogenous nucleic acid that can code for a cytokine, e.g., IL15, and an exogenous nucleic acid that can code for a receptor for the cytokine, e.g., IL15Ra.
- the modified oncolytic virus can comprise a mutation or deletion of the A52R gene, and can further comprise exogenous nucleic acid that can code for LIGHT.
- the modified oncolytic virus can comprise a mutation or deletion of the A52R gene, and can further comprise an exogenous nucleic acid that can code for IT AC (CXCL11).
- the modified oncolytic virus can comprise a mutation or deletion of the A52R gene, and comprise an exogenous nucleic acid that can code for a fractalkine (CX3CL1).
- the modified oncolytic virus can comprise a mutation or deletion of the A52R gene, and can further comprise an exogenous nucleic acid that can code for ITAC (CXCL11), and an exogenous nucleic acid that can code for a fractalkine (CX3CL1).
- a cytokine e.g., IL15
- its receptor e.g., IL15-Ra
- immunomodulatory effects of the oncolytic virus for example, due to improved ability of a complex formed by IL15 and IL15-Ra (IL15:IL15-R complex) to activate natural killer cells and promote T cell response.
- IL15:IL15-R complex a complex formed by IL15 and IL15-Ra
- the IL15 in the IL15:IL15-Ra complex can be presented to the IL15-RPy (IL 15 -receptor beta gamma complex) displayed on the surface of T cells and natural killer (NK) cells, thereby imparting potent immunomodulatory effects on the NK cells and the T cells.
- modified oncolytic viruses wherein the A52R gene can be mutated or deleted, and further, wherein the modified oncolytic viruses can comprise an exogenous nucleic acid that can code for a secreted hyaluronidase, such as HysA.
- modified oncolytic viruses wherein the A52R gene can be mutated or deleted, and further, wherein the modified oncolytic viruses can comprise an exogenous nucleic acid that can code for a chemokine receptor, such as CXCR4.
- modified oncolytic viruses wherein the A52R gene can be mutated or deleted, and further, wherein the modified oncolytic viruses can comprise an exogenous nucleic acid that can code for a chemokine receptor, such as CXCR4, and an exogenous nucleic acid that can code for a secreted hyaluronidase, such as HysA.
- modified oncolytic viruses wherein the A52R gene can be mutated or deleted, and further, wherein the modified oncolytic viruses can comprise an exogenous nucleic acid that can code for a membrane associated hyaluronidase, such as PH-20 (also known as SPAM-1).
- modified oncolytic viruses wherein the A52R gene can be mutated or deleted, and further, wherein the modified oncolytic viruses can comprise an exogenous nucleic acid that can code for a chemokine receptor, such as CXCR4.
- modified oncolytic viruses wherein the A52R gene can be mutated or deleted, and further, wherein the modified oncolytic viruses can comprise an exogenous nucleic acid that can code for a chemokine receptor, such as CXCR4, and an exogenous nucleic acid that can code for a membrane associated hyaluronidase, such as PH-20 (or SPAM-1).
- the modified oncolytic virus can comprise a complete or a partial deletion of the viral thymidine kinase (TK) gene.
- TK viral thymidine kinase
- in the genome of the modified oncolytic virus disclosed herein one or more of the exogenous nucleic acids are inserted in the loci of the deleted TK gene.
- Exemplary nucleic acid sequences for the viral genes disclosed herein, and amino acid sequences for the proteins coded by said genes, are provided in Table 3.
- the viral TK gene in the modified oncolytic virus, such as in an oncolytic vaccinia virus, may be replaced with a TK gene from a herpes simplex virus (HSV-TK).
- HSV TK may function as a substitute for the deleted TK and may have multifaceted advantages.
- HSV TK can be used as an additional therapeutic prodrug converting enzyme for converting ganciclovir (GCV) into its cytotoxic metabolite in a tumor.
- GCV ganciclovir
- this modification can also serve as a suicide gene, e.g., vaccinia expressing cells can be killed efficiently through addition of GCV, thereby shutting down the virus in the case of an adverse event or uncontrolled replication.
- the modified oncolytic virus of this disclosure can act as a safety switch).
- a mutated version of the HSV TK can be used to allow for PET imaging of labelled substrates with greatly increased sensitivity.
- the modified oncolytic virus, comprising a HSV TK that can be used in PET imaging can act as a reporter of viral replication in vivo to determine therapeutic activity early after treatment.
- the modified oncolytic virus can comprise a full-length viral backbone gene or viral backbone protein described above, or truncated versions thereof, or functional domains thereof, or fragments thereof, or variants thereof.
- the modified oncolytic vims can comprise mutation or deletion of one or more of viral backbones genes or viral backbone proteins, as described above. Mutations of the viral backbone genes and viral backbone proteins can comprise insertion, deletion, substitution, or modifications of nucleotides in nucleic acid sequences and amino acids in protein sequences. Deletion can comprise, in some examples, a complete or partial deletion of the viral backbone gene or protein.
- hyperproliferative disease such as a cancer or a tumor
- a modified oncolytic virus such as an oncolytic vaccinia virus as described herein
- Cancers that can be treated by a modified oncolytic virus, as described herein can include, but are not limited to, melanoma, hepatocellular carcinoma, breast cancer, lung cancer, peritoneal cancer, prostate cancer, bladder cancer, ovarian cancer, leukemia, lymphoma, renal carcinoma, pancreatic cancer, epithelial carcinoma, gastric cancer, colon carcinoma, duodenal cancer, pancreatic adenocarcinoma, mesothelioma, glioblastoma multiforme, astrocytoma, multiple myeloma, prostate carcinoma, hepatocellular carcinoma,
- cholangiosarcoma pancreatic adenocarcinoma, head and neck squamous cell carcinoma, colorectal cancer, intestinal-type gastric adenocarcinoma, cervical squamous-cell carcinoma, osteosarcoma, epithelial ovarian carcinoma, acute lymphoblastic lymphoma, myeloproliferative neoplasms, and sarcoma.
- Cancer cells that can be treated by the methods of this disclosure include cells from the bladder, blood, bone, bone marrow, brain, breast, colon, esophagus,
- the cancer may specifically be of the following histological type, though it is not limited to these: neoplasm, malignant;
- carcinoma carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma; lymphoepithelial carcinoma; basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp; adenocarcinoma, familial polyposis coli; solid carcinoma; carcinoid tumor, malignant; branchiolo-alveolar adenocarcinoma; papillary adenocarcinoma; chromophobe carcinoma; acidophil carcinoma; oxyphilic adenocarcinoma; basophil carcinoma; clear cell adenocarcinoma; gran
- pheochromocytoma glomangiosarcoma; malignant melanoma; amelanotic melanoma; superficial spreading melanoma; malignant melanoma in giant pigmented nevus;
- epithelioid cell melanoma blue nevus, malignant; sarcoma; fibrosarcoma; fibrous histiocytoma, malignant; myxosarcoma; liposarcoma; leiomyosarcoma;
- rhabdomyosarcoma embryonal rhabdomyosarcoma; alveolar rhabdomyosarcoma; stromal sarcoma; mixed tumor, malignant; mullerian mixed tumor; nephroblastoma;
- hepatoblastoma carcinosarcoma; mesenchymoma, malignant; brenner tumor, malignant; phyllodes tumor, malignant; synovial sarcoma; mesothelioma, malignant; dysgerminoma; embryonal carcinoma; teratoma, malignant; struma ovarii, malignant; choriocarcinoma; mesonephroma, malignant; hemangiosarcoma; hemangioendothelioma, malignant;
- Kaposi's sarcoma Kaposi's sarcoma; hemangiopericytoma, malignant; lymphangiosarcoma; osteosarcoma; juxtacortical osteosarcoma; chondrosarcoma; chondroblastoma, malignant; mesenchymal chondrosarcoma; giant cell tumor of bone; Ewing's sarcoma; odontogenic tumor, malignant; ameloblastic odontosarcoma; ameloblastoma, malignant; ameloblastic fibrosarcoma; pinealoma, malignant; chordoma; glioma, malignant; ependymoma;
- astrocytoma protoplasmic astrocytoma; fibrillary astrocytoma; astroblastoma;
- glioblastoma oligodendroglioma; oligodendroblastoma; primitive neuroectodermal;
- cerebellar sarcoma cerebellar sarcoma; ganglioneuroblastoma; neuroblastoma; retinoblastoma; olfactory neurogenic tumor; meningioma, malignant; neurofibrosarcoma; neurilemmoma, malignant; granular cell tumor, malignant; malignant lymphoma; hodgkin's disease; hodgkin's;
- malignant lymphoma small lymphocytic
- malignant lymphoma large cell, diffuse
- malignant lymphoma follicular
- mycosis fungoides other specified non-hodgkin's lymphomas
- malignant histiocytosis multiple myeloma
- mast cell sarcoma immunoproliferative small intestinal disease; leukemia; lymphoid leukemia; plasma cell leukemia; erythroleukemia; lymphosarcoma cell leukemia; myeloid leukemia; basophilic leukemia; eosinophilic leukemia; monocytic leukemia; mast cell leukemia;
- solid cancers that are metastatic can be treated using the modified oncolytic viruses of this disclosure, such as a modified oncolytic vaccinia virus that is advantageous for systemic delivery.
- solid cancers that are inaccessible or difficult to access such as for purpose of intratumoral delivery of therapeutic agents, can be treated using the modified oncolytic viruses of this disclosure, such as a modified oncolytic vaccinia virus that is advantageous for systemic delivery.
- Cancers that are associated with increased expression of free fatty acids can, in some examples, be treated using the modified oncolytic viruses of this disclosure, such as a modified oncolytic vaccinia virus that is advantageous for systemic delivery and forms increased amounts of EEV.
- the primary cancer can be melanoma, non-small cell lung, small-cell lung, lung,
- the primary cancer can be lung cancer.
- the lung cancer can be non-small cell lung carcinoma.
- this disclosure can be used to prevent cancer or to treat pre-cancers or premalignant cells, including metaplasias, dysplasias, and hyperplasias.
- the progression to cancer or to a more severe form of cancer can be halted, disrupted, or delayed by methods of this disclosure involving the modified oncolytic virus as discussed herein.
- the modified oncolytic virus as disclosed herein can be administered for treatment of tumors with high bioavailability of free fatty acids in the tumor microenvironment.
- free fatty acids released by adipocytes in tumors in obese patients can feed and enhance the replication of the modified oncolytic virus within the tumor, and formation of EEV form of the virus.
- the advantage can also be realized in non-obese patients, especially patients who have peritoneal cancer.
- peritoneal cancers can be targets for therapy using the modified oncolytic viruses of this disclosure as these tend to grow in omentum wall and can be fed by adipocytes, and as mentioned above free fatty acids released by adipocytes in tumors can feed and enhance the replication of the modified oncolytic virus within the tumor.
- the modified oncolytic virus as disclosed herein can form an increased titer of extracellular enveloped virus (EEV) in tumors with high bioavailability of free fatty acids.
- EEV extracellular enveloped virus
- This disclosure provides methods for treating a subject by administration of one or more modified oncolytic viruses, as disclosed herein.
- An "individual” or “subject,” as used interchangeably herein, refers to a human or a non-human subject.
- Non-limiting examples of non-human subjects include non-human primates, dogs, cats, mice, rats, guinea pigs, rabbits, pigs, fowl, horses, cows, goats, sheep, cetaceans, etc.
- the subject is human.
- a method of producing a toxic effect in a cancer cell comprising administering, to the cancer cell, a therapeutically effective amount of a modified virus, such as an oncolytic vaccinia virus, as described above, or a pharmaceutical composition containing the same.
- This disclosure further provides a method of inhibiting at least one of growth and proliferation of a second cancer cell comprising administering, to a first cancer cell, a modified oncolytic virus as described above such that the first cancer cell is infected with said virus.
- a cancer cell or a tumor can be contacted with a therapeutically effective dose of an exemplary oncolytic vaccinia virus as described herein or a pharmaceutical composition containing the same.
- an effective amount of a modified oncolytic virus of the present disclosure such as an oncolytic vaccinia virus as described herein or a pharmaceutical composition thereof, can include an amount sufficient to induce oncolysis, the disruption or lysis of a cancer cell or the inhibition or reduction in the growth or size of a cancer cell. Reducing the growth of a cancer cell may be manifested, for example, by cell death or a slower replication rate or reduced growth rate of a tumor comprising the cell or a prolonged survival of a subject containing the cancer cell.
- a method of treating a subject having a cancer or a tumor comprising administering, to the subject, an effective amount of a modified virus, as described above.
- An effective amount in such method can include an amount that reduces growth rate or spread of the cancer or that prolongs survival in the subject.
- This disclosure provides a method of reducing the growth of a tumor, which method can comprise administering, to the tumor, an effective amount of a modified oncolytic virus as described above.
- an effective amount of a modified virus, or a pharmaceutical composition thereof can include an amount sufficient to induce the slowing, inhibition or reduction in the growth or size of a tumor and can include the eradication of the tumor. Reducing the growth of a tumor may be manifested, for example, by reduced growth rate or a prolonged survival of a subject containing the tumor.
- This disclosure also provides a method of determining the infectivity or anti-tumor activity, or amount of tumor specific viral replication of an oncolytic vaccinia virus as described herein, which method can comprise; (i) administering to a subject a therapeutically effective amount of an oncolytic vaccinia virus or a pharmaceutical composition according to the present disclosure, which further expresses a luciferase reporter gene, alone or in combination with a further therapy; (ii) collecting a first biological sample from the subject immediately after administering the virus and determining the level of the luciferase reporter in the first biological sample (iii) collecting a second biological sample from the subject following the administration in step (ii) and (iii) detecting the level of the luciferase reporter in the second biological sample, wherein the oncolytic vaccinia virus is determined to be infective, demonstrate anti-tumor activity, exhibit tumor specific viral replication if the level of luciferase is higher in step (iii) than
- the second biological sample is collected about 30 mins, about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 12 hours, about 15 hours, about 24 hours, about 36 hours, about 48 hours, about 72 hours, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, about 10 days, about 11 days, about 12 days, about 13 days, about 14 days, about 15 days, about 1 month, to about 2 months after the administration in step (i).
- the method of mentioned above can further comprise, detecting in steps (i) and (iii), the level of one or more assaying cytokine levels, e.g., IL-2, IL-7, IL-8, IL-10, IFN- ⁇ , GM-CSF, T F-a, IL-6, IL-4, IL-5, and IL-13, in plasma samples collected from a subject after administering to said subject a therapeutically effective amount of a modified oncolytic virus of the present disclosure, such as an oncolytic vaccinia virus as described herein or a pharmaceutical composition comprising the same.
- a modified oncolytic virus of the present disclosure such as an oncolytic vaccinia virus as described herein or a pharmaceutical composition comprising the same.
- the increase in luciferase bioluminescence between steps (ii) and (iv) mentioned above is higher for a modified oncolytic virus as described herein, compared to that in an otherwise identical virus that does not comprise the modifications in the modified oncolytic virus.
- Other exemplary techniques for detecting and monitoring viral load after administration of the modified oncolytic viruses include real-time quantitative PCR.
- An exemplary method for monitoring the pharmacokinetics can comprise the following steps: (i) administering to the subject a therapeutically effective amount of an oncolytic vaccinia virus or a pharmaceutical composition comprising the same, alone or in combination with a further therapy; (ii) collecting biological samples from the subject at one or more time points selected from about 15 minutes, about 30 minutes, about 45 mins, about 60 mins, about 75 mins, about 90 mins, about 120 mins, about 180 mins, and about 240 mins, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 12 hours, about 15 hours, about 24 hours, about 36 hours, about 48 hours, about 72 hours, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, about 10 days, about 11 days, about 12 days, about 13 days, about 14 days, about 15 days, about 1 month, to about 2 months after the administration in step (i) and (iii) detecting the quantity of the viral genome (or
- viral genome copies/mL can be highest in the sample collected at the 15 mins time point and further the sample collected at the 240 mins time point may not contain a detectable quantity of the viral genome. Therefore, in some instances, a viral peak can be observed at about 15 mins following administration and majority of the viruses can be cleared from the subject's system after about 240 mins (or 4 hours). In some instances, a first viral peak can be observed after about 15 mins following administration and a second viral peak can be observed in the biological samples collected in the subsequent time points, e.g., at about 30 mins, about 45 mins, about 60 mins, or about 90 mins.
- the biological sample can be, in exemplar embodiments, blood, and the quantity of viral genome/mL can be determined by quantitative PCR or other appropriate techniques. In some examples, a first viral peak can be observed after about 15 mins following
- administration and a second viral peak can be observed after about 30 mins, about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 12 hours, about 15 hours, about 24 hours, about 36 hours, about 48 hours, about 72 hours, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, about 10 days, about 11 days, about 12 days, about 13 days, about 14 days, about 15 days, about 1 month, to about 2 months following administration of a modified oncolytic virus of the present disclosure, such as an oncolytic vaccinia virus as described herein.
- a modified oncolytic virus of the present disclosure such as an oncolytic vaccinia virus as described herein.
- tumor-selective replication of a modified virus can be measured through use of a reporter gene, such as a luciferase gene.
- a reporter gene such as a luciferase gene.
- the luciferase gene can be inserted into the genome of a virus, and a tumor cell can be infected with the virus. Bioluminescence in infected tumor cells can be measured to monitor tumor-selective replication.
- amount of a modified oncolytic virus of this disclosure, such as an oncolytic vaccinia virus, administered to a subject can be between about 10 3 and 10 12 infectious viral particles or plaque forming units (PFU), or between about 10 5 and 10 10 PFU, or between about 10 5 and 10 8 PFU, or between about 10 8 and 10 10 PFU.
- the amount of a modified oncolytic virus of this disclosure, such as an oncolytic vaccinia virus administered to a subject can be between about 10 3 and 10 12 viral particles or plaque forming units (PFU), or between about 10 5 and 10 10 PFU, or between about 10 5 and 10 8 PFU, or between about 10 8 and 10 10 PFU.
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise about 10 3 PFU/dose to about 10 4 PFU/dose, about 10 4 PFU/dose to about 10 5 PFU/dose, about 10 5 PFU/dose to about 10 6 PFU/dose, about 10 7 PFU/dose to about 10 8 PFU/dose, about 10 9 PFU/dose to about 10 10 PFU/dose, about 10 10 PFU/dose to about 10 11 PFU/dose, about 10 11 PFU/dose to about 10 12 PFU/dose, about 10 12 PFU/dose to about 10 13 PFU/dose, about 10" PFU/dose to about 10 14 PFU/dose, or about 10 14 PFU/dose to about 10 15 PFU/dose.
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise about 2 x 10 3 PFU/dose, 3 x 10 3 PFU/dose , 4 x 10 3 PFU/dose , 5 x 10 3 PFU/dose , 6 x 10 3 PFU/dose , 7 x 10 3 PFU/dose , 8 x 10 3 PFU/dose , 9 x 10 3 PFU/dose , about 10 4 PFU/dose, about 2 x 10 4 PFU/dose, about 3 xlO 4 PFU/dose , about 4 x 10 4 PFU/dose , about 5 x 10 4 PFU/dose , about 6 x 10 4 PFU/dose , about 7 x 10 4 PFU/dose , about 8 x 10 4 PFU/dose , about 9 x 10 4 PFU/dose , about 10 5 PFU/dose, 2 x 10 5 PFU/dose , 3 x 10 5 PFU/dose , 3 x 10 5 PFU/dose, 2
- PFU/dose about 10 10 PFU/dose, about 2 x 10 10 PFU/dose, about 3 x 10 10 PFU/dose, about 4 x 10 10 PFU/dose, about 5 xlO 10 PFU/dose , about 6 x 10 10 PFU/dose, about 7 x 10 10 PFU/dose , about 8 x 10 10 PFU/dose , about 9 x 10 10 PFU/dose, about 10 10 PFU/dose, about 2 x 10 10 PFU/dose, about 3 x 10 10 PFU/dose , about 4 x 10 10 PFU/dose , about 5 x 10 10 PFU/dose , about 6 x 10 10 PFU/dose , about 7 x 10 10 PFU/dose , about 8 x 10 10 PFU/dose , about 9 x 10 10 PFU/dose , about 10 11 PFU/dose, about 2 x 10 11 PFU/dose , about 3 x 10 11 PFU/dose , about 4 x 10 11 PFU/dose , about 5
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise 5 x 10 9 PFU/dose.
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise up to 5 x 10 9 PFU/dose.
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise about 10 3 viral particles/dose to about 10 4 viral particles /dose, about 10 4 viral particles /dose to about 10 5 viral particles /dose, about 10 5 viral particles /dose to about 10 6 viral particles /dose, about 10 7 viral particles /dose to about 10 8 viral particles /dose, about 10 9 viral particles /dose to about 10 10 viral particles /dose, about 10 10 viral particles /dose to about 10 11 viral particles /dose, about 10 11 viral particles /dose to about 10 12 viral particles /dose, about 10 12 viral particles /dose to about 10 13 viral particles /dose, about 10 13 viral particles /dose to about 10 14 viral particles /dose, or about 10 14 viral particles /dose to about 10 15 viral particles /dose.
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise about 10 3 PFU/kg to about 10 4 PFU/kg, about 10 4 PFU/kg to about 10 5 PFU/kg, about 10 5 PFU/kg to about 10 6 PFU/kg, about 10 7 PFU/kg to about 10 8 PFU/kg, about 10 9 PFU/kg to about 10 10 PFU/kg, about 10 10 PFU/kg to about 10 11 PFU/kg, about 10 11 PFU/kg to about 10 12 PFU/kg, about 10 12 PFU/kg to about 10 13 PFU/kg, about 10 13 PFU/kg to about 10 14 PFU/kg, or about 10 14 PFU/kg to about 10 15 PFU/kg.
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise about 2 x 10 3 PFU/kg, 3 x 10 3 PFU/kg , 4 x 10 3 PFU/kg , 5 x 10 3 PFU/kg , 6 x 10 3 PFU/kg , 7 x 10 3 PFU/kg , 8 x 10 3 PFU/kg , 9 x 10 3 PFU/kg , about 10 4 PFU/kg, about 2 x 10 4 PFU/kg, about 3 xlO 4 PFU/kg , about 4 x 10 4 PFU/kg , about 5 x 10 4 PFU/kg , about 6 x 10 4 PFU/kg , about 7 x 10 4 PFU/kg , about 8 x 10 4 PFU/kg , about 9 x 10 4 PFU/kg , about 10 5 PFU/kg, 2 x 10 5 PFU/kg , 3 x 10 5 PFU/kg , 3 x 10 5 PFU/kg , 3
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise 5 x 10 9 PFU/kg.
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise up to 5 x 10 9 PFU/kg.
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise about 10 3 viral particles/kg to about 10 4 viral particles/kg, about 10 4 viral particles/kg to about 10 5 viral particles/kg, about 10 5 viral particles/kg to about 10 6 viral particles/kg, about 10 7 viral particles/kg to about 10 8 viral particles/kg, about 10 9 viral particles/kg to about 10 10 viral particles/kg, about 10 10 viral particles/kg to about 10 11 viral particles/kg, about 10 11 viral particles/kg to about 10 12 viral particles/kg, about 10 12 viral particles/kg to about 10 13 viral particles/kg, about 10 13 viral particles/kg to about 10 14 viral particles/kg, or about 10 14 viral particles/kg to about 10 15 viral particles/kg.
- a liquid dosage form of an oncolytic vaccinia virus as described herein can comprise, in certain embodiments, a viral dose of about 10 3 PFU/mL to about 10 4 PFU/mL, about 10 4 PFU/mL to about 10 5 PFU/mL, about 10 5 PFU/mL to about 10 6 PFU/mL, about 10 7 PFU/mL to about 10 8 PFU/mL, about 10 9 PFU/mL to about 10 10 PFU/mL, about 10 10 PFU/mL to about 10 11 PFU/mL, about 10 11 PFU/mL to about 10 12 PFU/mL, about 10 12 PFU/mL to about 10 13 PFU/mL, about 10 13 PFU/mL to about 10 14 PFU/mL, or about 10 14 PFU/mL to about 10 15 PFU/mL.
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise about 2 x 10 3 PFU/mL, 3 x 10 3 PFU/mL , 4 x 10 3 PFU/mL , 5 x 10 3 PFU/mL , 6 x 10 3 PFU/mL , 7 x 10 3 PFU/mL , 8 x 10 3 PFU/mL , 9 x 10 3 PFU/mL , about 10 4 PFU/mL, about 2 x 10 4 PFU/mL, about 3 xlO 4 PFU/mL , about 4 x 10 4 PFU/mL , about 5 x 10 4 PFU/mL , about 6 x 10 4 PFU/mL , about 7 x 10 4 PFU/mL , about 8 x 10 4 PFU/mL , about 9 x 10 3 PFU/mL , about 10 4 PFU/mL, about 2 x 10 4 PFU/mL, about 3 x
- 10 4 PFU/mL about 10 5 PFU/mL, 2 x 10 5 PFU/mL , 3 x 10 5 PFU/mL , 4 x 10 5 PFU/mL , 5 x
- 10 9 PFU/mL about 2 x 10 9 PFU/mL, about 3 x 10 9 PFU/mL, about 4 x 10 9 PFU/mL, about 5 x 10 9 PFU/mL, about 6 x 10 9 PFU/mL, about 7 x 10 9 PFU/mL, about 8 x 10 9 PFU/mL, about 9 x 10 9 PFU/mL, about 10 10 PFU/mL, about 2 x 10 10 PFU/mL, about 3 x 10 10 PFU/mL, about 4 x 10 10 PFU/mL, about 5 xlO 10 PFU/mL , about 6 x 10 10 PFU/mL, about 7 x 10 10 PFU/mL , about 8 x 10 10 PFU/mL , about 9 x 10 10 PFU/mL, about 10 10 PFU/mL, about 2 x
- 10 10 PFU/mL about 3 x 10 10 PFU/mL , about 4 x 10 10 PFU/mL , about 5 x 10 10 PFU/mL , about 6 x 10 10 PFU/mL , about 7 x 10 10 PFU/mL , about 8 x 10 10 PFU/mL , about 9 x 10 10 PFU/mL , about 10 11 PFU/mL, about 2 x 10 11 PFU/mL , about 3 x 10 11 PFU/mL , about 4 x
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise 5 x 10 9 PFU/mL.
- a modified oncolytic virus of this disclosure can be administered at a dose that can comprise up to 5 x 10 9 PFU/mL.
- the dosage can comprise about 10 3 viral particles per injection, 10 4 viral particles per injection, 10 5 viral particles per injection, 10 6 viral particles per injection, 10 7 viral particles per injection, 10 8 viral particles per injection, 10 9 viral particles per injection, 10 10 viral particles per injection, 10 11 viral particles per injection, 10 12 viral particles per injection, 2 x 10 12 viral particles per injection, 10 13 viral particles per injection, 10 14 viral particles per injection, or 10 15 viral particles per injection.
- the dosage can comprise about 10 3 infectious viral particles per injection, 10 4 infectious viral particles per injection, 10 5 infectious viral particles per injection, 10 6 infectious viral particles per injection, 10 7 infectious viral particles per injection, 10 8 infectious viral particles per injection, 10 9 infectious viral particles per injection, 10 10 infectious viral particles per injection, 10 11 infectious viral particles per injection, 10 12 infectious viral particles per injection, 2 x 10 12 infectious viral particles per injection, 10 13 infectious viral particles per injection, 10 14 infectious viral particles per injection, or 10 15 infectious viral particles per injection.
- a modified oncolytic virus of this disclosure can be administered at a dose that can be about 10 3 Tissue Culture Inhibitor Dose 50% (TCID 5 o)/kg, 10 4 TCIDso/kg, 10 4 TCIDso/kg, 10 4 TCIDjo/kg, 10 4 TCID 50 /kg, 10 4 TCIDjo/kg, 10 4 TCIDjo/kg, 10 4 TCIDso/kg, 10 4 TCID 50 /kg, 10 4 TCIDjo/kg, 10 4 TCID 50 /kg, 10 4 TCID 50 /kg, 10 4 TCID 50 /kg, 10 4 TCID 50 /kg, 3xl0 8 TCIDso/kg, 4xl0 8 TCIDjo/kg, 5xl0 8 TCIDjo/kg, 3xl0 9 TCID 50 /kg, 4xl0 9 TCIDso/kg, 5xl0 9 TCIDjo/kg, 3xl0 10 TCIDjo
- the virus can be administered in an amount sufficient to induce oncolysis in at least about 20% of cells in a tumor, in at least about 30%> of cells in a tumor, in at least about 40%) of cells in a tumor, in at least about 50% of cells in a tumor, in at least about 60%) of cells in a tumor, in at least about 70% of cells in a tumor, in at least about 80%> of cells in a tumor, or in at least about 90% of cells in a tumor.
- a single dose of virus can refer to the amount administered to a subject or a tumor over a 1, 2, 5, 10, 15, 20 or 24 hour period.
- the dose can be spread over time or by separate injection.
- multiple doses e.g., 2, 3, 4, 5, 6 or more doses
- the vaccinia virus can be administered to the subject, for example, where a second treatment can occur within 1, 2, 3, 4, 5, 6, 7 days or weeks of a first treatment.
- multiple doses of the modified oncolytic virus can be administered to the subject over a period of 1, 2, 3, 4, 5, 6, 7 or more days or weeks.
- the oncolytic vaccina virus or the pharmaceutical composition as described herein can be administered over a period of about 1 week to about 2 weeks, about 2 weeks to about 3 weeks, about 3 weeks to about 4 weeks, about 4 weeks to about 5 weeks, about 6 weeks to about 7 weeks, about 7 weeks to about 8 weeks, about 8 weeks to about 9 weeks, about 9 weeks to about 10 weeks, about 10 weeks to about 11 weeks, about 11 weeks to about 12 weeks, about 12 weeks to about 24 weeks, about 24 weeks to about 48 weeks, about 48 weeks or about 52 weeks, or longer.
- the frequency of administration of the oncolytic vaccinia virus or the pharmaceutical composition as described herein can be, in certain instances, once daily, twice daily, once every week, once every three weeks, once every four weeks (or once a month), once every 8 weeks (or once every 2 months), once every 12 weeks (or once every 3 months), or once every 24 weeks (once every 6 months).
- the oncolytic vaccinia virus or the pharmaceutical composition can be administered, independently, in an initial dose for a first period of time, an intermediate dose for a second period of time, and a high dose for a third period of time.
- the initial dose is lower than the intermediate dose and the intermediate dose is lower than the high dose.
- the first, second, and third periods of time are, independently, about 1 week to about 2 weeks, about 2 weeks to about 3 weeks, about 3 weeks to about 4 weeks, about 4 weeks to about 5 weeks, about 6 weeks to about 7 weeks, about 7 weeks to about 8 weeks, about 8 weeks to about 9 weeks, about 9 weeks to about 10 weeks, about 10 weeks to about 11 weeks, about 11 weeks to about 12 weeks, about 12 weeks to about 24 weeks, about 24 weeks to about 48 weeks, about 48 weeks or about 52 weeks, or longer.
- the subject can be put on a reduced carbohydrate diet, e.g., a ketogenic diet prior to, concurrent with, and following administration of the modified oncolytic viruses, such as the oncolytic vaccinia viruses or the pharmaceutical composition comprising the same, as described herein, according to any of the methods of treatment described herein.
- a reduced carbohydrate diet e.g., a ketogenic diet
- the modified oncolytic viruses such as the oncolytic vaccinia viruses or the pharmaceutical composition comprising the same, as described herein, according to any of the methods of treatment described herein.
- the subject is put on a diet that can comprise consuming less than 500 grams of carbohydrates per day, less than 450 grams of carbohydrates per day, less than 450 grams of carbohydrates per day, less than 400 grams of carbohydrates per day, less than 350 grams of carbohydrates per day, less than 300 grams of carbohydrates per day, less than 250 grams of carbohydrates per day, less than 200 grams of carbohydrates per day, less than 150 grams of carbohydrates per day, less than 100 grams of carbohydrates per day, less than 90 grams of carbohydrates per day, less than 80 grams of carbohydrates per day, less than 70 grams of carbohydrates per day, less than 60 grams of carbohydrates per day, less than 50 grams of carbohydrates per day, less than 40 grams of carbohydrates per day, less than 30 grams of carbohydrates per day, less than 20 grams of carbohydrates per day, less or than 10 grams of carbohydrates per day.
- An exemplary method for the delivery of a modified oncolytic virus of the present disclosure, such as an oncolytic vaccinia virus as described herein or a pharmaceutical composition comprising the same, to cancer or tumor cells can be via intratumoral injection.
- alternate methods of administration can also be used, e.g, intravenous, via infusion, parenteral, intravenous, intradermal, intramuscular, transdermal, rectal, intraurethral, intravaginal, intranasal, intrathecal, or intraperitoneal.
- the routes of administration can vary with the location and nature of the tumor.
- the route of administration can be intradental, transdermal, parenteral, intravenous, intramuscular, intranasal, subcutaneous, regional (e.g., in the proximity of a tumor, particularly with the vasculature or adjacent vasculature of a tumor), percutaneous, intrathecal, intratracheal, intraperitoneal, intraarterial, intravesical, intratumoral, inhalation, perfusion, by lavage or orally.
- An injectable dose of the oncolytic virus can be administered as a bolus injection or as a slow infusion.
- the modified oncolytic virus can be administered to the patient from a source implanted in the patient.
- administration of the modified oncolytic virus can occur by continuous infusion over a selected period of time.
- an oncolytic vaccinia virus as described herein, or a pharmaceutical composition containing the same can be administered at a therapeutically effective dose by infusion over a period of about 15 mins, about 30 mins, about 45 mins, about 50 mins, about 55 mins, about 60 minutes, about 75 mins, about 90 mins, about 100 mins, or about 120 mins or longer.
- the oncolytic vaccina virus or the pharmaceutical composition of the present disclosure can be administered as a liquid dosage, wherein the total volume of administration is about 1 mL to about 5 mL, about 5 mL to 10 mL, about 15 mL to about 20 mL, about 25 mL to about 30 mL, about 30 mL to about 50 mL, about 50 mL to about 100 mL, about 100 mL to 150 mL, about 150 mL to about 200 mL, about 200 mL to about 250 mL, about 250 mL to about 300 mL, about 300 mL to about 350 mL, about 350 mL to about 400 mL, about 400 mL to about 450 mL, about 450 mL to 500 mL, about 500 mL to 750 mL, or about 750 mL to 1000 mL.
- compositions containing a modified virus can be prepared as solutions, dispersions in glycerol, liquid polyethylene glycols, and any combinations thereof in oils, in solid dosage forms, as inhalable dosage forms, as intranasal dosage forms, as liposomal formulations, dosage forms comprising nanoparticles, dosage forms comprising microparticles, polymeric dosage forms, or any combinations thereof.
- a pharmaceutical composition as described herein can comprise a stabilizer and a buffer.
- a buffer such as a buffer
- a pharmaceutical composition as described herein can comprise a solubilizer, such as sterile water, Tris-buffer.
- a pharmaceutical composition as described herein can comprise an excipient.
- An excipient can be an excipient described in the Handbook of Pharmaceutical Excipients, American Pharmaceutical Association (1986).
- suitable excipients can include a buffering agent, a preservative, a stabilizer, a binder, a compaction agent, a lubricant, a chelator, a dispersion enhancer, a disintegration agent, a flavoring agent, a sweetener, a coloring agent.
- an excipient can be a buffering agent.
- suitable buffering agents can include sodium citrate, magnesium carbonate, magnesium bicarbonate, calcium carbonate, and calcium bicarbonate.
- sodium bicarbonate, potassium bicarbonate, magnesium hydroxide, magnesium lactate, magnesium gluconate, aluminium hydroxide, sodium citrate, sodium tartrate, sodium acetate, sodium carbonate, sodium polyphosphate, potassium polyphosphate, sodium pyrophosphate, potassium pyrophosphate, disodium hydrogen phosphate, dipotassium hydrogen phosphate, trisodium phosphate, tripotassium phosphate, potassium metaphosphate, magnesium oxide, magnesium hydroxide, magnesium carbonate, magnesium silicate, calcium acetate, calcium glycerophosphate, calcium chloride, calcium hydroxide and other calcium salts or combinations thereof can be used in a pharmaceutical formulation.
- an excipient can comprise a preservative.
- suitable preservatives can include antioxidants, such as alpha-tocopherol and ascorbate, and antimicrobials, such as parabens, chlorobutanol, and phenol.
- Antioxidants can further include but not limited to EDTA, citric acid, ascorbic acid, butylated hydroxytoluene (BHT), butylated hydroxy anisole (BHA), sodium sulfite, p-amino benzoic acid, glutathione, propyl gallate, cysteine, methionine, ethanol and N- acetyl cysteine.
- a preservatives can include validamycin A, TL-3, sodium ortho vanadate, sodium fluoride, N- a-tosyl-Phe- chloromethylketone, N-a-tosyl-Lys-chloromethylketone, aprotinin,
- phenylmethyisulfonyi fluoride diisopropyifluorophosphate
- kinase inhibitor phosphatase inhibitor
- caspase inhibitor granzyme inhibitor
- cell adhesion inhibitor cell division inhibitor
- cell cycle inhibitor cell cycle inhibitor
- lipid signaling inhibitor protease inhibitor, reducing agent, alkylating agent, antimicrobial agent, oxidase inhibitor, or other inhibitor.
- a pharmaceutical composition as described herein can comprise a binder as an excipient.
- suitable binders can include starches, pregelatinized starches, gelatin, polyvinylpyrolidone, cellulose, methylcellulose, sodium carboxymethylcellulose, ethylcellulose, polyacrylamides, polyvinyloxoazolidone, polyvinylalcohols, C 12 -C 18 fatty acid alcohol, polyethylene glycol, polyols, saccharides, oligosaccharides, and combinations thereof.
- the binders that can be used in a pharmaceutical formulation can be selected from starches such as potato starch, corn starch, wheat starch; sugars such as sucrose, glucose, dextrose, lactose, maltodextrin; natural and synthetic gums; gelatine; cellulose derivatives such as microcrystalline cellulose, hydroxy-propyl cellulose, hydroxyethyl cellulose, hydroxypropyl methyl cellulose, carboxymethyl cellulose, methyl cellulose, ethyl cellulose; polyvinylpyrrolidone (povidone); polyethylene glycol (PEG); waxes; calcium carbonate; calcium phosphate; alcohols such as sorbitol, xylitol, mannitol and water or a combination thereof.
- a pharmaceutical composition as described herein can comprise a lubricant as an excipient.
- suitable lubricants can include magnesium stearate, calcium stearate, zinc stearate, hydrogenated vegetable oils, sterotex, polyoxyethylene monostearate, talc, polyethyleneglycol, sodium benzoate, sodium lauryl sulfate, magnesium lauryl sulfate, and light mineral oil.
- the lubricants that can be used in a pharmaceutical formulation can be selected from metallic stearates (such as magnesium stearate, calcium stearate, aluminium stearate), fatty acid esters (such as sodium stearyl fumarate), fatty acids (such as stearic acid), fatty alcohols, glyceryl behenate, mineral oil, paraffins, hydrogenated vegetable oils, leucine, polyethylene glycols (PEG), metallic lauryl sulphates (such as sodium lauryl sulphate, magnesium lauryl sulphate), sodium chloride, sodium benzoate, sodium acetate and talc or a combination thereof.
- metallic stearates such as magnesium stearate, calcium stearate, aluminium stearate
- fatty acid esters such as sodium stearyl fumarate
- fatty acids such as stearic acid
- fatty alcohols glyceryl behenate
- mineral oil such as paraffins, hydrogenated vegetable oils
- a pharmaceutical formulation can comprise a dispersion enhancer as an excipient.
- suitable dispersants can include starch, alginic acid, polyvinylpyrrolidones, guar gum, kaolin, bentonite, purified wood cellulose, sodium starch glycolate, isoamorphous silicate, and microcrystalline cellulose as high HLB emulsifier surfactants.
- a pharmaceutical composition as described herein can comprise a disintegrant as an excipient.
- a disintegrant can be a non- effervescent disintegrant.
- suitable non-effervescent disintegrants can include starches such as corn starch, potato starch, pregelatinized and modified starches thereof, sweeteners, clays, such as bentonite, micro-crystalline cellulose, alginates, sodium starch glycolate, gums such as agar, guar, locust bean, karaya, pectin, and tragacanth.
- a disintegrant can be an effervescent disintegrant.
- suitable effervescent disintegrants can include sodium bicarbonate in combination with citric acid, and sodium bicarbonate in combination with tartaric acid.
- an excipient can comprise a flavoring agent.
- Flavoring agents incorporated into an outer layer can be chosen from synthetic flavor oils and flavoring aromatics; natural oils; extracts from plants, leaves, flowers, and fruits; and combinations thereof.
- a flavoring agent can be selected from the group consisting of cinnamon oils; oil of wintergreen; peppermint oils; clover oil; hay oil; anise oil; eucalyptus; vanilla; citrus oil such as lemon oil, orange oil, grape and grapefruit oil; and fruit essences including apple, peach, pear, strawberry, raspberry, cherry, plum, pineapple, and apricot.
- an excipient can comprise a sweetener.
- suitable sweeteners can include glucose (corn syrup), dextrose, invert sugar, fructose, and mixtures thereof (when not used as a carrier); saccharin and its various salts such as a sodium salt; dipeptide sweeteners such as aspartame; dihydrochalcone compounds, glycyrrhizin; Stevia Rebaudiana (Stevioside); chloro derivatives of sucrose such as sucralose; and sugar alcohols such as sorbitol, mannitol, sylitol, and the like.
- a pharmaceutical composition as described herein can comprise a coloring agent.
- suitable color agents can include food, drug and cosmetic colors (FD&C), drug and cosmetic colors (D&C), and external drug and cosmetic colors (Ext. D&C).
- FD&C drug and cosmetic colors
- D&C drug and cosmetic colors
- Ext. D&C external drug and cosmetic colors
- a coloring agents can be used as dyes or their corresponding lakes.
- a pharmaceutical composition as described herein can comprise a chelator.
- a chelator can be a fungicidal chelator. Examples can include, but are not limited to: ethylenediamine-N,N,N',N'-tetraacetic acid (EDTA); a disodium, trisodium, tetrasodium, dipotassium, tripotassium, dilithium and diammonium salt of EDTA; a barium, calcium, cobalt, copper, dysprosium, europium, iron, indium, lanthanum, magnesium, manganese, nickel, samarium, strontium, or zinc chelate of EDTA; trans- 1,2- diaminocyclohexane-N,N,N',N'-tetraaceticacid monohydrate; N,N-bis(2- hydroxyethyl)glycine; l,3-diamino-2-hydroxypropane
- EDTA ethylenediamine
- ethylenediamine-N,N'-dipropionic acid dihydrochloride ethylenediamine-N,N- bis(methylenephosphonic acid) hemihydrate; N-(2-hydroxyethyl)ethylenediamine-N,N',N'- triacetic acid; ethylenediamine-N,N,N',N'-tetrakis(methylenephosponic acid); 0,0'-bis(2- aminoethyl)ethyleneglycol-N,N,N',N'-tetraacetic acid; N,N-bis(2- hydroxybenzyl)ethylenediamine-N,N-diacetic acid; l,6-hexamethylenediamine-N,N,N',N'- tetraacetic acid; N-(2 -hydroxy ethyl)iminodiacetic acid; iminodiacetic acid; 1,2- diaminopropane-N,N,N',N'-tetraacetic acid; nitri
- combination products that include one or more modified oncolytic viruses disclosed herein and one or more other antimicrobial or antifungal agents, for example, polyenes such as amphotericin B, amphotericin B lipid complex (ABCD), liposomal amphotericin B (L-AMB), and liposomal nystatin, azoles and triazoles such as voriconazole, fluconazole, ketoconazole, itraconazole, pozaconazole and the like; glucan synthase inhibitors such as caspofungin, micafungin (FK463), and V-echinocandin
- polyenes such as amphotericin B, amphotericin B lipid complex (ABCD), liposomal amphotericin B (L-AMB), and liposomal nystatin
- azoles and triazoles such as voriconazole, fluconazole, ketoconazole, itraconazole, pozaconazole and the
- LY303366 griseofulvin
- allylamines such as terbinafine
- flucytosine or other antifungal agents including those described herein.
- a peptide can be combined with topical antifungal agents such as ciclopirox olamine, haloprogin, tolnaftate, undecylenate, topical nystatin, amorolfine, butenafine, naftifine, terbinafine, and other topical agents.
- a pharmaceutical composition can comprise an additional agent.
- an additional agent can be present in a therapeutically effective amount in a pharmaceutical composition.
- the pharmaceutical compositions as described herein can comprise a preservative to prevent the growth of microorganisms.
- the pharmaceutical compositions as described herein may not comprise a preservative.
- the pharmaceutical forms suitable for inj ectable use can include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile inj ectable solutions or dispersions.
- the pharmaceutical compositions can comprise a carrier which is a solvent or a dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and/or vegetable oils, or any combinations thereof.
- Proper fluidity may be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- a coating such as lecithin
- surfactants for example, sodium bicarbonate, sodium bicarbonate, sodium bicarbonate, sodium bicarbonate, sodium bicarbonate, sodium bicarbonate, sodium bicarbonate, sodium bicarbonate, sodium bicarbonate, sodium sorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars or sodium chloride.
- Prolonged absorption of the inj ectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
- the liquid dosage form can be suitably buffered if necessary and the liquid diluent rendered isotonic with sufficient saline or glucose.
- the liquid dosage forms are especially suitable for intravenous, intramuscular, subcutaneous, intratumoral, and intraperitoneal administration.
- sterile aqueous media that can be employed will be known to those of skill in the art in light of the present disclosure.
- one dosage may be dissolved in lmL to 20 mL of isotonic NaCl solution and either added to 100 mL to 1000 mL of a fluid, e.g., sodium-bicarbonate buffered saline, or injected at the proposed site of infusion.
- a fluid e.g., sodium-bicarbonate buffered saline
- sterile injectable solutions can be prepared by
- a modified oncolytic virus such as oncolytic vaccinia viruses as described herein or a pharmaceutical composition containing the same, in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- the compositions disclosed herein may be formulated in a neutral or salt form.
- Pharmaceutically-acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
- the pharmaceutical compositions can be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective.
- a pharmaceutical composition of this disclosure can comprise an effective amount of a modified virus, disclosed herein, combined with a pharmaceutically acceptable carrier.
- a pharmaceutically acceptable carrier includes any carrier which does not interfere with the effectiveness of the biological activity of the active ingredients and/or that is not toxic to the patient to whom it is administered.
- suitable pharmaceutical carriers include phosphate buffered saline solutions, water, emulsions, such as oil/water emulsions, various types of wetting agents and sterile solutions.
- Additional non-limiting examples of pharmaceutically compatible carriers can include gels, bioadsorbable matrix materials, implantation elements containing the modified oncolytic virus or any other suitable vehicle, delivery or dispensing means or material. Such carriers can be formulated by conventional methods and can be administered to the subject at an effective amount.
- the modified oncolytic viruses of this disclosure can be produced by methods known to one of skill in the art.
- the modified oncolytic virus can be propagated in suitable host cells, e.g. , HeLa cells, 293 cells, or Vero cells, isolated from host cells and stored in conditions that promote stability and integrity of the virus, such that loss of infectivity over time is minimized.
- the modified oncolytic viruses are propagated in host cells using cell stacks, roller bottles, or perfusion bioreactors.
- downstream methods for purification of the modified oncolytic viruses can comprise filtration (e.g. , depth filtration, tangential flow filtration, or a combination thereof), ultracentrifugation, or chromatographic capture.
- the modified oncolytic virus can be stored, e.g. , by freezing or drying, such as by
- the stored modified oncolytic virus prior to administration, can be reconstituted (if dried for storage) and diluted in a
- modified oncolytic virus as described herein exhibit a higher titer in HeLa cells and 293 cells compared to an otherwise identical virus that does not comprise the modifications in the modified oncolytic virus. In certain instances, a higher titer in HeLa cells and 293 cells is seen in modified oncolytic virus.
- the methods of this disclosure comprise administering a modified oncolytic virus as disclosed herein or a pharmaceutical composition containing the same, followed by, and preceded by or in combination with one or more further therapy.
- further therapy can include, but are not limited to,
- the methods of this disclosure can comprise administering a modified oncolytic virus as disclosed herein, followed by, preceded by, or in combination with one or more anti-cancer agents or cancer therapies.
- Anti-cancer agents can include, but are not limited to,
- the cancer therapies can include chemotherapy, biological therapy, radiotherapy, immunotherapy, hormone therapy, anti-vascular therapy, cryotherapy, toxin therapy and/or surgery or combinations thereof.
- the methods of this disclosure can include administering a modified virus, disclosed herein, followed by, preceded by or in combination with an modified oncolytic virus of this disclosure.
- Combination of the modified oncolytic vaccinia virus with chemotherapy achieves a synergistic effect which is not seen in modified oncolytic viruses that do not comprise the modifications in the modified oncolytic virus.
- the synergistic effect of the above combination can be advantageously used to lower the dose of chemotherapy, such as Taxol®.
- chemotherapy such as Taxol®.
- the treatment method disclosed here, with the modified virus can reduced toxicities associated with chemotherapy, e.g., patients who respond to chemotherapy but suffer side effects at therapeutic doses.
- the synergistic effect can, in certain cases, results in a decrease in tumor growth compared to
- Exemplary decrease in tumor growth can be from about 2% to about 50%, such as about 5%, about 10%, about 20%, about 25%, about 35%, about 45% or about 50%.
- treatment using a modified oncolytic virus can be used alone or in combination with one or immunomodulatory agents.
- An immunomodulatory agent can include any compound, molecule or substance capable of suppressing antiviral immunity associated with a tumor or cancer.
- the immunomodulatory agent can be capable of suppressing innate immunity or adaptive immunity to the modified virus.
- Non-limiting examples of immunomodulatory agents include anti-CD33 antibody or variable region thereof, an anti-CDl lb antibody or variable region thereof, a COX2 inhibitor, e.g., celecoxib, cytokines, such as IL-12, GM-CSF, IL-2, IFN3 and lFNy, and chemokines, such as MIP-1, MCP-1 and IL-8.
- the immunomodulatory agent can include immune checkpoint modulators such as, but not limited to, anti-CTLA4, anti-PD-1, and anti-PD-Ll and TLR agonists (e.g., Poly I:C).
- the immunomodulatory agent can include an immune checkpoint inhibitor, such as an antagonist of PD-1 (e.g., an antagonist antibody that binds to PD-1), an antagonist of PD-Ll (e.g., an antagonist antibody that binds to PD-Ll), an antagonist of CTLA-4 (e.g., an antagonist antibody that binds to CTLA-4), an antagonist of A2AR (e.g., an antagonist antibody that binds to A2AR), an antagonist of B7-H3 (e.g., an antagonist antibody that binds to B7-H3), an antagonist of B7- H4 (e.g., an antagonist antibody that binds to B7-H4), an antagonist of BTLA (e.g., an antagonist antibody that binds to PD-1), an antagonist of
- the further therapy can comprise administering an immune checkpoint regulator.
- the immune checkpoint regulator can be TGN1412.
- the immune checkpoint regulator can be NKTR-214.
- the immune checkpoint regulator can be MEDI0562.
- the immune checkpoint regulator can be MEDI6469.
- the immune checkpoint regulator can be MEDI6383.
- the immune checkpoint regulator can be JTX-201 1.
- the immune checkpoint regulator can be Keytruda (pembrolizumab).
- the immune checkpoint regulator can be Opdivo (nivolumab).
- the immune checkpoint regulator can be Yervoy (ipilimumab).
- the immune checkpoint regulator can be tremelimumab. In one example, the immune checkpoint regulator can be Tecentriq (atezolizumab). In one example, the immune checkpoint regulator can be MGA271. In one example, the immune checkpoint regulator can be indoximod. In one example, the immune checkpoint regulator can be Epacadostat. In one example, the immune checkpoint regulator can be lirilumab. In one example, the immune checkpoint regulator can be BMS-986016. In one example, the immune checkpoint regulator can be MPDL3280A. In one example, the immune checkpoint regulator can be avelumab. In one example, the immune checkpoint regulator can be durvalumab.
- the immune checkpoint regulator can be MEDI4736. In one example, the immune checkpoint regulator can be MEDI4737. In one example, the immune checkpoint regulator can be TRX518. In one example, the immune checkpoint regulator can be MK-4166. In one example, the immune checkpoint regulator can be urelumab (BMS-663513). In one example, the immune checkpoint regulator can be PF-05082566 (PF-2566)
- the further therapy is radiation exemplary doses can be 5,000 Rads (50 Gy) to 100,000 Rads (1000 Gy), or 50,000 Rads (500 Gy), or other appropriate doses within the recited ranges.
- the radiation dose can be about 30 to 60 Gy, about 40 to about 50 Gy, about 40 to 48 Gy, or about 44 Gy, or other appropriate doses within the recited ranges, with the dose determined, example, by means of a dosimetry study as described above.
- "Gy” as used herein can refer to a unit for a specific absorbed dose of radiation equal to 100 Rads. Gy is the abbreviation for "Gray.”
- chemotherapeutic agents can include without limitation alkylating agents (e.g., nitrogen mustard derivatives, ethylenimines, alkyl sulfonates, hydrazines and triazines, nitrosureas, and metal salts), plant alkaloids (e.g., vinca alkaloids, taxanes, podophyllotoxins, and
- camptothecan analogs include antitumor antibiotics (e.g., anthracyclines, chromomycins, and the like), antimetabolites (e.g., folic acid antagonists, pyrimidine antagonists, purine antagonists, and adenosine deaminase inhibitors), topoisom erase I inhibitors, topoisom erase II inhibitors, and miscellaneous antineoplastics (e.g., ribonucleotide reductase inhibitors, adrenocortical steroid inhibitors, enzymes, antimicrotubule agents, and retinoids).
- antitumor antibiotics e.g., anthracyclines, chromomycins, and the like
- antimetabolites e.g., folic acid antagonists, pyrimidine antagonists, purine antagonists, and adenosine deaminase inhibitors
- topoisom erase I inhibitors e.g.,
- chemotherapeutic agents can include, without limitation, anastrozole (Arimidex®), bicalutamide (Casodex®), bleomycin sulfate (Blenoxane®), busulfan (Myleran®), busulfan injection (Busulfex®), capecitabine (Xeloda®), N4-pentoxycarbonyl-5-deoxy-5- fluorocytidine, carboplatin (Paraplatin®), carmustine (BiCNU®), chlorambucil (Leukeran®), cisplatin (Platinol®), cladribine (Leustatin®), cyclophosphamide (Cytoxan® or Neosar®), cytarabine, cytosine arabinoside (Cytosar-U®), cytarabine liposome injection (DepoCyt®), dacarbazine (DTIC-Dome®), dactinomycin (
- Efudex® flutamide
- Eulexin® flutamide
- tezacitibine gemcitabine (difluorodeoxycitidine), hydroxyurea (Hydrea®), Idarubicin (Idamycin®), ifosfamide (IFEX®), irinotecan
- Exemplary alkylating agents can include, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes): uracil mustard (Aminouracil Mustard®, Chlorethaminacil®, Demethyldopan®, Desm ethyl dopan®,
- Additional exemplary alkylating agents include, without limitation, Oxaliplatin (Eloxatin®); Temozolomide (Temodar® and Temodal®); Dactinomycin (also known as actinomycin-D, Cosmegen®); Melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, Alkeran®); Altretamine (also known as hexamethylmelamine (HMM), Hexalen®); Carmustine (BiCNU®); Bendamustine (Treanda®); Busulfan
- mechloroethamine hydrochloride Mustargen®
- Streptozocin Zanosar®
- Thiotepa also known as thiophosphoamide, TESPA and TSPA, Thioplex®
- anthracyclines can include, without limitation, e.g., doxorubicin
- daunomycin hydrochloride, daunomycin, and rubidomycin hydrochloride, Cerubidine®
- daunorubicin liposomal daunorubicin citrate liposome, DaunoXome®
- mitoxantrone DHAD
- Novantrone® epirubicin
- EllenceTM epirubicin
- Idamycin® Idamycin PFS®
- mitomycin C Mitamycin®
- geldanamycin herbimycin; ravidomycin; and desacetylravidomycin.
- Exemplary vinca alkaloids can include, but are not limited to, vinorelbine tartrate (Navelbine®), Vincristine (Oncovin®), and Vindesine (Eldisine®)); vinblastine (also known as vinblastine sulfate, vincaleukoblastine and VLB, Alkaban-AQ® and Velban®); and vinorelbine (Navelbine®).
- Exemplary proteasome inhibitors can, but are not limited to, bortezomib (Velcade®); carfilzomib (PX- 171 -007, (S)-4-Methyl-N— ((S)- 1 -(((S)-4-methyl- 1 -((R)-2-methyloxiran-2- yl)- 1 -oxopentan-2-yl)amino)- 1 -oxo-3 -phenylpropan-2-yl)-2-((S)-2-(2-morpholinoac etamido)-4-phenylbutanamido)-pentanamide); marizomib (NPI-0052); ixazomib citrate (MLN-9708); delanzomib (CEP-18770); and 0-Methyl-N-[(2-methyl-5-thiazolyl)carbonyl]- L-seryl-0-methyl-N-[(
- “In combination with,” as used herein, means that the modified virus, such as an oncolytic vaccinia virus as described herein or a pharmaceutical composition comprising the same, and the further therapy, such as a further therapy comprising one or more agents are administered to a subject as part of a treatment regimen or plan.
- being used in combination does not require that the modified oncolytic virus and the one or more agents are physically combined prior to administration or that they be administered over the same time frame.
- the modified oncolytic virus and the one or more agents can be administered concurrently to the subject being treated, or can be administered at the same time or sequentially in any order or at different points in time.
- the further therapy can be administered, in various embodiments, in a liquid dosage form, a solid dosage form, a suppository, an inhalable dosage form, an intranasal dosage form, in a liposomal formulation, a dosage form comprising nanoparticles, a dosage form comprising microparticles, a polymeric dosage form, or any combinations thereof.
- the further therapy is administered over a period of about 1 week to about 2 weeks, about 2 weeks to about 3 weeks, about 3 weeks to about 4 weeks, about 4 weeks to about 5 weeks, about 6 weeks to about 7 weeks, about 7 weeks to about 8 weeks, about 8 weeks to about 9 weeks, about 9 weeks to about 10 weeks, about 10 weeks to about 11 weeks, about 11 weeks to about 12 weeks, about 12 weeks to about 24 weeks, about 24 weeks to about 48 weeks, about 48 weeks or about 52 weeks, or longer.
- a method of treating a subject having a cancer can include administering, to the subject, an effective amount of a modified oncolytic virus, e.g., modified vaccinia virus, of this disclosure.
- the methods of this disclosure can further include administering to the subject an effective amount of one or more agents.
- the agent can be an anti -cancer agent, an immunomodulatory agent, or any combinations thereof, as described above.
- kits for administering a modified oncolytic virus as described herein can include a modified oncolytic virus or a pharmaceutical composition comprising a modified oncolytic virus as described above.
- a kit of this disclosure can further include one or more components such as instructions for use, devices and additional reagents, and components, such as tubes, containers and syringes for performing the methods disclosed above.
- a kit of this disclosure can further include one or more agents, e.g., at least one of an anti-cancer agent, an immunomodulatory agent, or any combinations thereof, that can be
- a kit of this disclosure can comprise one or more containers containing a modified virus, disclosed herein.
- a kit of this disclosure can comprise one or more containers that contain a modified oncolytic virus of this disclosure.
- a kit of this disclosure can include instructions for use, a device for administering the modified oncolytic virus to a subject, or a device for administering an additional agent or compound to a subject.
- the instructions can include a description of the modified oncolytic virus and, optionally, other components included in the kit, and methods for administration, including methods for determining the proper state of the subject, the proper dosage amount and the proper administration method for administering the modified virus. Instructions can also include guidance for monitoring the subject over duration of the treatment time.
- a kit of this disclosure can include a device for administering the modified oncolytic virus to a subject.
- a device for administering the modified oncolytic virus can be included in the kits provided herein.
- devices include, a hypodermic needle, an intravenous needle, a catheter, a needle-less injection device, an inhaler and a liquid dispenser, such as an eyedropper.
- a modified oncolytic virus to be delivered systemically for example, by intravenous injection, an intratumoral injection, an intraperitoneal injection, can be included in a kit with a hypodermic needle and syringe.
- EXAMPLE 1 EXEMPLARY MODIFIED VACCINIA VIRUS HAVING A MUTATION IN B5R GENE SHOWS ENHANCED THERAPEUTIC EFFECTS IN MURINE TUMOR MODELS
- the aim of this study was to explore the effects of an exemplary modified vaccinia virus according to this disclosure, where an exemplary mutation was introduced to the SCR3 and SCR4 regions of the viral B5R gene and the viral thymidine kinase (TK) gene was deleted (referred to herein as WR.B5RmutTK-), in murine tumor models, in comparison with vaccinia viruses that do not have the exemplary B5R mutation.
- TK viral thymidine kinase
- WR.TK- GMCSF modified vaccinia virus where TK gene was deleted and an exogenous nucleic acid encoding GMCSF was added
- WR.TK- GMCSF an exogenous nucleic acid encoding GMCSF
- mice were split into two groups, one group received immunization of vaccinia virus through one injection of WR. TK- virus (where TK gene was deleted from the genome) 3 weeks prior to tumor implantation ("Immunized mice") (FIG. 2B), and the other group were not immunized (“Non-immunized mice”) (FIG. 2A).
- WR.B5RmutTK- virus (referred to as B5R in the figure) was examined in comparison with another modified vaccinia virus WR.TK-A34R K151E, where TK was deleted and the viral A34R gene was mutated with an amino acid change, K151 to E (referred to WI in the figure).
- WR.B5RmutTK- virus exhibited significantly enhanced accumulation in the tumors in both immunized and non-immunized mice, suggesting the exemplary B5R mutation may promote delivery and spreading of the modified vaccinia virus in tumor.
- Increased viral replication in tumor were also observed in a plaque assay (FIGS. 3A-3B), which quantified the plaque forming capability of the viruses in the collected tumors, suggesting that the exemplary B5R mutation can promote replication of the modified vaccinia virus in tumor.
- EXAMPLE 2 EXEMPLARY MODFIED VACCINIA VIRUS HAVING AN EXEMPLARY EXOGENOUS NUCLEIC ACID THAT ENCODES CHEMOKINE RECEPTOR SHOWS ENHANCED THERAPEUTIC EFFECTS IN CANCER CELL LINES AND MURINE TUMOR MODELS
- the aim of this study was to explore the effects of several exemplary modified vaccinia viruses according to this disclosure, in each of which an exemplary exogenous nucleic acid encoding a chemokine receptor was added, in cancer cell lines and murine tumor models, in comparison with vaccinia viruses that do not have the exemplary exogenous nucleic acids.
- TK gene was deleted from the genome and an exogenous nucleic acid encoding mouse CCR5 was added.
- mCXCR4/TK- virus a virus that was deleted from the genome and an exogenous nucleic acid encoding mouse CXCR4 was added.
- TK- virus a virus that was deleted from the genome and an exogenous nucleic acid encoding mouse CXCR4 was added.
- TK- virus a virus was deleted. All three viruses were also engineered to express luciferase as a reporter.
- Each mouse was treated with a single injection of either one of the three viruses at a dose of 1 x 10 8 PFU.
- Number of viruses in the tumors was quantified by bioluminescence imaging and measurement of the luciferase activity in vivo, every day after the injection for three days (FIG. 4). It was observed that mCXCR4/TK- virus receiving mice showed significantly more photon intensity in the tumors, as compared to mice receiving mCCR5/TK- virus or TK- virus, suggesting expression of CXCR4 may promote viral delivery to the tumor. In contrast, CCR5/TK- showed relatively low photon intensity among the three over all three day measurement, suggesting expression of CCR5 may reduce viral delivery to the tumor.
- FIG. 5A Tumor volume was monitored as described above (FIG. 5A), showing that mCXCR4/TK- virus significantly delayed the tumor volume growth as compared to other two viruses and PBS sham control.
- FIG. 5B mouse survival percentage was also significantly improved by the administration of mCXCR4/TK- virus (identified in FIG. 5B as CXCR4).
- mice with B-cells depleted were administered to Balb/C mice having B-Cells and JH mice without B-cells, both of which had been implanted subcutaneously with pre-established 4T1 tumors.
- FIGS. 9A-9C consistent with the data above, in Balb/C mice, mCXCR4/TK- vims displayed increased accumulation in the tumors as measured by the bioluminescence imaging radiance. However, such an increase was not observed in JH mice, suggesting the enhanced
- B cells may serve as a vehicle for vaccinia vims to be delivered to the tumors in vivo.
- T cells were collected from the mice that had been implanted with 4T1 tumors subcutaneously and subsequently treated as described above, and their immune activity was examined by ELISpot assays that tested their interferon- ⁇ (IFNgamma) release in response to different immunogens.
- the tested T cells were recovered from spleens 14 days after the virus injection.
- T cells from TK- virus-treated mice displayed some immune response to tumor immunogens (4Tl-cell lysate), as compared to T cells from PBS-treated mice, whereas T cells from mCXCR4/TK- virus-treated mice displayed enhanced immune response (FIG. 11 A).
- CXCR4 expression did not seem to enhance T cell function against the vaccinia virus, as FIG. 11B shows that the interferon- ⁇ release, in response to inactivated vaccinia virus (VV) mixed with tumor cell 4T1 lysate, was not significantly different between T cells from TK- virus-treated mice and mCXCR4/TK- virus-treated mice.
- vaccinia viruses used were as follows: (i) a modified virus with the A52R gene deleted and an exogenous nucleic acid encoding mouse CXCR4 added, termed A52R- CXCR4+; (ii) a modified virus with the TK gene deleted and an exogenous nucleic acid encoding mouse GMCSF added, termed TK- GMCSF+; (iii) a modified virus with the TK gene deleted and no exogenous nucleic acid added, termed TK-, and (iv) a vehicle formulated buffer, termed VFB.
- VFB vehicle formulated buffer
- mice bearing RENCA tumors subcutaneously were treated with a single intravenous injection (1 x 10 7 PFU) of one of the four modified viruses. Tumors were harvested 24 hours later, and the number of viral genomes per milligram of tissue quantified by qPCR (FIG. 16). Higher numbers of A52R- CXCR4+ genomes were found in the tumors compared to the other modified viruses, supporting the above conclusion that viral CXCR4 expression can enhance viral delivery to tumors.
- EXAMPLE 3 EXEMPLARY VACCINIA VIRUSES HAVING EXEMPLARY EXOGENOUS NUCLEIC ACIDS THAT ENCODE EXTRACELLULAR MATRIX- DEGRADING ENZYMES SHOW ENHANCED THERAPEUTIC EFFECTS IN
- the aim of this study was to explore the effects of exemplary modified vaccinia virus according to this disclosure, where exemplary exogenous nucleic acids encoding extracellular matrix-degrading enzymes (such as hyaluronidases) were added, in murine tumor models, in comparison with vaccinia viruses that do not have an exemplary exogenous nucleic acid.
- exemplary exogenous nucleic acids encoding extracellular matrix-degrading enzymes such as hyaluronidases
- an exemplary modified vaccinia virus having an exogenous nucleic acid that encodes hyaluronidase PH-20 and having TK gene deleted (referred to herein as WR. TK-PH20) was tested in comparison with a WR.TK- only virus where there was only deletion of TK gene but no addition of PH-20 gene, together with another exemplary vaccinia virus having an exogenous nucleic acid that encodes a MMP8 and having TK gene deleted (referred to herein as WR.TK-mmp8). All three viruses were also engineered to express luciferase as a reporter. A single injection of either virus was given to BALB/c mice bearing RENCA tumors subcutaneously.
- FIG.13C there were a control group receiving water for all three injections, a Gemcitabine group receiving no virus injection but gemcitabine injections, a TK-w group receiving injection of WR.TK- but no gemcitabine, a TK-PH20DCK w group receiving injection of WR.TK-PH20DCK but no gemcitabine, a TK-+gem group receiving injections of both WR.TK- and gemcitabine, and a TK-PH20DCK+gem group receiving injections of both WR.TK-PH20CK and gemcitabine.
- exemplary vaccinia virus having an exogenous nucleic acid that encodes PH-20 with GPI-anchor and vaccinia virus having an exogenous nucleic acid that encodes PH-20 without GPI-anchor were examined and compared.
- BALB/c mice bearing RENCA tumors subcutaneously were treated with a single dose of 1 x 10 7 PFU of virus via intratumoral (IT) or intravenous (IV) delivery, and their tumor volumes was measured 45 days after the virus injection. Seven groups of mice were examined at this point (FIG. 14): one control group of mice receiving intravenous injection of no virus but sham control;
- WR.TK-PH20+(IT) group receiving intratumoral injection of WR.TK-PH20+ virus, where the PH20 expressed by the virus had a GPI-anchor; WR.TK-GMCSF(IT) group receiving intratumoral injection of WR.TK-GMCSF virus, where no PH20 was expressed but GMCSF; WR.TK-PH20+(no-gpi)(IT) group receiving intratumoral injection of WR.TK-PH20+(no- gpi) virus, where PH20 expressed by the virus had no GPI; WR.TK-PH20+(IV) group receiving intravenous injection of WR.TK -PH20+ virus, WR.TK-GMCSF(IV) group receiving intravenous injection of WR.TK-GMCSF virus, and WR.TK-PH20+(no-gpi)(IV) group receiving intravenous injection of WR.TK-PH20+(no-gpi) virus.
- TK-HysA TK-lin
- TK-sko hyaluronidase
- TK- modified virus In another experiment, cells in culture were infected with one of: the TK- modified virus, the TK- HysA modified virus, or the TK-MMP8 modified virus described above, each of which also expressed GFP.
- the TK-HysA and TK-MMP8 viruses replicated, spread, and prevented cancer cell expansion more so than the TK- virus, suggesting that HysA or MMP8 expression can enhance oncolytic virus replication, spread, and cancer cell killing (FIGS. 18A-18D).
- the TK-HysA and TK-MMP8 viruses replicated and spread more than the TK- virus, and the TK-HysA virus prevented cancer cell expansion more effectively than the TK- virus, supporting a role for HysA in enhancing oncolytic viral replication, spread, and cancer cell killing (FIGS. 19A-19D).
- TK- HysA modified virus ii) the TK-MMP8 modified virus, (iii) the TK-PH20-expressing modified virus described above (TK-PH20/TK-SPAM1), (iv) the TK- modified virus without an exogenous enzyme added, and (v) a vehicle formulated buffer (VFB).
- a vehicle formulated buffer VFB
- BALB/c mice bearing RENCA tumors subcutaneously were treated with a single intravenous injection (1 x 10 7 PFU) of one of the five viruses. Tumors were harvested 24 hours later, and the number of viral genomes per milligram of tissue quantified by qPCR (FIG. 20). Higher numbers of TK- HysA genomes were found in the tumors compared to the other viruses, suggesting that HysA expression can result in enhanced delivery of a modified vaccinia virus to tumors.
- mice bearing RENCA tumors subcutaneously were treated with one intratumoral injection (1 x 10 7 PFU) of the TK-HysA, TK-MMP8, TK-PH20 (labeled in FIG. 21 as SPAMl), or TK- modified virus, and tumor volume was monitored as described above. Intratumorally-delivered TK-HysA, TK-MMP8 and TK-PH20 delayed tumor growth more the TK- virus, suggesting that expression of HysA, MMP8 or PH20 can enhance the anti-tumoral efficacy of oncolytic viruses (FIG. 21).
- HysA modified viruses were generated wherein the A52R gene was deleted, and an exogenous nucleic acid encoding HysA inserted to the A52R locus (A52R- HysA) (labeled in FIG. 22A-D as WR. A52R- EL hysA GFP 1MOI).
- A52R- HysA modified virus
- the A52R-HysA modified virus successfully spread in cultures of LLC or MC38 cancer cells, and limited expansion of the cancer cells (FIGS. 22A- 22D).
- EXAMPLE 4 EXEMPLARY VACCINIA VIRUS HAVING AN
- the aim of this study was to explore the effects of an exemplary modified vaccinia virus according to this disclosure, where the vaccinia virus VHl gene was replaced with a mutated VHl gene from a different poxvirus, in murine tumor models, in comparison with vaccinia viruses that do not have the exemplary modifications.
- mice bearing RENCA tumors subcutaneously were treated with a single intratumoral injection (10 x 10 7 PFU) of WR.TK-GMCSF virus, WR.TK-VHlmut virus, or sham control.
- the WR.TK-VHlmut virus had TK gene deleted and VHl gene replaced with a VHl gene from a different species of poxvirus, which was also modified with certain mutations to be more active.
- the WR.TK-GMCSF virus had TK gene deleted and had an exogenous nucleic acid encoding GMCSF, but had no modification of VHl gene. Tumor volume growth was monitored as shown in FIG. 15 over the time after the virus injection by caliper measurement.
- EXAMPLE 5 CLINICAL STUDY OF AN EXEMPLARY MODIFIED VACCINIA VIRUS IN PATIENTS WITH A METASTATIC CANCER
- a Phase IB/2, open-label, study of an exemplary vaccinia virus (WR.TK- PH20.CXCR4) as disclosed herein is carried out in patients with a metastatic cancer.
- the study is an open-label, Phase IB/2 study evaluating the modified vaccinia virus WR.TK-PH20.CXCR4 in patients with a metastatic cancer.
- the study has 2 phases: a Dose Escalation/Confirmation Phase (Phase lb) and an Expansion Phase (Phase 2), with the Expansion Phase utilizing a Simon 2-stage design for each cohort.
- the modified vaccinia virus WR.TK-PH20.CXCR4 is a Western Reserve vaccinia virus, comprising a deletion of TK gene, an exogenous nucleic acid coding for PH20 and CXCR4. As implicated in animal studies, the deletion of TK and expression of PH20 and CXCR4 in vaccinia virus can result in greater therapeutic effects against cancer.
- Phase IB Dose escalation phase
- dose level 1 for WR. TK-PH20. CXCR4 virus is up to 5 xlO 9 PFU by intravenous injection once.
- dose level -1 for WR.TK-PH20.CXCR4 virus is set at up to 5 xl0 7 PFU once.
- Each dose level in the dose escalation phase enrolls between 6 and 12 evaluable patients.
- Any detected cumulative toxicity may require later dose reductions and/or other changes to the dosing schedule, as appropriate, including further refinement of the RP2D.
- Phase 2 In the Expansion Phase, WR.TK-PH20.CXCR4 virus is evaluated using the RP2D identified in the Dose Escalation/Confirmation Phase in patients with a metastatic cancer.
- patients with the metastatic cancer are randomized in a 2: 1 ratio to receive WR.TK-PH20.CXCR4 virus (at the RP2D) or placebo.
- the primary endpoint of this randomized component is progression free survival (PFS) as assessed by iRECIST.
- Secondary endpoints include durable remission rate (DRR), treatment free interval (TFI), quality of life (QoL), overall response rate (ORR), overall survival (OS), and safety.
- the duration of treatment for the test arm is 6 months, 9 months, 12 months, or 18 months, and that for the control arm is 4-6 months. Accrual is estimated to take 12 months, and the duration of the trial is projected to be 2-3 years.
- EXAMPLE 6 CLINICAL STUDY OF AN EXEMPLARY MODIFIED VACCINIA VIRUS IN PATIENTS WITH A CANCER
- a Phase IB/2, open-label, study of an exemplary vaccinia virus (WR.TK- PH20.CXCR4) as disclosed herein is carried out in patients with a cancer.
- the study is an open-label, Phase IB/2 study evaluating the modified vaccinia virus WR.TK-PH20.CXCR4 in patients with a cancer.
- the study has 2 phases: a Dose Escalation/Confirmation Phase (Phase lb) and an Expansion Phase (Phase 2), with the Expansion Phase utilizing a Simon 2-stage design for each cohort.
- the modified vaccinia virus WR.TK-PH20.CXCR4 is a Western Reserve vaccinia virus, comprising a deletion of TK gene, an exogenous nucleic acid coding for PH20 and CXCR4. As implicated in animal studies, the deletion of TK and expression of PH20 and CXCR4 in vaccinia virus can result in greater therapeutic effects against cancer.
- Phase IB Dose escalation phase
- DLT dose-limiting toxicities
- MTD maximum tolerated dose
- R2D recommended Phase 2 dose
- dose level 1 for WR.TK-PH20.CXCR4 virus is up to 5 xlO 9 PFU by intravenous injection once.
- dose level -1 for WR.TK-PH20.CXCR4 virus is set at up to 5 xl0 7 PFU once.
- Each dose level in the dose escalation phase enrolls between 6 and 12 evaluable patients.
- Any detected cumulative toxicity may require later dose reductions and/or other changes to the dosing schedule, as appropriate, including further refinement of the RP2D.
- Phase 2 In the Expansion Phase, WR.TK-PH20.CXCR4 virus is evaluated using the RP2D identified in the Dose Escalation/Confirmation Phase in patients with a cancer.
- patients with the cancer are randomized in a 2: 1 ratio to receive WR.TK-PH20.CXCR4 virus (at the RP2D) or placebo.
- the primary endpoint of this randomized component is progression free survival (PFS) as assessed by iRECIST.
- Secondary endpoints include durable remission rate (DRR), treatment free interval (TFI), quality of life (QoL), overall response rate (ORR), overall survival (OS), and safety.
- the duration of treatment for the test arm is 6 months, 9 months, 12 months, or 18 months, and that for the control arm is 4-6 months. Accrual is estimated to take 12 months, and the duration of the trial is projected to be 2-3 years.
- EXAMPLE 7 EXEMPLARY VACCINIA VIRUSES WITH EXEMPLARY MUTATIONS TO PROMOTE NK CELL ACTIVITY SHOW ENHANCED THERAPEUTIC EFFECTS IN MURINE TUMOR MODELS
- mice bearing RENCA tumors subcutaneously were treated with a single intratumoral injection (1 x 10 8 PFU) of K7R- IL15+ CCL5+, TK- LIGHT+, or TK-GMCSF+ viruses.
- Control mice received an intravenous injection of a control buffer. Tumor volume was quantified on day 34 after treatment. Tumor volume was smaller in mice having received the K7R-IL15+CCL5+ or TK-LIGHT+ modified viruses, suggesting that mutations in oncolytic viruses designed to promote NK cell activity can result in enhanced anti-cancer therapeutic effects (FIG. 23).
- mice bearing RENCA tumors subcutaneously were treated with a single intratumoral injection (1 x 10 7 PFU) of TK-LIGHT+, TK-GMCSF+, TK-ITAC + fractalkine+, A52R- IL15+/IL15R-a+, TK- ITAC+ LIGHT+ A52R- IL15+/IL15- Ra, or a vehicle formulated buffer, termed VFB, and tumor volume was monitored over time as described above.
- EXAMPLE 8 EXEMPLARY VACCINIA VIRUS WITH EXEMPLARY EXOGENOUS NUCLEIC ACIDS ENCODING A CHEMOKTNE RECEPTOR AND AN EXTRACELLULAR MATRIX-DE GRADING ENZYME SHOWS SPREAD BETWEEN AND KILLING OF CANCER CELLS
- TK- HysA A52R- CXCR4 a modified virus was developed wherein the A52R gene and TK gene were deleted, and exogenous nucleic acids encoding HysA and CXCR4 were inserted (TK- HysA A52R- CXCR4). LLC cancer cells in culture were infected with the TK- (labeled in FIGS. 25A-25B as WR TK- GFP 1MOI), A52R-HysA (labeled in FIGS. 25A-25B as WR A52R- EL HysA GFP 1MOI), or TK- HysA A52R- CXCR4 (labeled in FIGS.
- EXAMPLE 9 AN EXEMPLARY MODIFIED HIGH EEV-EXPRESSING VACCINIA VIRUS HAVING AN EXEMPLARY DELETION OF SCR1 SHOWS SPREAD BETWEEN AND KILLING OF CANCER CELLS
- IHDJ was selected as an exemplary high EEV-producing virus to be evaluated for oncolytic potential.
- a modified IHDJ virus was developed wherein the neutralizing antibody binding site on the surface of the EEV (B5R SCR1) was deleted (IHDJ-B5RcoASCRl).
- IHDJ-B5RcoASCRl both expressing GFP
- a plaque assay further supported the ability of the IHDJ and IHDJ-B5RcoASCRl viruses to spread between and kill cancer cells (FIG. 26C).
- Exemplary sequences for the viral backbone genes and viral proteins are provided in Table 4. Further provided are exemplary sequences for proteins expressed by various exogenous nucleic acid sequences that can be inserted into the modified oncolytic viruses described herein.
- the above described viral backbones genes and viral proteins, in the modified oncolytic viruses described herein can comprise sequences that are about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100%) identical to the exemplary sequences of viral backbones genes and viral proteins provided in Table 4.
- the above described proteins expressed from the exogenous nucleic acid sequences in the modified oncolytic viruses described herein can comprise sequences that are about 70%, about 75%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%), about 99%, or about 100% identical to the exemplary sequences of proteins provided in Table 4.
- A34R >sp 1 P210571
- A34 VACCC Protein A34 OS Vaccinia virus
- A33R >tr 1 Q71TT11 Q71TT1 9POXV
- A33R OS Vaccinia virus
- SPI-2 >sp 1 P150591 SPI2 VACCW Serine proteinase inhibitor 2
- VGF >sp 1 P011361 VGF VACCW Pro-vaccinia growth factor
- A36R >NC 006998.1:145059-145724 Vaccinia virus, complete genome
- A33R >NC 006998.1:143331-143888 Vaccinia virus, complete genome
- SPI-1 >M24217.1 Vaccinia virus serine protease inhibitor superfamily gene SPI-1
- SPI-2 >M24218.1 Vaccinia virus serine protease inhibitor superfamily gene SPI-2
- VGF >S61049.1
- VGF growth factor [vaccinia virus, LIVP,
- NIL >NC 006998.1 : C22172-21819 Vaccinia virus, complete genome
- Hyaluronida MRPFSLEVSLHLPWAMAAHLLPVCTLFLNLLSMTQGSRDPWPNQPFTTIWN se Bos ANTEWCMKKHGVDVDISIFDWTNPGQTFRGPNMTIFYSSQLGTYPYYTSAG taurus
- EPVFGGLPQNASLNAHLARTFQDILAAMP EPRFSGLAVIDWEAWRPRWAFNW PROTEIN/NUC EXEMPLARY AMINO ACID/NUCLEIC ACID SEQUENCES
- Hyaluronida MRMLRRHHISFRSFAGSSGTPQAVFTFLLLPCCLALDFRAPPLISNTSFLWA se Bos WNAPVERC RRFQLPPDLRLFSVKGSPQKSATGQFITLFYADRLGYYPHID taurus) EKTGKTVFGGIPQLGNLKSHMEKAKNDIAYYIPNDSVGLAVIDWENWRPTWA
- Hyaluronida MGMFRRHHISFRSFAGSSGTPQAVFTFLLLPCCLALDFRAPPLISNTSFLWA se Bos WNAPVERC RRFQLPPDLRLFSVKGSPQKSATGQFITLFYADRLGYYPHID taurus) EKTGKTVFGGIPQLGNLKSHLEKAKNDIAYYIPNDSVGLAVIDWENWRPTWA
- Hyaluronida SERPKRVFNIYWNVPTFMCHQYDLYFDEVTNFNIKRNSKDDFQGDKIAIFYD se (Vespula PGEFPALLSLKDGKYKKRNGGVPQEGNITIHLQKFIENLDKIYPNRNFSGIG vulgaris) VIDFERWRPI FRQNWGNMKIHKNFSIDLVRNEHPTWNKKMIELEASKRFEKY
- Hyaluronida DRTIWPKKGFSIYWNIPTHFCHNFGVYFKELKQFNIKYNSMNNFRGETISLF se Vespula YDPGNFPSMVLLKNGTYEIRNEGVPQKGNLTIHLEQFTKELDEIYPKKIAGG vulgaris
- Streptococc AFLRIMEKKDNNTRLWLSEMTSGTTNKHTLTKIYNPKLNVSEVTLELYYE us KGTGSATFDNISMKAKGPKDSEHPQPVTTQIEES TALNKNYVFNKADY agalactiae QYTLTNPSLGKIVGGILYPNATGSTTVKISDKSGKIIKEVPLSVTASTED serogroup KFTKLLDKWNDVTIGNHVYDTNDSNMQKINQKLDETNAKNIKTIKLDSNH
- KGEMMDLSRGRAISRENETSHTASATVMKSLLRLSDTMDESTKTKYKQIV KTSVKSDSSYDSNDTLNSYSDIDKMKKLMNDSTISKNDLTQQLKIYNDMD RVTYHNKELDFAFGLSMTSKNIARYENINGENLKGWHTGAGMSYLYNSDV KHYRDNFWATADMTRLPGTTTLNDMPSTNTKNDKSFVGGTKLNNKYASIG MDFENQDKTLTAKKSYFILNDKIVFIGTGIKSTDSSKNPVTSVENRKANG YKLFKGDIEITTSD AQETHSVFLESNDTKKNIGYHFLDKPKITVKKES HTGKWSEINKSQKTDDKKDEYYEVTQTHNTSDSKYAYVLYPGLSKSDFKS KNNNVSIVKQDEDFHVIKDNDGVFAG YSDSTKSFDINGTIVELKEKGM FVIKKKDDNTYECSFYNPTSTNSTSNKESKISVTGYTITNQSVSNFKESD
- Streptococc NSIIAGNDAYDKTNPDMVTFHNKAEKDAQNIIKSYQGPDHENRTYLWEHA us pyogenes KDYSASTNITKTYRNIEKIAKQITNPESCYYQDSKAIAIVKDGMAFMYEH serotype M2 AYNLNRENHQTTGKENKENWWVYEIGTPRAINNTLSLMYPYFTQEEILKY (strain TAPIEKFVPDPTRFRVRAANFSPFEANSGNLIDMGRVKLISGILRKDDLE MGAS10) ISDTIKAIEKVFTLVDEGNGFYQDGSLIDHWTNTQSPLYKKGIAYTGAY
- Streptococc NSIIAGNDAYDKTNPDMVTFHNKAEKDAQNIIKSYQGPDHENRTYLWEHA us pyogenes KDYSASTNITKTYRNIEKIAKQITNPESCYYQDSKAIAIVKDGMAFMYEH serotype M6 AYNLDRENHQTTGKENKENWWVYEIGTPRAINNTLSLMYPYFTQEEILKY
- Streptococc NSIIAGNDAYDKTNPDMVTFHNKAEKDAQNIIKSYQGPDHENRTYLGNMQ us pyogenes RIIPLLLISRKLTAILKKISKMKSLMEDSTISTNGLTQQLKIYNDMDRVT serotype YHNKGLDFAFGLSMTSKNVARYESINGENLKGWHTGAGMSYLYNSDVKHY M12 (strain RDNFWATADMKRLAGTTTLDNEEPKSTDVKKSSKTFVGGTKFDDQHASIG MGAS2) MDFENQDKTLTAKKSYFILNDKIVFLGTGIKSTDSSKNPVTTIENRKAND
- Streptococc NSIIAGNDAYVKTNPDMVTFHNKAEKDAQNIIKSYQGPDHENRTYLWEHA us pyogenes KDYSASTNITKTYRNIEKIAKQITNPESCYYQDSKAIAIVKDGMAFMYEH serotype AYNLNRENHQTTGKENKENWWVYEIGTPRAINNTLSLMYPYFTQEEILKY M12 (strain TAPIEKFVPDPTRFRVRAANFSPFEASSGNLIDMGRVKLISGILRKDDLE MGAS9) ISDTIKAIEKVFTLVDEGNGFYQDGSLIDHWTNAQSPLYKKGIAYTGAY
- Streptococc NSIIAGNDAYDKTNPDMVTFHNKAEKDAQNIIKSYQGPDHENRTYLWEHA us pyogenes KDYSASANITKTYRNIEKIAKQITNPESCYYQDSKAIAIVKDGMAFMYEH serotype AYNLDRENHQTTGKENKENWWVYEIGTPRAINNTLSLMYPYFTQEEILKY M28 TAPIEKFVPDPTRFRVRAANFSPFEANSGNLIDMGRVKLISGILRKDDLE
- Streptococc KEEKNLVANGEFISTTAPSGNWKELAATNWETWIPANVKKENGQVRIDEG us suis RLHISSTASYRVAVHQTVDVDPNKRYLFSYDVETKDLKGSGVRVRLRSLT
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Cell Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Plant Pathology (AREA)
- Toxicology (AREA)
- General Chemical & Material Sciences (AREA)
- Physics & Mathematics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Mycology (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3081436A CA3081436A1 (en) | 2017-10-31 | 2018-10-31 | Platform oncolytic vector for systemic delivery |
| EP18873293.7A EP3703723A4 (en) | 2017-10-31 | 2018-10-31 | ONCOLYTIC PLATFORM VECTOR FOR SYSTEMS ADMINISTRATION |
| KR1020207015355A KR20200081438A (ko) | 2017-10-31 | 2018-10-31 | 전신 전달을 위한 플랫폼 종양용해 벡터 |
| EP21191521.0A EP3973973A1 (en) | 2017-10-31 | 2018-10-31 | Platform oncolytic vector for systemic delivery |
| JP2020544346A JP7551496B2 (ja) | 2017-10-31 | 2018-10-31 | 全身送達のためのプラットフォーム腫瘍溶解性ベクター |
| CN201880085079.9A CN111556757A (zh) | 2017-10-31 | 2018-10-31 | 用于全身递送的平台溶瘤载体 |
| US16/759,705 US12036257B2 (en) | 2017-10-31 | 2018-10-31 | Platform oncolytic vector for systemic delivery |
| AU2018359420A AU2018359420A1 (en) | 2017-10-31 | 2018-10-31 | Platform oncolytic vector for systemic delivery |
| US17/192,736 US20210196770A1 (en) | 2017-10-31 | 2021-03-04 | Platform oncolytic vector for systemic delivery |
| US17/498,158 US12318419B2 (en) | 2017-10-31 | 2021-10-11 | Platform oncolytic vector for systemic delivery |
| US17/513,034 US12226440B2 (en) | 2017-10-31 | 2021-10-28 | Platform oncolytic vector for systemic delivery |
| US17/575,787 US12472217B2 (en) | 2017-10-31 | 2022-01-14 | Platform oncolytic vector for systemic delivery |
| JP2023222848A JP2024019723A (ja) | 2017-10-31 | 2023-12-28 | 全身送達のためのプラットフォーム腫瘍溶解性ベクター |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762579517P | 2017-10-31 | 2017-10-31 | |
| US62/579,517 | 2017-10-31 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/759,705 A-371-Of-International US12036257B2 (en) | 2017-10-31 | 2018-10-31 | Platform oncolytic vector for systemic delivery |
| US17/192,736 Continuation US20210196770A1 (en) | 2017-10-31 | 2021-03-04 | Platform oncolytic vector for systemic delivery |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019089755A1 true WO2019089755A1 (en) | 2019-05-09 |
Family
ID=66333632
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/058456 Ceased WO2019089755A1 (en) | 2017-10-31 | 2018-10-31 | Platform oncolytic vector for systemic delivery |
Country Status (8)
| Country | Link |
|---|---|
| US (5) | US12036257B2 (https=) |
| EP (2) | EP3703723A4 (https=) |
| JP (2) | JP7551496B2 (https=) |
| KR (1) | KR20200081438A (https=) |
| CN (1) | CN111556757A (https=) |
| AU (1) | AU2018359420A1 (https=) |
| CA (1) | CA3081436A1 (https=) |
| WO (1) | WO2019089755A1 (https=) |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111154806A (zh) * | 2020-01-08 | 2020-05-15 | 深圳普菲科生命科技有限公司 | 一种嵌合外源超级细胞因子的溶瘤病毒载体系统及其在药物中的应用 |
| WO2021076982A1 (en) * | 2019-10-16 | 2021-04-22 | KaliVir Immunotherapeutics LLC | Modified extracellular enveloped virus |
| WO2021116943A1 (en) * | 2019-12-12 | 2021-06-17 | Ignite Immunotherapy, Inc. | Variant oncolytic vaccinia virus and methods of use thereof |
| WO2022109133A1 (en) * | 2020-11-19 | 2022-05-27 | Kalivir Immunotherapeutics, Inc. | Oncolytic immunotherapy by tumor micro-environment remodeling |
| WO2022170919A1 (zh) * | 2021-02-09 | 2022-08-18 | 南京惟亚德生物医药有限公司 | 一种重组溶瘤腺病毒及其应用 |
| CN115175690A (zh) * | 2020-01-09 | 2022-10-11 | 辉瑞大药厂 | 重组牛痘病毒 |
| CN116133671A (zh) * | 2020-07-14 | 2023-05-16 | 辉瑞公司 | 重组牛痘病毒 |
| RU2805179C1 (ru) * | 2019-12-12 | 2023-10-11 | Игнайт Иммьюнотерапи, Инк. | Вариант онколитического вируса осповакцины и способы его применения |
| US11802292B2 (en) | 2018-01-05 | 2023-10-31 | Ottawa Hospital Research Institute | Modified orthopoxvirus vectors |
| US11963990B2 (en) | 2021-04-30 | 2024-04-23 | Kalivir Immunotherapeutics, Inc. | Oncolytic viruses for modified MHC expression |
| US12036257B2 (en) | 2017-10-31 | 2024-07-16 | Kalivir Immunotherapeutics, Inc. | Platform oncolytic vector for systemic delivery |
| WO2025184411A1 (en) | 2024-02-27 | 2025-09-04 | Calidi Biotherapeutics (Nevada), Inc. | Serum-resistant eev viruses and uses thereof |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20210369759A1 (en) * | 2020-01-29 | 2021-12-02 | Helix Nanotechnologies, Inc. | METHODS AND COMPOSITIONS FOR NUCLEIC ACID EXPRESSION INVOLVING INHIBITION of NF-kB PATHWAYS AND/OR IRF PATHWAYS |
| EP4298214A4 (en) * | 2021-02-23 | 2025-03-19 | Aldevron, LLC | NUCLEIC ACID VECTORS AND METHODS OF USE |
| CN113144181B (zh) * | 2021-04-20 | 2022-07-19 | 徐州医科大学 | 一种靶向b7h3的dna疫苗、制备方法及应用 |
| IL320318A (en) * | 2022-10-19 | 2025-06-01 | Kalivir Immunotherapeutics Inc | Nucleic acids encoding tgf-beta inhibitor and il-12 and uses thereof |
| CN116947981B (zh) * | 2023-07-07 | 2024-04-23 | 华中农业大学 | 一种lsdv和gtpv通用型诊断抗原及其单克隆抗体和应用 |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070298054A1 (en) * | 2003-12-05 | 2007-12-27 | Hokkaido Technology Licensing Office Co., Ltd. | Highly Safe Smallpox Vaccine Virus and Vaccinia Virus Vector |
| US20090208562A1 (en) * | 2005-01-20 | 2009-08-20 | Bror Morein | Vaccine Composition Comprising a Fibronectin Binding Protein or a Fibronectin Binding Peptide |
| US20100016224A1 (en) * | 2006-08-25 | 2010-01-21 | The Provost, Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabe | Compositions and methods for modulating an immune response |
| US20110053247A1 (en) * | 2008-03-06 | 2011-03-03 | David Baker | Large-scale production of soluble hyaluronidase |
| US20160235793A1 (en) * | 2013-08-22 | 2016-08-18 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Immuno-Oncolytic Therapies |
| WO2017043815A1 (en) * | 2015-09-08 | 2017-03-16 | Sillajen, Inc. | Modified oncolytic vaccinia viruses expressing a cytokine and a car- boxylesterase and methods of use thereof |
Family Cites Families (116)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4458066A (en) | 1980-02-29 | 1984-07-03 | University Patents, Inc. | Process for preparing polynucleotides |
| US4409450A (en) | 1982-07-29 | 1983-10-11 | Amp Incorporated | Double pole membrane switch having preferred sequence closing feature |
| ZA842025B (en) | 1983-03-21 | 1984-11-28 | Hoffmann La Roche | Interleuken-2 |
| FR2573436B1 (fr) | 1984-11-20 | 1989-02-17 | Pasteur Institut | Adn recombinant comportant une sequence nucleotidique codant pour un polypeptide determine sous le controle d'un promoteur d'adenovirus, vecteurs contenant cet adn recombinant, cellules eucaryotes transformees par cet adn recombinant, produits d'excretion de ces cellules transformees et leurs applications, notamment a la constitution de vaccins |
| US4797368A (en) | 1985-03-15 | 1989-01-10 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus as eukaryotic expression vector |
| US5139941A (en) | 1985-10-31 | 1992-08-18 | University Of Florida Research Foundation, Inc. | AAV transduction vectors |
| US5585362A (en) | 1989-08-22 | 1996-12-17 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy |
| WO1991018088A1 (en) | 1990-05-23 | 1991-11-28 | The United States Of America, Represented By The Secretary, United States Department Of Commerce | Adeno-associated virus (aav)-based eucaryotic vectors |
| US5173414A (en) | 1990-10-30 | 1992-12-22 | Applied Immune Sciences, Inc. | Production of recombinant adeno-associated virus vectors |
| US5252479A (en) | 1991-11-08 | 1993-10-12 | Research Corporation Technologies, Inc. | Safe vector for gene therapy |
| CA2130578A1 (en) | 1992-04-17 | 1993-10-28 | Geewananda P. Gunawardana | Taxol derivatives |
| EP1024198A3 (en) | 1992-12-03 | 2002-05-29 | Genzyme Corporation | Pseudo-adenoviral vectors for the gene therapy of haemophiliae |
| US5776468A (en) | 1993-03-23 | 1998-07-07 | Smithkline Beecham Biologicals (S.A.) | Vaccine compositions containing 3-0 deacylated monophosphoryl lipid A |
| FR2705361B1 (fr) | 1993-05-18 | 1995-08-04 | Centre Nat Rech Scient | Vecteurs viraux et utilisation en thérapie génique. |
| FR2705686B1 (fr) | 1993-05-28 | 1995-08-18 | Transgene Sa | Nouveaux adénovirus défectifs et lignées de complémentation correspondantes. |
| SK282843B6 (sk) | 1993-07-13 | 2002-12-03 | Rhone-Poulenc Rorer S. A. | Defektný rekombinantný adenovírus a farmaceutický prostriedok s jeho obsahom |
| US5543158A (en) | 1993-07-23 | 1996-08-06 | Massachusetts Institute Of Technology | Biodegradable injectable nanoparticles |
| EP1167379A3 (en) | 1994-07-15 | 2004-09-08 | University Of Iowa Research Foundation | Immunomodulatory oligonucleotides |
| US6207646B1 (en) | 1994-07-15 | 2001-03-27 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| IL116816A (en) | 1995-01-20 | 2003-05-29 | Rhone Poulenc Rorer Sa | Cell for the production of a defective recombinant adenovirus or an adeno-associated virus and the various uses thereof |
| UA68327C2 (en) | 1995-07-04 | 2004-08-16 | Gsf Forschungszentrum Fur Unwe | A recombinant mva virus, an isolated eukaryotic cell, infected with recombinant mva virus, a method for production in vitro of polypeptides with use of said cell, a method for production in vitro of virus parts (variants), vaccine containing the recombinant mva virus, a method for immunization of animals |
| US5912264A (en) | 1997-03-03 | 1999-06-15 | Bristol-Myers Squibb Company | 6-halo-or nitrate-substituted paclitaxels |
| JP4139860B2 (ja) | 1997-11-10 | 2008-08-27 | ストラカン インターナショナル リミティッド | 浸透増強および刺激減少システム |
| US6506559B1 (en) | 1997-12-23 | 2003-01-14 | Carnegie Institute Of Washington | Genetic inhibition by double-stranded RNA |
| AT406376B (de) | 1998-01-16 | 2000-04-25 | Immuno Ag | Chimäres poxvirus enthaltend eine retrovirale vektorkomponente |
| JPH11268865A (ja) | 1998-03-20 | 1999-10-05 | Omron Corp | 用紙仕分け装置及び方法 |
| AUPP249298A0 (en) | 1998-03-20 | 1998-04-23 | Ag-Gene Australia Limited | Synthetic genes and genetic constructs comprising same I |
| US6198323B1 (en) | 1999-01-28 | 2001-03-06 | Lucent Technologies Inc. | Flip-flop having gated inverter feedback structure with embedded preset/clear logic |
| US20040214783A1 (en) | 2002-05-08 | 2004-10-28 | Terman David S. | Compositions and methods for treatment of neoplastic disease |
| GB9927444D0 (en) | 1999-11-19 | 2000-01-19 | Cancer Res Campaign Tech | Inhibiting gene expression |
| US20030180352A1 (en) | 1999-11-23 | 2003-09-25 | Patel Mahesh V. | Solid carriers for improved delivery of active ingredients in pharmaceutical compositions |
| US6967023B1 (en) | 2000-01-10 | 2005-11-22 | Foamix, Ltd. | Pharmaceutical and cosmetic carrier or composition for topical application |
| CO5280224A1 (es) | 2000-02-02 | 2003-05-30 | Univ Florida State Res Found | Taxanos sustituidos con ester en c7, utiles como agentes antitumorales y composiciones farmaceuticas que los contienen |
| DK1263936T3 (da) | 2000-03-14 | 2006-02-13 | Bavarian Nordic As | andret stamme af den modificerede Vacciniavirus Ankara (MVA) |
| EP1272630A2 (en) | 2000-03-16 | 2003-01-08 | Genetica, Inc. | Methods and compositions for rna interference |
| ES2254408T4 (es) | 2000-04-25 | 2007-10-01 | Immunex Corporation | Procedimiento de tratamiento de tumores usando terapia fotodinamica. |
| US7179483B2 (en) | 2000-04-26 | 2007-02-20 | Watson Pharmaceuticals, Inc. | Compositions and methods for transdermal oxybutynin therapy |
| US20060057553A1 (en) | 2000-05-30 | 2006-03-16 | Estuardo Aguilar-Cordova | Chimeric viral vectors for gene therapy |
| US8512718B2 (en) | 2000-07-03 | 2013-08-20 | Foamix Ltd. | Pharmaceutical composition for topical application |
| JP4845327B2 (ja) | 2000-07-21 | 2011-12-28 | 千葉県 | 腫瘍特異的プロモーター |
| AU2002211490A1 (en) | 2000-10-04 | 2002-04-15 | The Trustees Of The University Of Pennsylvania | Compositions and methods of using capsid protein from flaviviruses and pestiviruses |
| EP1213025A1 (de) | 2000-12-06 | 2002-06-12 | Laboratoires Serobiologiques(Societe Anonyme) | Kosmetische und/oder dermopharmazeutische Zubereitungen enthaltend Extrakte aus den Blättern der Pflanze Argania spinosa |
| EP1341817A2 (en) | 2000-12-08 | 2003-09-10 | Novo Nordisk A/S | Tff peptides |
| ATE437221T1 (de) | 2001-05-14 | 2009-08-15 | Gbp Ip Llc | Lentivirale vektoren kodierend für gerinnungsfaktoren für die gentherapie |
| JP2003009883A (ja) | 2001-07-05 | 2003-01-14 | Mitsubishi Pharma Corp | マスト細胞の細胞死誘発剤 |
| WO2003035683A2 (en) | 2001-10-26 | 2003-05-01 | Uffe Holmskov | Surfactant protein-d and atherosclerosis |
| US7368122B1 (en) | 2002-03-08 | 2008-05-06 | Dow Pharmaceutical Sciences | Skin cream |
| KR20120002613A (ko) | 2002-08-12 | 2012-01-06 | 제네렉스, 인코포레이티드 | 폭스바이러스 및 암과 관련된 방법 및 조성물 |
| EP2186811A1 (en) | 2002-08-23 | 2010-05-19 | Sloan-Kettering Institute For Cancer Research | Synthesis of epothilones, intermediates thereto, analogues and uses thereof |
| GB0226251D0 (en) | 2002-11-11 | 2002-12-18 | San Raffaele Centro Fond | Acetylated protein |
| US20040143026A1 (en) | 2002-12-31 | 2004-07-22 | Shah Kishore R. | Bioadhesive hydrophilic composition for treatment of mammalian skin |
| NZ570709A (en) | 2003-06-13 | 2010-04-30 | Univ Pennsylvania | Nucleic acid sequences encoding and compositions comprising IgE signal peptide and/or IL-15 and methods for using the same |
| ATE420160T1 (de) | 2003-06-18 | 2009-01-15 | Genelux Corp | Modifizierte rekombinante vacciniaviren, verwendungen davon |
| AU2004272607B2 (en) | 2003-09-11 | 2008-11-06 | Cornerstone Therapeutics Inc. | Monoclonal antibodies against HMGB1 |
| EP1528101A1 (en) | 2003-11-03 | 2005-05-04 | ProBioGen AG | Immortalized avian cell lines for virus production |
| DE102004030044A1 (de) | 2004-06-22 | 2006-01-12 | Birken Gmbh | Triterpenhaltiger Oleogelbildner, triterpenhaltiges Oleogel und Verfahren zur Herstellung eines triterpenhaltigen Oleogels |
| US20100094560A1 (en) | 2006-08-15 | 2010-04-15 | Prometheus Laboratories Inc. | Methods for diagnosing irritable bowel syndrome |
| DK2062023T4 (en) | 2006-08-25 | 2017-02-20 | The Government Of The Us Secretary Dept Of Health And Human Services | INTERGENIC SITES BETWEEN CONSERVATED GENES THROUGH MODIFIED VACCINIA ANKARA (VAT) VACCINIAVIRUS |
| EP2097517B1 (en) | 2006-10-16 | 2014-06-04 | Genelux Corporation | Recombinant Lister strain vaccinia virus encoding an anti-VEGF single chain antibody |
| GB0702695D0 (en) | 2007-02-12 | 2007-03-21 | Ark Therapeutics Ltd | Production of vectors |
| US8003363B2 (en) | 2007-05-14 | 2011-08-23 | Bavarian Nordic A/S | Purification of vaccinia virus- and recombinant vaccinia virus-based vaccines |
| ES2560871T3 (es) | 2007-07-10 | 2016-02-23 | Apogenix Gmbh | Proteínas de fusión de colectina de la superfamilia de TNF |
| WO2009054996A2 (en) | 2007-10-25 | 2009-04-30 | Genelux Corporation | Systems and methods for viral therapy |
| US8313896B2 (en) | 2008-04-04 | 2012-11-20 | The General Hospital Corporation | Oncolytic herpes simplex virus immunotherapy in the treatment of brain cancer |
| ES2532896T5 (es) | 2008-05-14 | 2018-03-20 | Immatics Biotechnologies Gmbh | Péptidos del MHC de clase II novedosos y potentes derivados de survivina y neurocan |
| EP2349296B1 (en) | 2008-08-21 | 2017-04-05 | Ottawa Hospital Research Institute | Engineered synergistic oncolytic viral symbiosis |
| CN101381742A (zh) | 2008-10-23 | 2009-03-11 | 浙江理工大学 | 晚期启动子靶向性调控溶瘤腺病毒pCN305载体及其构建方法与应用 |
| EP2184297A1 (en) | 2008-11-07 | 2010-05-12 | Hla-G Technologies | HLA-G polypeptides and pharmaceutical uses thereof |
| ES2385251B1 (es) | 2009-05-06 | 2013-05-06 | Fundació Privada Institut D'investigació Biomèdica De Bellvitge | Adenovirus oncolíticos para el tratamiento del cáncer. |
| CA2709292A1 (en) | 2009-07-10 | 2011-01-10 | The Governors Of The University Of Alberta | Oncolytic viruses and methods for treating neoplastic disorders |
| JP5686814B2 (ja) | 2010-09-17 | 2015-03-18 | 独立行政法人科学技術振興機構 | Hmgbタンパクによって仲介される免疫応答の活性化の抑制剤及びスクリーニング方法 |
| WO2012089225A1 (en) | 2010-12-29 | 2012-07-05 | Curevac Gmbh | Combination of vaccination and inhibition of mhc class i restricted antigen presentation |
| AU2012204467B2 (en) | 2011-01-04 | 2016-08-18 | Sillajen, Inc. | Generation of antibodies to tumor antigens and generation of tumor specific complement dependent cytotoxicity by administration of oncolytic vaccinia virus |
| EP2527459A1 (en) | 2011-05-02 | 2012-11-28 | Rheinische Friedrich-Wilhelms-Universität Bonn | Blood-based gene detection of non-small cell lung cancer |
| EP2739293B1 (en) | 2011-08-05 | 2020-06-10 | SillaJen Biotherapeutics, Inc. | Methods and compositions for production of vaccina virus |
| FI20115914L (fi) | 2011-09-16 | 2013-03-17 | Oncos Therapeutics Ltd | Muunnettu onkolyyttinen virus |
| US9283287B2 (en) | 2012-04-02 | 2016-03-15 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of nuclear proteins |
| US10806697B2 (en) | 2012-12-21 | 2020-10-20 | Therapeuticsmd, Inc. | Vaginal inserted estradiol pharmaceutical compositions and methods |
| EP3473708B1 (en) | 2012-07-24 | 2021-01-27 | The General Hospital Corporation | Oncolytic virus therapy for resistant tumors |
| WO2014048500A1 (en) | 2012-09-28 | 2014-04-03 | Probiogen Ag | Novel mva virus and uses thereof |
| US9180091B2 (en) | 2012-12-21 | 2015-11-10 | Therapeuticsmd, Inc. | Soluble estradiol capsule for vaginal insertion |
| KR20140122603A (ko) | 2013-04-10 | 2014-10-20 | 신라젠(주) | 세포외 피막성 백시니아 바이러스의 생성과 관련된 단백질을 코딩하는 폴리뉴클레오티드로 형질전환된 숙주세포 |
| DK2986311T3 (en) | 2013-04-18 | 2019-02-25 | Tilt Biotherapeutics Oy | IMPROVED ADOPTIVE CELL THERAPY |
| KR102322510B1 (ko) | 2013-07-18 | 2021-11-08 | 브이아이비 브이지더블유 | 수용체 결합친화성이 현격히 감소된 사이토카인을 수반하는 푸소카인 |
| US10238700B2 (en) | 2014-01-02 | 2019-03-26 | Genelux Corporation | Oncolytic virus adjunct therapy with agents that increase virus infectivity |
| KR102442436B1 (ko) * | 2014-03-14 | 2022-09-15 | 노파르티스 아게 | Lag-3에 대한 항체 분자 및 그의 용도 |
| MA39818A (fr) | 2014-03-30 | 2017-02-08 | Benevir Biopharm Inc | Virus oncolytiques « armés » comprenant un inhibiteur de tap exogène et leurs utilisations thérapeutiques |
| US20160060311A1 (en) | 2014-08-27 | 2016-03-03 | Daewoong Jo | Development of Protein-Based Biotherapeutics That Penetrates Cell-Membrane and Induces Anti-Lung Cancer Effect - Improved Cell-Permeable Suppressor of Cytokine Signaling (iCP-SOCS3) Proteins, Polynucleotides Encoding the Same, and Anti-Lung Cancer Compositions Comprising the Same |
| PT3186281T (pt) | 2014-08-28 | 2019-07-10 | Halozyme Inc | Terapia de combinação com uma enzima de degradação de hialuronano e um inibidor de pontos de verificação imunológica |
| BR112017007765B1 (pt) * | 2014-10-14 | 2023-10-03 | Halozyme, Inc | Composições de adenosina deaminase-2 (ada2), variantes do mesmo e métodos de usar o mesmo |
| CN105829930B (zh) | 2014-10-24 | 2019-04-26 | 华为技术有限公司 | 模式复用解复用器和交换节点 |
| CN115300622A (zh) | 2015-02-25 | 2022-11-08 | 纪念斯隆-凯特琳癌症中心 | 使用灭活的修饰的痘苗病毒安卡拉作为实体肿瘤的单一免疫疗法或与免疫检查点阻断剂组合 |
| EP3217993A1 (en) | 2015-07-20 | 2017-09-20 | Virttu Biologics Limited | Treatment of cancer by infusion of oncolytic herpes simplex virus to the blood |
| EP4643874A3 (en) | 2015-12-22 | 2026-02-11 | Novartis AG | Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy |
| KR20180133395A (ko) | 2016-02-25 | 2018-12-14 | 메모리얼 슬로안 케터링 캔서 센터 | 암 면역요법을 위한, 인간 flt3l 또는 gm-csf의 발현이 있거나 없으며 티미딘 키나제가 결실된 복제 가능 약독화 백시니아 바이러스 |
| WO2017165464A1 (en) | 2016-03-21 | 2017-09-28 | Elstar Therapeutics, Inc. | Multispecific and multifunctional molecules and uses thereof |
| AU2017332367B2 (en) | 2016-09-21 | 2021-12-23 | Stephen H. Thorne | High mobility group box i mutant |
| WO2018058258A1 (en) | 2016-09-30 | 2018-04-05 | University Health Network | Recombinant oncolytic viruses for cancer therapy |
| WO2018091680A1 (en) | 2016-11-18 | 2018-05-24 | Transgene Sa | Cowpox-based oncolytic vectors |
| US11185586B2 (en) | 2016-11-22 | 2021-11-30 | Alloplex Biotherapeutics, Inc. | Allogeneic tumor cell vaccine |
| KR20190112263A (ko) | 2016-12-12 | 2019-10-04 | 멀티비르 인코포레이티드 | 암 및 감염성 질환의 치료 및 예방을 위한 바이러스 유전자 치료요법 및 면역 체크포인트 억제제를 포함하는 방법 및 조성물 |
| AU2018223211B2 (en) | 2017-02-21 | 2025-02-27 | Adelaide university | T cells expressing chemokine receptors for treating cancer |
| TWI672677B (zh) | 2017-03-31 | 2019-09-21 | 鈺立微電子股份有限公司 | 用以融合多深度圖的深度圖產生裝置 |
| WO2019055860A1 (en) | 2017-09-15 | 2019-03-21 | The Texas A&M University System | METHODS FOR IMPROVING IMMUNOTHERAPY IN THE TREATMENT OF CANCER |
| EP3703723A4 (en) | 2017-10-31 | 2021-12-15 | KaliVir Immunotherapeutics, Inc. | ONCOLYTIC PLATFORM VECTOR FOR SYSTEMS ADMINISTRATION |
| WO2019148109A1 (en) | 2018-01-26 | 2019-08-01 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Expression of metabolic modulators in tumor microenvironment to improve tumor therapy |
| EP3788142A4 (en) | 2018-05-02 | 2022-04-27 | Tonix Pharma Holdings Limited | SYNTHETIC CHIMERIC VACCINE VIRUS |
| EP3833762A4 (en) | 2018-08-09 | 2022-09-28 | Verseau Therapeutics, Inc. | Oligonucleotide compositions for targeting ccr2 and csf1r and uses thereof |
| CA3116192C (en) | 2018-11-06 | 2025-09-23 | Calidi Biotherapeutics (Nevada), Inc. | IMPROVED SYSTEMS FOR CELL-MEDIATED ONCOLYTIC VIRAL THERAPY |
| TW202038994A (zh) | 2019-01-14 | 2020-11-01 | 美商醫格耐免疫治療公司 | 重組痘瘡病毒及其使用方法 |
| WO2020165730A1 (en) | 2019-02-14 | 2020-08-20 | Ignite Immunotherapy, Inc. | Recombinant vaccinia virus and methods of use thereof |
| US20230405105A1 (en) | 2019-09-20 | 2023-12-21 | Transgene Sa | Combination of a poxvirus encoding hpv polypeptides with an anti-pd-l1 antibody |
| WO2021116943A1 (en) | 2019-12-12 | 2021-06-17 | Ignite Immunotherapy, Inc. | Variant oncolytic vaccinia virus and methods of use thereof |
| WO2021140435A1 (en) | 2020-01-09 | 2021-07-15 | Pfizer Inc. | Recombinant vaccinia virus |
| AU2021310520A1 (en) | 2020-07-14 | 2023-02-16 | Pfizer Inc. | Recombinant vaccinia virus |
| CN112668865A (zh) | 2020-12-23 | 2021-04-16 | 贵阳市城市轨道交通集团有限公司 | 一种城市地铁风险动态分析方法 |
-
2018
- 2018-10-31 EP EP18873293.7A patent/EP3703723A4/en active Pending
- 2018-10-31 KR KR1020207015355A patent/KR20200081438A/ko not_active Ceased
- 2018-10-31 CA CA3081436A patent/CA3081436A1/en active Pending
- 2018-10-31 WO PCT/US2018/058456 patent/WO2019089755A1/en not_active Ceased
- 2018-10-31 JP JP2020544346A patent/JP7551496B2/ja active Active
- 2018-10-31 CN CN201880085079.9A patent/CN111556757A/zh active Pending
- 2018-10-31 EP EP21191521.0A patent/EP3973973A1/en active Pending
- 2018-10-31 AU AU2018359420A patent/AU2018359420A1/en not_active Abandoned
- 2018-10-31 US US16/759,705 patent/US12036257B2/en active Active
-
2021
- 2021-03-04 US US17/192,736 patent/US20210196770A1/en active Pending
- 2021-10-11 US US17/498,158 patent/US12318419B2/en active Active
- 2021-10-28 US US17/513,034 patent/US12226440B2/en active Active
-
2022
- 2022-01-14 US US17/575,787 patent/US12472217B2/en active Active
-
2023
- 2023-12-28 JP JP2023222848A patent/JP2024019723A/ja active Pending
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070298054A1 (en) * | 2003-12-05 | 2007-12-27 | Hokkaido Technology Licensing Office Co., Ltd. | Highly Safe Smallpox Vaccine Virus and Vaccinia Virus Vector |
| US20090208562A1 (en) * | 2005-01-20 | 2009-08-20 | Bror Morein | Vaccine Composition Comprising a Fibronectin Binding Protein or a Fibronectin Binding Peptide |
| US20100016224A1 (en) * | 2006-08-25 | 2010-01-21 | The Provost, Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabe | Compositions and methods for modulating an immune response |
| US20110053247A1 (en) * | 2008-03-06 | 2011-03-03 | David Baker | Large-scale production of soluble hyaluronidase |
| US20160235793A1 (en) * | 2013-08-22 | 2016-08-18 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Immuno-Oncolytic Therapies |
| WO2017043815A1 (en) * | 2015-09-08 | 2017-03-16 | Sillajen, Inc. | Modified oncolytic vaccinia viruses expressing a cytokine and a car- boxylesterase and methods of use thereof |
Non-Patent Citations (5)
| Title |
|---|
| CHERTOVA ET AL.: "Characterization and Favorable in Vivo Properties of Heterodimeric Soluble IL -15/ IL -1 5RaALPHA Cytokine Compared to IL -15 Monomer", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 288, 6 May 2013 (2013-05-06), pages 18093 - 18103, XP055134195 * |
| GIL ET AL.: "Targeting CXCL12/CXCR4 Signaling with Oncolytic Virotherapy Disrupts Tumor Vasculature and Inhibits Breast Cancer Metastases", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 110, no. 14, 13 March 2013 (2013-03-13), pages 1291 - 1300, XP055070607 * |
| LAWLER ET AL.: "Oncolytic Viruses in Cancer Treatment", JAMA ONCOLOGY, vol. 3, no. 6, 1 June 2017 (2017-06-01), pages 841 - 849, XP055703235 * |
| NISHIO ET AL.: "Oncolytic Virus Expressing RANTES and IL -15 Enhances Function of CAR-Modified T Cells in Solid Tumors", ONCOIMMUNOLOGY, vol. 4, no. 2, 6 March 2015 (2015-03-06), pages 1 - 3, XP055703238 * |
| See also references of EP3703723A4 * |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12318419B2 (en) | 2017-10-31 | 2025-06-03 | Kalivir Immunotherapeutics, Inc. | Platform oncolytic vector for systemic delivery |
| US12226440B2 (en) | 2017-10-31 | 2025-02-18 | Kalivir Immunotherapeutics, Inc. | Platform oncolytic vector for systemic delivery |
| US12036257B2 (en) | 2017-10-31 | 2024-07-16 | Kalivir Immunotherapeutics, Inc. | Platform oncolytic vector for systemic delivery |
| US12472217B2 (en) | 2017-10-31 | 2025-11-18 | Kalivir Immunotherapeutics, Inc. | Platform oncolytic vector for systemic delivery |
| US11802292B2 (en) | 2018-01-05 | 2023-10-31 | Ottawa Hospital Research Institute | Modified orthopoxvirus vectors |
| WO2021076982A1 (en) * | 2019-10-16 | 2021-04-22 | KaliVir Immunotherapeutics LLC | Modified extracellular enveloped virus |
| CN115380041A (zh) * | 2019-12-12 | 2022-11-22 | 伊格奈特免疫疗法公司 | 变体溶瘤痘苗病毒及其使用方法 |
| RU2805179C1 (ru) * | 2019-12-12 | 2023-10-11 | Игнайт Иммьюнотерапи, Инк. | Вариант онколитического вируса осповакцины и способы его применения |
| WO2021116943A1 (en) * | 2019-12-12 | 2021-06-17 | Ignite Immunotherapy, Inc. | Variant oncolytic vaccinia virus and methods of use thereof |
| CN111154806A (zh) * | 2020-01-08 | 2020-05-15 | 深圳普菲科生命科技有限公司 | 一种嵌合外源超级细胞因子的溶瘤病毒载体系统及其在药物中的应用 |
| CN115175690A (zh) * | 2020-01-09 | 2022-10-11 | 辉瑞大药厂 | 重组牛痘病毒 |
| CN116133671A (zh) * | 2020-07-14 | 2023-05-16 | 辉瑞公司 | 重组牛痘病毒 |
| JP2023552289A (ja) * | 2020-11-19 | 2023-12-15 | カリヴィル イムノセラピューティクス, インコーポレイテッド | 腫瘍微小環境リモデリングによる腫瘍溶解性免疫療法 |
| US12403165B2 (en) | 2020-11-19 | 2025-09-02 | KaliVir Immunotherapeutcs, Inc. | Oncolytic immunotherapy by tumor micro-environment remodeling |
| WO2022109133A1 (en) * | 2020-11-19 | 2022-05-27 | Kalivir Immunotherapeutics, Inc. | Oncolytic immunotherapy by tumor micro-environment remodeling |
| WO2022170919A1 (zh) * | 2021-02-09 | 2022-08-18 | 南京惟亚德生物医药有限公司 | 一种重组溶瘤腺病毒及其应用 |
| US12016893B2 (en) | 2021-04-30 | 2024-06-25 | Kalivir Immunotherapeutics, Inc. | Oncolytic viruses for modified MHC expression |
| US11963990B2 (en) | 2021-04-30 | 2024-04-23 | Kalivir Immunotherapeutics, Inc. | Oncolytic viruses for modified MHC expression |
| WO2025184411A1 (en) | 2024-02-27 | 2025-09-04 | Calidi Biotherapeutics (Nevada), Inc. | Serum-resistant eev viruses and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| US20210196770A1 (en) | 2021-07-01 |
| CA3081436A1 (en) | 2019-05-09 |
| JP7551496B2 (ja) | 2024-09-17 |
| EP3703723A4 (en) | 2021-12-15 |
| US20220016192A1 (en) | 2022-01-20 |
| US20220125865A1 (en) | 2022-04-28 |
| EP3973973A1 (en) | 2022-03-30 |
| JP2021500932A (ja) | 2021-01-14 |
| EP3703723A1 (en) | 2020-09-09 |
| KR20200081438A (ko) | 2020-07-07 |
| AU2018359420A1 (en) | 2020-06-04 |
| US12472217B2 (en) | 2025-11-18 |
| US20220054565A1 (en) | 2022-02-24 |
| US12318419B2 (en) | 2025-06-03 |
| CN111556757A (zh) | 2020-08-18 |
| US20210093684A1 (en) | 2021-04-01 |
| US12036257B2 (en) | 2024-07-16 |
| JP2024019723A (ja) | 2024-02-09 |
| US12226440B2 (en) | 2025-02-18 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12472217B2 (en) | Platform oncolytic vector for systemic delivery | |
| AU2022200169B2 (en) | High mobility group box i mutant | |
| KR102619496B1 (ko) | Stat3를 타겟으로 하는 종양용해성 바이러스 | |
| US20250249054A1 (en) | Methods of Treating Cancer | |
| US12403165B2 (en) | Oncolytic immunotherapy by tumor micro-environment remodeling | |
| WO2019046619A1 (en) | TP53 GENE AS A BIOMARKER FOR REACTIVITY TO IMMUNOTHERAPY | |
| KR20220082025A (ko) | 변형된 세포외 외피보유 바이러스 | |
| HK40058302A (en) | Methods of treating cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18873293 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3081436 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020544346 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20207015355 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018359420 Country of ref document: AU Date of ref document: 20181031 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018873293 Country of ref document: EP Effective date: 20200602 |
|
| WWR | Wipo information: refused in national office |
Ref document number: 1020207015355 Country of ref document: KR |