WO2019039891A1 - 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도 - Google Patents

중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도 Download PDF

Info

Publication number
WO2019039891A1
WO2019039891A1 PCT/KR2018/009754 KR2018009754W WO2019039891A1 WO 2019039891 A1 WO2019039891 A1 WO 2019039891A1 KR 2018009754 W KR2018009754 W KR 2018009754W WO 2019039891 A1 WO2019039891 A1 WO 2019039891A1
Authority
WO
WIPO (PCT)
Prior art keywords
chain variable
variable region
monoclonal antibody
respiratory syndrome
present
Prior art date
Application number
PCT/KR2018/009754
Other languages
English (en)
French (fr)
Inventor
이한샘
최장훈
김성순
왕링슈
그레이햄바니
마스콜라존
Original Assignee
대한민국(관리부서 질병관리본부장)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 대한민국(관리부서 질병관리본부장) filed Critical 대한민국(관리부서 질병관리본부장)
Priority to US16/641,580 priority Critical patent/US20210355193A1/en
Publication of WO2019039891A1 publication Critical patent/WO2019039891A1/ko
Priority to US17/952,308 priority patent/US20230265169A1/en

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • C07K16/1002—Coronaviridae
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56983—Viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
    • G01N2333/08—RNA viruses
    • G01N2333/165—Coronaviridae, e.g. avian infectious bronchitis virus
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2469/00—Immunoassays for the detection of microorganisms
    • G01N2469/10—Detection of antigens from microorganism in sample from host

Definitions

  • the present invention relates to monoclonal antibodies against spike proteins of the respiratory syndrome coronavirus and their uses.
  • MERS Middle East Respiratory Syndrome
  • MERS-CoV beta-coronavirus
  • SARS severe acute respiratory syndrome
  • MERS-CoV a newly discovered beta-coronavirus ( ⁇ CoV) in 2012, is an approximately 30,000 kb (+) - sense single stranded RNA virus It is a virus similar to severe acute respiratory syndrome (SARS) virus.
  • MERS-CoV binds to the human DPP4 (dipeptidyl peptidase 4) receptor using a spike protein (S protein) and penetrates into cells (Wang N, Shi X, Jiang LJ, Zhang S, Wang D, Tong P, Guo D, et al ., Cell Research. 2013: 23: 986).
  • MERS-CoV has a latency of about one week and causes severe respiratory symptoms such as high fever, cough, and difficulty in breathing.
  • Interferon is an immune protein that is released when a virus or a bacterium enters the human body. It induces the viruses to release antiviral cytokines to nearby cells, thereby suppressing virus multiplication and bringing in immune cells to remove virus-infected cells.
  • interferon causes side effects such as decreased bone marrow function, anemia, a decrease in white blood cell count, or a decrease in platelet count.
  • Ribavirin another therapeutic agent, inhibits the proliferation of RNA by inhibiting the synthesis of various types of viruses in the form of nucleoside analogues.
  • ribavirin causes side effects such as toxicity, carcinogenesis or hemolytic anemia.
  • the clinical basis for administering interferon and ribavirin for the treatment of MERS is also poor.
  • MERS In rhesus monkey animal models, MERS was shown to be effective when mixed with interferon and ribavirin (Falzarano D, Wit E, Rasmussen AL et al ., Nature Medicine, 2013, 19, 10, p1313-1318) In the Middle East, interferon and ribavirin were mixed and showed no significant effect when injected into a total of five patients with severe conditions (Al-Tawfiq JA, Momattin H., Dib J et al ., International Journal of Infectious Diseases 2014 , 20, p42-46). Thus, there is a need to develop biologically safe therapeutic antibodies that can be used in severe, immunocompromised, and underlying disease patients, effectively inhibiting the growth of viruses.
  • Korean Patent Registration No. 10-1593641 discloses a monoclonal antibody that specifically binds to MERS-CoV nucleocapsid and a composition for MERS-CoV diagnosis comprising the same.
  • the present inventors produced 24 monoclonal antibodies specifically binding to the spike protein of MERS-CoV as a result of the development of therapeutic antibody against MERS-CoV, and 11 of them (77-A5, Co-V and the S1 antigen, respectively, of the MERS-CoV and the S1-A5, 77-A6, And 90-F1, 90-E5, 90-E6, 90-F2, 77-A5 and 77-A6 antibodies were superior to the MERS-CoV RBD antigen.
  • the antibodies to 77-A5, 77-A6, 90-E5, 90-E6, 90-F1 and 90-F2 exhibit neutralizing ability against MERS pseudovirus and MERS-CoV, and 90-B2 and 90- MERS-CoV.
  • the present inventors have completed the present invention by confirming that these antibodies have a certain monomer form and excellent physical stability.
  • Another object of the present invention is to provide a gene encoding the monoclonal antibody of the present invention, a recombinant vector containing the same, and a host cell into which the gene or the recombinant vector is introduced.
  • Another object of the present invention is to provide a preventive, therapeutic or diagnostic use for a respiratory syndrome of the middle ear comprising the monoclonal antibody of the present invention.
  • the present invention provides a medicament having a complementarity determining region (CDR) comprising an amino acid sequence represented by SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, Syndrome Coronavirus spike proteins that provide a heavy chain variable region of a monoclonal antibody that specifically binds to the spike protein of the coronavirus.
  • CDR complementarity determining region
  • the present invention also provides a gene encoding a heavy chain variable region of a monoclonal antibody of the present invention.
  • the present invention also provides a recombinant vector containing a gene encoding a heavy chain variable region of the monoclonal antibody of the present invention.
  • the present invention provides a gene encoding a heavy chain variable region of the monoclonal antibody of the present invention, or a host cell into which a recombinant vector containing the gene is introduced.
  • the present invention also provides a composition for preventing, treating or diagnosing a respiratory syndrome of the middle ear comprising the heavy chain variable region of the monoclonal antibody of the present invention.
  • the present invention also provides a kit for detecting or quantifying an antigen of a respiratory syndrome of the Middle East comprising the heavy chain variable region of the monoclonal antibody of the present invention.
  • the present invention also relates to the use of a medicament for the treatment of the respiratory syndrome coronavirus of the middle ear respiratory syndrome wherein the complementarity determining regions (CDRs) are composed of the amino acid sequences of SEQ ID NOS: 2, 4, 6, 8, 10, 12, 14, 16, 18, Providing a light chain variable region of a monoclonal antibody that specifically binds to a spike protein.
  • CDRs complementarity determining regions
  • the present invention also provides a gene encoding a light chain variable region of the monoclonal antibody of the present invention.
  • the present invention also provides a recombinant vector containing a gene encoding a light chain variable region of the monoclonal antibody of the present invention.
  • the present invention provides a gene encoding a light chain variable region of the monoclonal antibody of the present invention, or a host cell into which a recombinant vector containing the gene is introduced.
  • the present invention also provides a composition for preventing, treating or diagnosing a respiratory syndrome of the middle ear comprising a light chain variable region of the monoclonal antibody of the present invention.
  • the present invention also provides kits for detecting or quantifying antigens of the respiratory syndrome of the Middle East comprising the light chain variable region of the monoclonal antibody of the present invention.
  • the present invention also relates to a polypeptide comprising a heavy chain variable region having an amino acid sequence represented by SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 or 21, Comprising a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 6, 8, 10, 12, 14, 16, 18, 20 or 22, provided a monoclonal antibody that specifically binds to a coronavirus spike protein of the middle respiratory syndrome do.
  • the present invention also provides a gene encoding a monoclonal antibody of the present invention.
  • the present invention also provides a recombinant vector containing the gene encoding the monoclonal antibody of the present invention.
  • the present invention provides a gene encoding a monoclonal antibody of the present invention, or a host cell into which a recombinant vector containing the gene is introduced.
  • the present invention also provides a composition for the prevention, treatment or diagnosis of a respiratory syndrome of the Middle East comprising the monoclonal antibody of the present invention.
  • the present invention also provides a kit for detecting or quantifying an antigen of a respiratory syndrome of the Middle East comprising the monoclonal antibody of the present invention.
  • the present invention also provides a method of preventing, treating or diagnosing a respiratory syndrome of the Middle East comprising administering to a subject a heavy chain variable region of the present invention.
  • the present invention also provides the use of the heavy chain variable region of the invention for use in the manufacture of a medicament for the prevention, treatment or diagnosis of the respiratory syndrome of the Middle East.
  • the present invention also provides a method of preventing, treating or diagnosing a respiratory syndrome of the Middle East comprising administering a light chain variable region of the present invention to a subject.
  • the present invention also provides the use of the light chain variable region of the invention for use in the manufacture of a medicament for the prevention, treatment or diagnosis of the respiratory syndrome of the Middle East.
  • the present invention also provides a method for preventing, treating or diagnosing a respiratory syndrome of the Middle East comprising administering a monoclonal antibody of the present invention to a subject.
  • the present invention provides the use of the monoclonal antibodies of the invention for use in the manufacture of medicaments for the prevention, treatment or diagnosis of the respiratory syndrome of the Middle East.
  • the monoclonal antibodies 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90- 90-F1, 90-E5, 90-E6, 90-F2, 77-A5 and 77-A6 monoclonal antibodies of the present invention have excellent binding affinity to the S1 domain of the whole spike protein of MERS- It has excellent adhesion to RBS (Receptor Binding Domain) antigen of MERS-CoV.
  • the antibodies to 77-A5, 77-A6, 90-E5, 90-E6, 90-F1 and 90-F2 exhibit neutralizing ability against MERS pseudovirus and MERS-CoV, and 90-B2 and 90- MERS-CoV. Since the monoclonal antibody has a constant monomer form and is excellent in stability, it can be usefully used for prevention, treatment, or diagnosis of MERS.
  • FIG. 2 is a graph showing the binding ability of an antibody against the S1 antigen of MERS-CoV consisting of the 1st to 757th amino acids of the spike protein.
  • FIG. 3 is a graph showing the binding affinity of the antibody against the RBD antigen of MERS-CoV consisting of the 377th to 588th amino acids of the spike protein.
  • FIG. 4 is a graph showing the binding affinity of the antibody against the S2 antigen of MERS-CoV consisting of the 757th to 1275th amino acids of the spike protein.
  • FIG. 5A is a graph showing the effect of the spike protein of the MERS-CoV Erasmus strain on 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90- -E6, 90-F1 and 90-F2 antibodies.
  • Fig. 5B shows the results of the measurement of the number of p53-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90- 90-E6, 90-F1 and 90-F2 antibodies.
  • FIG. 6A is a graph showing the neutralization ability of 77-A5, 77-A6, 90-A3, 90-A9, 90-B2 and 90-B7 antibodies against MERS-CoV.
  • FIG. 6B is a graph showing neutralization activities of 90-C4, 90-E5 90-E6, 90-F1 and 90-F2 antibodies against MERS-CoV.
  • FIG. 7 is a graph showing the morphology of antibodies through SEC-HPLC.
  • FIG. 8A is a graph showing binding affinity of an antigen-antibody through an SPR (Surface Plasmon Resonance) assay by attaching an S1 antigen.
  • SPR Surface Plasmon Resonance
  • FIG. 8B is a graph showing the binding force of an antigen-antibody through an SPR (Surface Plasmon Resonance) assay by attaching an RBD antigen.
  • 9A is a graph showing the thermal stability of 77-A5 and 77-A6 antibodies through a PTS (Protein Thermal Shift) assay.
  • FIG. 9B is a graph showing the thermal stability of 90-B2 and 90-B7 antibodies through a PTS (Protein Thermal Shift) assay.
  • FIG. 9C is a graph showing the thermal stability of 90-F1 and 90-F2 antibodies through a PTS (Protein Thermal Shift) assay.
  • the present invention relates to a spike protein of the middle respiratory syndrome coronavirus wherein the complementarity determining region (CDR) is composed of the amino acid sequence represented by SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, To provide a heavy chain variable region of a specifically binding monoclonal antibody.
  • CDR complementarity determining region
  • the spike protein may be a polypeptide consisting of any sequence known in the art.
  • the polypeptide may be a mutant or fragment of an amino acid having a different sequence by deletion, insertion, substitution, or a combination of amino acid residues within a range that does not affect the function of the protein. Amino acid exchanges in proteins or peptides that do not globally alter the activity of the molecule are known in the art.
  • the spike protein may comprise an amino acid sequence as set forth in SEQ ID NO: 23.
  • the heavy chain variable region can specifically bind to the 1st to 757th amino acid sites from the N-terminus of the Middle A respiratory syndrome coronavirus spike protein.
  • the heavy chain variable region of the monoclonal antibody comprising the amino acid sequence of SEQ ID NO: 1, 3, 15, 17, 19 or 21 among the heavy chain variable regions has a complementarity determining region of N - < / RTI > amino acid position from the 377th to the 588th amino acid position.
  • the present invention also relates to a gene encoding a heavy chain variable region of the monoclonal antibody of the present invention; A recombinant vector containing the gene; And a host cell to which the gene or the recombinant vector is introduced.
  • the heavy chain variable region may have the characteristics as described above.
  • the heavy chain variable region is selected from the group consisting of the Middle A respiratory syndrome coronas, wherein the complementarity determining regions (CDRs) are comprised of amino acid sequences as set forth in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, Variable region of a monoclonal antibody that specifically binds to the spike protein of the virus.
  • CDRs complementarity determining regions
  • the gene includes not only a sequence encoding a heavy chain variable region but also a polynucleotide having a base sequence substantially identical to the gene and a fragment thereof.
  • a polynucleotide having substantially the same base sequence may have 80% or more, specifically 90% or more, more specifically 95% or more homology with the polynucleotide of the present invention.
  • the polynucleotides of the present invention may include mutants in which one or more base sequences are substituted, deleted or inserted, so long as they encode a protein having equivalent activity.
  • the vector refers to a recombinant vector capable of expressing a peptide of interest in a desired host cell, including a necessary regulatory element operably linked to the expression of the gene insert.
  • the vector includes expression control elements such as initiation codon, termination codon, promoter, operator, etc.
  • the initiation codon and termination codon are generally considered to be part of the nucleotide sequence encoding the polypeptide, It must be functional and must be in coding sequence and in frame.
  • a nucleic acid sequence encoding a promoter and a protein or RNA may be operably linked to affect the expression of the coding sequence.
  • Operational linkages with vectors can be made using genetic recombination techniques well known in the art, and site-specific DNA cleavage and linkage can be accomplished using enzymes generally known in the art.
  • the vector system of the present invention can be constructed through various methods known in the art, and specific methods for this are disclosed in Sambrook et al ., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press (2001).
  • the vector of the present invention can typically be constructed as a vector for cloning or as a vector for expression.
  • the vector of the present invention can be constructed by using prokaryotic cells or eukaryotic cells as hosts.
  • a strong promoter capable of promoting transcription such as a tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pL ⁇ promoter, pR ⁇ promoter , rac5 promoter, amp promoter, recA promoter, SP6 promoter, trp promoter, and T7 promoter
  • a ribosome binding site for initiation of decoding such as a tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pL ⁇ promoter, pR ⁇ promoter , rac5 promoter, amp promoter, recA promoter, SP6 promoter, trp promoter, and T7 promoter
  • a ribosome binding site for initiation of decoding such as a tac promoter, lac
  • the E. coli e.g., HB101, BL21, DH5 ⁇ , etc.
  • the promoter and operator site of the E. coli tryptophan biosynthetic pathway (Yanofsky, C., J. Bacteriol., 158: 1018-1024 ) And the left promoter of phage lambda (pL? Promoter, Herskowitz, I. and Hagen, D., Ann. Rev. Genet., 14: 399-445 (1980)).
  • the promoter of the toxin protein gene of Bacillus thuringiensis Appl. Environ. Microbiol. 64: 3932-3938 (1998); Mol. Gen. Genet. 250: 734-741 (1996)
  • any promoter capable of expressing in Bacillus may be used as a regulatory region.
  • the vectors that can be used in the present invention include plasmids (for example, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8 / 9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, (for example, ⁇ gt4 ⁇ ⁇ B, ⁇ -Charon, ⁇ z1 and M13) or viruses (for example, SV40 and the like) ).
  • plasmids for example, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8 / 9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, (for example, ⁇ gt4 ⁇ ⁇ B, ⁇ -Charon, ⁇ z1 and M13) or viruses (for example, SV40 and the like) ).
  • the vector of the present invention is an expression vector and a eukaryotic cell is used as a host
  • a promoter derived from a genome of a mammalian cell for example, a metallothionine promoter, a beta -actin promoter, An adeno-associated virus promoter, a vaccinia virus 7.5K promoter, an SV40 promoter, a cytomegalovirus promoter, an HSV (e.g., a mammalian promoter), or a mammalian virus (MMTV) promoter, HIV LTR promoter, Moloney virus promoter Epstein Barr virus (EBV) promoter, tobacco mosaic virus and lowsarcoma virus (RSV) promoter) are to be used
  • the polyadenylation sequence as a transcription termination sequence is generally .
  • the vector of the present invention may be fused with other sequences to facilitate purification of the antibody expressed therefrom.
  • Fusion sequences include, for example, glutathione S-transferase, maltose binding protein, FLAG or 6x His.
  • the protein expressed by the vector of the present invention is an antibody
  • the expressed antibody can be easily purified through a protein A column or the like, without any additional sequence for purification.
  • the vector may further comprise a selection marker.
  • Selection markers can be used to confer selectable phenotypes such as drug resistance, resistance to cytotoxic agents, or surface protein expression as markers for selection of transformed microorganisms or recombinant vectors.
  • the transformed cells can be selected because only the cells expressing the selectable marker in the selected agent's environment survive.
  • Any selection marker that can be used in the conventional art can be used.
  • ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin or tetracycline may be used as selectable markers.
  • a variety of host cells can be used to express the heavy chain variable region of a monoclonal antibody according to the invention.
  • An example of a host cell that can be used in Escherichia (Escherichia sp.), Bacillus (Bacillus sp.), Genus Streptomyces (Streptomyces sp.), Pseudomonas species (Pseudomonas sp.), Proteus in (Proteus sp.) or Staphylococcus sp., for example.
  • fungi such as Aspergillus sp., Fungi such as Pichia sp.), the genus Saccharomyces sp.), investigating car break in Rome Seth (Schizosaccharomyces sp.) or neuro-La in Spokane (Neurospora sp.), other eukaryotic cells or animal cells, plant cells, and the like.
  • a commonly known gene manipulation method can be used.
  • physical methods include microinjection, liposome-based methods, direct DNA uptake, receptor-mediated DNA transfer, DNA transport using Ca ++ , Can be used.
  • the present inventors prepared a monoclonal antibody specific for the spike protein of MERS-CoV, and identified 77-A5, 77-A6, 90-A3, 90-A9, 90- (See FIGS. 1 and 2), the 90-F5, 90-C4, 90-C4, 90-E5, 90-E6, 90-F1 and 90-F2 antibodies are excellent in the full-length spikes of MERS-
  • the F1, 90-E5, 90-E6, 90-F2, 77-A5 and 77-A6 antibodies were found to be highly adherent to the RBD antigen of MERS-CoV (see FIG. 3).
  • the present invention also provides a composition for preventing, treating or diagnosing the respiratory syndrome of the middle ear comprising the heavy chain variable region of the monoclonal antibody of the present invention.
  • the heavy chain variable region may have the characteristics as described above.
  • the heavy chain variable region is selected from the group consisting of the Middle A respiratory syndrome coronas, wherein the complementarity determining regions (CDRs) are comprised of amino acid sequences as set forth in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, Variable region of a monoclonal antibody that specifically binds to the spike protein of the virus.
  • CDRs complementarity determining regions
  • composition for treating the respiratory syndrome of the present invention may be administered as an individual therapeutic agent or in combination with other therapeutic agents, and may be administered sequentially or simultaneously with conventional therapeutic agents.
  • the composition comprising the heavy chain variable region of the monoclonal antibody may be injected in vivo in the form of an antibody-therapeutic conjugate and used in the treatment of viral infections.
  • the therapeutic agent may be a chemotherapeutic agent, a radionuclide, an immunotherapeutic agent, a cytokine, a chemokine, a toxin, a biologic agent, or an enzyme inhibitor.
  • Methods of binding antibiotics to antibodies are described, for example, in G. Gregoriadies, ed., Academic Press London, (1979); Arnon et al ., Recent Results in Cancer Res., 75: 236 (1980); And Moolton et al ., Immunolog. Res., 62: 47 (1982).
  • Preferred agents for coupling to antibodies of the present invention include antibiotics, antiparasitics, antifungals and related agents such as, for example, sulfonamides, penicillins and cephalosporins, aminoglycosides, tetracyclines, chloramphenicol, , Diaminopyradine, metroniazide, isoniazid, rifampin, streptomycin, sulfone, erythromycin, polymyxin, nisatin, amphotericin, 5-fluorocytosine, 5-iodo-2'-deoxyuridine , 1-adamantha amine, adenine arabinoside, ammanidin, ribavirin or azatrimidine (AZT).
  • antibiotics antibiotics, antiparasitics, antifungals and related agents such as, for example, sulfonamides, penicillins and cephalosporins, aminoglycosides, tetracyclines, chlorampheni
  • Immunomodulators that may be used as therapeutic agents in the antibody-therapeutic agent conjugate may be, but are not limited to, lymphokines or cytokines.
  • composition for preventing or treating respiratory syndrome of the present invention may contain 10 to 95% by weight of the heavy chain variable region of the monoclonal antibody of the present invention, which is an active ingredient, based on the total weight of the composition.
  • composition for preventing or treating the present invention may further contain at least one active ingredient which exhibits the same or similar functions in addition to the above-mentioned effective ingredients.
  • compositions for the prevention or treatment of the present invention may also include carriers, diluents, excipients or a combination of two or more thereof commonly used in biological preparations.
  • the pharmaceutically acceptable carrier is not particularly limited as long as it is suitable for delivering the composition in vivo. Examples include Merck Index, 13th ed., Merck & Inc. Sterilized water, Ringer's solution, buffered saline, dextrose solution, maltodextrin solution, glycerol, ethanol, or a mixture of at least one of these components. At this time, other conventional additives such as an antioxidant, a buffer, a bacteriostatic agent and the like may be added as necessary.
  • composition When the composition is formulated, it is prepared using diluents or excipients such as fillers, extenders, binders, humectants, disintegrants, surfactants and the like which are usually used.
  • diluents or excipients such as fillers, extenders, binders, humectants, disintegrants, surfactants and the like which are usually used.
  • composition of the present invention may be formulated as an oral preparation or a parenteral preparation.
  • Solid formulations for oral administration include tablets, pills, powders, granules, capsules, troches and the like, which may contain one or more excipients such as starch, calcium carbonate, sucrose, Lactose, gelatin, and the like.
  • Lubricants such as magnesium stearate and talc may also be added.
  • liquid formulations include suspensions, solutions, emulsions or syrups, which may contain excipients such as wetting agents, sweeteners, fragrances, preservatives and the like.
  • Formulations for parenteral administration may include injections such as sterile aqueous solutions, non-aqueous solutions, suspensions, and emulsions.
  • non-aqueous solvent and suspending agent examples include propylene glycol, polyethylene glycol, vegetable oil such as olive oil, injectable ester such as ethyl oleate, and the like.
  • the prophylactic or therapeutic composition of the present invention may be administered orally or parenterally according to the intended method, and parenteral administration may be carried out by external or intraperitoneal injection, rectal injection, subcutaneous injection, intravenous injection, intramuscular injection, May be selected from the scan injection method.
  • composition for preventing or treating according to the present invention is administered in a pharmaceutically effective amount. It may vary depending on the type of disease, severity, activity of the drug, sensitivity to the drug, time of administration, route of administration and rate of excretion, duration of treatment,
  • the composition of the present invention may be administered alone or in combination with other therapeutic agents. When administered concomitantly, the administration can be sequential or simultaneous.
  • the amount of the active ingredient contained in the composition for preventing or treating according to the present invention may be 0.001 to 10,000 mg / kg, specifically 0.1 to 5 g / kg.
  • the administration may be one time per day and may be divided into several times.
  • the diagnostic composition of the present invention means a main means used for diagnosis of a desired disease, and may include substances for diagnosing MERS-CoV according to the object of the present invention. Diagnostic methods can include contacting the antibody or antibody fragment with a sample.
  • the sample can be a tissue, cell, or tissue taken from the sputum, nostril, sinus cavity, salivary gland, lung, liver, pancreas, kidney, ear, eye, placenta, digestive tract, heart, ovary, pituitary, adrenal, , Urine, whole blood, serum, plasma, feces, cell culture supernatant, or ruptured eukaryotic cells.
  • the formation of the sample and antibody complex can be accomplished by various methods such as colormetric method, electrochemical method, fluorimetric method, luminometry, particle counting method, visual assessment or scintillation counting method (scintillation counting method).
  • the detection can be performed using various markers for detecting a sample and an antibody complex.
  • An enzyme, a minerals, a ligand, a luminescent material, a fine particle or a radioisotope may be used as a label.
  • enzymes include acetylcholinesterase, alkaline phosphatase,? -D-galactosidase, horseradish peroxidase and? -Lactamase, fluorescein such as fluorescein, Eu 3 + , Eu 3 + chelate or cryptite, ligands such as biotin derivatives, emitters such as acridinium ester and isoluminol derivatives, fine particles such as colloidal gold and colored latex, As the element, 57 Co, 3 H, 125 I and 125 I-Bonton Hunter reagents can be used.
  • the present inventors prepared a monoclonal antibody specific for the spike protein of MERS-CoV, and identified 77-A5, 77-A6, 90-A3, 90-A9, 90- (See FIGS. 1 and 2), the 90-F5, 90-C4, 90-C4, 90-E5, 90-E6, 90-F1 and 90-F2 antibodies are excellent in the full-length spikes of MERS-
  • the F1, 90-E5, 90-E6, 90-F2, 77-A5 and 77-A6 antibodies were found to be highly adherent to the RBD antigen of MERS-CoV (see FIG. 3).
  • the antibodies to 77-A5, 77-A6, 90-E5, 90-E6, 90-F1 and 90-F2 exhibit neutralizing ability against MERS pseudovirus and MERS-CoV, and 90-B2 and 90- And exhibited neutralizing ability only for MERS-CoV (Figs. 5A, 5B, 6A and 6B).
  • the monoclonal antibody had a constant monomer form (see FIG. 7), confirming that the stability was excellent (see FIGS. 9A to 9C).
  • the present invention also provides a kit for detecting or quantifying an antigen of the respiratory syndrome of the Middle East using an antibody and a protein comprising the heavy chain variable region of the monoclonal antibody of the present invention.
  • the heavy chain variable region may have the characteristics as described above.
  • the heavy chain variable region is selected from the group consisting of the Middle A respiratory syndrome coronas, wherein the complementarity determining regions (CDRs) are comprised of amino acid sequences as set forth in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, Variable region of a monoclonal antibody that specifically binds to the spike protein of the virus.
  • CDRs complementarity determining regions
  • the kit may be prepared by conventional methods known to those skilled in the art, and may further comprise buffers, stabilizers, inert proteins, and the like.
  • the kit includes a fluorescence method performed by detecting the fluorescence of a fluorescent substance attached as a detector to detect the amount of the detection reagent, or a high-speed screening by radiation, which is performed by detecting the radiation of the radioisotope attached as a detector throughput screening (HTS) system, a surface plasmon resonance (SPR) method for measuring the surface plasmon resonance change in real time without labeling of the detection body, or a surface plasmon resonance imaging (SPRI) method for imaging the SPR system.
  • a fluorescence method performed by detecting the fluorescence of a fluorescent substance attached as a detector to detect the amount of the detection reagent
  • a high-speed screening by radiation which is performed by detecting the radiation of the radioisotope attached as a detector throughput screening (HTS) system
  • SPR surface plasmon resonance
  • the present inventors prepared a monoclonal antibody specific for the spike protein of MERS-CoV, and identified 77-A5, 77-A6, 90-A3, 90-A9, 90- (See FIGS. 1 and 2), the 90-F5, 90-C4, 90-C4, 90-E5, 90-E6, 90-F1 and 90-F2 antibodies are excellent in the full-length spikes of MERS-
  • the F1, 90-E5, 90-E6, 90-F2, 77-A5 and 77-A6 antibodies were found to be highly adherent to the RBD antigen of MERS-CoV (see FIG. 3).
  • the antibodies to 77-A5, 77-A6, 90-E5, 90-E6, 90-F1 and 90-F2 exhibit neutralizing ability against MERS pseudovirus and MERS-CoV, and 90-B2 and 90- And exhibited neutralizing ability only for MERS-CoV (Figs. 5A, 5B, 6A and 6B).
  • the monoclonal antibody was found to have a monomeric form (see Fig. 7), confirming excellent stability ( Figs. 9A to 9C).
  • the present invention also provides a method of preventing, treating or diagnosing a respiratory syndrome of the Middle East comprising administering to a subject a heavy chain variable region of the present invention.
  • the heavy chain variable region according to the present invention may have the characteristics as described above.
  • the heavy chain variable region is selected from the group consisting of the Middle A respiratory syndrome coronas, wherein the complementarity determining regions (CDRs) are comprised of amino acid sequences as set forth in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, Variable region of a monoclonal antibody that specifically binds to the spike protein of the virus.
  • CDRs complementarity determining regions
  • the subject may also be a mammal, particularly a human.
  • the heavy chain variable region of the present invention can be administered orally or parenterally in accordance with the desired method, and parenteral administration can be performed by external or intraperitoneal injection, rectal injection, subcutaneous injection, intravenous injection, intramuscular injection, Can be selected.
  • the heavy chain variable region according to the invention is administered in a pharmaceutically effective amount. It may vary depending on the type of disease, severity, activity of the drug, sensitivity to the drug, time of administration, route of administration and rate of excretion, duration of treatment,
  • the composition of the present invention may be administered alone or in combination with other therapeutic agents. When administered concomitantly, the administration can be sequential or simultaneous.
  • the amount of active ingredient contained in the heavy chain variable region according to the present invention may be 0.001 to 10,000 mg / kg, specifically 0.1 to 5 g / kg.
  • the administration may be one time per day and may be divided into several times.
  • the heavy chain variable region of the present invention refers to a main means used for diagnosis of a target disease.
  • Materials for diagnosing MERS-CoV may be included according to the purpose of the present invention. Diagnostic methods can include contacting the antibody or antibody fragment with a sample.
  • the sample can be a tissue, cell, or tissue taken from the sputum, nostril, sinus cavity, salivary gland, lung, liver, pancreas, kidney, ear, eye, placenta, digestive tract, heart, ovary, pituitary, adrenal, , Urine, whole blood, serum, plasma, feces, cell culture supernatant, or ruptured eukaryotic cells.
  • the formation of the sample and antibody complex can be accomplished by various methods such as colormetric method, electrochemical method, fluorimetric method, luminometry, particle counting method, visual assessment or scintillation counting method (scintillation counting method).
  • the detection can be performed using various markers for detecting a sample and an antibody complex.
  • An enzyme, a minerals, a ligand, a luminescent material, a fine particle or a radioisotope may be used as a label.
  • enzymes include acetylcholinesterase, alkaline phosphatase,? -D-galactosidase, horseradish peroxidase and? -Lactamase, fluorescein such as fluorescein, Eu 3 + , Eu 3 + chelate or cryptite, ligands such as biotin derivatives, emitters such as acridinium ester and isoluminol derivatives, fine particles such as colloidal gold and colored latex, As the element, 57 Co, 3 H, 125 I and 125 I-Bonton Hunter reagents can be used.
  • the present invention provides the use of the heavy chain variable region of the present invention for use in the manufacture of a medicament for the prevention, treatment or diagnosis of the respiratory syndrome of the Middle East.
  • the heavy chain variable region according to the present invention may have the characteristics as described above.
  • the present invention also relates to the use of a medicament for the treatment of the respiratory syndrome coronavirus of the middle ear respiratory syndrome wherein the complementarity determining regions (CDRs) are composed of the amino acid sequences of SEQ ID NOS: 2, 4, 6, 8, 10, 12, 14, 16, 18, Providing a light chain variable region of a monoclonal antibody that specifically binds to a spike protein.
  • CDRs complementarity determining regions
  • the spike protein may have the characteristics described above.
  • the spike protein may comprise an amino acid sequence as set forth in SEQ ID NO: 23.
  • the light chain variable region can specifically bind to the 1st to 757th amino acid sites from the N-terminus of the middle respiratory syndrome coronavirus spike protein.
  • the light chain variable region of the monoclonal antibody comprising the amino acid sequence of SEQ ID NO: 2, 4, 16, 18, 20 or 22 among the light chain variable regions has a complementarity determining region of N - < / RTI > amino acid position from the 377th to the 588th amino acid position.
  • the present invention also relates to a gene encoding a light chain variable region of a monoclonal antibody of the present invention; A recombinant vector containing the gene; And a host cell to which the gene or the recombinant vector is introduced.
  • the light chain variable region may have the characteristics as described above.
  • the light chain variable region comprises a heavy chain variable region having a complementarity determining region (CDR) of the amino acid sequence of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, Can be a light chain variable region of a monoclonal antibody that specifically binds to a spike protein of coronavirus.
  • CDR complementarity determining region
  • the gene may have the characteristics as described above.
  • the vector refers to a recombinant vector capable of expressing a peptide of interest in a desired host cell, which gene construct contains an essential regulatory element operatively linked to the expression of the gene insert, and may have the above-described characteristics.
  • a variety of host cells can be used to express the light chain variable region of a monoclonal antibody according to the invention.
  • the host cells that can be used may have the characteristics as described above.
  • a commonly known gene manipulation method can be used.
  • physical methods include microinjection, liposome-based methods, direct DNA uptake, receptor-mediated DNA transfer, DNA delivery using Ca ++, or viruses
  • a gene transfer method can be used.
  • the present invention provides a composition for preventing, treating or diagnosing the respiratory syndrome of the middle ear comprising the light chain variable region of the monoclonal antibody of the present invention.
  • the light chain variable region may have the characteristics as described above.
  • the light chain variable region comprises a heavy chain variable region having a complementarity determining region (CDR) of the amino acid sequence of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, Can be a light chain variable region of a monoclonal antibody that specifically binds to a spike protein of coronavirus.
  • CDR complementarity determining region
  • composition for the prevention or treatment of the present invention may have the above-described characteristics.
  • the diagnostic composition of the present invention may have the above-described characteristics.
  • the diagnostic composition of the present invention means a main means used for diagnosis of a desired disease, and materials for diagnosing MERS-CoV according to the purpose of the present invention may be included. Diagnostic methods can include contacting the antibody or antibody fragment with a sample.
  • the sample can be a tissue, cell, or tissue taken from the sputum, nostril, sinus cavity, salivary gland, lung, liver, pancreas, kidney, ear, eye, placenta, digestive tract, heart, ovary, pituitary, adrenal, , Urine, whole blood, serum, plasma, feces, cell culture supernatant, or ruptured eukaryotic cells.
  • the present invention also provides a kit for detecting or quantifying an antigen of a respiratory syndrome of the Middle East using an antibody and a protein comprising a light chain variable region of the monoclonal antibody of the present invention.
  • the light chain variable region may have the characteristics as described above.
  • the light chain variable region comprises a heavy chain variable region having a complementarity determining region (CDR) of the amino acid sequence of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, Can be a light chain variable region of a monoclonal antibody that specifically binds to a spike protein of coronavirus.
  • CDR complementarity determining region
  • the kit may have the above-described characteristics.
  • it can be prepared by conventional methods known to those skilled in the art, and can further include buffers, stabilizers, inactive proteins, and the like.
  • the kit includes a fluorescence method performed by detecting the fluorescence of a fluorescent substance attached as a detector to detect the amount of the detection reagent, or a high-speed screening by radiation, which is performed by detecting the radiation of the radioisotope attached as a detector throughput screening (HTS) system, a surface plasmon resonance (SPR) method for measuring the surface plasmon resonance change in real time without labeling of the detection body, or a surface plasmon resonance imaging (SPRI) method for imaging the SPR system.
  • a fluorescence method performed by detecting the fluorescence of a fluorescent substance attached as a detector to detect the amount of the detection reagent
  • a high-speed screening by radiation which is performed by detecting the radiation of the radioisotope attached as a detector throughput screening (HTS) system
  • the present invention also provides a method of preventing, treating or diagnosing a respiratory syndrome of the Middle East comprising administering a light chain variable region of the present invention to a subject.
  • the light chain variable region according to the present invention may have the above-described characteristics.
  • the light chain variable region comprises a heavy chain variable region having a complementarity determining region (CDR) of the amino acid sequence of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, Can be a light chain variable region of a monoclonal antibody that specifically binds to the spike protein of the virus.
  • CDR complementarity determining region
  • the subject may also be a mammal, particularly a human.
  • the light chain variable region of the present invention may be administered orally or parenterally in accordance with the desired method, and the parenteral administration may be by external or intraperitoneal injection, rectal injection, subcutaneous injection, intravenous injection, intramuscular injection, Can be selected.
  • the light chain variable region according to the invention is administered in a pharmaceutically effective amount. It may vary depending on the type of disease, severity, activity of the drug, sensitivity to the drug, time of administration, route of administration and rate of excretion, duration of treatment,
  • the composition of the present invention may be administered alone or in combination with other therapeutic agents. When administered concomitantly, the administration can be sequential or simultaneous.
  • the amount of the active ingredient contained in the light chain variable region according to the present invention may be 0.001 to 10,000 mg / kg, specifically 0.1 to 5 g / kg.
  • the administration may be one time per day and may be divided into several times.
  • the light chain variable region of the present invention means a main means used for diagnosis of a desired disease, and may include substances for diagnosing MERS-CoV according to the purpose of the present invention. Diagnostic methods can include contacting the antibody or antibody fragment with a sample.
  • the sample can be a tissue, cell, or tissue taken from the sputum, nostril, sinus cavity, salivary gland, lung, liver, pancreas, kidney, ear, eye, placenta, digestive tract, heart, ovary, pituitary, adrenal, , Urine, whole blood, serum, plasma, feces, cell culture supernatant, or ruptured eukaryotic cells.
  • the formation of the sample and antibody complex can be accomplished by various methods such as colormetric method, electrochemical method, fluorimetric method, luminometry, particle counting method, visual assessment or scintillation counting method (scintillation counting method).
  • the detection can be performed using various markers for detecting a sample and an antibody complex.
  • An enzyme, a minerals, a ligand, a luminescent material, a fine particle or a radioisotope may be used as a label.
  • enzymes include acetylcholinesterase, alkaline phosphatase,? -D-galactosidase, horseradish peroxidase and? -Lactamase, fluorescein such as fluorescein, Eu 3 + , Eu 3 + chelate or cryptite, ligands such as biotin derivatives, emitters such as acridinium ester and isoluminol derivatives, fine particles such as colloidal gold and colored latex, As the element, 57 Co, 3 H, 125 I and 125 I-Bonton Hunter reagents can be used.
  • the present invention provides the use of the light chain variable region of the present invention for use in the manufacture of a medicament for the prevention, treatment or diagnosis of the respiratory syndrome of the Middle East.
  • the light chain variable region according to the present invention may have the above-described characteristics.
  • the present invention also relates to a polypeptide comprising a heavy chain variable region having an amino acid sequence represented by SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 or 21, Comprising a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 6, 8, 10, 12, 14, 16, 18, 20 or 22, provided a monoclonal antibody that specifically binds to a coronavirus spike protein of the middle respiratory syndrome do.
  • the spike protein may have the characteristics described above.
  • the spike protein may comprise an amino acid sequence as set forth in SEQ ID NO: 23.
  • the light chain variable region and the heavy chain variable region may have the above-described characteristics.
  • the monoclonal antibody is also called a monoclonal antibody or monoclonal antibody, and is an antibody produced by a single antibody-forming cell, and has a primary structure (amino acid sequence) homogeneous. Although it is produced by culturing a hybridoma cell in which only one antigenic determinant is recognized and a cancer cell and an antibody-producing cell are fused in general, the recombinant protein expression host cell using the obtained antibody gene sequence is used It can also produce.
  • the present invention also relates to a gene encoding a monoclonal antibody of the present invention; A recombinant vector containing the gene; And a host cell to which the gene or the recombinant vector is introduced.
  • the monoclonal antibody may have the above-described characteristics.
  • the complementarity determining region may comprise a heavy chain variable region consisting of an amino acid sequence represented by SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, which may be a monoclonal antibody that specifically binds to a middle respiratory syndrome coronavirus spike protein comprising a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 6, 8, 10, 12, 14, 16, 18, 20 or 22 .
  • the gene may have the characteristics as described above.
  • the vector refers to a recombinant vector capable of expressing a peptide of interest in a desired host cell, which gene construct contains an essential regulatory element operatively linked to the expression of the gene insert, and may have the above-described characteristics.
  • a variety of host cells can be used to express monoclonal antibodies according to the invention.
  • the host cells that can be used may have the characteristics as described above.
  • a commonly known gene manipulation method can be used.
  • physical methods include microinjection, liposome-based methods, direct DNA uptake, receptor-mediated DNA transfer, DNA delivery using Ca ++, or viruses
  • a gene transfer method can be used.
  • the present invention provides a composition for preventing, treating or diagnosing the respiratory syndrome of the middle ear comprising the monoclonal antibody of the present invention.
  • the monoclonal antibody may have the above-described characteristics.
  • the complementarity determining region may comprise a heavy chain variable region consisting of an amino acid sequence represented by SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, which may be a monoclonal antibody that specifically binds to a middle respiratory syndrome coronavirus spike protein comprising a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 6, 8, 10, 12, 14, 16, 18, 20 or 22 .
  • composition for the prevention or treatment of the present invention may have the above-described characteristics.
  • the diagnostic composition of the present invention may have the above-described characteristics.
  • the diagnostic composition of the present invention means a main means used for diagnosis of a desired disease, and materials for diagnosing MERS-CoV according to the purpose of the present invention may be included. Diagnostic methods can include contacting the antibody or antibody fragment with a sample.
  • the sample can be a tissue, cell, or tissue taken from the sputum, nostril, sinus cavity, salivary gland, lung, liver, pancreas, kidney, ear, eye, placenta, digestive tract, heart, ovary, pituitary, adrenal, , Urine, whole blood, serum, plasma, feces, cell culture supernatant, or ruptured eukaryotic cells.
  • the present invention also provides a kit for detecting or quantifying an antigen of a respiratory syndrome of the Middle East comprising the monoclonal antibody of the present invention.
  • the monoclonal antibody may have the above-described characteristics.
  • the complementarity determining region may comprise a heavy chain variable region consisting of an amino acid sequence represented by SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, which may be a monoclonal antibody that specifically binds to a middle respiratory syndrome coronavirus spike protein comprising a light chain variable region comprising an amino acid sequence as set forth in SEQ ID NO: 6, 8, 10, 12, 14, 16, 18, 20 or 22 .
  • the kit may have the above-described characteristics.
  • the kit may be prepared by conventional methods known to those skilled in the art, and may further comprise buffers, stabilizers, inert proteins, and the like.
  • the kit includes a fluorescence method performed by detecting the fluorescence of a fluorescent substance attached as a detector to detect the amount of the detection reagent, or a high-speed screening by radiation, which is performed by detecting the radiation of the radioisotope attached as a detector throughput screening (HTS) system, a surface plasmon resonance (SPR) method for measuring the surface plasmon resonance change in real time without labeling of the detection body, or a surface plasmon resonance imaging (SPRI) method for imaging the SPR system.
  • a fluorescence method performed by detecting the fluorescence of a fluorescent substance attached as a detector to detect the amount of the detection reagent
  • a high-speed screening by radiation which is performed by detecting the radiation of the radioisotope attached as a detector throughput screening (HTS)
  • the present invention also provides a method for preventing, treating or diagnosing a respiratory syndrome of the Middle East comprising administering a monoclonal antibody of the present invention to a subject.
  • the light chain variable region comprises a heavy chain variable region wherein the complementarity determining region (CDR) is comprised of an amino acid sequence as set forth in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, A spike protein of the middle respiratory syndrome coronavirus comprising a light chain variable region consisting of an amino acid sequence represented by SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, Lt; / RTI > monoclonal antibody.
  • CDR complementarity determining region
  • the subject may also be a mammal, particularly a human.
  • the monoclonal antibody of the present invention can be administered orally or parenterally according to the desired method, and parenteral administration can be performed by external or intraperitoneal injection, rectal injection, subcutaneous injection, intravenous injection, intramuscular injection, Can be selected.
  • Monoclonal antibodies according to the invention are administered in a pharmaceutically effective amount. It may vary depending on the type of disease, severity, activity of the drug, sensitivity to the drug, time of administration, route of administration and rate of excretion, duration of treatment,
  • the composition of the present invention may be administered alone or in combination with other therapeutic agents. When administered concomitantly, the administration can be sequential or simultaneous.
  • the amount of the active ingredient contained in the monoclonal antibody according to the present invention may be 0.001 to 10,000 mg / kg, specifically 0.1 to 5 g / kg.
  • the administration may be one time per day and may be divided into several times.
  • the monoclonal antibody of the present invention means a main means used for diagnosis of a target disease, and may include substances for diagnosing MERS-CoV according to the object of the present invention. Diagnostic methods can include contacting the antibody or antibody fragment with a sample.
  • the sample can be a tissue, cell, or tissue taken from the sputum, nostril, sinus cavity, salivary gland, lung, liver, pancreas, kidney, ear, eye, placenta, digestive tract, heart, ovary, pituitary, adrenal, , Urine, whole blood, serum, plasma, feces, cell culture supernatant, or ruptured eukaryotic cells.
  • the formation of the sample and antibody complex can be accomplished by various methods such as colormetric method, electrochemical method, fluorimetric method, luminometry, particle counting method, visual assessment or scintillation counting method (scintillation counting method).
  • the detection can be performed using various markers for detecting a sample and an antibody complex.
  • An enzyme, a minerals, a ligand, a luminescent material, a fine particle or a radioisotope may be used as a label.
  • enzymes include acetylcholinesterase, alkaline phosphatase,? -D-galactosidase, horseradish peroxidase and? -Lactamase, fluorescein such as fluorescein, Eu 3 + , Eu 3 + chelate or cryptite, ligands such as biotin derivatives, emitters such as acridinium ester and isoluminol derivatives, fine particles such as colloidal gold and colored latex, As the element, 57 Co, 3 H, 125 I and 125 I-Bonton Hunter reagents can be used.
  • the present invention provides the use of the monoclonal antibodies of the present invention for use in the manufacture of medicaments for the prevention, treatment, or diagnosis of the respiratory syndrome of the Middle East.
  • the monoclonal antibody according to the present invention may have the above-described characteristics.
  • PBMCs peripheral blood mononuclear cells
  • the sequences of the heavy, kappa, and lambda light chain CDRs of the antibody gene were amplified by PCR from the B cells of the initial patient of the isolated MERS. Subsequently, a base sequence suitable for immunoglobulin antibody expression was verified using a web-based IMGT (International Immunogenetics Information Systems, http://www.imgt.org) program.
  • the heavy chain, kappa light chain and lambda light chain CDR portions of each of the antibodies were inserted into a pVRC vector containing a mouse IgM signal peptide and an IgG constant region provided by the USA NIH / NIAID / VRC. Then, the produced antibody plasmid was transfected into Expi293F cells, and after 5 days, a cell culture was obtained and purified with a protein G agarose column to prepare an antibody.
  • 0.2 ⁇ g / 100 ⁇ l of PBS / well was added to a MaxiSorp 96-well plate (Nunc) and MERS-CoV full spike trimer antigen was reacted at 4 ° C. for one day.
  • the reaction solution was removed and the PBST was blocked with a blocking solution containing 5% skim milk and 2% BSA at room temperature for 1 hour.
  • the antibody prepared in Example 1 was diluted in the blocking solution to a concentration of 10, 2.5, 0.625, 0.15625, 0.039, 0.009, 0.002, 0.0006 or 0.0001 ⁇ ⁇ / ml and placed in the plate coated with the whole- , Which was reacted at room temperature for 1 hour.
  • the cells were washed 6 times with PBST, and a rabbit anti-human IgG H & L-HRP (horse radish peroxidase) secondary antibody was added and reacted for 1 hour.
  • Anti-mouse IgG-HRP secondary antibody was added to wells containing G2 and G4 antibodies, and reacted for 1 hour.
  • 100 ⁇ l of TMB solution was added, followed by shading and reaction at room temperature for 30 minutes.
  • 100 ⁇ l of a stop solution Enzygost
  • the CDR amino acid sequence of 11 MERS antibodies Antibody Name
  • the CDR sequence of the heavy chain CDR sequence of kappa light chain CDR sequence of lambda light chain 77-A5 TGVHSQVQLVQSGAEVKKPGSSVKVSCKASGGTFRSHAISWVRQAPGQGLEWMGGIIPIFASANYAQKFQGRVTITADESTSTAYMDLSSLRSDDTAVYYCAKNVSPKSYSGRYSISYFYGVDVWGQGTTVTVSSA (SEQ ID NO: 1) TGSWAQSALTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLSGHYVFGTGTKVTVLGQPKANPTVTLFPPS (SEQ ID NO: 2) 77-A6 TGVHSEVQLLESGGGLVQPGGSLRLSCADSGLTFSSYAMSWVRQAPGKGLEWVSAISVSG
  • 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90- , 90-F1 and 90-F2 antibodies specifically adhered well to the full-length spike trimmer antigen of MERS-CoV, which showed a higher affinity than the A2, A10 and G4 antibodies (Fig. 1).
  • the CDR sequences of the 11 species of antibodies specifically binding to the full-length spike trimmer antigen are shown in Table 1 above.
  • the binding affinity of the 24 kinds of antibodies prepared in Example 1 was measured in the same manner as in Experimental Example 1-1 except that the S1 domain of MERS-CoV consisting of the 1st to 757th amino acids of the spike protein was used as an antigen Respectively.
  • 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90- , 90-F1 and 90-F2 antibodies showed higher adhesion than the A2 and A10 antibodies developed by the National Institutes of Health for the S1 antigen and in particular 90-F1, 90-B7, 90-E6,
  • the 77-A5, 90-F2, and 77-A6 antibodies showed higher affinity than the C2 and G2 antibodies ( Figure 2).
  • the 90-F1, 90-E5, 90-E6, 90-F2, 77-A5 and 77- A6 antibodies among the 24 antibodies showed higher binding affinity to the RBD antigen , while the remaining antibodies showed no binding (Fig. 3).
  • the Huh7.5 cells were suspended in trypsin, suspended in DMEM (Dulbecco's modified Eagle's medium) containing 10% FBS to a concentration of 10 4 cells / 100 ⁇ l / well, and then seeded on a 96-well tissue culture plate And cultured for one day.
  • DMEM Dulbecco's modified Eagle's medium
  • recombinant lentivirus recombinant MERS pseudovirus expressing luciferase, US NIH / NIAID / VRC available from USA
  • spike protein of MERS-CoV Erasmus strain or Bisha 1 strain
  • 90 ⁇ l of the antibody of Example 1 at a concentration of 10, 1, 0.1, 0.01 or 0.001 ⁇ s / ml diluted with the culture medium was mixed with DMEM culture medium containing 10% FBS and reacted at 37 ° C. for 45 minutes to prepare a mixed solution Respectively.
  • ⁇ l of a mixed solution was added to the cultured cells, and 100 ⁇ l of a DMEM culture medium containing 10% FBS was added thereto and cultured in a cell incubator at 37 ⁇ C and 5% CO 2 for 3 days. After the culture medium was removed, the cells were lysed by adding 1 ⁇ lysis buffer (Promega, E153A) at a concentration of 25 ⁇ l / well and stirring for 15 minutes. 50 [mu] l of luciferase substrate reagent (Promega, E151A) was added to the lysed cells, fluorescence was measured with a luminometer, and neutralization activity was calculated by the following formula (1).
  • the antibodies 77-A5, 77-A6, 90-E5, 90-E6, 90-F1 and 90- The 90-F1 antibody was found to be capable of neutralizing the MERS pseudovirus Erasmus strain and the Bisha 1 strain, and the 77-A5, 77-A6, 90-F1 and 90- (Fig. 5A, Fig. 5B and Table 2). These results indicate that the 77-A5, 77-A6, 90-F1 and 90-F2 antibodies have broad neutralizing capacity.
  • a plaque reduction neutralizing test was performed using MERS-CoV (Erasmus strain and KNIH strain) to confirm the neutralization ability of the antibody prepared in Example 1.
  • Vero cells were dispensed into a 24-well plate at a concentration of 10 5 cells / well, and then cultured. The culture medium of the cultured cells was removed and the antibody of Example 1 at a concentration of 10, 2.5, 0.625, 0.156, 0.039, 0.009 or 0.002 ng / ml diluted with the cell culture medium and the MERS- CoV (EMC, KNIH-002, KNIH-016 and KNIH-042) were mixed to prepare a mixed solution.
  • MERS-CoV Erasmus strain and KNIH strain
  • the mixed cells were dispensed into the cultured cells at a rate of 100 ⁇ l / well, and reacted at 37 ° C for 1 hour. Then, DMEM culture medium containing 1.5% of CMC (carboxymethyl cellulose) was added at a concentration of 1 ml / well and cultured for 3 days. After the cultivation was completed, plaques were confirmed by crystal violet staining and the number of plaques in each well was measured and the neutralization ability was calculated by the following formula (2). Further, to the neutralizing activity was determined by calculating the ND 50 values in the same way as the expression (3).
  • m is log 10
  • ⁇ is a constant interval between dilutions represented by log 10 values
  • ⁇ p is the sum of all the ratios of plaques / the average number of plaques for virus control.
  • S1 antigen or RBD antigen and the avidity of the antibody was analyzed by SPR assay. Specifically, the S1 antigen or the RBD antigen was attached to the CM5 chip surface, and then the antibody was injected. Then, the association time is 3 minutes, the dissociation time is the condition described in Table 4, the running buffer is HBS-EP, and the regeneration solution is SPR assay Respectively.
  • the 77-A5 and 90-B2 antibodies had low K D values against the S1 antigen of 75 pM or less, And the 90-F1 antibody had a low binding affinity for RBD antigen when the K D value for RBD antigen was below 72 pM when the RBD antigen was attached.
  • the 90-B2 and 90-B7 antibodies did not bind to the RBD antigen at all, which means that the 90-B2 and 90-B7 antibodies are specific for the S1 antigen ( Figures 8a, 8b and 5).
  • the stability of the antibody was confirmed in PBS (phosphate buffered saline) containing calcium and magnesium at pH 7.4, which is a storage solution of the antibodies. Specifically, 0.75 ⁇ g of the antibody prepared in Example 1 was used, and PTS assay was performed according to the manufacturer's method using Protein Thermal Shift TM Dye Kit (Catalog No. 4466038, Life technologies).
  • the melting point of the 77-A5 antibody was 67.52 DEG C
  • the antibody 77-A6 was 68.44 DEG C and 75.44 DEG C
  • the antibody 90-B2 was 72.46 DEG C
  • the protein is hydrophobically exposed at temperatures of 68.21 ⁇ and 81.19 ⁇ for the antibody, 69.21 ⁇ and 79.81 ⁇ for the 90-F1 antibody, and 68.89 ⁇ and 75.10 ⁇ for the 90-F2 antibody, (Figs. 9A to 9C).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Virology (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Food Science & Technology (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

본 발명은 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도에 관한 것이다. 구체적으로, 본 발명에 따른 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2 단일클론항체는 MERS-CoV의 전장 스파이크 단백질 및 상기 단백질의 S1 도메인에 대한 부착력이 우수하고, 그중에서 90-F1, 90-E5, 90-E6, 90-F2, 77-A5 및 77-A6 단일클론항체는 MERS-CoV의 RBD 항원에 대해 부착력이 우수하다. 또한, 77-A5, 77-A6, 90-E5, 90-E6, 90-F1 및 90-F2 항체는 MERS 슈도바이러스 및 MERS-CoV에 대해 중화능을 나타내고, 90-B2와 90-B7 항체는 MERS-CoV에 대해서만 중화능을 나타내었다. 또한, 상기 단일클론항체들은 일정한 단량체 형태를 띄며, 안정성이 우수하기에 MERS의 치료 또는 진단에 유용하게 사용될 수 있다.

Description

중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도
본 발명은 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도에 관한 것이다.
중동호흡기증후군(middle east respiratory syndrome, MERS)은 2012년 9월 중동 지역을 중심으로 처음 발생하였으며, WHO에서 발표한 바에 따르면, 2017년 6월 5일을 기준으로 26개국으로 확산되어, 전 세계적으로 1,980명의 확진환자와 693명의 사망자를 발생시킨 치사율이 35%에 이르는 고위험 질환이다.
MERS의 병원체인 중동호흡기증후군 코로나바이러스(middle east respiratory syndrome coronavirus, MERS-CoV)는 2012년에 새로 발견된 베타코로나바이러스(βCoV)이며, 약 3만 kb의 (+)-센스 단일가닥 RNA 바이러스로 중증급성호흡기증후군(severe acute respiratory syndrome, SARS) 바이러스와 유사한 바이러스이다. MERS-CoV는 스파이크 단백질(S protein)을 이용해 사람의 DPP4(Dipeptidyl peptidase 4) 수용체에 결합하여 세포 내로 침투한다(Wang N, Shi X, Jiang LJ, Zhang S, Wang D, Tong P, Guo D, et al., Cell Research. 2013:23:986). MERS-CoV는 1주일 정도의 잠복기를 가지며, 고열, 기침, 호흡곤란 등 심한 호흡기 증상을 일으킨다.
현재, MERS 치료는 면역조절인자인 인터페론과 항바이러스제인 리바비린(ribarvirin) 또는 로피나비어(lopinavir)를 사용하여 치료하고 있다(Public Health England, ISARIC, 2015. Sep. 5. ver 3.0; 정용필, 송준영, 서유빈 et al., Infection & Chemotherapy. 2015). 인터페론은 인체에서 바이러스나 세균이 들어왔을때 배출하는 면역 단백질로 주변 세포들에게 항바이러스 싸이토카인들을 내뿜도록 유도하여 바이러스 증식을 억제하고, 면역 세포들을 불러들여 바이러스에 감염된 세포들을 제거하도록 한다. 그러나 인터페론의 사용은 골수의 기능저하, 빈혈, 백혈구 수의 감소 또는 혈소판 수의 감소 등의 부작용을 유발한다.
또 다른 치료제인 리바비린은 뉴클레오시드 유사체(nucleoside analogue) 형태로 다양한 종류의 바이러스의 RNA 합성을 방해함으로써 이의 증식을 억제한다. 그러나 리바비린은 독성, 발암 또는 용혈빈혈 등의 부작용을 유발한다. 또한, MERS의 치료를 위해 인터페론과 리바비린을 투여하는 것에 대한 임상적인 근거도 희박하다. 붉은털원숭이 동물모델에서는 인터페론과 리바비린을 혼합하여 투여하였을 때 MERS의 치료효과를 보였으나(Falzarano D, Wit E, Rasmussen AL et al., Nature Medicine, 2013, 19, 10, p1313- 1318), 실제 중동에서 인터페론과 리바비린을 혼합하여 심각한 상태의 메르스 환자들 총 5명에게 주입하였을 때 큰 효과를 나타내지 못하였다(Al-Tawfiq JA, Momattin H., Dib J et al., International Journal of Infectious Diseases 2014, 20, p42-46). 따라서, 효과적으로 바이러스의 증식을 막으면서 중증환자, 면역저하환자 및 기저질환환자에게도 사용가능한 생물학적으로 안전한 치료용 항체의 개발이 필요하다.
이와 관련하여, 대한민국 특허등록 제10-1593641호에는 MERS-CoV 뉴클레오캡시드에 특이적으로 결합하는 단일클론항체 및 이를 포함하는 MERS-CoV 진단용 조성물이 개시되어 있다.
이에, 본 발명자들은 MERS-CoV에 대한 치료용 항체를 개발 결과물로, MERS-CoV의 스파이크 단백질에 특이적으로 부착하는 24종의 단일클론항체를 제조하였고, 이 중 11개의 항체(77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2)는 MERS-CoV의 전장 스파이크 및 S1 항원에 대한 부착력이 우수하며, 90-F1, 90-E5, 90-E6, 90-F2, 77-A5 및 77-A6 항체는 MERS-CoV의 RBD 항원에 대해 부착력이 우수함을 확인하였다. 또한,77-A5, 77-A6, 90-E5, 90-E6, 90-F1 및 90-F2 항체는 MERS 슈도바이러스 및 MERS-CoV에 대해 중화능을 나타내고, 90-B2와 90-B7 항체는 MERS-CoV에 대해서만 중화능을 나타내었다. 또한, 본 항체들은 일정한 단량체 형태를 띄며, 물리적 안정성이 우수함을 확인함으로써, 본 발명을 완성하였다.
본 발명의 목적은 중동호흡기증후군 코로나바이러스의 스파이크(spike) 단백질에 특이적으로 결합하는 단일클론항체를 제공하는 것이다.
본 발명의 다른 목적은 본 발명의 단일클론항체를 코딩하는 유전자 및 이를 함유하는 재조합 벡터, 상기 유전자 또는 재조합 벡터가 도입된 숙주세포를 제공하는 것이다.
본 발명의 또 다른 목적은 본 발명의 단일클론항체를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단 용도를 제공하는 것이다.
본 발명의 또 다른 목적은 본 발명의 단일클론항체를 포함하는 중동호흡기증후군의 항원을 검출 또는 정량하는 키트를 제공하는 것이다.
상기 목적을 달성하기 위하여, 본 발명은 상보성 결정부위(CDR)가 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 중쇄 가변영역을 제공한다.
또한, 본 발명은 본 발명의 단일클론항체의 중쇄 가변영역을 코딩하는 유전자를 제공한다.
또한, 본 발명은 본 발명의 단일클론항체의 중쇄 가변영역을 코딩하는 유전자를 함유하는 재조합 벡터를 제공한다.
또한, 본 발명은 본 발명의 단일클론항체의 중쇄 가변영역을 코딩하는 유전자 또는 상기 유전자를 포함하는 재조합 벡터가 도입된 숙주세포를 제공한다.
또한, 본 발명은 본 발명의 단일클론항체의 중쇄 가변영역을 포함하는 중동호흡기증후군의 예방, 치료 또는 진단용 조성물을 제공한다.
또한, 본 발명은 본 발명의 단일클론항체의 중쇄 가변영역을 포함하는 중동호흡기증후군의 항원을 검출 또는 정량하는 키트를 제공한다.
또한, 본 발명은 상보성 결정부위(CDR)가 각각 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 경쇄 가변영역을 제공한다.
또한, 본 발명은 본 발명의 단일클론항체의 경쇄 가변영역을 코딩하는 유전자를 제공한다.
또한, 본 발명은 본 발명의 단일클론항체의 경쇄 가변영역을 코딩하는 유전자를 함유하는 재조합 벡터를 제공한다.
또한, 본 발명은 본 발명의 단일클론항체의 경쇄 가변영역을 코딩하는 유전자 또는 상기 유전자를 포함하는 재조합 벡터가 도입된 숙주세포를 제공한다.
또한, 본 발명은 본 발명의 단일클론항체의 경쇄 가변영역을 포함하는 중동호흡기증후군의 예방, 치료 또는 진단용 조성물을 제공한다.
또한, 본 발명은 본 발명의 단일클론항체의 경쇄 가변영역을 포함하는 중동호흡기증후군의 항원을 검출 또는 정량하는 키트를 제공한다.
또한, 본 발명은 상보성 결정부위가 각각 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중쇄 가변영역과 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 경쇄 가변영역을 포함하는 중동호흡기증후군 코로나바이러스 스파이크 단백질에 특이적으로 결합하는 단일클론항체를 제공한다.
또한, 본 발명은 본 발명의 단일클론항체를 코딩하는 유전자를 제공한다.
또한, 본 발명은 본 발명의 단일클론항체를 코딩하는 유전자를 함유하는 재조합 벡터를 제공한다.
또한, 본 발명은 본 발명의 단일클론항체를 코딩하는 유전자 또는 상기 유전자를 포함하는 재조합 벡터가 도입된 숙주세포를 제공한다.
또한, 본 발명은 본 발명의 단일클론항체를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단용 조성물을 제공한다.
또한, 본 발명은 본 발명의 단일클론항체를 포함하는 중동호흡기증후군의 항원을 검출 또는 정량하는 키트를 제공한다.
또한, 본 발명은 본 발명의 중쇄 가변영역을 개체에 투여하는 단계를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단 방법을 제공한다.
또한, 본 발명은 중동호흡기증후군의 예방, 치료 또는 진단을 위한 약제의 제조에 사용하기 위한 본 발명의 중쇄 가변영역의 용도를 제공한다.
또한, 본 발명은 본 발명의 경쇄 가변영역을 개체에 투여하는 단계를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단 방법을 제공한다.
또한, 본 발명은 중동호흡기증후군의 예방, 치료 또는 진단을 위한 약제의 제조에 사용하기 위한 본 발명의 경쇄 가변영역의 용도를 제공한다.
또한, 본 발명은 본 발명의 단일클론항체를 개체에 투여하는 단계를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단 방법을 제공한다.
아울러, 본 발명은 중동호흡기증후군의 예방, 치료 또는 진단을 위한 약제의 제조에 사용하기 위한 본 발명의 단일클론항체의 용도를 제공한다.
본 발명에 따른 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2 단일클론항체는 MERS-CoV의 전장 스파이크 단백질 및 상기 단백질의 S1 도메인에 대한 부착력이 우수하고, 그중에서 90-F1, 90-E5, 90-E6, 90-F2, 77-A5 및 77-A6 단일클론항체는 MERS-CoV의 RBD(Receptor Binding Domain) 항원에 대해 부착력이 우수하다. 또한, 77-A5, 77-A6, 90-E5, 90-E6, 90-F1 및 90-F2 항체는 MERS 슈도바이러스 및 MERS-CoV에 대해 중화능을 나타내고, 90-B2와 90-B7 항체는 MERS-CoV에 대해서만 중화능을 나타내었다. 상기 단일클론항체는 일정한 단량체 형태를 띄며, 안정성이 우수하기에 MERS의 예방, 치료 또는 진단에 유용하게 사용될 수 있다.
도 1은 MERS-CoV의 전장 스파이크 트리머 항원에 대한 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2 항체의 부착력을 확인한 그래프이다. 이때, 양성대조군으로 미국 NIH에서 개발한 C2, A2, A10, G2 및 G4 항체를 사용하였다.
도 2는 스파이크 단백질의 1부터 757번째 아미노산으로 이루어진 MERS-CoV의 S1 항원에 대한 항체의 부착력을 확인한 그래프이다.
도 3은 스파이크 단백질의 377부터 588번째 아미노산으로 이루어진 MERS-CoV의 RBD 항원에 대한 항체의 부착력을 확인한 그래프이다.
도 4는 스파이크 단백질의 757부터 1275번째 아미노산으로 이루어진 MERS-CoV의 S2 항원에 대한 항체의 부착력을 확인한 그래프이다.
도 5a는 MERS-CoV Erasmus 균주의 스파이크 단백질을 이용한 슈도바이러스에 대한 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2 항체의 중화능을 확인한 그래프이다.
도 5b는 MERS-CoV Bisha 1 균주의 스파이크 단백질을 이용한 슈도바이러스에 대한 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2 항체의 중화능을 확인한 그래프이다.
도 6a은 MERS-CoV에 대한 77-A5, 77-A6, 90-A3, 90-A9, 90-B2 및 90-B7 항체의 중화능을 확인한 그래프이다.
도 6b은 MERS-CoV에 대한 90-C4, 90-E5 90-E6, 90-F1 및 90-F2 항체의 중화능을 확인한 그래프이다.
도 7은 SEC-HPLC를 통해 항체의 형태를 분석한 그래프이다.
도 8a은 S1 항원을 부착시켜 SPR(Surface Plasmon Resonance) 어세이를 통해 항원-항체의 결합력을 분석한 그래프이다.
도 8b은 RBD 항원을 부착시켜 SPR(Surface Plasmon Resonance) 어세이를 통해 항원-항체의 결합력을 분석한 그래프이다.
도 9a는 PTS(Protein Thermal Shift) 어세이를 통해 77-A5 및 77-A6 항체의 열 안정성을 확인한 그래프이다.
도 9b는 PTS(Protein Thermal Shift) 어세이를 통해 90-B2 및 90-B7 항체의 열 안정성을 확인한 그래프이다.
도 9c는 PTS(Protein Thermal Shift) 어세이를 통해 90-F1 및 90-F2 항체의 열 안정성을 확인한 그래프이다.
이하, 본 발명을 상세히 설명한다.
본 발명은 상보성 결정부위(CDR)가 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 중쇄 가변영역을 제공한다.
상기 스파이크 단백질은 통상의 기술분야에 알려진 어떠한 서열로 구성되는 폴리펩티드일 수 있다. 상기 폴리펩티드는 단백질의 기능에 영향을 미치지 않는 범위 내에서, 아미노산 잔기의 결실, 삽입, 치환 또는 이들의 조합에 의해서 상이한 서열을 가지는 아미노산의 변이체 또는 단편일 수 있다. 분자의 활성을 전체적으로 변경시키지 않는 단백질 또는 펩티드에서의 아미노산 교환은 당해 분야에 공지되어 있다. 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly 간의 교환이다. 경우에 따라서는 인산화(phosphorylation), 황화(sulfation), 아크릴화(acrylation), 당화(glycosylation), 메틸화(methylation), 파네실화(farnesylation) 등으로 수식(modification)될 수 있다. 본 발명의 일 실시예에서, 상기 스파이크 단백질은 서열번호 23으로 기재되는 아미노산 서열로 구성될 수 있다.
상기 중쇄 가변영역은 중동호흡기증후군 코로나바이러스 스파이크 단백질의 N-말단으로부터 1번째 내지 757번째 아미노산 부위에 특이적으로 결합할 수 있다. 또한, 상기 중쇄 가변영역중, 상보성 결정부위가 서열번호 1, 3, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 단일클론항체의 중쇄 가변영역은 중동호흡기증후군 코로나바이러스 스파이크 단백질의 N-말단으로부터 377번째 내지 588번째 아미노산 부위에도 특이적으로 결합할 수 있다.
본 발명의 구체적인 실시예에서, 본 발명자들은 MERS-CoV의 스파이크 단백질에 특이적인 24종의 단일클론항체를 제조하고, 이 중 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2 항체는 MERS-CoV의 전장 스파이크 및 S1 항원에 대한 부착력이 우수하며(도 1 및 도 2 참조), 90-F1, 90-E5, 90-E6, 90-F2, 77-A5 및 77-A6 항체는 MERS-CoV의 RBD 항원에 대해 부착력이 우수함을 확인하였다(도 3 참조).
또한, 본 발명은 본 발명의 단일클론항체의 중쇄 가변영역을 코딩하는 유전자; 상기 유전자를 함유하는 재조합 벡터; 및 상기 유전자 또는 재조합 벡터가 도입된 숙주세포를 제공한다.
상기 중쇄 가변영역은 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 중쇄 가변영역은 상보성 결정부위(CDR)가 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 중쇄 가변영역일 수 있다.
상기 유전자는 중쇄 가변영역을 코딩하는 서열뿐만 아니라, 상기 유전자와 실질적으로 동일한 염기서열을 갖는 폴리뉴클레오티드 및 이의 단편을 포함한다. 실질적으로 동일한 염기서열을 갖는 폴리뉴클레오티드는 본 발명의 폴리뉴클레오티드와 80％ 이상, 구체적으로는 90％ 이상, 더욱 구체적으로는 95％ 이상의 상동성을 가질 수 있다. 상술한 바와 같이, 본 발명의 폴리뉴클레오티드는 이와 동등한 활성을 갖는 단백질을 코딩하는 한, 하나 이상의 염기서열이 치환, 결실 또는 삽입된 변이체를 포함할 수 있다.
상기 벡터는 목적하는 숙주세포에서 목적 펩타이드를 발현할 수 있는 재조합 벡터로서, 유전자 삽입물이 발현되도록 작동가능하게 연결된 필수적인 조절 요소를 포함하는 유전자 제작물을 의미한다. 상기 벡터는 개시코돈, 종결코돈, 프로모터, 오퍼레이터 등의 발현조절 요소들을 포함하는데, 상기 개시코돈 및 종결코돈은 일반적으로 폴리펩타이드를 암호화하는 뉴클레오티드 서열의 일부로 간주되며, 유전자 제작물이 투여되었을 때 개체에서 반드시 작용을 나타내야 하며 코딩 서열과 인프레임(in frame)에 있어야 한다.
본 발명의 용어 "작동가능하게 연결(operably linked)"은 일반적인 기능을 수행하도록 핵산 발현조절 서열과 목적하는 단백질 또는 RNA를 코딩하는 핵산 서열이 기능적으로 연결(functional linkage)되어 있는 상태를 의미한다. 예를 들어 프로모터와 단백질 또는 RNA를 코딩하는 핵산 서열이 작동가능하게 연결되어 코딩서열의 발현에 영향을 미칠 수 있다. 벡터와의 작동가능한 연결은 당해 기술분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용할 수 있다.
본 발명의 벡터 시스템은 당업계에 공지된 다양한 방법을 통해 구축될 수 있으며, 이에 대한 구체적인 방법은 Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press(2001)에 개시되어 있다.
본 발명의 벡터는 전형적으로 클로닝을 위한 벡터 또는 발현을 위한 벡터로서 구축될 수 있다. 또한, 본 발명의 벡터는 원핵세포 또는 진핵세포를 숙주로 하여 구축될 수 있다. 예를 들어, 본 발명의 벡터가 발현 벡터이고, 원핵 세포를 숙주로 하는 경우에는, 전사를 진행시킬 수 있는 강력한 프로모터 (예컨대, tac 프로모터, lac 프로모터, lacUV5 프로모터, lpp 프로모터, pLλ 프로모터, pRλ 프로모터, rac5 프로모터, amp 프로모터, recA 프로모터, SP6 프로모터, trp 프로모터 및 T7 프로모터 등), 해독의 개시를 위한 라이보좀 결합 자리 및 전사/해독 종결 서열을 포함하는 것이 일반적이다. 숙주 세포로서 E. coli(예컨대, HB101, BL21, DH5α 등)가 이용되는 경우, E. coli 트립토판 생합성 경로의 프로모터 및 오퍼레이터 부위(Yanofsky, C., J. Bacteriol., 158:1018-1024(1984)) 그리고 파아지 λ의 좌향 프로모터 (pLλ 프로모터, Herskowitz, I. and Hagen, D., Ann. Rev. Genet., 14:399-445(1980))가 조절 부위로서 이용될 수 있다. 숙주세포로서 바실러스 균이 이용되는 경우, 바실러스 츄린겐시스의 독소단백질 유전자의 프로모터(Appl. Environ. Microbiol. 64:3932-3938(1998); Mol. Gen. Genet. 250:734-741(1996)) 또는 바실러스균에서 발현 가능한 어떠한 프로모터라도 조절부위로 이용될 수 있다.
한편, 본 발명에 이용될 수 있는 벡터는 당업계에서 종종 사용되는 플라스미드(일례로, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14, pGEX 시리즈, pET 시리즈, pRSET, pBluescript, pGEX2T, pCR1, pMB9, RP4 및 pUC19 등), 파지(일례로, λgt4·λB, λ-Charon, λΔz1 및 M13 등) 또는 바이러스(일례로, SV40 등)를 조작하여 제작될 수 있다.
한편, 본 발명의 벡터가 발현 벡터이고, 진핵 세포를 숙주로 하는 경우에는, 포유동물 세포의 지놈으로부터 유래된 프로모터(일례로, 메탈로티오닌 프로모터, β-액틴 프로모터, 사람 헤로글로빈 프로모터 및 사람 근육 크레아틴 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터(일례로, 소유두종바이러스 프로모터, 아데노바이러스-연관 바이러스(adeno-associated virus) 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 프로모터, HSV의 tk 프로모터, 마우스 유방 종양 바이러스(MMTV) 프로모터, HIV의 LTR 프로모터, 몰로니 바이러스의 프로모터 엡스타인 바 바이러스(EBV)의 프로모터, 담배모자이크 바이러스 및 로우스 사코마 바이러스(RSV)의 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 갖는다.
본 발명의 벡터는 그로부터 발현되는 항체의 정제를 용이하게 하기 위하여, 다른 서열과 융합될 수도 있다. 융합되는 서열은 예컨대, 글루타티온 S-트랜스퍼라제, 말토스 결합 단백질, FLAG 또는 6x His 등이 있다.
또한, 본 발명의 벡터에 의해 발현되는 단백질이 항체이기 때문에, 정제를 위한 추가적인 서열 없이도, 발현된 항체는 단백질 A 컬럼 등을 통하여 용이하게 정제할 수 있다.
또한, 상기 벡터는 선택마커를 더 포함할 수 있다. 선택마커는 형질전환된 미생물 또는 재조합된 벡터의 선별을 위한 마커로서 약물 내성, 영양 요구성, 세포 독성제에 대한 내성 또는 표면 단백질의 발현과 같이 선택 가능한 표현형을 부여하기 위해 사용될 수 있다. 선택마커를 포함하는 벡터를 사용하면 선택제가 처리된 환경에서 선택마커를 발현하는 세포만 생존하므로 형질 전환된 세포를 선별할 수 있다. 통상의 기술분야에서 사용할 수 있는 선택마커라면 모두 사용할 수 있다. 일례로, 선택마커로서 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 게네티신, 네오마이신 또는 테트라사이클린을 사용할 수 있다.
본 발명에 따른 단일클론항체의 중쇄 가변영역을 발현시키기 위해 다양한 숙주세포가 사용될 수 있다. 사용할 수 있는 숙주세포의 일례로, 에세리키아 속(Escherichia sp.), 바실러스 속(Bacillus sp.), 스트렙토마이세스 속(Streptomyces sp.), 슈도모나스 속(Pseudomonas sp.), 프로테우스 속(Proteus sp.) 또는 스타필로코쿠스 속(Staphylococcus sp.)과 같은 원핵 세포일 수 있다. 또한, 아스페르길러스 속(Aspergillus sp.)과 같은 진균, 피키아 속(Pichia sp.), 사카로마이세스 속(Saccharomyces sp.), 쉬조사카로마세스 속(Schizosaccharomyces sp.) 또는 뉴로스포라 속(Neurospora sp.)과 같은 효모, 그 밖의 하등진핵 세포 또는 동물 세포, 식물 세포 등 진핵 세포일 수 있다.
본 발명의 재조합 벡터를 숙주세포에 도입하여 형질전환하는 방법으로는 통상적으로 알려진 유전자 조작방법을 사용할 수 있다. 예를 들어, 물리적인 방법으로서, 미세주입법, 리포좀을 이용한 방법, 직접적인 DNA 흡수 방법(directed DNA uptake), 수용체 매개 DNA 트랜스퍼 방법(receptor-mediated DNA transfer), Ca++을 이용한 DNA 운반 방법 또는 바이러스를 이용한 유전자 운반 방법을 사용할 수 있다.
본 발명의 구체적인 실시예에서, 본 발명자들은 MERS-CoV의 스파이크 단백질에 특이적인 단일클론항체를 제조하고, 이 중 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2 항체는 MERS-CoV의 전장 스파이크 및 S1 항원에 대한 부착력이 우수하며(도 1 및 도 2 참조), 90-F1, 90-E5, 90-E6, 90-F2, 77-A5 및 77-A6 항체는 MERS-CoV의 RBD 항원에 대해 부착력이 우수함을 확인하였다(도 3 참조).
또한, 본 발명은 본 발명의 단일클론항체의 중쇄 가변영역을 포함하는 중동호흡기증후군 예방, 치료 또는 진단용 조성물을 제공한다.
상기 중쇄 가변영역은 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 중쇄 가변영역은 상보성 결정부위(CDR)가 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 중쇄 가변영역일 수 있다.
본 발명의 중동호흡기증후군 치료용 조성물은 개별 치료제로 투여되거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있다.
상기 단일클론항체의 중쇄 가변영역을 포함하는 조성물은 항체-치료제 결합체 형태로 생체내로 투입되어 바이러스 감염 치료에 이용될 수 있다. 치료제로는 화학 치료제, 방사성핵종, 면역치료제, 사이토킨, 케모킨, 독소, 생물작용제 또는 효소 저해물질 등을 사용할 수 있다. 항생제를 항체에 결합시키는 방법은 예를 들면, 문헌 G. Gregoriadies, ed., Academic Press London, (1979); Arnon et al., Recent Results in Cancer Res.,75: 236(1980); 및 Moolton et al., Immunolog. Res., 62:47(1982)에 기재되어 있다.
본 발명의 항체와 커플링 시키기기에 바람직한 약품은 항세균, 구충, 항진균 및 관련 약제들로, 예를 들면, 설폰아미드, 페니실린 및 세팔로스포린, 아미노글리코시드, 테트라사이클린, 클로람페니콜, 피페라진, 클로로퀸, 디아미노피라딘, 메트로니아지드, 이소니아지드, 리팜핀, 스트렙토마이신, 설폰, 에리트로마이신, 폴리믹신, 나이스타틴, 암포테리신, 5-플루오로사이토신, 5-요오드-2'-데옥시우리딘, 1-아다만타아민, 아데닌 아라비노사이드, 암만니틴, 리바바린 또는 아지도티미딘(AZT)일 수 있다. 약제를 특이적 표적 부위로 표적화하는데 적당하고 바람직한 여러 가지 조건은 예를 들어, 문헌 Trouet et al., Plenum Press, New York and London, 19-30(1982)에 보고되어 있다. 상기 항체-치료제 결합체에서 치료제로 이용될 수 있는 면역조절제는 림포카인 또는 사이토카인일 수 있으나, 이에 한정되지 않는다.
본 발명의 중동호흡기증후군 예방 또는 치료용 조성물은 조성물 전체 중량에 대하여 유효성분인 본 발명의 단일클론항체의 중쇄 가변영역을 10 내지 95 중량%로 포함할 수 있다. 또한, 본 발명의 예방 또는 치료용 조성물은 상기 유효성분 외에 추가로 동일 또는 유사한 기능을 나타내는 유효성분을 1종 이상 추가로 함유할 수 있다.
본 발명의 예방 또는 치료용 조성물은 또한 생물학적 제제에 통상적으로 사용되는 담체, 희석제, 부형제 또는 둘 이상의 이들의 조합을 포함할 수 있다. 약제학적으로 허용 가능한 담체는 조성물을 생체 내에 전달하는데 적합한 것이면 특별히 제한되지 않으며, 예로서, Merck Index, 13th ed., Merck & Co. Inc. 에 기재된 화합물, 식염수, 멸균수, 링거액, 완충 식염수, 덱스트로스 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 또는 이들 성분 중 1 성분 이상을 혼합한 것일 수 있다. 이때, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다.
상기 조성물을 제제화할 경우, 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 제조된다.
본 발명의 조성물은 경구제제 또는 비경구제제로 제형화 될 수 있다. 경구 투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제, 트로키제 등이 포함되며, 이러한 고형 제제는 하나 이상의 조성물에 적어도 하나 이상의 부형제, 예를 들면, 전분, 탄산칼슘, 수크로스, 락토오스 및 젤라틴 등을 섞어 조제될 수 있다. 또한, 마그네슘 스티레이트, 탈크 같은 윤활제들도 첨가될 수 있다. 한편, 액상 제제로는 현탁제, 내용액제, 유제 또는 시럽제 등이 해당되는데, 여기에는 습윤제, 감미제, 방향제, 보존제 등과 같은 부형제가 포함될 수 있다.
비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁용제, 유제 등의 주사제가 포함될 수 있다.
비수성용제, 현탁용제로는 프로필렌글리콜, 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다.
본 발명의 예방 또는 치료용 조성물은 목적하는 방법에 따라 경구 투여하거나 비경구 투여될수 있으며, 비경구 투여는 피부 외용 또는 복강내 주사, 직장내 주사, 피하주사, 정맥주사, 근육내 주사 또는 흉부내 주사 주입방식중 선택될 수 있다.
본 발명에 따른 예방 또는 치료용 조성물은 약제학적으로 유효한 양으로 투여된다. 이는 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 동시 사용되는 약물 등에 따라 달라질 수 있다. 본 발명의 조성물은 단독 또는 다른 치료제와 병용하여 투여될 수 있다. 병용 투여시, 투여는 순차적 또는 동시일 수 있다.
그러나 바람직한 효과를 위해서, 본 발명에 따른 예방 또는 치료용 조성물에 포함되는 유효성분의 양은 0.001 내지 10,000 mg/㎏, 구체적으로는 0.1 내지 5 g/kg일 수 있다. 상기 투여는 하루에 1회일 수 있고, 수회로 나뉠 수도 있다.
본 발명의 진단용 조성물은 목적하는 질환의 진단에 사용되는 주된 수단을 의미하는 것으로, 본 발명의 목적에 따라 MERS-CoV를 진단하기 위한 물질들이 포함될 수 있다. 진단 방법은 항체 또는 항체 단편을 샘플과 접촉시키는 것을 포함할 수 있다. 상기 샘플은 객담, 콧구멍, 부비강(sinus cavity), 침샘, 폐, 간, 췌장, 신장, 귀, 눈, 태반, 소화관, 심장, 난소, 뇌하수체, 부신, 갑상선, 뇌 또는 피부로부터 취한 조직, 세포, 소변, 전혈, 혈청, 혈장, 분변, 세포 배양 상등액 또는 파열된 진핵세포일 수 있다.
샘플과 항체 복합체의 형성은 비색법(colormetric method), 전기화학법(electrochemical method), 형광법(fluorimetric method), 발광법(luminometry), 입자계수법(particle counting method), 육안측정법(visual assessment) 또는 섬광계수법(scintillation counting method)으로 검출할 수 있다.
상기 검출은 샘플과 항체 복합체를 검출하기 위한 것으로 여러 가지 표지체를 사용하여 실시할 수 있다. 표지체로 효소, 형광물, 리간드, 발광물, 미소입자 또는 방사성 동위원소를 사용할 수 있다.
검출 표지체로서 효소로는 아세틸콜린에스테라제, 알칼라인 포스파타제, β-D-갈락토시다제, 호스래디쉬 퍼옥시다제 및 β-라타마제 등을, 형광물로는 플루오레세인, Eu3 +, Eu3 +킬레이트 또는 크립테이트 등을, 리간드로는 바이오틴 유도체 등을, 발광물로는 아크리디늄 에스테르 및 이소루미놀 유도체 등을, 미소입자로는 콜로이드 금 및 착색된 라텍스 등을, 방사성 동위원소로는 57Co, 3H, 125I 및 125I-볼톤(Bonton) 헌터(Hunter) 시약 등을 사용할 수 있다.
본 발명의 구체적인 실시예에서, 본 발명자들은 MERS-CoV의 스파이크 단백질에 특이적인 단일클론항체를 제조하고, 이 중 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2 항체는 MERS-CoV의 전장 스파이크 및 S1 항원에 대한 부착력이 우수하며(도 1 및 도 2 참조), 90-F1, 90-E5, 90-E6, 90-F2, 77-A5 및 77-A6 항체는 MERS-CoV의 RBD 항원에 대해 부착력이 우수함을 확인하였다(도 3 참조). 또한, 77-A5, 77-A6, 90-E5, 90-E6, 90-F1 및 90-F2 항체는 MERS 슈도바이러스 및 MERS-CoV에 대해 중화능을 나타내고, 90-B2와 90-B7 항체는 MERS-CoV에 대해서만 중화능을 나타내었다(도 5a, 도 5b, 도 6a 및 도 6b 참조). 상기 단일클론항체는 일정한 단량체 형태를 띄며(도 7 참조), 안정성이 우수함을 확인하였다(도 9a 내지 도 9c 참조).
또한, 본 발명은 본 발명의 단일클론항체의 중쇄 가변영역을 포함한 항체 및 단백질을 이용해 중동호흡기증후군의 항원을 검출 또는 정량하는 키트를 제공한다.
상기 중쇄 가변영역은 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 중쇄 가변영역은 상보성 결정부위(CDR)가 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 중쇄 가변영역일 수 있다.
상기 키트는 당업자에게 알려진 종래의 제조방법에 의해 제조될 수 있으며, 버퍼, 안정화제, 불활성 단백질 등을 더 포함할 수 있다. 상기 키트는 검출시약의 양을 탐색하기 위해 검출체로서 부착된 형광물질의 형광을 검출함으로써 수행되는 형광법 또는 검출체로서 부착된 방사선 동위원소의 방사선을 검출함으로써 수행되는 방사선법을 통한 초고속 스크리닝(high throughput screening, HTS) 시스템, 검출체의 표지 없이 표면의 플라즈몬 공명 변화를 실시간으로 측정하는 SPR(surface plasmon resonance) 방법 또는 SPR 시스템을 영상화하여 확인하는 SPRI(surface plasmon resonance imaging) 방법을 이용할 수 있다.
본 발명의 구체적인 실시예에서, 본 발명자들은 MERS-CoV의 스파이크 단백질에 특이적인 단일클론항체를 제조하고, 이 중 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2 항체는 MERS-CoV의 전장 스파이크 및 S1 항원에 대한 부착력이 우수하며(도 1 및 도 2 참조), 90-F1, 90-E5, 90-E6, 90-F2, 77-A5 및 77-A6 항체는 MERS-CoV의 RBD 항원에 대해 부착력이 우수함을 확인하였다(도 3 참조). 또한, 77-A5, 77-A6, 90-E5, 90-E6, 90-F1 및 90-F2 항체는 MERS 슈도바이러스 및 MERS-CoV에 대해 중화능을 나타내고, 90-B2와 90-B7 항체는 MERS-CoV에 대해서만 중화능을 나타내었다(도 5a, 도 5b, 도 6a 및 도 6b 참조). 상기 단일클론항체는 단량체 형태를 띄며(도 7 참조), 안정성이 우수함을 확인하였다( 도 9a 내지 도 9c 참조).
또한, 본 발명은 본 발명의 중쇄 가변영역을 개체에 투여하는 단계를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단 방법을 제공한다.
본 발명에 따른 중쇄 가변영역은 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 중쇄 가변영역은 상보성 결정부위(CDR)가 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 중쇄 가변영역일 수 있다.
또한, 상기 개체는 포유동물, 구체적으로 인간일 수 있다.
본 발명의 중쇄 가변영역은 목적하는 방법에 따라 경구 투여하거나 비경구 투여될수 있으며, 비경구 투여는 피부 외용 또는 복강내 주사, 직장내 주사, 피하주사, 정맥주사, 근육내 주사 또는 흉부내 주사 주입방식중 선택될 수 있다.
본 발명에 따른 중쇄 가변영역은 약제학적으로 유효한 양으로 투여된다. 이는 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 동시 사용되는 약물 등에 따라 달라질 수 있다. 본 발명의 조성물은 단독 또는 다른 치료제와 병용하여 투여될 수 있다. 병용 투여시, 투여는 순차적 또는 동시일 수 있다.
그러나 바람직한 효과를 위해서, 본 발명에 따른 중쇄 가변영역에 포함되는 유효성분의 양은 0.001 내지 10,000 mg/㎏, 구체적으로는 0.1 내지 5 g/kg일 수 있다. 상기 투여는 하루에 1회일 수 있고, 수회로 나뉠 수도 있다.
본 발명의 중쇄 가변영역은 목적하는 질환의 진단에 사용되는 주된 수단을 의미하는 것으로, 본 발명의 목적에 따라 MERS-CoV를 진단하기 위한 물질들이 포함될 수 있다. 진단 방법은 항체 또는 항체 단편을 샘플과 접촉시키는 것을 포함할 수 있다. 상기 샘플은 객담, 콧구멍, 부비강(sinus cavity), 침샘, 폐, 간, 췌장, 신장, 귀, 눈, 태반, 소화관, 심장, 난소, 뇌하수체, 부신, 갑상선, 뇌 또는 피부로부터 취한 조직, 세포, 소변, 전혈, 혈청, 혈장, 분변, 세포 배양 상등액 또는 파열된 진핵세포일 수 있다.
샘플과 항체 복합체의 형성은 비색법(colormetric method), 전기화학법(electrochemical method), 형광법(fluorimetric method), 발광법(luminometry), 입자계수법(particle counting method), 육안측정법(visual assessment) 또는 섬광계수법(scintillation counting method)으로 검출할 수 있다.
상기 검출은 샘플과 항체 복합체를 검출하기 위한 것으로 여러 가지 표지체를 사용하여 실시할 수 있다. 표지체로 효소, 형광물, 리간드, 발광물, 미소입자 또는 방사성 동위원소를 사용할 수 있다.
검출 표지체로서 효소로는 아세틸콜린에스테라제, 알칼라인 포스파타제, β-D-갈락토시다제, 호스래디쉬 퍼옥시다제 및 β-라타마제 등을, 형광물로는 플루오레세인, Eu3 +, Eu3 +킬레이트 또는 크립테이트 등을, 리간드로는 바이오틴 유도체 등을, 발광물로는 아크리디늄 에스테르 및 이소루미놀 유도체 등을, 미소입자로는 콜로이드 금 및 착색된 라텍스 등을, 방사성 동위원소로는 57Co, 3H, 125I 및 125I-볼톤(Bonton) 헌터(Hunter) 시약 등을 사용할 수 있다.
나아가, 본 발명은 중동호흡기증후군의 예방, 치료 또는 진단을 위한 약제의 제조에 사용하기 위한 본 발명의 중쇄 가변영역의 용도를 제공한다.
본 발명에 따른 중쇄 가변영역은 상술한 바와 같은 특징을 가질 수 있다.
또한, 본 발명은 상보성 결정부위(CDR)가 각각 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 경쇄 가변영역을 제공한다.
상기 스파이크 단백질은 상술한 바와 같은 특징을 가질 수 있다. 본 발명의 일 실시예에서, 상기 스파이크 단백질은 서열번호 23으로 기재되는 아미노산 서열로 구성될 수 있다.
상기 경쇄 가변영역은 중동호흡기증후군 코로나바이러스 스파이크 단백질의 N-말단으로부터 1번째 내지 757번째 아미노산 부위에 특이적으로 결합할 수 있다. 또한, 상기 경쇄 가변영역중, 상보성 결정부위가 서열번호 2, 4, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 단일클론항체의 경쇄 가변영역은 중동호흡기증후군 코로나바이러스 스파이크 단백질의 N-말단으로부터 377번째 내지 588번째 아미노산 부위에도 특이적으로 결합할 수 있다.
또한, 본 발명은 본 발명의 단일클론항체의 경쇄 가변영역을 코딩하는 유전자; 상기 유전자를 함유하는 재조합 벡터; 및 상기 유전자 또는 재조합 벡터가 도입된 숙주세포를 제공한다.
상기 경쇄 가변영역은 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 경쇄 가변영역은 상보성 결정부위(CDR)가 각각 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 경쇄 가변영역일 수 있다.
상기 유전자는 상술한 바와 같은 특징을 가질 수 있다.
상기 벡터는 목적하는 숙주세포에서 목적 펩타이드를 발현할 수 있는 재조합 벡터로서, 유전자 삽입물이 발현되도록 작동가능하게 연결된 필수적인 조절 요소를 포함하는 유전자 제작물을 의미하며, 상술한 바와 같은 특징을 가질 수 있다.
본 발명에 따른 단일클론항체의 경쇄 가변영역을 발현시키기 위해 다양한 숙주세포가 사용될 수 있다. 사용할 수 있는 숙주세포는 상술한 바와 같은 특징을 가질 수 있다.
본 발명의 재조합 벡터를 숙주세포에 도입하여 형질전환하는 방법으로는 통상적으로 알려진 유전자 조작방법을 사용할 수 있다. 예를 들어, 물리적인 방법으로서, 미세주입법, 리포좀을 이용한 방법, 직접적인 DNA 흡수 방법(directed DNA uptake), 수용체 매개 DNA 트랜스퍼 방법(receptor-mediated DNA transfer), Ca++을 이용한 DNA 운반 방법 또는 바이러스를 이용한 유전자 운반 방법을 사용할 수 있다.
또한, 본 발명은 본 발명의 단일클론항체의 경쇄 가변영역을 포함하는 중동호흡기증후군 예방, 치료 또는 진단용 조성물을 제공한다.
상기 경쇄 가변영역은 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 경쇄 가변영역은 상보성 결정부위(CDR)가 각각 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 경쇄 가변영역일 수 있다.
본 발명의 예방 또는 치료용 조성물은 상술한 바와 같은 특징을 가질 수 있다.
본 발명의 진단용 조성물은 상술한 바와 같은 특징을 가질 수 있다. 일례로, 본 발명의 진단용 조성물은 목적하는 질환의 진단에 사용되는 주된 수단을 의미하는 것으로, 본 발명의 목적에 따라 MERS-CoV를 진단하기 위한 물질들이 포함될 수 있다. 진단 방법은 항체 또는 항체 단편을 샘플과 접촉시키는 것을 포함할 수 있다. 상기 샘플은 객담, 콧구멍, 부비강(sinus cavity), 침샘, 폐, 간, 췌장, 신장, 귀, 눈, 태반, 소화관, 심장, 난소, 뇌하수체, 부신, 갑상선, 뇌 또는 피부로부터 취한 조직, 세포, 소변, 전혈, 혈청, 혈장, 분변, 세포 배양 상등액 또는 파열된 진핵세포일 수 있다.
또한, 본 발명은 본 발명의 단일클론항체의 경쇄 가변영역을 포함한 항체 및 단백질을 이용해 중동호흡기증후군의 항원을 검출 또는 정량하는 키트를 제공한다.
상기 경쇄 가변영역은 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 경쇄 가변영역은 상보성 결정부위(CDR)가 각각 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 경쇄 가변영역일 수 있다.
상기 키트는 상술한 바와 같은 특징을 가질 수 있다. 일례로, 당업자에게 알려진 종래의 제조방법에 의해 제조될 수 있으며, 버퍼, 안정화제, 불활성 단백질 등을 더 포함할 수 있다. 상기 키트는 검출시약의 양을 탐색하기 위해 검출체로서 부착된 형광물질의 형광을 검출함으로써 수행되는 형광법 또는 검출체로서 부착된 방사선 동위원소의 방사선을 검출함으로써 수행되는 방사선법을 통한 초고속 스크리닝(high throughput screening, HTS) 시스템, 검출체의 표지 없이 표면의 플라즈몬 공명 변화를 실시간으로 측정하는 SPR(surface plasmon resonance) 방법 또는 SPR 시스템을 영상화하여 확인하는 SPRI(surface plasmon resonance imaging) 방법을 이용할 수 있다.
또한, 본 발명은 본 발명의 경쇄 가변영역을 개체에 투여하는 단계를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단 방법을 제공한다.
본 발명에 따른 경쇄 가변영역은 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 경쇄 가변영역은 상보성 결정부위(CDR)가 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 경쇄 가변영역일 수 있다.
또한, 상기 개체는 포유동물, 구체적으로 인간일 수 있다.
본 발명의 경쇄 가변영역은 목적하는 방법에 따라 경구 투여하거나 비경구 투여될수 있으며, 비경구 투여는 피부 외용 또는 복강내 주사, 직장내 주사, 피하주사, 정맥주사, 근육내 주사 또는 흉부내 주사 주입방식중 선택될 수 있다.
본 발명에 따른 경쇄 가변영역은 약제학적으로 유효한 양으로 투여된다. 이는 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 동시 사용되는 약물 등에 따라 달라질 수 있다. 본 발명의 조성물은 단독 또는 다른 치료제와 병용하여 투여될 수 있다. 병용 투여시, 투여는 순차적 또는 동시일 수 있다.
그러나 바람직한 효과를 위해서, 본 발명에 따른 경쇄 가변영역에 포함되는 유효성분의 양은 0.001 내지 10,000 mg/㎏, 구체적으로는 0.1 내지 5 g/kg일 수 있다. 상기 투여는 하루에 1회일 수 있고, 수회로 나뉠 수도 있다.
본 발명의 경쇄 가변영역은 목적하는 질환의 진단에 사용되는 주된 수단을 의미하는 것으로, 본 발명의 목적에 따라 MERS-CoV를 진단하기 위한 물질들이 포함될 수 있다. 진단 방법은 항체 또는 항체 단편을 샘플과 접촉시키는 것을 포함할 수 있다. 상기 샘플은 객담, 콧구멍, 부비강(sinus cavity), 침샘, 폐, 간, 췌장, 신장, 귀, 눈, 태반, 소화관, 심장, 난소, 뇌하수체, 부신, 갑상선, 뇌 또는 피부로부터 취한 조직, 세포, 소변, 전혈, 혈청, 혈장, 분변, 세포 배양 상등액 또는 파열된 진핵세포일 수 있다.
샘플과 항체 복합체의 형성은 비색법(colormetric method), 전기화학법(electrochemical method), 형광법(fluorimetric method), 발광법(luminometry), 입자계수법(particle counting method), 육안측정법(visual assessment) 또는 섬광계수법(scintillation counting method)으로 검출할 수 있다.
상기 검출은 샘플과 항체 복합체를 검출하기 위한 것으로 여러 가지 표지체를 사용하여 실시할 수 있다. 표지체로 효소, 형광물, 리간드, 발광물, 미소입자 또는 방사성 동위원소를 사용할 수 있다.
검출 표지체로서 효소로는 아세틸콜린에스테라제, 알칼라인 포스파타제, β-D-갈락토시다제, 호스래디쉬 퍼옥시다제 및 β-라타마제 등을, 형광물로는 플루오레세인, Eu3 +, Eu3 +킬레이트 또는 크립테이트 등을, 리간드로는 바이오틴 유도체 등을, 발광물로는 아크리디늄 에스테르 및 이소루미놀 유도체 등을, 미소입자로는 콜로이드 금 및 착색된 라텍스 등을, 방사성 동위원소로는 57Co, 3H, 125I 및 125I-볼톤(Bonton) 헌터(Hunter) 시약 등을 사용할 수 있다.
나아가, 본 발명은 중동호흡기증후군의 예방, 치료 또는 진단을 위한 약제의 제조에 사용하기 위한 본 발명의 경쇄 가변영역의 용도를 제공한다.
본 발명에 따른 경쇄 가변영역은 상술한 바와 같은 특징을 가질 수 있다.
또한, 본 발명은 상보성 결정부위가 각각 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중쇄 가변영역과 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 경쇄 가변영역을 포함하는 중동호흡기증후군 코로나바이러스 스파이크 단백질에 특이적으로 결합하는 단일클론항체를 제공한다.
상기 스파이크 단백질은 상술한 바와 같은 특징을 가질 수 있다. 본 발명의 일 실시예에서, 상기 스파이크 단백질은 서열번호 23으로 기재되는 아미노산 서열로 구성될 수 있다. 상기 경쇄 가변영역 및 중쇄 가변영역은 상술한 바와 같은 특징을 가질 수 있다.
상기 단일클론항체는 모노클로날 항체 또는 단클론항체라고도 불리며, 단일 항체 형성세포가 생성하는 항체로, 1차 구조(아미노산 배열)가 균일한 특징이 있다. 오직 하나의 항원 결정기만을 인식하며, 일반적으로 암세포와 항체생산세포를 융합한 하이브리도마(hybridoma cell)를 배양하여 생산되지만, 확보된 항체 유전자 서열을 이용하여 다른 재조합 단백질 발현 숙주세포를 이용하여 생산할 수도 있다.
또한, 본 발명은 본 발명의 단일클론항체를 코딩하는 유전자; 상기 유전자를 함유하는 재조합 벡터; 및 상기 유전자 또는 재조합 벡터가 도입된 숙주세포를 제공한다.
상기 단일클론항체는 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 상보성 결정부위가 각각 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중쇄 가변영역과 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 경쇄 가변영역을 포함하는 중동호흡기증후군 코로나바이러스 스파이크 단백질에 특이적으로 결합하는 단일클론항체일 수 있다.
상기 유전자는 상술한 바와 같은 특징을 가질 수 있다.
상기 벡터는 목적하는 숙주세포에서 목적 펩타이드를 발현할 수 있는 재조합 벡터로서, 유전자 삽입물이 발현되도록 작동가능하게 연결된 필수적인 조절 요소를 포함하는 유전자 제작물을 의미하며, 상술한 바와 같은 특징을 가질 수 있다.
본 발명에 따른 단일클론항체를 발현시키기 위해 다양한 숙주세포가 사용될 수 있다. 사용할 수 있는 숙주세포는 상술한 바와 같은 특징을 가질 수 있다.
본 발명의 재조합 벡터를 숙주세포에 도입하여 형질전환하는 방법으로는 통상적으로 알려진 유전자 조작방법을 사용할 수 있다. 예를 들어, 물리적인 방법으로서, 미세주입법, 리포좀을 이용한 방법, 직접적인 DNA 흡수 방법(directed DNA uptake), 수용체 매개 DNA 트랜스퍼 방법(receptor-mediated DNA transfer), Ca++을 이용한 DNA 운반 방법 또는 바이러스를 이용한 유전자 운반 방법을 사용할 수 있다.
또한, 본 발명은 본 발명의 단일클론항체를 포함하는 중동호흡기증후군 예방, 치료 또는 진단용 조성물을 제공한다.
상기 단일클론항체는 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 상보성 결정부위가 각각 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중쇄 가변영역과 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 경쇄 가변영역을 포함하는 중동호흡기증후군 코로나바이러스 스파이크 단백질에 특이적으로 결합하는 단일클론항체일 수 있다.
본 발명의 예방 또는 치료용 조성물은 상술한 바와 같은 특징을 가질 수 있다.
본 발명의 진단용 조성물은 상술한 바와 같은 특징을 가질 수 있다. 일례로, 본 발명의 진단용 조성물은 목적하는 질환의 진단에 사용되는 주된 수단을 의미하는 것으로, 본 발명의 목적에 따라 MERS-CoV를 진단하기 위한 물질들이 포함될 수 있다. 진단 방법은 항체 또는 항체 단편을 샘플과 접촉시키는 것을 포함할 수 있다. 상기 샘플은 객담, 콧구멍, 부비강(sinus cavity), 침샘, 폐, 간, 췌장, 신장, 귀, 눈, 태반, 소화관, 심장, 난소, 뇌하수체, 부신, 갑상선, 뇌 또는 피부로부터 취한 조직, 세포, 소변, 전혈, 혈청, 혈장, 분변, 세포 배양 상등액 또는 파열된 진핵세포일 수 있다.
또한, 본 발명은 본 발명의 단일클론항체를 포함하는 중동호흡기증후군의 항원을 검출 또는 정량하는 키트를 제공한다.
상기 단일클론항체는 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 상보성 결정부위가 각각 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중쇄 가변영역과 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 경쇄 가변영역을 포함하는 중동호흡기증후군 코로나바이러스 스파이크 단백질에 특이적으로 결합하는 단일클론항체일 수 있다.
상기 키트는 상술한 바와 같은 특징을 가질 수 있다. 상기 키트는 당업자에게 알려진 종래의 제조방법에 의해 제조될 수 있으며, 버퍼, 안정화제, 불활성 단백질 등을 더 포함할 수 있다. 상기 키트는 검출시약의 양을 탐색하기 위해 검출체로서 부착된 형광물질의 형광을 검출함으로써 수행되는 형광법 또는 검출체로서 부착된 방사선 동위원소의 방사선을 검출함으로써 수행되는 방사선법을 통한 초고속 스크리닝(high throughput screening, HTS) 시스템, 검출체의 표지 없이 표면의 플라즈몬 공명 변화를 실시간으로 측정하는 SPR(surface plasmon resonance) 방법 또는 SPR 시스템을 영상화하여 확인하는 SPRI(surface plasmon resonance imaging) 방법을 이용할 수 있다.
또한, 본 발명은 본 발명의 단일클론항체를 개체에 투여하는 단계를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단 방법을 제공한다.
본 발명에 따른 단일클론항체는 상술한 바와 같은 특징을 가질 수 있다. 일례로, 상기 경쇄 가변영역은 상보성 결정부위(CDR)가 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중쇄 가변영역과 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 경쇄 가변영역을 포함하는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체일 수 있다.
또한, 상기 개체는 포유동물, 구체적으로 인간일 수 있다.
본 발명의 단일클론항체는 목적하는 방법에 따라 경구 투여하거나 비경구 투여될수 있으며, 비경구 투여는 피부 외용 또는 복강내 주사, 직장내 주사, 피하주사, 정맥주사, 근육내 주사 또는 흉부내 주사 주입방식중 선택될 수 있다.
본 발명에 따른 단일클론항체는 약제학적으로 유효한 양으로 투여된다. 이는 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 동시 사용되는 약물 등에 따라 달라질 수 있다. 본 발명의 조성물은 단독 또는 다른 치료제와 병용하여 투여될 수 있다. 병용 투여시, 투여는 순차적 또는 동시일 수 있다.
그러나 바람직한 효과를 위해서, 본 발명에 따른 단일클론항체에 포함되는 유효성분의 양은 0.001 내지 10,000 mg/㎏, 구체적으로는 0.1 내지 5 g/kg일 수 있다. 상기 투여는 하루에 1회일 수 있고, 수회로 나뉠 수도 있다.
본 발명의 단일클론항체는 목적하는 질환의 진단에 사용되는 주된 수단을 의미하는 것으로, 본 발명의 목적에 따라 MERS-CoV를 진단하기 위한 물질들이 포함될 수 있다. 진단 방법은 항체 또는 항체 단편을 샘플과 접촉시키는 것을 포함할 수 있다. 상기 샘플은 객담, 콧구멍, 부비강(sinus cavity), 침샘, 폐, 간, 췌장, 신장, 귀, 눈, 태반, 소화관, 심장, 난소, 뇌하수체, 부신, 갑상선, 뇌 또는 피부로부터 취한 조직, 세포, 소변, 전혈, 혈청, 혈장, 분변, 세포 배양 상등액 또는 파열된 진핵세포일 수 있다.
샘플과 항체 복합체의 형성은 비색법(colormetric method), 전기화학법(electrochemical method), 형광법(fluorimetric method), 발광법(luminometry), 입자계수법(particle counting method), 육안측정법(visual assessment) 또는 섬광계수법(scintillation counting method)으로 검출할 수 있다.
상기 검출은 샘플과 항체 복합체를 검출하기 위한 것으로 여러 가지 표지체를 사용하여 실시할 수 있다. 표지체로 효소, 형광물, 리간드, 발광물, 미소입자 또는 방사성 동위원소를 사용할 수 있다.
검출 표지체로서 효소로는 아세틸콜린에스테라제, 알칼라인 포스파타제, β-D-갈락토시다제, 호스래디쉬 퍼옥시다제 및 β-라타마제 등을, 형광물로는 플루오레세인, Eu3 +, Eu3 +킬레이트 또는 크립테이트 등을, 리간드로는 바이오틴 유도체 등을, 발광물로는 아크리디늄 에스테르 및 이소루미놀 유도체 등을, 미소입자로는 콜로이드 금 및 착색된 라텍스 등을, 방사성 동위원소로는 57Co, 3H, 125I 및 125I-볼톤(Bonton) 헌터(Hunter) 시약 등을 사용할 수 있다.
나아가, 본 발명은 중동호흡기증후군의 예방, 치료 또는 진단을 위한 약제의 제조에 사용하기 위한 본 발명의 단일클론항체의 용도를 제공한다.
본 발명에 따른 단일클론항체는 상술한 바와 같은 특징을 가질 수 있다.
이하, 본 발명을 하기 실시예에 의해 상세히 설명한다.
단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 이들에 의하여 한정되는 것은 아니다.
<실시예 1> MERS-CoV의 스파이크 단백질에 특이적인 단일클론항체 제조
2015년 5월에서 7월 사이 국내에서 MERS가 발생한 시기에 MERS 초기 환자의 혈액을 수득하고, 이로부터 통상적인 방법에 따라 말초 혈액 단핵구(peripheral blood mononuclear cell, PBMC)를 분리한 후, 초저온 냉동보관하였다. 미국 NIH/NIAID/VRC에서 제공한 MERS-CoV 스파이크 트리머(trimer) 단백질 프로브(PE 형광 염료), 항-인간 IgG-FITC 및 항-인간 CD20 IgG-Cy55PerCP를 이용하여 유세포분석기(FACS)로 분리된 PBMC로부터 메르스 항체를 가진 B세포를 단일세포로 분리(single cell sorting)하였다. 또한, B세포 이외의 불필요한 면역세포들은 CD3, CD4, CD8 및 CD14 마커들을 부착시켜 음성적으로 선택하여 FACS로 제거하였다. 분리된 MERS 초기 환자의 B세포로부터 항체 유전자의 중쇄, 카파 경쇄 및 람다 경쇄의 CDR 부분을 PCR로 증폭한 후, 서열을 확인하였다. 이후, 웹기반 IMGT(International Immunogenetics Information systems, http://www.imgt.org) 프로그램을 이용하여 면역글로불린 항체 발현에 적합한 염기 서열을 검증하였다. 미국 NIH/NIAID/VRC에서 제공한 마우스 IgM 신호 펩타이드와 IgG 불변부(constant region)가 포함된 pVRC 벡터에 항체 각각의 중쇄, 카파 경쇄 및 람다 경쇄의 CDR 부분을 클로닝하여 삽입하였다. 이후, 제조된 항체 플라스미드를 Expi293F 세포에 트랜스펙션하고, 5일 후에 세포 배양액을 수득하여 단백질 G 아가로스 컬럼으로 정제하여 항체를 제조하였다.
<실험예 1> 항원에 대한 항체의 부착력 확인
<1-1> MERS-CoV의 전장 스파이크 트리머 항원에 대한 항체의 부착력 확인
스파이크 단백질의 N-말단부터 1 내지 1275번째 아미노산으로 이루어져 있으며, 막관통 부분이 제거된 MERS-CoV의 전장 스파이크 트리머 항원에 대해 <실시예 1>에서 제조한 총 24종의 항체 부착력을 확인하였다. 또한, <실시예 1>에서 제조한 단일클론항체와 미국 NIH에서 개발한 인간 항-S1 단일클론항체인 A2 및 A10, 인간 항-RBD 단일클론항체인 C2, 마우스 항-S2 단일클론항체인 G4 및 마우스 항-S1 단일클론항체인 G2의 부착력을 비교하였다.
구체적으로, MaxiSorp 96-웰 플레이트(Nunc)에 MERS-CoV의 전장 스파이크 트리머(full Spike trimer) 항원을 0.2 ㎍/100 ㎕ PBS/well이 되도록 넣고, 4℃에서 하루동안 반응시켰다. 반응이 완료된 후, 반응액을 제거하고 PBST에 5% 스킴밀크 및 2% BSA가 포함된 블로킹 용액으로 실온에서 1시간 동안 블로킹시켰다. 다음으로 실시예 1 에서 제조한 항체를 농도가 10, 2.5, 0.625, 0.15625, 0.039, 0.009, 0.002, 0.0006 또는 0.0001 ㎍/㎖이 되도록 블로킹 용액에 희석하여 상기 전장 스파이크 트리머 항원이 코팅된 플레이트에 넣고, 이를 실온에서 1시간 동안 반응시켰다. 이후, PBST로 6번 세척하고, 토끼 항-인간 IgG H&L-HRP(horse radish peroxidase) 2차 항체를 넣고, 1시간 동안 반응시켰다. G2 및 G4 항체가 들어있는 웰에는 항-마우스 IgG-HRP 2차 항체를 넣고, 1시간 동안 반응시켰다. PBST로 6번 세척한 후, 100 ㎕의 TMB 용액을 넣고, 차광하여 실온에서 30분 동안 반응시켰다. 반응이 완료되면 100 ㎕의 스탑 용액(Enzygost)을 넣고, 450 nm에서 흡광도를 측정하여 항원에 대한 항체의 부착력을 확인하였다.
11종의 MERS 항체에 대한 CDR 아미노산 염기서열
항체이름 중쇄의 CDR 서열 카파 경쇄의 CDR 서열 람다 경쇄의 CDR 서열
77-A5 TGVHSQVQLVQSGAEVKKPGSSVKVSCKASGGTFRSHAISWVRQAPGQGLEWMGGIIPIFASANYAQKFQGRVTITADESTSTAYMDLSSLRSDDTAVYYCAKNVSPKSYSGRYSISYFYGVDVWGQGTTVTVSSA(서열번호 1) TGSWAQSALTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLSGHYVFGTGTKVTVLGQPKANPTVTLFPPS(서열번호 2)
77-A6 TGVHSEVQLLESGGGLVQPGGSLRLSCADSGLTFSSYAMSWVRQAPGKGLEWVSAISVSGGSTYYSDSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCVKARSIVGPFDYWGQGTLVTVSSAS(서열번호 3) TGSWAQSALTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQHLPGTAPKLLIYDNIMRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDTSLSAVVFGGGTKLTVLGQPKAAPSVTLFPPS(서열번호 4)
90-A3 TGVHSQVQLVQSGAEVKKPGASVKVSCMTSGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDRGAYWDCGGDCYLSAFDYWGQGTLVTVSSAS(서열번호 5) TGSNSQAVVTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAVVFGGGTKLTVLGQPKAAPSVTLFPPS(서열번호 6)
90-A9 TGVHSQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSFPISWVRQAPGQGLEWMGGIIPIFGAANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARNYEEIVVIPAIMNFGYWGQGTLVTVSSAS(서열번호 7) TGVHSEIVLTQSPGTLSLSPGERATLSCRASQSVASSYLAWYQQKPGQAPRLLIYGTSSRATGIPDRFSGSGSGADFTLTISRLEPEDFAVYYCQQYGTSPLTFGGGTKVEIK(서열번호 8)
90-B2 TGVHSQVQLQESGPGLVKPSETLSLTCTVSGGSISSSSYYWGWIRQPPGKGLEWIGSIYYSGNTYYNPSLKSRVTISVDTSKNHFSLRLSSVTAADTAVYFCARSLPHYDSTGYLLYWGQGTLVTVSSAS(서열번호 9) TGVHSEIVLTQSPATLSLSPGGRATLSCRASQSVSRYLAWYQQKPGRAPRLLIYDASNRAPGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPQTTFGPGTKVDIKRT(서열번호 10)
90-B7 TGVHSEVQLLESGGGLVKPGGSLRLSCAASGFTFGSYSMTWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCARGNGYCSHNSCYKIGVWFDPWGQGTLVTVSSAS(서열번호 11) TGSNSQAVVTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAFVFGTGTKVTVLGQPKANPTVTLFPPS(서열번호 12)
90-C4 TGVHSQVQLQESGPGLVKPSGTLSLTCAVSGGSINSSNWWSWVRQPPGKGLEWIGEIYYSGSTNYNPSLKSRVTTSVDNSKNQFSLKLSSVTAADTAVYYCATFDSGGYNPNWFDPWGQGTLVTVSSAS(서열번호 13) TGSWAQSALTQPPSVSGAPGQRVTISCTGSSSSIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLGQPKANPTVTLFPPS(서열번호 14)
90-E5 TGVHSQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYTINWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADASTSTAYMELSSLRSEDTAVYYCARVLLRSSSWFSSNWFDPWGQGTLVTVSSAS(서열번호 15) TGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKVLIYGNSNRPSGVPDRFSGSKSDTSASLAITGLQAEDEADYYCQSYDSSLSVVFGGGTKLTVLGQPKAAPSVTLFPPS(서열번호 16)
90-E6 TGVHSEVQLVESGGGLVQPGRSLRLSCAASGFTFDDHAMHWVRQAPGKGLEWVSGFSWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDRRSDYYFYGMDVWGQGTTVTVSSAS(서열번호 17) TGSWAQSVLTQPPSVSAAPGQKVTISCSGSRSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLNAGVFGGGTKLTVLGQPKAAPSVTLFPPS(서열번호 18)
90-F1 TGVHSQVQLVQSGAEVKRPGSSVKVSCKTSGGTFNNNAINWVRQAPGQGLEWMGGIIPFFGIAKYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARDLPRESSYGSGSYYTHYYAMDVWGQGTTVTVSSAS(서열번호 19) TGVHSEIVLTQSPATLSLSPGERATLSCGASQSVSSSYLAWYQQKPGLAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPLTFGGGTKVEIKRT(서열번호 20)
90-F2 TGVHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTTYYMHWVRQAPGQGLEWMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGAVVVILDYWGQGTLVTVSSAS(서열번호 21) TGVHSDIQMTQSPSTLSASVGDRVTITCRASQTISTWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYSYTFGQGTKLEIKRT(서열번호 22)
그 결과, 도 1에 나타낸 바와 같이, 24종의 항체 중 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2 항체가 MERS-CoV의 전장 스파이크 트리머 항원에 특이적으로 잘 부착하였고, 이는 A2, A10 및 G4 항체보다 더 높은 부착력을 나타냈다(도 1). 전장 스파이크 트리머 항원에 특이적으로 잘 부착한 11종 항체의 CDR 서열은 상기 표 1과 같다.
<1-2> MERS-CoV의 S1 항원에 대한 항체의 부착력 확인
스파이크 단백질의 1부터 757번째 아미노산으로 이루어진 MERS-CoV의 S1 도메인을 항원으로서 사용한 것을 제외하고는 실험예 <1-1>과 동일한 방법으로 <실시예 1>에서 제조한 총 24종의 항체 부착력을 확인하였다.
그 결과, 도 2에 나타낸 바와 같이, 24종의 항체 중 77-A5, 77-A6, 90-A3, 90-A9, 90-B2, 90-B7, 90-C4, 90-E5, 90-E6, 90-F1 및 90-F2 항체는 S1 항원에 대해 미국 국립보건원에서 개발한 A2 및 A10 항체보다 더 높은 부착력을 나타냈으며, 특히, 90-F1, 90-B7, 90-E6, 77-A4, 77-A5, 90-F2 및 77-A6 항체는 C2 및 G2 항체보다 더 높은 부착력을 나타냈다(도 2).
<1-3> MERS-CoV의 RBD 항원에 대한 항체의 부착력 확인
스파이크 단백질의 377부터 588번째 아미노산으로 이루어진 MERS-CoV의 RBD(receptor binding domain)를 항원으로서 사용한 것을 제외하고는 실험예 <1-1>과 동일한 방법으로 <실시예 1>에서 제조한 총 24종의 항체 부착력을 확인하였다.
그 결과, 도 3에 나타낸 바와 같이, 24종의 항체 중 90-F1, 90-E5, 90-E6, 90-F2, 77-A5 및 77-A6 항체는 RBD 항원에 대해 C2 항체보다 더 높은 부착력을 나타냈으나, 나머지 항체는 부착력을 나타내지 않았다(도 3).
<1-4> MERS-CoV의 S2 항원에 대한 항체의 부착력 확인
스파이크 단백질의 C-말단 부위로, 757부터 1275번째 아미노산으로 이루어져 있으며, 퓨전(fusion)기능을 가지는 MERS-CoV의 S2 도메인을 항원으로서 사용한 것을 제외하고는 실험예 <1-1>과 동일한 방법으로 <실시예 1>에서 제조한 총 24종의 항체 부착력을 확인하였다.
그 결과, 도 4에 나타낸 바와 같이, S2 항원에 대해 77-A6 항체를 제외한 <실시예 1>에서 제조한 24종의 항체는 매우 낮은 부착력을 나타냈다(도 4).
<실험예 2> MERS 슈도바이러스에 대한 항체의 중화능 확인
Huh7.5 세포주에 트립신을 처리하여 부유시킨 후, 104 cells/100 ㎕/well이 되도록 10% FBS가 포함된 DMEM(Dulbecco’s modified Eagle’s medium) 세포 배양액으로 희석한 다음, 96-웰 조직 배양 플레이트에 분주하여 하루 동안 배양하였다. 한편, MERS-CoV의 스파이크 단백질(Erasmus 균주 또는 Bisha 1 균주)을 포함하고 있는 재조합 렌티바이러스(루시퍼라제를 발현하는 재조합 MERS 슈도바이러스, 입수처: 미국 NIH/NIAID/VRC) 상층액 90 ㎕와 세포 배양액으로 희석된 10, 1, 0.1, 0.01 또는 0.001 ㎲/㎖ 농도의 <실시예 1>의 항체 90 ㎕를 10% FBS가 포함된 DMEM 배양액과 혼합하여 37 ℃에서 45분 동안 반응시켜 혼합액을 제조하였다. 상기 배양된 세포에 혼합액을 50 ㎕씩 첨가하고, 10% FBS가 포함된 DMEM 배양액을 100 ㎕씩 첨가하여, 37℃, 5% CO2 조건인 세포 배양기에서 3일 동안 배양시켰다. 배양액을 제거한 후, 1X 용해버퍼(Promega, E153A)를 25 ㎕/well의 농도로 넣어, 15분 동안 교반하면서 세포를 용해시켰다. 용해된 세포에 50 ㎕의 루시퍼라제 기질 시약(Promega, E151A)을 첨가한 후, 루미노미터로 형광을 측정하고, 하기 수학식 1과 같은 방법으로 중화능을 계산하였다.
[수학식 1]
Figure PCTKR2018009754-appb-I000001
11종의 항체 중화능
항체 농도(㎍/㎖) 항체 중화능(%)
77-A5 77-A6 90-A3 90-A9 90-B2
10 95.93 99.04 -29.25 -9.72 -152.78
2.5 92.87 99.53 5.01 31.92 -71.75
0.625 67.05 97.96 22.00 18.73 -59.75
0.15625 64.10 92.04 28.44 15.01 -59.65
0.039063 3.16 56.75 2.43 -6.41 -40.74
0.009766 28.89 41.59 -15.18 -1.78 -44.11
0.002441 -3.78 3.81 6.57 -18.34 -25.61
바이러스만 0.00 0.00 0.00 0.00
항체 농도(㎍/㎖) 항체 중화능(%)
90-B7 90-C4 90-E5 90-E6 90-F1 90-F2
10 -49.92 20.88 91.00 58.10 99.83 98.17
2.5 -9.19 28.48 79.40 66.30 99.65 94.39
0.625 -32.26 -3.31 61.12 44.77 98.55 86.01
0.15625 -30.39 17.46 46.94 41.31 98.56 59.63
0.039063 -21.07 2.43 38.62 41.83 88.45 48.10
0.009766 0.10 -23.37 37.07 10.61 69.87 21.76
0.002441 -9.71 -7.53 38.20 36.45 54.92 48.40
바이러스만 0.00 0.00 15.11 26.03 0.00 0.00
그 결과, 도 5a, 도 5b 및 표 2 에 나타낸 바와 같이, 77-A5, 77-A6, 90-E5, 90-E6, 90-F1 및 90-F2 항체가 MERS 슈도바이러스 Erasmus 균주에 대해 중화능을 보였고, 그 중 77-A5, 77-A6, 90-F1 및 90-F2 항체는 MERS 슈도바이러스 Bisha 1 균주에 대해서도 중화능을 보였으며, 90-F1 항체는 MERS 슈도바이러스 Erasmus 균주 및 Bisha 1 균주에 대해 중화능이 가장 높았다(도 5a, 도 5b 및 표 2). 이를 통해, 77-A5, 77-A6, 90-F1 및 90-F2 항체는 폭넓은 중화능이 있음을 알 수 있었다.
<실험예 3> MERS-CoV에 대한 항체의 중화능 확인
<실시예 1>에서 제조한 항체의 중화능을 확인하기 위해 MERS-CoV(Erasmus 균주 및 KNIH 균주)를 이용하여 플라크감소중화시험(plaque reduction neutralizing test, PRNT)을 수행하였다. 먼저, Vero 세포를 24 웰 플레이트에 105 cells/well의 농도로 분주한 후, 배양하여 준비하였다. 배양된 세포의 배양 배지를 제거하고, 세포 배양액으로 희석된 10, 2.5, 0.625, 0.156, 0.039, 0.009 또는 0.002 ng/㎖ 농도의 <실시예 1>의 항체와 50 PFU/well로 희석된 MERS-CoV(EMC, KNIH-002, KNIH-016 및 KNIH-042 균주)를 혼합하여 혼합용액을 제조하였다. 상기 배양된 세포에 혼합액을 100 ㎕/well씩 분주하고, 37℃에서 1시간 동안 반응시켰다. 이후, 1.5%의 CMC(carboxymethyl cellulose)가 포함된 DMEM 배양액을 1 ㎖/well의 농도로 첨가하고, 3일 동안 배양하였다. 배양이 완료되면 크리스탈 바이올렛 염색을 통해 플라크를 확인하고, 각 웰의 플라크 수를 측정하여 하기 수학식 2와 같은 방법으로 중화능을 계산하였다. 또한, 하기 수학식 3과 같은 방법으로 ND50 값을 계산하여 중화능을 측정하였다. 하기 수학식 3에서 m은 가장 높은 희석도의 log10 값을, △는 log10 값으로 나타내어지는 희석도간의 일정한 간격을, ∑p는 플라크 수의 모든 비율의 합/바이러스 컨트롤에 대한 플라크의 평균 수를 의미한다.
[수학식 2]
Figure PCTKR2018009754-appb-I000002
[수학식 3]
Figure PCTKR2018009754-appb-I000003
PRNT를 통한 항체의 중화능 분석
항체 ND50 ND50 항체농도(㎍/㎖)
77-A5 35.60 0.28
77-A6 95.73 0.10
90-A3 0.63 15.81
90-A9 0.58 17.30
90-B2 39.52 0.25
90-B7 14.93 0.67
90-C4 0.78 12.76
90-E5 6.60 1.51
90-E6 0.68 14.78
90-F1 956.46 0.01
90-F2 53.96 0.19
음성대조군 1.00 10.04
그 결과, 도 6a 및 도 6b 및 표 3에 나타낸 바와 같이, 77-A5, 77-A6, 90-B2, 90-B7, 90-F1, 90-F2 및 90-E5 항체가 MERS-CoV에 대해 중화능을 보였고, 그 중 90-F1 항체의 중화능이 가장 우수하였다(도 6a, 도 6b 및 표 3). 상기 결과는 모든 MERS-CoV(EMC, KNIH-002, KNIH-016 및 KNIH-042 균주)에서 같은 결과를 나타내었다.
<실험예 4> 항체의 물리화학적 특성 분석
SEC-HPLC(size exclusion chromatography-HPLC), SPR 어세이(surface plasmon resonance assay) 및 PTS 어세이(protein thermal shift assay)를 통해 <실험예 2> 및 <실험예 3>에서 뛰어난 중화능을 보인 77-A5, 77-A6, 90-B2, 90-B7, 90-F1 및 90-F2 항체의 물리화학적 특성을 분석하였다.
<4-1> SEC-HPLC를 통한 항체의 형태 분석
water SEC-HPLC 시스템을 이용하여 항체의 형태를 분석하였다. HPLC 분석 컬럼은 Agilent Bio SEC3을, 검출기는 자외선흡광도계(280 nm)를 사용하였다. 이때, 시료로써, 1 ㎎/㎖ 농도의 항체를 10 ㎕ 주입하였고, 유속은 0.3 ㎖/min으로 하였다. 또한, 이동상으로 1X PBS를 사용하여, 등용매 용리하였다.
그 결과, 도 7에 나타낸 바와 같이, 6종의 항체 모두 일정한 단량체(monomer) 형태였으며, 응집된 형태가 거의 없었다(도 7).
<4-2> SPR 어세이를 통한 항체의 결합력 분석
S1 항원 또는 RBD 항원을 부착시켜 SPR 어세이를 통해 항체의 결합력(avidity)을 분석하였다. 구체적으로, S1 항원 또는 RBD 항원을 CM5 칩 표면에 부착시킨 후, 항체를 주입하였다. 이후, 결합(association) 시간은 3분으로, 해리(dissociation) 시간은 표 4에 기재된 조건으로, 러닝 버퍼는 HBS-EP를, 재생(regeneration)용액은 표 4에 기재된 것을 사용하여 SPR 어세이를 수행하였다.
SPR 어세이 조건
항체 해리 시간 재생 용액
77-A5 30분 10 mM NaOH, 1 M NaCl
77-A6 6분 10 mM NaOH
90-B2 30분 10 mM NaOH, 1 M NaCl
90-B7 10분 10 mM NaOH, 250 mM NaCl
90-F1 10분 10 mM Glycine(pH 2.0), 250 mM NaCl
90-F2 6분 10 mM NaOH, 500 mM NaCl
SPR 어세이를 통한 항체의 결합력 분석
특징 77-A5 77-A6 90-B2 90-B7 90-F1 90-F2
S1 항원에 대한 결합력
Ka(1/Ms) 1.33×105 6.38×104 1.31×105 6.81×105 6.48×105 1.34×105
Kd(1/s) ≤1.00×10-5 4.43×10-5 ≤1.00×10-5 1.04×10-4 9.88×10-5 8.82×10-4
KD(M) ≤7.51×10-11 6.95×10-10 ≤7.51×10-11 1.53×10-10 1.53×10-10 6.60×10-9
RBD 항원에 대한 결합력
Ka(1/Ms) 1.30×105 4.67×104 - - 3.76×105 2.38×105
Kd(1/s) 2.08×10-5 3.15×10-5 - - 2.71×10-5 1.40×10-5
KD(M) 1.61×10-10 6.73×10-10 - - 7.20×10-11 5.86×10-9
그 결과, 도 8a, 도 8b 및 표 5에 나타낸 바와 같이, S1 항원을 부착시킨 경우, 77-A5 및 90-B2 항체가 S1 항원에 대한 KD값이 75 pM 이하로 낮아 S1 항원에 대한 결합력이 높음을 알 수 있었고, RBD 항원을 부착시킨 경우, 90-F1 항체가 RBD 항원에 대한 KD값이 72 pM 이하로 낮아 RBD 항원에 대한 결합력이 높음을 알 수 있었다. 특히, 90-B2 및 90-B7 항체는 RBD 항원에 전혀 결합되지 않았고, 이는 90-B2 및 90-B7 항체가 S1 항원에 특이적임을 의미한다(도 8a, 도 8b 및 표 5).
<4-3> PTS 어세이를 통한 항체의 안정성 확인
항체들의 보관 용액인 pH가 7.4이고 칼슘과 마그네슘을 포함하지 않는 PBS(phosphate buffered saline)에서 항체의 안정성을 확인하였다. 구체적으로, 0.75 ㎍의 <실시예1>에서 제조한 항체를 사용하였고, Protein Thermal Shift™ Dye Kit(Catalog No. 4466038, Life technologies)를 이용하여 제조사의 방법에 따라 PTS 어세이를 수행하였다.
그 결과, 도 9a 내지 도 9c에 나타낸 바와 같이, 77-A5 항체의 용해점(melting point)은 67.52℃, 77-A6 항체는 68.44℃ 및 75.44℃, 90-B2 항체는 72.46℃, 90-B7 항체는 68.21℃ 및 81.19℃, 90-F1항체는 69.21℃ 및 79.81℃, 90-F2항체는 68.89℃ 및 75.10℃로 6종의 항체 모두 67.52℃ 이상의 온도에서 단백질 소수성이 노출되므로, 안정적인 구조를 가지고 있음을 알 수 있었다(도 9a 내지 도 9c).

Claims (28)

  1. 상보성 결정부위(CDR)가 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크(spike) 단백질에 특이적으로 결합하는 단일클론항체의 중쇄 가변영역.
  2. 제 1항에 있어서, 상기 스파이크 단백질이 서열번호 23으로 기재되는 아미노산 서열로 구성되는, 단일클론항체의 중쇄 가변영역.
  3. 제 1항에 있어서, 상기 중쇄 가변영역은 중동호흡기증후군 코로나바이러스 스파이크 단백질의 N-말단으로부터 1번째 내지 757번째 아미노산 부위에 특이적으로 결합하는, 단일클론항체의 중쇄 가변영역.
  4. 제 1항의 중쇄 가변영역을 코딩하는 유전자.
  5. 제 4항의 유전자를 함유하는 재조합 벡터.
  6. 제 4항의 유전자 또는 제 5항의 재조합 벡터가 도입된 숙주세포.
  7. 제 1항의 중쇄 가변영역을 포함하는 중동호흡기증후군의 예방, 치료 또는 진단용 조성물.
  8. 제 1항의 중쇄 가변영역을 포함하는 중동호흡기증후군의 항원을 검출 또는 정량하는 키트.
  9. 상보성 결정부위(CDR)가 각각 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 특이적으로 결합하는 단일클론항체의 경쇄 가변영역.
  10. 제 9항에 있어서, 상기 스파이크 단백질이 서열번호 23으로 기재되는 아미노산 서열로 구성되는, 단일클론항체의 경쇄 가변영역.
  11. 제 9항에 있어서, 상기 경쇄 가변영역은 중동호흡기증후군 코로나바이러스 스파이크 단백질의 N-말단으로부터 1번째 내지 757번째 아미노산 부위에 특이적으로 결합하는, 단일클론항체의 경쇄 가변영역.
  12. 제 9항의 경쇄 가변영역을 코딩하는 유전자.
  13. 제 12항의 유전자를 함유하는 재조합 벡터.
  14. 제 12항의 유전자 또는 제 13항의 재조합 벡터가 도입된 숙주세포.
  15. 제 9항의 경쇄 가변영역을 포함하는 중동호흡기증후군의 예방, 치료 또는 진단용 조성물.
  16. 제 9항의 경쇄 가변영역을 포함하는 중동호흡기증후군의 항원을 검출 또는 정량하는 키트.
  17. 상보성 결정부위가 각각 서열번호 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 또는 21로 기재되는 아미노산 서열로 구성되는 중쇄 가변영역과 서열번호 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 또는 22로 기재되는 아미노산 서열로 구성되는 경쇄 가변영역을 포함하는 중동호흡기증후군 코로나바이러스 스파이크 단백질에 특이적으로 결합하는 단일클론항체.
  18. 제 17항의 단일클론항체를 코딩하는 유전자.
  19. 제 18항의 유전자를 함유하는 재조합 벡터.
  20. 제 18항의 유전자 또는 제 19항의 재조합 벡터가 도입된 숙주세포.
  21. 제 17항의 단일클론항체를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단용 조성물.
  22. 제 17항의 단일클론항체를 포함하는 중동호흡기증후군의 항원을 검출 또는 정량하는 키트.
  23. 제 1항의 중쇄 가변영역을 개체에 투여하는 단계를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단 방법.
  24. 중동호흡기증후군의 예방, 치료 또는 진단을 위한 약제의 제조에 사용하기 위한 제 1항의 중쇄 가변영역의 용도.
  25. 제 9항의 경쇄 가변영역을 개체에 투여하는 단계를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단 방법.
  26. 중동호흡기증후군의 예방, 치료 또는 진단을 위한 약제의 제조에 사용하기 위한 제 9항의 경쇄 가변영역의 용도.
  27. 제 17항의 단일클론항체를 개체에 투여하는 단계를 포함하는 중동호흡기증후군의 예방, 치료 또는 진단 방법.
  28. 중동호흡기증후군의 예방, 치료 또는 진단을 위한 약제의 제조에 사용하기 위한 제 17항의 단일클론항체의 용도.
PCT/KR2018/009754 2017-08-23 2018-08-23 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도 WO2019039891A1 (ko)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US16/641,580 US20210355193A1 (en) 2017-08-23 2018-08-23 Monoclonal anitbody for spike protein of middle east respiratory syndrome coronavirus and use thereof
US17/952,308 US20230265169A1 (en) 2017-08-23 2022-09-25 Monoclonal antibody for spike protein of middle east respiratory syndrome coronavirus, and use thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2017-0106836 2017-08-23
KR1020170106836A KR101895228B1 (ko) 2017-08-23 2017-08-23 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/641,580 A-371-Of-International US20210355193A1 (en) 2017-08-23 2018-08-23 Monoclonal anitbody for spike protein of middle east respiratory syndrome coronavirus and use thereof
US17/952,308 Division US20230265169A1 (en) 2017-08-23 2022-09-25 Monoclonal antibody for spike protein of middle east respiratory syndrome coronavirus, and use thereof

Publications (1)

Publication Number Publication Date
WO2019039891A1 true WO2019039891A1 (ko) 2019-02-28

Family

ID=64100755

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2018/009754 WO2019039891A1 (ko) 2017-08-23 2018-08-23 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도

Country Status (3)

Country Link
US (2) US20210355193A1 (ko)
KR (1) KR101895228B1 (ko)
WO (1) WO2019039891A1 (ko)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11168128B2 (en) 2020-02-26 2021-11-09 Vir Biotechnology, Inc. Antibodies against SARS-CoV-2 and methods of using the same
CN113667010A (zh) * 2020-05-15 2021-11-19 普米斯生物技术(珠海)有限公司 冠状病毒的抗体及其衍生物用途
CN113801223A (zh) * 2020-11-25 2021-12-17 苏州大学 抗严重急性呼吸系统综合征ii型冠状病毒sars-cov-2的中和抗体
WO2021255755A1 (en) * 2020-06-15 2021-12-23 Vangala Rajanikanth Lateral flow assay device for detection of analytes and method of detection thereof
CN114426574A (zh) * 2020-10-29 2022-05-03 中国科学院武汉病毒研究所 新型冠状病毒中和性人源单克隆抗体及其应用
CN114605527A (zh) * 2020-12-04 2022-06-10 中国科学院分子细胞科学卓越创新中心 一种抗新型冠状病毒SARS-CoV-2的抗体及其制备方法和用途

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102007161B1 (ko) * 2018-11-07 2019-08-07 대한민국 메르스 코로나 바이러스 스파이크 s1 단백질에 특이적으로 결합하는 단클론 항체
KR101969696B1 (ko) * 2019-01-23 2019-04-16 대한민국(관리부서 질병관리본부장) 메르스 코로나 바이러스 스파이크 s2 단백질에 특이적으로 결합하는 단클론 항체
WO2021221493A1 (ko) * 2020-04-29 2021-11-04 한국화학연구원 사스 코로나바이러스 2 스파이크 단백질과 결합하는 수용체와 항체를 포함하는 사스 코로나바이러스 2 진단 키트
KR102351653B1 (ko) * 2020-04-29 2022-01-14 한국화학연구원 사스 코로나바이러스 2 스파이크 단백질과 결합하는 수용체와 항체를 포함하는 사스 코로나바이러스 2 진단 키트
BR112023000503A2 (pt) * 2020-07-16 2023-01-31 Caregen Co Ltd Peptídeo com atividade neutralizante contra a síndrome respiratória aguda grave do coronavírus-2
EP4186922A1 (en) * 2020-07-24 2023-05-31 Celltrion, Inc. Binding molecule having neutralizing activity against coronavirus superfamily
KR20220026083A (ko) 2020-08-25 2022-03-04 바이오스트림테크놀러지스(주) 코로나바이러스의 수용체-결합 도메인과 면역 글로불린의 불가변 부위로 구성된 융합 단백질
WO2022098173A1 (ko) * 2020-11-06 2022-05-12 주식회사 녹십자 코로나바이러스 스파이크 단백질에 특이적인 항체 및 이의 용도
CN117487004B (zh) * 2023-09-25 2024-04-30 中山大学 抗冠状病毒s蛋白的单克隆抗体及其应用

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20160055164A (ko) * 2013-09-19 2016-05-17 노바백스, 인코포레이티드 면역원성 중동호흡기증후군 코로나바이러스 (ΜＥＲＳ-ＣｏＶ) 조성물 및 방법
KR20170005133A (ko) * 2014-05-23 2017-01-11 리제너론 파아마슈티컬스, 인크. 중동 호흡기 증후군-코로나바이러스 스파이크 단백질에 대한 인간 항체

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015057942A1 (en) * 2013-10-18 2015-04-23 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Human monoclonal antibodies against the middle east respiratory syndrome coronavirus (mers-cov) and engineered bispecific fusions with inhibitory peptides

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20160055164A (ko) * 2013-09-19 2016-05-17 노바백스, 인코포레이티드 면역원성 중동호흡기증후군 코로나바이러스 (ΜＥＲＳ-ＣｏＶ) 조성물 및 방법
KR20170005133A (ko) * 2014-05-23 2017-01-11 리제너론 파아마슈티컬스, 인크. 중동 호흡기 증후군-코로나바이러스 스파이크 단백질에 대한 인간 항체

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
JIANG, L. ET AL.: "Potent Neutralization of MERS-CoV by Human Neutralizing Monoclonal Antibodies to the Viral Spike Glycoprotein", SCIENCE TRANSLATIONAL MEDICINE, vol. 6, no. 234, 30 April 2014 (2014-04-30), pages 1 - 10, XP009182042, DOI: doi:10.1126/scitranslmed.3008140 *
LEE, HANSAEM ET AL.: "Trend in Human Therapeutic MERS-CoV Antibody Development", PUBLIC HEALTH WEEKLY REPORT, vol. 9, no. 37, 8 September 2016 (2016-09-08), pages 727 - 732, XP055576995 *
YING, T. ET AL.: "Exceptionally Potent Neutralization of Middle East Respiratory Syndrome Coronavirus by Human Monoclonal Antibodies", JOURNAL OF VIROLOGY, vol. 88, no. 14, July 2014 (2014-07-01), pages 7796 - 7805, XP009181617, DOI: doi:10.1128/JVI.00912-14 *

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11168128B2 (en) 2020-02-26 2021-11-09 Vir Biotechnology, Inc. Antibodies against SARS-CoV-2 and methods of using the same
US11479599B2 (en) 2020-02-26 2022-10-25 Vir Biotechnology, Inc. Antibodies against SARS-CoV-2 and methods of using the same
CN113667010A (zh) * 2020-05-15 2021-11-19 普米斯生物技术(珠海)有限公司 冠状病毒的抗体及其衍生物用途
CN113667010B (zh) * 2020-05-15 2023-07-28 普米斯生物技术(珠海)有限公司 冠状病毒的抗体及其衍生物用途
WO2021255755A1 (en) * 2020-06-15 2021-12-23 Vangala Rajanikanth Lateral flow assay device for detection of analytes and method of detection thereof
CN114426574A (zh) * 2020-10-29 2022-05-03 中国科学院武汉病毒研究所 新型冠状病毒中和性人源单克隆抗体及其应用
CN113801223A (zh) * 2020-11-25 2021-12-17 苏州大学 抗严重急性呼吸系统综合征ii型冠状病毒sars-cov-2的中和抗体
CN113801223B (zh) * 2020-11-25 2023-02-10 苏州大学 抗严重急性呼吸系统综合征ii型冠状病毒sars-cov-2的中和抗体
CN114605527A (zh) * 2020-12-04 2022-06-10 中国科学院分子细胞科学卓越创新中心 一种抗新型冠状病毒SARS-CoV-2的抗体及其制备方法和用途

Also Published As

Publication number Publication date
US20230265169A1 (en) 2023-08-24
US20210355193A1 (en) 2021-11-18
KR101895228B1 (ko) 2018-10-30

Similar Documents

Publication Publication Date Title
WO2019039891A1 (ko) 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도
WO2020251187A1 (ko) Tigit에 대한 항체 및 이의 용도
WO2015005632A1 (ko) Dll4와 vegf에 특이적으로 결합하는 신규 이중표적 단백질 및 이의 용도
WO2019112347A2 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2017023138A1 (ko) 키메라 항원 수용체 및 키메라 항원 수용체가 발현된 t 세포
WO2020153605A1 (ko) 메소텔린 특이적인 키메라 항원 수용체 및 이를 발현하는 t 세포
WO2019066586A1 (ko) 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체
WO2019132533A1 (ko) 항-pd-l1 항체 및 이의 용도
WO2018026248A1 (ko) 프로그램화된 세포 사멸 단백질(pd-1)에 대한 신규 항체 및 이의 용도
WO2019125070A1 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2021060837A1 (en) Anti-mers-cov antibody and use thereof
WO2024049161A1 (ko) 신규한 항-pd-l1 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2016200189A1 (ko) 광견병 바이러스 g 단백질의 에피토프 및 이에 특이적으로 결합하는 광견병 바이러스 중화 결합 분자
WO2022119380A1 (ko) 신규한 ace2 변이체 및 그의 이용
WO2022085905A1 (ko) SARS-CoV-2 스파이크 단백질에 특이적으로 결합하는 항체 및 이의 용도
WO2018026249A1 (ko) 프로그램화된 세포 사멸 단백질 리간드-1 (pd-l1)에 대한 항체 및 이의 용도
WO2021221470A1 (ko) 인터페론-베타 변이체와 항체가 융합된 재조합 단백질 및 이를 포함하는 약학 조성물
WO2022035200A1 (ko) Il-12 및 항-cd20 항체를 포함하는 융합단백질 및 이의 용도
WO2021210939A1 (ko) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체
WO2020204305A1 (ko) 항-메소텔린 항체, 항-cd3 항체 또는 항-egfr 항체를 포함하는 융합 단백질 및 이를 포함하는 이중 특이적 또는 삼중 특이적 항체 및 이의 용도
WO2015182798A1 (ko) 골수-유래 억제세포(myeloid-derived suppressor cells, mdscs) 저해용 조성물
WO2015088256A1 (ko) 광견병 바이러스를 중화시킬 수 있는 결합 분자
WO2019093807A2 (ko) Il-17a 에 특이적으로 결합하는 항체 및 이의 용도
WO2024096592A1 (ko) 메소텔린에 대한 친화도가 상승된 키메릭 항원 수용체 및 이의 용도
WO2022220648A1 (ko) Hla-dr 특이적 키메라 항원 수용체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18849199

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 18849199

Country of ref document: EP

Kind code of ref document: A1

122 Ep: pct application non-entry in european phase

Ref document number: 18849199

Country of ref document: EP

Kind code of ref document: A1