WO2022220648A1 - Hla-dr 특이적 키메라 항원 수용체 및 이의 용도 - Google Patents

Hla-dr 특이적 키메라 항원 수용체 및 이의 용도 Download PDF

Info

Publication number
WO2022220648A1
WO2022220648A1 PCT/KR2022/005485 KR2022005485W WO2022220648A1 WO 2022220648 A1 WO2022220648 A1 WO 2022220648A1 KR 2022005485 W KR2022005485 W KR 2022005485W WO 2022220648 A1 WO2022220648 A1 WO 2022220648A1
Authority
WO
WIPO (PCT)
Prior art keywords
nucleic acid
car
cell
mvr
cells
Prior art date
Application number
PCT/KR2022/005485
Other languages
English (en)
French (fr)
Inventor
권병세
장영균
이정윤
이새롬
손현태
이혜미
Original Assignee
주식회사 유틸렉스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 유틸렉스 filed Critical 주식회사 유틸렉스
Publication of WO2022220648A1 publication Critical patent/WO2022220648A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
    • A61K2239/48—Blood cells, e.g. leukemia or lymphoma
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14—Blood; Artificial blood
    • A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/461—Cellular immunotherapy characterised by the cell type used
    • A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/463—Cellular immunotherapy characterised by recombinant expression
    • A61K39/4631—Chimeric Antigen Receptors [CAR]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464402—Receptors, cell surface antigens or cell surface determinants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464436—Cytokines
    • A61K39/46444—Interleukins [IL]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/54—Interleukins [IL]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/54—Interleukins [IL]
    • C07K14/55—IL-2
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70517—CD8
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70575—NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2833—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62—DNA sequences coding for fusion proteins
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0634—Cells from the blood or the immune system
    • C12N5/0636—T lymphocytes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004—Oxidoreductases (1.)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004—Oxidoreductases (1.)
    • C12N9/0008—Oxidoreductases (1.) acting on the aldehyde or oxo group of donors (1.2)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y102/00—Oxidoreductases acting on the aldehyde or oxo group of donors (1.2)
    • C12Y102/01—Oxidoreductases acting on the aldehyde or oxo group of donors (1.2) with NAD+ or NADP+ as acceptor (1.2.1)
    • C12Y102/01012—Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) (1.2.1.12)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells

Definitions

  • the present invention relates to a chimeric antigen receptor (CAR) comprising an HLA-DR specific antigen binding domain, and more particularly, to a nucleic acid encoding the chimeric antigen receptor, a vector comprising the nucleic acid, and the nucleic acid Or it relates to an immune cell containing a vector and a pharmaceutical composition for preventing or treating cancer comprising the nucleic acid, vector or immune cell.
  • CAR chimeric antigen receptor
  • a nucleic acid encoding a chimeric antigen receptor (CAR), which has specificity as a surface antigen of cancer cells and an ability to activate cells is introduced into T cells or NK cells, and the obtained transgenic cells are proliferated in vitro.
  • CAR chimeric antigen receptor
  • This method is thought to have a stronger anti-cancer effect and a longer-lasting effect compared to antibody drugs, and the clinical effect is very much expected.
  • a second-generation CAR combining a costimulatory domain (CD28 or CD137/4-1BB) and CD3 ⁇ was prepared to improve responsiveness to immune cells. Compared with the first-generation CAR, the number of CAR-containing immune cells remaining in the body significantly increased. .
  • the second-generation CAR used one co-stimulatory domain, whereas the third-generation CAR used two or more co-stimulatory domains.
  • the costimulatory domain can be combined with 4-1BB, CD28 or OX40, and the like.
  • the second-generation CAR is specifically described in U.S. Patent Nos. 7,741,465, 7,446,190 or 9,212,229, and the third-generation CAR is specifically described in U.S. Patent No. 8,822,647, which is incorporated herein by reference.
  • the fourth-generation CAR includes additional genes encoding cytokines such as IL-12 or IL-15, allowing the expression of additional CAR-based immune proteins of cytokines, and the fifth-generation CAR enhances immune cells It further comprises an interleukin receptor chain, for example, IL-2R ⁇ .
  • the fourth-generation CAR is specifically described in U.S. Patent No. 10,316,102, and the fifth-generation CAR is specifically described in U.S. Patent No. 10,336,810, which is incorporated herein by reference.
  • the present inventors have filed a patent application for a CAR using an MVR (Malignancy Variant Receptor) antibody that specifically binds to HLA-DR (Human Leukocyte Antigen - antigen D Related; antigen D related human leukocyte antigen) KR2019/010244), as a result of diligent efforts to develop a CAR with increased cell viability and increased in vivo anticancer activity when producing immune cells into which CAR is introduced, glyceraldehyde 3-phosphate dehydrogenase (GAPDH) cleaved to a size of 540 bp in the CAR structure; NM_002046.7) and/or interleukin 18 (IL-18) was added to confirm that the cell expression rate and anticancer activity were increased, and the present invention was completed.
  • MVR Malignancy Variant Receptor
  • CAR HLA-DR specific chimeric antigen receptor
  • Another object of the present invention is to provide a vector comprising the nucleic acid.
  • Another object of the present invention is to provide an immune cell containing the nucleic acid or vector.
  • Another object of the present invention is a pharmaceutical composition for preventing or treating cancer comprising the nucleic acid, vector or immune cell, a method for preventing or treating cancer using the immune cell, use of the immune cell for preventing or treating cancer, and cancer
  • An object of the present invention is to provide the use of said immune cells for the manufacture of a medicament for prophylaxis or treatment.
  • the present invention is (a) HLA-DR (Human Leukocyte Antigen - antigen D Related) specific antigen binding domain (antigen binding domain), transmembrane domain (transmembrane domain) and intracellular signaling domain ( chimeric antigen receptor (CAR) containing an intracellular signaling domain; and (b) a nucleic acid encoding cleaved glyceraldehyde 3-phosphate dehydrogenase (GAPDH).
  • HLA-DR Human Leukocyte Antigen - antigen D Related
  • specific antigen binding domain antigen binding domain
  • transmembrane domain transmembrane domain
  • intracellular signaling domain chimeric antigen receptor (CAR) containing an intracellular signaling domain
  • GPDH nucleic acid encoding cleaved glyceraldehyde 3-phosphate dehydrogenase
  • the present invention also provides a vector comprising the nucleic acid.
  • the present invention also provides an immune cell containing the nucleic acid or vector.
  • the present invention also provides a pharmaceutical composition for preventing or treating cancer comprising the nucleic acid, vector, or immune cell.
  • the present invention also provides a method for preventing or treating cancer comprising administering the nucleic acid, vector, or immune cell, use of the nucleic acid, vector, or immune cell for preventing or treating cancer, and a pharmaceutical for preventing or treating cancer Provided is the use of said immune cell for manufacture.
  • the present invention relates to a CAR-T cell prepared using a nucleic acid encoding IL-18 and a CAR containing MVR specific for HLA-DR increased in tumor cells as an antigen-binding domain, and increased cell expression rate and in Since it exhibits in vivo efficacy, it can provide an excellent cancer treatment effect.
  • FIG. 1 is a schematic diagram showing the structure of an MVR CAR lentiviral plasmid.
  • FIG. 4 is a graph showing the results of MVR and MVR-g540 CAR-T expansion (A: Total Fold Expansion, B: Fold Expansion).
  • FIG. 5 is a graph showing the cell viability (Cell Viability) results of MVR, MVR-g540 CAR-T.
  • FIG. 7 is a graph showing the results of in vitro killing assay of MVR and MVR-g540-CAR-T.
  • FIG. 8 is a graph showing the results of the expansion (fold expansion) of MVR-g540, MVR-g540-NFAT-IL-18 CAR-T (A: Total Fold Expansion, B: Fold Expansion).
  • FIG. 9 is a graph showing the cell viability (Cell viability) results of MVR-g540, MVR-g540-NFAT-IL-18 CAR-T
  • FIG. 11 is a graph showing the results of an in vitro killing assay of MVR-g540, MVR-g540-NFAT-IL-18 CAR T ( FIG. 11A : analysis results in Daudi cells, FIG. 11B : in NALM6 cells) Analysis).
  • FIG. 12 is a graph showing the tumor size measurement results of the MVR CAR-T, MVR-g540 CAR-T treatment group.
  • Figure 12 A is a diagram showing the average value of the tumor size according to the breeding date after CAR-T cell inoculation.
  • 12B is a diagram showing the results of confirming the tumor size according to the breeding date after inoculation with a negative control group, MVR CAR-T, and MVR-g540 CAR-T.
  • 13 is a graph showing the blood analysis results of the MVR CAR-T and MVR-g540 CAR-T treatment groups.
  • 14 is a graph showing the results of in vivo analysis of MVR-g540 CAR-T and MVR-g540-NFAT-IL-18 CAR-T.
  • 14A is a diagram showing changes in photons according to breeding days after CAR-T cell injection.
  • Figure 14B is a view showing the results of confirming the photon (photon) change according to the breeding date after the negative control, MVR CAR-T, MVR-g540 CAR-T injection.
  • 14C is a diagram showing the results of confirming the survival rate of the experimental animals after CAR-T cell injection.
  • the CAR expression rate and cell viability are increased during the production of HLA-DR-specific CAR-T cells, and the in vitro and in vivo efficacy is increased by expressing the cleaved glyceraldehyde 3-phosphate dehydrogenase (GAPDH) together.
  • GPDH cleaved glyceraldehyde 3-phosphate dehydrogenase
  • the present invention in one aspect, (a) HLA-DR (Human Leukocyte Antigen - antigen D Related) specific antigen binding domain (antigen binding domain), transmembrane domain (transmembrane domain) and intracellular signaling domain (intracellular) a chimeric antigen receptor (CAR) comprising a signaling domain; and (b) a nucleic acid encoding cleaved glyceraldehyde 3-phosphate dehydrogenase (GAPDH).
  • HLA-DR Human Leukocyte Antigen - antigen D Related
  • specific antigen binding domain antigen binding domain
  • transmembrane domain transmembrane domain
  • intracellular signaling domain intracellular
  • a chimeric antigen receptor (CAR) comprising a signaling domain
  • GPDH nucleic acid encoding cleaved glyceraldehyde 3-phosphate dehydrogenase
  • chimeric antigen receptor is a synthetic construct designed to induce an immune response against a target antigen and cells expressing the antigen.
  • CAR includes an extracellular binding domain, a transmembrane domain and an intracellular signaling domain.
  • extracellular binding domain refers to a portion of a CAR comprising an antigen binding domain having the ability to specifically bind to a desired target antigen.
  • the extracellular binding domain is any protein that retains the ability to specifically recognize and bind to a biological molecule (eg, a cell surface receptor or tumor protein, lipid, polysaccharide, or other cell surface target molecule, or component thereof); polypeptides, oligopeptides or peptides.
  • a binding domain includes any naturally occurring, synthetic, semisynthetic or recombinantly produced binding partner for a biological molecule of interest.
  • an extracellular binding domain may bind to or associate with a target molecule with an affinity of at least about 10 ⁇ 5 M or Ka (ie, the equilibrium dissociation constant of a particular binding interaction having units of 1/M). binds specifically to molecules.
  • affinity can be defined as the equilibrium dissociation constant (Kd) of a particular binding interaction with units of M (eg, 10 ⁇ 5 M to 10 ⁇ 13 M or less).
  • the affinity of the extracellular binding domain and the CAR according to the present invention can be determined using conventional techniques, for example, competition ELISA (enzyme-linked immunosorbent assay) or labeled ligands or using the Biacore T100 (which is located in Peace, NJ). Combination using surface-plasmon resonance devices such as Cataway Biacore, Inc.) or optical biosensor technology such as EnSpire or the EPIC system available from Corning and Perkin Elmer, respectively. It can be readily determined by association or substitution analysis.
  • the antigen-binding domain may be characterized as an HLA-DR specific antigen-binding domain.
  • the HLA-DR-specific antigen-binding domain may include an HLA-DR-specific antibody or fragment thereof, wherein the HLA-DR-specific antibody or fragment thereof is represented by SEQ ID NO: 2 It may be characterized as an MVR scFv comprising an amino acid sequence, but is not limited thereto.
  • HLA-DR Human Leukocyte Antigen - antigen D Related
  • HLA-DR and its ligands which are peptides 9 amino acids long or longer, constitute ligands for the TCR.
  • HLA-DR molecules are upregulated in response to signaling.
  • peptides such as Staphylococcus enterotoxin I peptides
  • T-helper cells T-helper cells
  • fragment of the antibody means a fragment having an antigen-binding function, scFv, Fab, F(ab') 2 , Fv and nanobody (nanobody) fragment, etc. It is used in the meaning of including fragments. .
  • a “single chain Fv” or “scFv” antibody fragment comprises the VH and VL domains of an antibody, which domains are present within a single polypeptide chain.
  • the Fv polypeptide may further comprise a polypeptide linker between the VH and VL domains that enables the scFv to form the desired structure for antigen binding.
  • An “Fv” fragment is an antibody fragment that contains a complete antibody recognition and binding site. This region consists of a dimer in which one heavy chain variable domain and one light chain variable domain are tightly and substantially covalently associated, for example, with an scFv.
  • a "Fab” fragment contains the variable and constant domains of a light chain and the variable and first constant domains (CH1) of a heavy chain.
  • F(ab') 2 antibody fragments generally comprise a pair of Fab fragments covalently linked near their carboxy terminus by a hinge cysteine between them.
  • a “nanobody” is a fragment containing a monomeric variable antibody domain. It mainly consists of a low-molecular-weight fragment derived from an antibody domain such as a camel that shows target specificity only with a heavy monomer chain.
  • the chimeric antigen receptor may be characterized in that it comprises a transmembrane domain.
  • transmembrane domain is a part of a CAR that fuses an extracellular binding moiety and an intracellular signaling domain and anchors the CAR to the plasma membrane of an immune effector cell.
  • the transmembrane domain may be derived from a natural, synthetic, semisynthetic or recombinant source.
  • the transmembrane domain is the alpha ( ⁇ ), beta ( ⁇ ) or zeta ( ⁇ ) chain of T-cell receptor (TCR), CD28, CD3 epsilon ( ⁇ ), CD45, CD4, CD5, CD8, It may be characterized as selected from the group consisting of CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154, but is not limited thereto.
  • the transmembrane domain may be attached to the extracellular binding domain of the CAR via a linker.
  • the linker may be a short oligo- or polypeptide linker of 2 to 10 amino acids in length, preferably a glycine (G)-serine (S) doublet, but is not limited thereto. .
  • the binding domain of a CAR is generally followed by one or more “hinge domains”. Accordingly, the nucleic acid encoding the chimeric antigen receptor may further include a nucleic acid encoding a hinge.
  • hinge domain is the part of a CAR that plays an important role in the positioning of the antigen binding domain away from the effector cell surface to allow for proper cell/cell contact, antigen binding and activation.
  • CARs generally include one or more hinge domains between an extracellular binding domain and a transmembrane domain.
  • the hinge domain may be derived from natural, synthetic, semi-synthetic or recombinant sources.
  • the hinge domain may comprise the amino acid sequence of a naturally occurring immunoglobulin hinge region or an altered immunoglobulin hinge region.
  • An “altered hinge region” is defined as (a) a naturally occurring hinge region having at most 30% amino acid change (eg, at most 25%, 20%, 15%, 10% or 5% amino acid substitutions or deletions), (b) at most of at least 10 amino acids (e.g., at least 12, 13, 14 or 15 amino acids) in length with a 30% amino acid change (e.g., amino acid substitutions or deletions of up to 25%, 20%, 15%, 10% or 5%) a portion of a naturally occurring hinge region, or (c) a core hinge region (which is 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15, or at least 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in length).
  • one or more cysteine residues in the naturally occurring immunoglobulin hinge region may be substituted with one or more other amino acid residues (eg, one or more serine residues).
  • the altered immunoglobulin hinge region may alternatively or additionally have a proline residue of the wild-type immunoglobulin hinge region substituted with another amino acid residue (eg, a serine residue).
  • the hinge domain comprises a hinge region derived from the extracellular region of type 1 membrane proteins such as CD8, CD4, CD28 and CD7, which may be a wild-type hinge region from these molecules or may be altered.
  • any transmembrane domain including the hinge domain can be used as long as it can connect the extracellular domain and the intracellular domain between the cell membrane.
  • it may consist of a hinge domain and a transmembrane domain derived from CD8, but is not limited thereto.
  • the chimeric antigen receptor may be characterized in that it comprises an intracellular signaling domain.
  • the intracellular signaling domain is T-cell receptor (TCR) zeta ( ⁇ ), FcR gamma ( ⁇ ), FcR beta ( ⁇ ), CD3 gamma ( ⁇ ), CD3 delta ( ⁇ ), CD3 epsilon ( ⁇ ), CD3 zeta ( ⁇ ), a primary signaling domain selected from the group consisting of CD5, CD22, CD79a, CD79b and CD66d; and/or CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB (CD137), OX40 (CD134), CDS, ICAM-1, ICOS (CD278), LFA-1 (CD11a/CD18), GITR, MyD88 , DAP1, PD-1, LIGHT, NKG2C, B7-H3 and may be characterized in that it comprises a co-stimulatory signaling domain selected from the group consisting of a ligand that specifically binds to CD83. .
  • intracellular signaling domain refers to effector cell functions, such as activation, including release of cytotoxic factors to CAR-bound target cells, cytokine production, proliferation and refers to the portion of a CAR that is involved in the transmission of the message of effective CAR binding to a target antigen into the interior of an immune effector cell to elicit cytotoxic activity, or other cellular response elicited by antigen binding to the extracellular binding domain of the CAR will do Effectoral function refers to a specific function of a cell, for example, the agonistic function of a T cell may be cytolytic activity, or may support or be active, including the secretion of cytokines.
  • an intracellular signaling domain refers to a portion of a protein that transmits an operative function signal and directs a cell to perform a specific function.
  • T cell activation is mediated by two different classes of intracellular signaling domains.
  • T cell activation is mediated by a primary signaling domain that initiates antigen-dependent primary activation through a T cell receptor and a costimulatory signaling domain that acts in an antigen-independent manner to provide a secondary signal.
  • the intracellular signaling domain may be characterized as comprising a “primary signaling domain” and a “co-stimulatory signaling domain”.
  • primary signaling domain refers to a signaling domain that modulates primary activation of a T cell receptor complex in a stimulating or inhibitory manner.
  • a primary signaling domain that acts in a stimulatory manner may contain a signaling motif known as an immunoreceptor tyrosine-based activation motif or ITAM.
  • ITAM containing the primary signaling domain may be selected from the group consisting of, but not limited to, TCR ⁇ , FcR ⁇ , FcR ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , CD5, CD22, CD79a, CD79b and CD66d.
  • the primary signaling domain may be CD3 zeta ( ⁇ ), and as a preferred example, CD3 zeta ( ⁇ ) including the amino acid sequence shown in SEQ ID NO: 9, but is not limited thereto. .
  • co-stimulatory signaling domain refers to an intracellular signaling domain of a co-stimulatory molecule.
  • a costimulatory molecule is an antigen receptor or cell surface molecule other than an Fc receptor that upon binding to an antigen provides a secondary signal required for efficient activation and function of T lymphocytes.
  • the costimulatory signaling domain is OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), CD7, CD30, CD40, PD-1, It may be characterized in that it is selected from the group consisting of LIGHT, NKG2C, B7-H3, CD83 and 4-1BB (CD137), but is not limited thereto.
  • 4-1BB was used as the costimulatory signaling domain, and eu4 was added with 5 amino acids to the 4-1BB cytoplasmic domain used in CAR-T in order to increase the immunological efficacy of 4-1BB.
  • a CAR expression vector was newly constructed using -1BB (SEQ ID NO: 7) as a costimulatory signal factor.
  • eu4-1BB (SEQ ID NO: 7) with 5 amino acids added to the 4-1BB cytoplasmic domain used in CAR-T as the costimulatory signaling domain and CD3 zeta ( ⁇ ) as the primary signaling domain ( SEQ ID NO: 9) can be used, and these two domains were combined and defined as 'euBBz'.
  • the chimeric antigen receptor according to the present invention may include two or more intracellular signaling domains, and when it includes two or more intracellular signaling domains, the intracellular signaling domains may be connected in series with each other. Alternatively, they may be linked through an oligopeptide linker or a polypeptide linker consisting of 2 to 10 amino acids, and examples of such linker sequences include glycine-serine continuous sequences.
  • the nucleic acid encoding the chimeric antigen receptor according to the present invention may further include a nucleic acid encoding a signal peptide.
  • the signal peptide may be located in front of the extracellular binding domain.
  • the signal peptide may be, for example, a signal peptide such as GM-CSF or CD8 ⁇ , but is not limited thereto.
  • CD8 ⁇ was used as a signal peptide.
  • the nucleic acid encoding the chimeric antigen receptor may further include a nucleic acid encoding a cleaved glyceraldehyde 3-phosphate dehydrogenase (GAPDH).
  • GAPDH cleaved glyceraldehyde 3-phosphate dehydrogenase
  • the nucleic acid encoding the cleaved GAPDH may consist of or may be a nucleic acid sequence comprising the nucleic acid sequence encoding the polypeptide represented by SEQ ID NO: 11, preferably cleaved GAPDH consisting of SEQ ID NO: 11 cleaved to a size of 540 bp. It may be a nucleic acid encoding (glyceraldehyde 3-phosphate dehydrogenase).
  • the nucleic acid encoding glyceraldehyde 3-phosphate dehydrogenase (GAPDH) cleaved to a size of 540 bp may be referred to as gapdh540 or g540 in the present invention.
  • the polypeptide encoded by the nucleic acid cut into the 540 bp size may include, have, or consist of the polypeptide sequence shown in SEQ ID NO: 11.
  • the nucleic acid encoding GAPDH, cut to a size of 540 bp encodes a polypeptide represented by SEQ ID NO: 11, for example, SEQ ID NO: 10 or NCBI Reference Sequence; It may have or consist of the nucleic acid sequence of NM_002046.7.
  • SEQ ID NO: 10 includes a stop codon 3bp in a nucleic acid encoding GAPDH of 540bp.
  • CAR-T (MVR-g540) further comprising a nucleic acid encoding cleaved glyceraldehyde 3-phosphate dehydrogenase (GAPDH) of the present invention is compared with MVR not containing cleaved GAPDH, HLA- expressed upon T cell activation It can reduce fratricide generated when DR and CAR-T cells combine, thereby significantly increasing cell viability, and exhibiting an effect equivalent to that of MVR. That is, the MVR-g540 of the present invention can exhibit the effect of increasing the cell viability while maintaining the effect of CAR-T.
  • GAPDH glyceraldehyde 3-phosphate dehydrogenase
  • the nucleic acid may further include a nucleic acid encoding interleukin 18 (IL-18).
  • the interleukin 18 may include or consist of the amino acid sequence of SEQ ID NO: 16, and the nucleic acid encoding it may include or consist of the nucleic acid sequence of SEQ ID NO: 15.
  • the nucleic acid encoding the interleukin 18 may be characterized in that it further comprises a secretion signal sequence.
  • the secretion signal sequence may be characterized as an IL-2 secretion signal sequence, but is not limited thereto.
  • the IL-2 secretion signal sequence may be a polypeptide sequence represented by SEQ ID NO: 14.
  • the nucleic acid encoding the interleukin 18 may be operably linked to a binding site.
  • the binding site may be characterized as a nuclear factor of activated T cells (NFAT) binding site, but is not limited thereto.
  • NFAT nuclear factor of activated T cells
  • the NFAT binding site may include or consist of a nucleic acid sequence represented by SEQ ID NO: 12.
  • nucleic acid (polynucleotide) according to the present invention can be modified by codon optimization, which is due to the degeneracy of codons. A technician will be able to understand it well. Some of these polynucleotides possess minimal homology with the nucleotide sequence of any naturally occurring gene.
  • polynucleotides that are variable due to differences in codon utilization for example, polynucleotides optimized for codon selection in humans, primates and/or mammals are preferred.
  • the present invention is the chimeric antigen receptor; and a nucleic acid encoding cleaved glyceraldehyde 3-phosphate dehydrogenase (GAPDH) and/or interleukin 18.
  • GPDH cleaved glyceraldehyde 3-phosphate dehydrogenase
  • the term "vector” refers to a nucleic acid molecule capable of transferring or transporting another nucleic acid molecule.
  • the transferred nucleic acid is generally linked to a vector nucleic acid molecule, eg, inserted into a vector nucleic acid molecule.
  • the vector may include sequences that direct autonomous replication in the cell, or it may include sequences sufficient to permit integration into host cell DNA.
  • the vector may be selected from the group consisting of DNA, RNA, plasmid, lentiviral vector, adenoviral vector and retroviral vector. Although not limited thereto, it may preferably be characterized as a lentiviral vector.
  • the nucleic acid or the vector is transfected or transformed into a virus-producing cell line (packaging cell line).
  • a virus-producing cell line packaging cell line.
  • exogenous nucleic acids DNA or RNA
  • transfection or transformation
  • electrophoresis calcium phosphate precipitation
  • DEAE -Dextran transfection or lipofection
  • the virus produced from the virus-producing cells is transformed into immune cells (transduction).
  • the nucleic acid of the virus "transformed” into a cell is used to produce the chimeric antigen receptor protein of the present invention, with or without integration into the genome of the cell.
  • the present invention relates to an immune cell comprising the nucleic acid or the vector.
  • the immune cells are capable of inducing the desired cancer treatment effect by inducing immunity, for example, T cells, NK cells, NKT cells, cytokine-induced killer cells (Cytokine Induced Killer cell, CIK) , may be selected from the group consisting of macrophages and dendritic cells, but is not limited thereto. Preferably, it may be characterized as a T cell.
  • T cells for example, T cells, NK cells, NKT cells, cytokine-induced killer cells (Cytokine Induced Killer cell, CIK)
  • CIK cytokine-induced killer cells
  • the immune cells expressing the chimeric antigen receptor according to the present invention are CAR-T cells (Chimeric Antigen Receptor T Cells), CAR-NK cells (Chimeric Antigen Receptor Natural Killer Cells), and CAR-NK T cells (Chimeric Antigen Receptor Natural Cells). killer T Cell) or CAR-macrophage (Chimeric Antigen Receptor Macrophage).
  • the T cells are CD4 positive T cells; CD8 positive cytotoxic T lymphocyte (CTL); gamma-delta T cells; It may be characterized in that it is selected from the group consisting of T cells isolated from tumor infiltrating lymphocytes (TIL) and peripheral blood mononuclear cells (PBMC), but is not limited thereto.
  • TIL tumor infiltrating lymphocytes
  • PBMC peripheral blood mononuclear cells
  • the immune cells of the present invention can kill cancer cells by specifically recognizing HLA-DR, and can selectively kill only cancer cells overexpressing HLA-DR. effect can be provided.
  • the immune cells containing the CAR and the IL-18-encoding nucleic acid or vector containing the CAR of the present invention are specifically IL-18 when T cells are activated while the CAR located outside the cell and the antigen HLA-DR are in contact. It may be characterized by secreting.
  • the present invention relates to a pharmaceutical composition for preventing or treating cancer comprising the immune cells.
  • the present invention relates to a method for preventing or treating cancer comprising administering the immune cells to a subject.
  • the present invention relates to the use of the immune cells for the prevention or treatment of cancer.
  • the present invention relates to the use of the immune cells for the manufacture of a medicament for the prevention or treatment of cancer.
  • said pharmaceutical composition cancer prevention or treatment methods; the use of immune cells for cancer prophylaxis; And with respect to the use of immune cells for the manufacture of drugs for preventing or treating cancer, in order to avoid duplication of the same description, the descriptions of the nucleic acids, vectors, and immune cells may be applied mutatis mutandis.
  • the subject may be a mammal having a tumor, specifically, a human, but is not limited thereto.
  • prevention refers to any action that inhibits or delays the progression of cancer by administering the composition of the present invention
  • treatment refers to inhibition of the development of cancer, alleviation or elimination of symptoms.
  • cancer and “tumor” are used interchangeably and refer to or mean a physiological condition in a mammal that is typically characterized by unregulated cell growth/proliferation.
  • Cancers that can be treated with the CAR of the present invention include vascularized tumors as well as non-vascularized or yet substantially non-vascularized tumors.
  • the cancer may include non-solid tumors (eg, hematologic tumors such as leukemia and lymphoma), or may include solid tumors.
  • the types of cancer that can be treated with the CAR of the invention include carcinomas, blastomas, and sarcomas, and certain leukemia or lymphoid malignancies, benign and malignant tumors such as sarcomas, carcinomas and melanomas, It is not limited thereto. Also included are adult tumors/cancers and pediatric tumors/cancers.
  • Hematological cancers are cancers of the blood or bone marrow.
  • hematological (or hematopoietic) cancers include acute leukemia (eg, acute lymphocytic leukemia, acute myeloid leukemia and myeloblastic, prolymphocytic, myeloid monocytic, monocytic and erythroleukemia), chronic leukemia (eg, For example, chronic lymphocytic (granulocytic) leukemia, chronic myelogenous leukemia, and chronic lymphocytic leukemia), polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma (delayed and high-stage forms), multiple myeloma, leukemias including Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hair cell leukemia and myelodysplasia.
  • acute leukemia eg, acute lymphocytic
  • a solid tumor is an abnormal mass of tissue that usually does not contain capsules or fluid compartments. Solid tumors can be benign or malignant. Different types of solid tumors are named for the types of cells that form them (eg, sarcomas, carcinomas, and lymphomas). Examples of solid tumors such as sarcomas and carcinomas include fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteosarcoma, and other sarcomas, synovioma, mesothelioma, Ewing tumor, pleiosarcoma, rhabdomyosarcoma.
  • rectal carcinoma lymphoid malignancy, colorectal cancer, stomach cancer, pancreatic cancer, breast cancer, lung cancer, ovarian cancer, prostate cancer, pharyngeal cancer, hepatocellular carcinoma, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, medullary thyroid carcinoma, Papillary thyroid carcinoma, pheochromocytoma, sebaceous adenocarcinoma, papillary carcinoma, papillary adenocarcinoma, medullary carcinoma, bronchial carcinoma, renal cell carcinoma, liver tumor, cholangiocarcinoma, choriocarcinoma, Wilms' tumor, cervical cancer , testicular tumors, seminoma, bladder cancer, melanoma, and CNS tumors (eg, gliomas (eg, brainstem glioma and mixed glioma), glioblastoma (also known as glioblastoma multiform
  • the cancer is esophageal adenocarcinoma, colorectal cancer, melanoma, ocular melanoma, small cell lung cancer, neuroblastoma, teratoma, fetal cancer, squamous cell carcinoma, head and neck squamous cell carcinoma, thymoma, lymphoblastic leukemia, B cell It may be characterized as selected from the group consisting of lymphoma, obese giant B-cell lymphoma, leukemia and acute myeloid leukemia, but is not limited thereto.
  • composition of the present invention may further comprise a pharmaceutically acceptable carrier.
  • the term "pharmaceutically acceptable carrier” refers to a carrier or diluent that does not stimulate the organism and does not inhibit the biological activity and properties of the administered compound.
  • the pharmaceutically acceptable carrier which is sterile and biocompatible, is saline, sterile water, buffered saline, albumin injection, dextrose solution, maltodextrin solution, glycerol, and these components.
  • One or more components may be mixed and used, and other conventional additives such as antioxidants, buffers, and bacteriostats may be added as needed.
  • diluents such as an aqueous solution, suspension, emulsion, etc., pills, capsules, granules or tablets.
  • the pharmaceutical composition of the present invention may be in various oral or parenteral formulations.
  • formulation it is prepared using diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrants, and surfactants that are usually used.
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, etc., and such solid preparations include at least one excipient in one or more compounds, for example, starch, calcium carbonate, sucrose or lactose ( lactose), gelatin, etc.
  • lubricants such as magnesium stearate and talc are also used.
  • Liquid formulations for oral administration include suspensions, internal solutions, emulsions, syrups, etc.
  • various excipients such as wetting agents, sweeteners, fragrances, and preservatives may be included.
  • Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried preparations, and suppositories.
  • Non-aqueous solvents and suspensions may include propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate.
  • As the base of the suppository witepsol, macrogol, tween 61, cacao butter, laurin, glycerogelatin, and the like can be used.
  • composition of the present invention may be administered orally or parenterally, and in the case of parenteral administration, infusion, intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal administration Administration (intraperitoneal injection), endothelial administration, topical administration (topical administration), intranasal administration (intranasal injection), intrapulmonary administration and intrarectal administration (Intrarectal administration), etc. may be administered, but is not limited thereto.
  • parenteral administration infusion, intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal administration Administration (intraperitoneal injection), endothelial administration, topical administration (topical administration), intranasal administration (intranasal injection), intrapulmonary administration and intrarectal administration (Intrarectal administration), etc.
  • parenteral administration infusion, intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal administration Administration (intraperitoneal injection), endothelial administration, topical administration (topical administration), intranasal administration
  • a suitable dosage of the composition for preventing or treating cancer of the present invention depends on factors such as formulation method, administration method, patient's age, weight, sex, pathological condition, food, administration time, administration route, excretion rate, and response sensitivity. These vary, and an ordinarily skilled practitioner can readily determine and prescribe a dosage effective for the desired treatment or prophylaxis.
  • composition of the present invention may be administered as an individual therapeutic agent or may be administered in combination with other known therapeutic agents having an effect of preventing, ameliorating or treating cancer symptoms, and may be administered sequentially or simultaneously with conventional therapeutic agents.
  • Example 1-1 Lentiviral transfer plasmid types for MVR CAR
  • the structure of the lentiviral transfer vector for CAR construction according to the present invention is shown in Table 1 below.
  • Glyceraldehyde 3-phosphate dehydrogenase (GAPDH, NCBI Reference Sequence; NM_002046.7) (herein, abbreviated as "gapdh540" or "g540”) was added to the intracellular domain of MVR CAR-T (Note) Gene synthesis was requested by IDT.
  • Glyceraldehyde 3-phosphate dehydrogenase (GAPDH, NCBI Reference Sequence; NM_002046.7) (herein, abbreviated as "gapdh540" or "g540”) was added to the intracellular domain of MVR CAR-T (Note) Gene synthesis was requested by IDT.
  • the gene sequence information of the CAR structure including the MVR scFv gene sequence and intracellular domain is shown in Table 2 below ( FIG. 1 ).
  • Example 1-3 Cloning using Stbl III, a competent cell
  • the vector was linearized using the restriction enzymes EcoRV and SalI inside the CAR construct of pELPS4-MVR-euBBz.
  • the synthesized insert gene was also ligated with the vector after the same restriction enzyme treatment.
  • Example 1-5 Lentiviral transfer plasmid cloning for IL-18 expression MVR CAR-T construction
  • activated T cell nuclear factor (NFAT) binding site-IL-2 minimal promoter Nuclear Factor of activated T cells (NFAT)-IL-2 minimal promoter
  • NFAT binding site the sequence in pGL3-NFAT luciferase (snapgene, Nature. 1992 Jun 25. 357(6380):695-7) was used, and 6 NFAT binding sites were used.
  • NFAT-IL-18 gene sequence information is shown in Table 2 above.
  • Example 2 Lentivirus production and titer measurement
  • Example 3-1 T cell isolation (isolation)
  • PBMCs were incubated with CD4 and CD8 microbeads, and CD4+, CD8+ T cells were isolated using a magnet.
  • Example 3-3 Activated T cell transduction
  • Activated T cells were transformed with lentivirus and cell growth was measured from day 2 to day 9. On day 9, cells were collected and used for in vitro experiments.
  • Example 3-4 In vitro culture and analysis
  • MVR and MVR-g540 CAR-T was cultured for 9 days, and the fold expansion was compared ( FIGS. 4A and 4B ).
  • MVR-g540 CAR-T exhibited an increase in cell viability by about 10% or more compared to 69%, which is the survival rate of MVR CAR-T cells.
  • Example 3-5 In vitro killing assay
  • Luciferase based cytotoxicity assay using LCL B-Lymphoblastoid Cell Line expressed by HLA-DR as target cell and CAR-T cell as effector cell proceeded.
  • LCL B-Lymphoblastoid Cell Line
  • CAR-T cell effector cell proceeded.
  • Cells were cocultured in a 96-well white polystyrene microplate according to the ratio of E:T (effector (E): target (T)), and luciferase assay reagent (Bright-Glo TM ) ) and reacted for 5 minutes, then fluorescence was measured using a luminometer.
  • Example 4 In vitro analysis of MVR-g540, MVR-g540-NFAT-IL-18 CAR-T
  • Example 4-1 T cell isolation (isolation)
  • PBMCs were incubated with CD4 and CD8 microbeads, and CD4+, CD8+ T cells were isolated using a magnet.
  • Example 4-2 T cell activation (activation)
  • Example 4-3 Activated T cell transduction
  • Activated T cells were transduced with lenti-virus, and cell growth was measured from day 2 to day 9. On day 9, cells were collected and used for in vitro experiments.
  • Example 4-4 In vitro culture and analysis
  • MVR-g540 and MVR-g540-NFAT-IL-18 CAR-T were cultured for 9 days to compare the expansion (fold expansion) (FIG. 8).
  • Example 4-5 In vitro killing assay
  • Daudi and NALM6 cells expressing HLA-DR were used as target cells, and CAR-T cells were used as effector cells to perform a luciferase based cytotoxicity assay.
  • Cells were cocultured in a 96-well white polystyrene microplate according to the ratio of E:T (effector (E): target (T)), and luciferase assay reagent (Bright-Glo TM ) ) and reacted for 5 minutes, then fluorescence was measured using a luminometer.
  • Example 5 In vivo analysis of MVR, MVR-g540 CAR-T
  • LCL-Luc B-Lymphoblastoid Cell Line
  • the LCL-Luc cell line was subcultured once every 2-3 days, 37° C., and cultured in a CO 2 incubator.
  • Example 5-2 Preparation of cells for administration to animals
  • MVR CAR-T truncated MVR CAR-T
  • MVR CAR-T truncated MVR CAR-T
  • MVR-g540 CAR-T cells for administration were prepared.
  • physiological saline 5% Human Serum Albumin, 5% HSA
  • a portion of the suspension was diluted 20-fold, and 2 ⁇ L of the staining solution and 18 ⁇ L of the diluted cell suspension were mixed for cell counting, and the number of cells was counted using a LUNA-FL Automated Fluorescence cell counter. After the measurement, prepare 600 ⁇ L of MVR CAR-T at a concentration of 0.5 x 10 6 cells/100 ⁇ L, and 1 x 10 6 cells/100 ⁇ L of CAR positive cells.
  • Example 5-4 Blood collection and FACS analysis
  • Example 5-5 MVR, MVR-g540 administration group cancer size measurement results
  • MVR CAR-T and MVR-g540 CAR-T were performed using 30 NSGs.
  • the size of the cancer was about 80mm 3
  • the group was divided and MVR CAR-T was administered, and the tumor size was measured twice a week for 32 days using Auto caliper (TM900).
  • TM900 Auto caliper
  • all subjects died on day 14, and both MVR CAR-T 0.5 x 10 6 , MVR CAR-T 1 x 10 6 , and MVR-g540 CAR-T 0.5 x 10 6 decreased in tumor size.
  • the tumor size increased again on day 28.
  • MVR-g540 CAR-T 1 x 10 6 the tumor size started to decrease from the 4th day of CAR-T administration in all 5 mice and continued to decrease until the end of the experiment ( FIG. 12 ).
  • Example 5-6 Blood analysis of MVR, MVR-g540 administration group
  • Example 6 In vivo analysis of MVR-g540, MVR-g540-NFAT-IL-18 CAR-T
  • a stable cell line expressing luciferase was prepared.
  • one cell line that binds to MVR was selected. MVR binding was confirmed using the Daudi cell line.
  • a cell line expressing luciferase-GFP was prepared using the B Lymphoma cell line. Transformation was induced using a lentivirus, and the transduction efficiency was confirmed by confirming the expression of GFP. Thereafter, only cell lines into which the luciferase-GFP gene was inserted were selectively selected using puromycin, and then a luciferase function test was performed. As a result of this experiment, when the change in the RLU value according to the number of cell lines was confirmed, it was confirmed that the RLU value decreased by 50% as the number of cell lines decreased by 50%, which was then used for animal model production. The developed cell line was used for the production of animal models.
  • Example 6-3 MVR-g540 and MVR-g540-NFAT-IL-18 CAR-T efficacy verification
  • Daudi_GFP-Luc 1 x 10 6 cells/head and 2 x 10 6 cells/head were administered to NSG mice by tail vein to determine the period of tumor induction in the mouse.
  • the period of tumor induction in the mouse As a result of this experiment, when tumors were induced using Daudi_GFP-Luc, there was no significant difference between 1 x 10 6 cells/head and 2 x 10 6 cells/head.
  • each CAR-T was administered when the photon value reached 1 x 10 7 (Table 5). ).
  • Example 6-4 Comparison of efficacy after induction of animal models
  • MVR-g540 CAR-T 0.5 x 10 6 and 1 x 10 6 showed 50% and 66.7% mortality on the 21st day of administration, respectively, but in the case of MVR-g540-NFAT-IL-18 CAR-T At both concentrations, no subjects died until day 35 (FIG. 14).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • Cell Biology (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Mycology (AREA)
  • Oncology (AREA)
  • Hematology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Hospice & Palliative Care (AREA)
  • Plant Pathology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

본 발명은 HLA-DR 특이적 항원 결합 도메인을 포함하는 키메라 항원 수용체(chimeric antigen receptor: CAR)에 관한 것으로, 보다 상세하게는 상기 키메라 항원 수용체를 코딩하는 핵산; 상기 핵산을 포함하는 벡터; 상기 핵산 또는 벡터를 포함하는 면역세포; 및 상기 핵산, 상기 핵산을 포함하는 벡터, 또는 상기 핵산 또는 벡터를 포함하는 면역세포를 포함하는 암 예방 또는 치료용 약학 조성물에 관한 것이다. 본 발명의 종양세포에서 증가된 HLA-DR에 특이적인 MVR을 항원 결합 도메인으로 포함하는 CAR를 코딩하는 핵산을 이용하여 제작한 CAR-T 세포는 증가된 세포 발현율 및 in vivo 효능을 나타내므로, 우수한 암 치료 효과를 제공할 수 있다.

Description

HLA-DR 특이적 키메라 항원 수용체 및 이의 용도
본 발명은 HLA-DR 특이적 항원 결합 도메인을 포함하는 키메라 항원 수용체(chimeric antigen receptor: CAR)에 관한 것으로, 보다 상세하게는 상기 키메라 항원 수용체를 코딩하는 핵산, 상기 핵산을 포함하는 벡터, 상기 핵산 또는 벡터를 함유하는 면역세포 및 상기 핵산, 벡터 또는 면역세포를 포함하는 암 예방 또는 치료용 약학 조성물에 관한 것이다.
최근 암에 대한 새로운 양자면역 유전자 치료로서, 유전자변형 세포 요법이 주목받고 있다. 이 치료법은 암세포의 표면항원으로의 특이성과 세포의 활성화능을 가지는 키메라 항원 수용체(chimeric antigen receptor: CAR)를 코딩하는 핵산을 T 세포 또는 NK 세포에 도입하고, 수득된 유전자도입 세포를 체외에서 증식시켜서 수주하는 방법이다. 이 방법은 항체의약에 비해서 항암 효과가 보다 강력하고, 효과도 보다 장기간 지속된다고 생각되고 있으며, 그 임상효과에 대단히 기대를 하고 있다.
1세대 CAR에서는 암세포에서 특이적으로 발현하는 항원 인식 부위를 포함하는 세포외 도메인, 막횡단 도메인 및 세포내 신호전달 도메인을 포함하고, 신호전달 도메인으로서 CD3ζ만을 이용하였는데, 암에 대한 치료 효과가 미미하였고, 지속시간이 짧다는 문제가 있었다. 이러한 1세대 CAR는 미국등록특허 제6,319,494호에 구체적으로 기재되어 있으며, 본 발명에 참조로서 도입된다.
면역세포에 대한 반응성 향상을 위하여 공자극 도메인(CD28 또는 CD137/4-1BB)과 CD3ζ를 결합한 2세대 CAR가 제조되었는데, 1세대 CAR와 비교하여 체내에 잔존하는 CAR 포함 면역세포의 수가 현저히 증가하였다. 2세대 CAR는 한 가지의 공자극 도메인을 이용한 것에 반해, 3세대 CAR에서는 두 가지 이상의 공자극 도메인을 이용하였다. 생체 내 CAR를 포함하는 면역세포의 확장 및 지속성 달성을 위해 공자극 도메인을 4-1BB, CD28 또는 OX40 등과 결합시킬 수 있다. 2세대 CAR는 미국등록특허 제7,741,465호, 제7,446,190호 또는 제9,212,229호에 구체적으로 기재되어 있고, 3세대 CAR는 미국등록특허 제8,822,647호에 구체적으로 기재되어 있으며, 본 발명에 참조로서 도입된다.
4세대 CAR에서는 IL-12 또는 IL-15와 같은 사이토카인(cytokine)을 암호화하는 추가 유전자를 포함하여, 사이토카인의 CAR 기반 면역단백질이 추가로 발현될 수 있도록 하고, 5세대 CAR는 면역세포 강화를 위해 인터루킨 리셉터 체인, 예를 들어, IL-2Rβ를 추가로 포함한다. 4세대 CAR는 미국등록특허 제10,316,102호, 5세대 CAR는 미국등록특허 제10,336,810호에 구체적으로 기재되어 있으며, 본 발명에 참조로서 도입된다.
본 발명자들은, HLA-DR(Human Leukocyte Antigen - antigen D Related; 항원 D 연관 인간 백혈구 항원)에 특이적으로 결합하는 MVR(Malignancy Variant Receptor) 항체를 이용한 CAR에 대해 특허출원 진행한 바 있으며(PCT/KR2019/010244), CAR가 도입된 면역세포 생산 시 세포 생존율이 증가하고, in vivo 항암능이 증가된 CAR를 개발하기 위해 예의 노력한 결과, CAR 구조에 540bp 크기로 절단된 GAPDH(glyceraldehyde 3-phosphate dehydrogenase; NM_002046.7) 및/또는 인터루킨 18(IL-18)을 추가함으로써 세포 발현율 및 항암능이 증가되는 것을 확인하고, 본 발명을 완성하였다.
본 배경기술 부분에 기재된 상기 정보는 오직 본 발명의 배경에 대한 이해를 향상시키기 위한 것이며, 이에 본 발명이 속하는 기술분야에서 통상의 지식을 가지는 자에게 있어 이미 알려진 선행기술을 형성하는 정보를 포함하지 않을 수 있다.
본 발명의 목적은 사이토카인을 분비하도록 설계된 HLA-DR 특이적 키메라 항원 수용체(chimeric antigen receptor: CAR)를 코딩하는 핵산을 제공하는 데 있다.
본 발명의 다른 목적은 상기 핵산을 포함하는 벡터를 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 핵산 또는 벡터를 함유하는 면역세포를 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 핵산, 벡터 또는 면역세포를 포함하는 암 예방 또는 치료용 약학 조성물, 상기 면역세포를 이용한 암 예방 또는 치료방법, 암 예방 또는 치료를 위한 상기 면역세포의 용도, 및 암 예방 또는 치료용 약제 제조를 위한 상기 면역세포의 사용을 제공하는 데 있다.
상기 목적을 달성하기 위하여, 본 발명은 (a) HLA-DR(Human Leukocyte Antigen - antigen D Related) 특이적 항원 결합 도메인(antigen binding domain), 막횡단 도메인(transmembrane domain) 및 세포내 신호전달 도메인(intracellular signaling domain)을 포함하는 키메라 항원 수용체(chimeric antigen receptor: CAR); 및 (b) 절단된 GAPDH(glyceraldehyde 3-phosphate dehydrogenase)를 코딩하는 핵산을 제공한다.
본 발명은 또한, 상기 핵산을 포함하는 벡터를 제공한다.
본 발명은 또한, 상기 핵산 또는 벡터를 함유하는 면역세포를 제공한다.
본 발명은 또한, 상기 핵산, 벡터, 또는 면역세포를 포함하는 암 예방 또는 치료용 약학 조성물을 제공한다.
본 발명은 또한, 상기 핵산, 벡터, 또는 면역세포를 투여하는 단계를 포함하는 암 예방 또는 치료방법, 암 예방 또는 치료를 위한 상기 핵산, 벡터, 또는 면역세포의 용도, 및 암 예방 또는 치료용 약제 제조를 위한 상기 면역세포의 사용을 제공한다.
본 발명은 종양세포에서 증가된 HLA-DR에 특이적인 MVR을 항원 결합 도메인으로 포함하는 CAR와 IL-18을 코딩하는 핵산을 이용하여 제작한 CAR-T 세포에 관한 것으로, 증가된 세포 발현율 및 in vivo 효능을 나타내므로, 우수한 암 치료 효과를 제공할 수 있다.
도 1은 MVR CAR 렌티바이러스 플라스미드(Lentiviral Plasmid)의 구조를 나타낸 모식도이다.
도 2는 MVR-g540 CAR 렌티바이러스 전달 플라스미드(Lentiviral Transfer plasmid)의 클로닝(Cloning) 결과이다.
도 3은 MVR-g540-NFAT-IL-18 CAR 렌티바이러스 전달 플라스미드(Lentiviral Transfer plasmid)의 클로닝(Cloning) 결과이다.
도 4는 MVR, MVR-g540 CAR-T의 확장(Fold expansion) 결과를 나타낸 그래프이다(A: Total Fold Expansion, B: Fold Expansion).
도 5는 MVR, MVR-g540 CAR-T의 세포 생존능(Cell Viability) 결과를 나타낸 그래프이다.
도 6은 MVR, MVR-g540 CAR-T의 FACS 분석 결과이다.
도 7은 MVR, MVR-g540-CAR-T의 In vitro 킬링 분석(killing assay) 결과를 나타낸 그래프이다.
도 8은 MVR-g540, MVR-g540-NFAT-IL-18 CAR-T의 확장(Fold expansion) 결과를 나타낸 그래프이다(A: Total Fold Expansion, B: Fold Expansion).
도 9는 MVR-g540, MVR-g540-NFAT-IL-18 CAR-T의 세포 생존능(Cell viability) 결과를 나타낸 그래프이다
도 10은 MVR-g540, MVR-g540-NFAT-IL-18 CAR-T의 FACS 분석 결과이다 (A: 7일차, B: 9 일차).
도 11은 MVR-g540, MVR-g540-NFAT-IL-18 CAR T의 In vitro 킬링 분석(killing assay) 결과를 나타낸 그래프이다(도 11A: Daudi 세포에서의 분석결과, 도 11B: NALM6 세포에서의 분석결과).
도 12는 MVR CAR-T, MVR-g540 CAR-T 처리군의 종양크기 측정 결과를 나타낸 그래프이다. 도 12 A는 CAR-T 세포 접종 후 사육일자에 따른 종양 크기의 평균값을 나타낸 도이다. 도 12 B는 음성 대조군, MVR CAR-T, MVR-g540 CAR-T 접종 후 사육일자에 따른 종양 크기를 확인한 결과를 나타낸 도이다.
도 13은 MVR CAR-T, MVR-g540 CAR-T 처리군의 혈액분석 결과를 나타낸 그래프이다.
도 14는 MVR-g540 CAR-T, MVR-g540-NFAT-IL-18 CAR-T의 In vivo 분석 결과를 나타낸 그래프이다. 도 14 A는 CAR-T 세포 주입 후 사육일자에 따른 광자(photon) 변화를 나타낸 도이다. 도 14B는 음성 대조군, MVR CAR-T, MVR-g540 CAR-T 주입 후 사육일자에 따른 광자(photon) 변화를 확인한 결과를 나타낸 도이다. 도 14C는 CAR-T 세포 주입 후 실험 동물의 생존율을 확인한 결과를 나타낸 도이다.
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로 본 명세서에서 사용된 명명법은 본 기술분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명의 일 실시예에서는, HLA-DR 특이적 CAR-T 세포 생산 시 CAR 발현율 및 세포 생존율이 증가되고, 절단된 GAPDH(glyceraldehyde 3-phosphate dehydrogenase)를 함께 발현하여 in vitro 및 in vivo 효능이 증가됨을 확인하였다. 또한, 활성화된 T 세포에서 IL-18 발현을 함께 유도하면 in vitro 및 in vivo 에서 항암 효능을 증가시킬 수 있음을 확인하였다.
따라서, 본 발명은 일 관점에서, (a) HLA-DR(Human Leukocyte Antigen - antigen D Related) 특이적 항원 결합 도메인(antigen binding domain), 막횡단 도메인(transmembrane domain) 및 세포내 신호전달 도메인(intracellular signaling domain)을 포함하는 키메라 항원 수용체(chimeric antigen receptor: CAR); 및 (b) 절단된 GAPDH(glyceraldehyde 3-phosphate dehydrogenase)를 코딩하는 핵산에 관한 것이다.
본 발명에서 용어 "키메라 항원 수용체(Chimeric antigen receptor: CAR)"는 표적 항원 및 해당 항원을 발현하는 세포에 대하여 면역반응을 유도할 수 있도록 설계된 합성 구조체(construct)이다. CAR는 세포외 결합 도메인(extracellular binding domain), 막횡단 도메인(transmembrane domain) 및 세포내 신호전달 도메인(intracellular signaling domain)을 포함한다. 암 세포의 표면에 특이적으로 발현되는 암 세포 표면 항원을 인식하는 수용체를 코딩하는 유전자를 면역세포에 도입하여, 면역세포가 체내에서 암 세포를 사멸시키도록 하는 역할을 할 수 있다. 암 세포에서 특이적으로 발현하는 항원과 결합하는 수용체를 포함하는 면역세포를 통해, 암 세포만 표적하여 면역반응을 일으킬 수 있다.
본 발명의 용어 "세포외 결합 도메인(extracellular binding domain)"이란, 목적하는 표적 항원에 특이적으로 결합하는 능력을 갖는 항원 결합 도메인(antigen binding domain)을 포함하는 CAR의 부분을 의미한다. 세포외 결합 도메인은, 생물학적 분자(예: 세포 표면 수용체 또는 종양 단백질, 지질, 다당류, 또는 기타 세포 표면 표적 분자, 또는 이의 성분)를 특이적으로 인식하고 이에 결합하는 능력을 보유하는 임의의 단백질, 폴리펩타이드, 올리고펩타이드 또는 펩타이드를 포함할 수 있다. 결합 도메인은 목적하는 생물학적 분자를 위한 임의의 천연 발생, 합성, 반합성 또는 재조합에 의해 생성된 결합 파트너를 포함한다.
본 발명의 용어 "특이적으로 결합하는"이란, 배경 결합보다 큰 결합 친화성으로 또 다른 분자에 대한 분자의 결합을 의미하는 것이다. 예를 들면, 세포외 결합 도메인은 약 10-5M 이상의 친화성 또는 Ka(즉, 1/M의 단위를 갖는 특정 결합 상호작용의 평형 해리 상수)로 표적 분자에 결합하거나 이와 연합하는 경우, 표적 분자에 대해 특이적으로 결합한다. 또는, 친화성은 M의 단위를 갖는 특정 결합 상호작용의 평형 해리 상수(Kd)(예: 10-5M 내지 10-13M 또는 그 이하)로 정의될 수 있다.
본 발명에 따른 세포외 결합 도메인 및 CAR의 친화성은 통상의 기술, 예를 들면, 경쟁 ELISA(효소-결합된 면역흡착 검정) 또는 표지된 리간드를 사용하거나 바이아코어(Biacore) T100(이는 뉴저지주 피스카타웨이 바이아코어 인코포레이티드로부터 이용가능함) 등의 표면-플라스몬 공명 장치 또는 각각 코닝(Corning) 및 퍼킨 엘머(Perkin Elmer)로부터 이용가능한 EPIC 시스템 또는 EnSpire 등의 광학 바이오센서 기술을 사용하는 결합 회합 또는 치환 분석에 의해 용이하게 측정할 수 있다.
본 발명에 있어서, 상기 항원 결합 도메인은 HLA-DR 특이적 항원 결합 도메인인 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 HLA-DR 특이적 항원 결합 도메인은 HLA-DR 특이적 항체 또는 이의 단편을 포함하는 것을 특징으로 할 수 있으며, 상기 HLA-DR 특이적 항체 또는 이의 단편은 서열번호 2로 표시되는 아미노산 서열을 포함하는 MVR scFv인 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
HLA-DR(Human Leukocyte Antigen - antigen D Related; 항원 D 연관 인간 백혈구 항원)은 고전적인 주요 조직 적합성 복합체 II 분자이다(Shackelford, D. A. et al., (1982) Immunol. Rev. 66: 133-187). HLA-DR 및 9개 아미노산 길이 또는 그 초과의 펩타이드인 그의 리간드는 TCR에 대한 리간드를 구성한다. HLA-DR 분자는 신호전달에 반응하여 상향조절 된다. 감염의 경우에, 펩타이드(예컨대 스타필로코쿠스 장독소 I 펩타이드)는 DR 분자와 결합되어 T-헬퍼 세포에서 발견되는 아주 많은 T-세포 수용체 중 몇 개에 제시된다. 이어서, 이러한 세포는 B 세포 증식을 자극하는 B 세포의 표면 상의 항원과 결합한다.
본 발명에서, 항체의 "단편"은, 항원 결합 기능을 보유하고 있는 단편을 의미하며, scFv, Fab, F(ab')2, Fv 및 나노바디(nanobody) 단편 등을 포함하는 의미로 사용된다.
"단일쇄 Fv" 또는 "scFv" 항체 단편은 항체의 VH 및 VL 도메인을 포함하는데, 이들 도메인은 단일 폴리펩티드 사슬 내에 존재한다. Fv 폴리펩티드는 scFv가 항원 결합을 위해 목적하는 구조를 형성할 수 있도록 하는 VH 도메인과 VL 도메인 사이에 폴리펩티드 링커를 추가로 포함할 수 있다. "Fv" 단편은 완전한 항체 인식 및 결합 부위를 함유하는 항체 단편이다. 이러한 영역은 1개의 중쇄 가변 도메인과 1개의 경쇄 가변 도메인이, 예를 들어 scFv로 단단하게 사실상 공유적으로 연합된 이량체로 이루어진다. "Fab" 단편은 경쇄의 가변 및 불변 도메인과, 중쇄의 가변 및 제1 불변 도메인(CH1)을 함유한다. "F(ab')2" 항체 단편은 일반적으로 그들 사이에 힌지 시스테인에 의해 그들의 카복시 말단 근처에 공유적으로 연결되는 한 쌍의 Fab 단편을 포함한다. "나노바디(nanobody)"는 단량체 가변항체 도메인(monomeric variable antibody domain)을 함유하는 단편이다. 주로 단량체 중쇄만으로 표적특이성을 보이는 낙타 등의 항체 도메인으로부터 유래된 저분자량의 단편으로 이루어진다.
본 발명에 있어서, 상기 키메라 항원 수용체는 막횡단 도메인(transmembrane domain)을 포함하는 것을 특징으로 할 수 있다.
본 발명의 용어 "막횡단 도메인(transmembrane domain)"이란, 세포외 결합 부분 및 세포내 신호전달 도메인을 융합시키고 면역 작동 세포의 원형질 막에 CAR를 고정시키는 CAR의 일부이다. 막횡단 도메인은 천연, 합성, 반합성 또는 재조합 공급원으로부터 유래할 수 있다. 본 발명에 있어서, 상기 막횡단 도메인은 T-세포 수용체(TCR)의 알파(α), 베타(β) 또는 제타(ζ) 사슬, CD28, CD3 엡실론(ε), CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 및 CD154로 구성된 군에서 선택되는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
상기 막횡단 도메인은 링커(linker)를 통해 CAR의 세포외 결합 도메인에 부착될 수 있다. 예를 들어, 링커는 2 내지 10개 아미노산 길이의 짧은 올리고- 또는 폴리펩타이드 링커일 수 있으며, 바람직하게는 글라이신(G)-세린(S) 이중체(doublet)일 수 있으나, 이에 제한되는 것은 아니다.
CAR의 결합 도메인은 일반적으로 하나 이상의 "힌지 도메인(hinge domain)"이 후속한다. 따라서, 상기 키메라 항원 수용체를 코딩하는 핵산은 힌지(hinge)를 코딩하는 핵산을 더 포함하는 것을 특징으로 할 수 있다.
본 발명의 용어 "힌지 도메인"이란, 적절한 세포/세포 접촉, 항원 결합 및 활성화를 가능하게 하도록 작동 세포 표면으로부터 떨어져 항원 결합 도메인의 위치결정에 중요한 역할을 담당하는 CAR의 일부이다. CAR는 일반적으로 세포외 결합 도메인과 막횡단 도메인 사이에 하나 이상의 힌지 도메인을 포함한다. 힌지 도메인은 천연, 합성, 반-합성 또는 재조합 공급원으로부터 유래될 수 있다. 힌지 도메인은 천연 발생 면역글로불린 힌지 영역 또는 변화된 면역글로불린 힌지 영역의 아미노산 서열을 포함할 수 있다. "변화된 힌지 영역"은 (a) 최대 30%의 아미노산 변화(예: 최대 25%, 20%, 15%, 10% 또는 5%의 아미노산 치환 또는 결실)을 갖는 천연 발생 힌지 영역, (b) 최대 30% 아미노산 변화(예: 최대 25%, 20%, 15%, 10% 또는 5%의 아미노산 치환 또는 결실)을 갖는 적어도 10개 아미노산(예: 적어도 12, 13, 14 또는 15개 아미노산) 길이의 천연 발생 힌지 영역의 일부, 또는 (c) 코어 힌지 영역(이는 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 또는 15, 또는 적어도 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 또는 15개 아미노산 길이일 수 있다)을 포함하는 천연 발생 힌지 영역의 일부를 지칭한다. 특정 실시형태에서, 천연 발생 면역글로불린 힌지 영역에서 하나 이상의 시스테인 잔기는 하나 이상의 다른 아미노산 잔기(예: 하나 이상의 세린 잔기)로 치환될 수 있다. 변화된 면역글로불린 힌지 영역은 대안적으로 또는 추가적으로 또 다른 아미노산 잔기(예: 세린 잔기)로 치환된 야생형 면역글로불린 힌지 영역의 프롤린 잔기를 가질 수 있다. 힌지 도메인은 CD8, CD4, CD28 및 CD7 등의 유형 1 막단백질의 세포외 영역으로부터 유래하는 힌지 영역을 포함하고, 이는 이들 분자로부터의 야생형 힌지 영역일 수 있거나 변화될 수 있다.
본 발명에 있어서, 상기 힌지 도메인을 포함하는 막횡단 도메인은 상기 세포외 도메인과 세포내 도메인을 세포막 사이로 연결 가능하다면 어떠한 것이든 사용 가능하다. 바람직하게는 CD8로부터 유래된 힌지 도메인 및 막횡단 도메인으로 이루어질 수 있지만, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 키메라 항원 수용체는 세포내 신호전달 도메인(intracellular signaling domain)을 포함하는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 세포내 신호전달 도메인은 T-세포 수용체(TCR) 제타(ζ), FcR 감마(γ), FcR 베타(β), CD3 감마(γ), CD3 델타(δ), CD3 엡실론(ε), CD3 제타(ζ), CD5, CD22, CD79a, CD79b 및 CD66d로 구성된 군에서 선택되는 1차 신호전달 도메인(primary signaling domain); 및/또는 CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB(CD137), OX40(CD134), CDS, ICAM-1, ICOS(CD278), LFA-1(CD11a/CD18), GITR, MyD88, DAP1, PD-1, LIGHT, NKG2C, B7-H3 및 CD83과 특이적으로 결합하는 리간드로 구성된 군에서 선택되는 공자극 신호전달 도메인(co-stimulatory signaling domain)을 포함하는 것을 특징으로 할 수 있다.
본 발명의 용어 "세포내 신호전달 도메인(intracellular signaling domain)"이란, 작동 세포 기능, 예를 들면, CAR-결합된 표적 세포에 대한 세포독성 인자의 방출을 포함하는 활성화, 사이토카인 생성, 증식 및 세포독성 활성, 또는 CAR의 세포외 결합 도메인에 대한 항원 결합으로 유발된 기타 세포 반응을 유발하기 위해 면역 작동 세포의 내부로 표적 항원에 대한 효과적 CAR 결합의 메시지의 전달에 관여하는 CAR의 부분을 의미하는 것이다. 작동 기능은 세포의 특수한 기능을 지칭하며, 예를 들면, T 세포의 작동 기능은 세포용해 활성일 수 있거나, 사이토카인의 분비를 포함하는 활성을 지원할 수 있거나 활성일 수 있다. 따라서, 세포내 신호전달 도메인은 작동 기능 신호를 전달하고 세포가 특수한 기능을 수행하도록 지시하는 단백질의 일부를 의미한다.
T 세포 수용체 단독으로 생성된 신호는 T 세포를 충분하게 활성화할 수 없다고 알려졌기에 공자극 신호가 추가로 요구되는 것으로 공지되어 있다. 따라서, T 세포 활성화는 세포내 신호전달 도메인의 2개 상이한 부류에 의해 매개된다. 예를 들면, T 세포 수용체를 통한 항원-의존성 일차 활성화를 개시하는 1차 신호전달 도메인 및 2차 신호를 제공하기 위해 항원-독립적 방식으로 작용하는 공자극 신호전달 도메인에 의해 T 세포 활성화가 매개된다. 따라서, 상기 세포내 신호전달 도메인은 "1차 신호전달 도메인(primary signaling domain)" 및 "공자극 신호전달 도메인(co-stimulatory signaling domain)"을 포함하는 것을 특징으로 할 수 있다.
본 발명의 용어 "1차 신호전달 도메인(primary signaling domain)"이란, T 세포 수용체 복합체의 1차 활성화를 자극 또는 억제 방식으로 조절하는 신호전달 도메인을 의미하는 것이다. 자극 방식으로 작용하는 1차 신호전달 도메인은 면역수용체 티로신-기반 활성화 모티브 또는 ITAM으로 공지되어 있는 신호전달 모티브를 함유할 수 있다. 1차 신호전달 도메인을 함유하는 ITAM은 TCRζ, FcRγ, FcRβ, CD3γ, CD3δ, CD3ε, CD3ζ, CD5, CD22, CD79a, CD79b 및 CD66d로 구성된 군에서 선택될 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 1차 신호전달 도메인은 CD3 제타(ζ)일 수 있고, 바람직한 일 예로, 서열번호 9로 표시되는 아미노산 서열을 포함하는 CD3 제타(ζ)일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 용어 "공자극 신호전달 도메인(co-stimulatory signaling domain)"이란, 공자극 분자의 세포내 신호전달 도메인을 의미한다. 공자극 분자는 항원 수용체 또는 항원에 결합 시 T 림프구의 효율적 활성화 및 기능에 요구되는 2차 신호를 제공하는 Fc 수용체 이외의 세포 표면 분자이다. 본 발명에 있어서, 상기 공자극 신호전달 도메인은 OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1(CD11a/CD18), ICOS(CD278), CD7, CD30, CD40, PD-1, LIGHT, NKG2C, B7-H3, CD83 및 4-1BB(CD137)로 구성된 군에서 선택되는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 일 실시예에서는 공자극 신호전달 도메인으로서 4-1BB를 이용하였으며, 4-1BB에 면역학적 효능을 증가시키기 위하여 CAR-T에서 사용하는 4-1BB cytoplasmic domain에 5개의 아미노산을 추가한 eu4-1BB(서열번호 7)를 보조자극 신호인자로 하여 CAR 발현 벡터를 새롭게 구축하였다.
본 발명에 있어서, 공자극 신호 전달 도메인으로 CAR-T에서 사용하는 4-1BB cytoplasmic domain에 5개의 아미노산을 추가한 eu4-1BB(서열번호 7)와 1차 신호전달 도메인으로 CD3 제타(ζ)(서열번호 9) 를 이용할 수 있으며, 이러한 2가지 도메인을 합쳐서 'euBBz' 로 정의하였다.
본 발명에 따른 키메라 항원 수용체는 2개 이상의 세포내 신호전달 도메인을 포함할 수 있고, 2개 이상의 세포내 신호전달 도메인을 포함하는 경우에는 세포내 신호전달 도메인들이 서로 직렬로 연결될 수 있다. 또는 2~10 아미노산으로 이루어지는 올리고펩타이드 링커 또는 폴리펩타이드 링커를 통해 연결되어 있을 수도 있고, 이러한 링커 서열의 예로서 글리신-세린 연속 서열을 들 수 있다.
본 발명에 따른 키메라 항원 수용체를 코딩하는 핵산은 신호 펩타이드(signal peptide)를 코딩하는 핵산을 더 포함할 수 있다. 상기 신호 펩타이드(signal peptide)는 세포외 결합 도메인 앞에 위치할 수 있다.
상기 신호 펩타이드(signal peptide)는 일 예로, GM-CSF, 또는 CD8α와 같은 신호 펩타이드(signal peptide) 등이 사용될 수 있으나, 이에 제한되는 것은 아니다. 본 발명의 실시예에서는 CD8α를 신호 펩타이드(signal peptide)로 사용하였다.
본 발명에 있어서, 상기 키메라 항원 수용체를 코딩하는 핵산은 절단된 GAPDH(glyceraldehyde 3-phosphate dehydrogenase)를 코딩하는 핵산을 더 포함할 수 있다. 상기 절단된 GAPDH를 코딩하는 핵산은 서열번호 11로 표시되는 폴리펩티드를 코딩하는 핵산 서열로 이루어지거나, 이를 포함하는 핵산 서열일 수 있으며, 바람직하게는 540bp 크기로 절단된 서열번호 11로 이루어진 절단된 GAPDH(glyceraldehyde 3-phosphate dehydrogenase)를 코딩하는 핵산일 수 있다. 상기 540bp 크기로 절단된 GAPDH(glyceraldehyde 3-phosphate dehydrogenase)를 코딩하는 핵산은 본 발명에서 gapdh540 또는 g540으로 지칭될 수 있다. 상기 540bp 크기로 절단된 핵산에 의해서 코딩되는 폴리펩티드는 서열번호 11로 표시되는 폴리펩티드 서열을 포함, 갖거나 이로 이루어진 것 일 수 있다. 상기 540bp 크기로 절단된, GAPDH를 코딩하는 핵산은 서열번호 11로 표시되는 폴리펩티드를 코딩하는 것으로, 일 예로 서열번호 10 또는 NCBI Reference Sequence; NM_002046.7의 핵산 서열을 가지거나 이로 이루어진 것 일 수 있다. 상기 서열번호 10 은 540bp 의 GAPDH를 코딩하는 핵산에 stop codon 3bp 를 포함한다.
본 발명의 절단된 GAPDH(glyceraldehyde 3-phosphate dehydrogenase)를 코딩하는 핵산을 더 포함하는 CAR-T (MVR-g540) 는 절단된 GAPDH를 포함하지 않는 MVR 과 비교하여, T 세포 활성화시 발현되는 HLA-DR과 CAR-T 세포가 결합하면서 발생하는 Fratricide 을 감소시키고, 이를 통해 세포 생존율을 현저하게 증가시키면서 MVR 과 동등한 정도의 효과를 나타낼 수 있다. 즉, 본 발명의 MVR-g540은 CAR-T의 효과는 유지하면서 세포 생존율을 증가시키는 효과를 나타낼 수 있다.
본 발명에 있어서, 상기 핵산은 인터루킨 18(IL-18)을 코딩하는 핵산을 더 포함할 수 있다. 일 예로, 상기 인터루킨 18은 서열번호 16의 아미노산 서열을 포함하거나, 이로이루어진 것 일 수 있고, 이를 코딩하는 핵산은 서열번호 15의 핵산 서열을 포함하거나, 이로 이루어진 것 일 수 있다.
상기 인터루킨 18을 코딩하는 핵산은 분비 신호 서열(secretion signal sequence)을 추가로 포함하는 것을 특징으로 할 수 있다. 상기 분비 신호 서열은 IL-2 분비 신호 서열인 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다. 일 예로 상기 IL-2 분비 신호 서열은 서열번호 14로 나타내는 폴리펩티드 서열일 수 있다.
본 발명에 있어서, 상기 인터루킨 18을 코딩하는 핵산은 결합부위(binding site) 와 작동 가능하게 연결된 것일 수 있다.
바람직하게는, 상기 결합부위는 NFAT(nuclear factor of activated T cells) 결합부위를 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
일 예로, 상기 NFAT 결합부위는 서열번호 12로 표시되는 핵산 서열을 포함하거나 이로 이루어진 것 일 수 있다.
본 발명에 따른 핵산(폴리뉴클레오타이드)은 코돈 최적화에 의해 변형될 수 있으며, 이는 코돈의 축퇴성(degeneracy)에서 기인한 것으로, 폴리펩타이드 또는 이의 변이체 단편을 코딩하는 많은 뉴클레오타이드 서열이 존재한다는 것은 통상의 기술자가 잘 이해할 수 있을 것이다. 이들 폴리뉴클레오타이드의 일부는 임의의 자연 발생형 유전자의 뉴클레오타이드 서열과 최소 상동성을 보유한다.
특히 코돈 활용법의 차이로 인해 가변적인 폴리뉴클레오타이드, 예를 들어 인간, 영장류 및/또는 포유동물의 코돈 선택에 최적화된 폴리뉴클레오타이드가 바람직하다.
본 발명은 다른 관점에서, 상기 키메라 항원 수용체; 및 절단된 GAPDH(glyceraldehyde 3-phosphate dehydrogenase) 및/또는 인터루킨 18을 코딩하는 핵산을 포함하는 벡터에 관한 것이다. 본 발명의 용어 "벡터"란, 다른 핵산 분자를 전이시키거나 수송할 수 있는 핵산 분자를 의미하는 것이다. 전이된 핵산은 일반적으로 벡터 핵산 분자에 연결되는데, 예를 들면, 벡터 핵산 분자 내에 삽입된다. 벡터는 세포에서의 자율적 복제를 지시하는 서열을 포함할 수 있거나, 숙주 세포 DNA 내로의 통합을 가능하게 하는데 충분한 서열을 포함할 수 있다. 상기 벡터는 DNA, RNA, 플라스미드, 렌티바이러스 벡터, 아데노바이러스 벡터 및 레트로바이러스 벡터로 구성된 군에서 선택되는 것을 특징으로 할 수 있다. 이에 제한되는 것은 아니나, 바람직하게는 렌티바이러스 벡터인 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 핵산 또는 상기 벡터는 바이러스 생산세포(packaging cell line)에 형질주입 또는 형질전환 (transfection)된다. "형질주입" 또는 "형질전환"시키기 위해 원핵 또는 진핵 숙주세포 내로 외인성 핵산(DNA 또는 RNA)을 도입하는 데에 통상 사용되는 여러 종류의 다양한 기술, 예를 들어 전기 영동법, 인산칼슘 침전법, DEAE-덱스트란 트랜스펙션 또는 리포펙션(lipofection) 등을 사용할 수 있다.
본 발명에 있어서, 바이러스 생산세포로부터 생산된 바이러스는 면역세포에 형질전환(transduction)된다. 세포내로 "형질전환"된 바이러스의 핵산은 세포의 게놈에 삽입되거나 혹은 삽입되지 않은 채로 본 발명의 키메라 항원 수용체 단백질을 생산하는 데 사용된다.
본 발명은 또 다른 관점에서, 상기 핵산 또는 상기 벡터를 포함하는 면역세포에 관한 것이다.
본 발명에 있어서, 상기 면역세포는 면역을 유도하여 목적하는 암 치료 효과를 유발할 수 있는 것으로, 예를 들어, T 세포, NK 세포, NKT 세포, 사이토카인 유도 살해세포(Cytokine Induced Killer cell, CIK), 대식세포 및 수지상세포로 구성된 군에서 선택될 수 있으나, 이에 제한되는 것은 아니다. 바람직하게는 T 세포인 것을 특징으로 할 수 있다.
따라서, 본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포는 CAR-T 세포(Chimeric Antigen Receptor T Cell), CAR-NK 세포(Chimeric Antigen Receptor Natural Killer Cell), CAR-NK T 세포(Chimeric Antigen Receptor Natural killer T Cell) 또는 CAR-대식세포(Chimeric Antigen Receptor Macrophage) 등일 수 있다.
본 발명에 있어서, 상기 T 세포는 CD4 양성 T 세포; CD8 양성 세포독성 T 림프구(Cytotoxic T lymphocyte; CTL); gamma-delta T 세포; 종양 침윤 림프구(Tumor infiltrating lymphocyte; TIL) 및 말초혈액 단핵세포(Peripheral blood mononuclear cell; PBMC)에서 분리한 T 세포로 구성된 군에서 선택되는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 면역세포는 HLA-DR를 특이적으로 인식하여 암세포를 사멸할 수 있고, HLA-DR이 과발현된 암세포만 선택적으로 사멸 가능하므로, 낮은 부작용을 가지면서도, CAR-T 세포 치료제로서 우수한 항암효과를 제공할 수 있다.
또한, 본 발명의 CAR와 IL-18을 코딩하는 핵산 또는 이를 포함하는 벡터를 포함하는 면역세포는 세포 외부에 위치한 CAR와 항원 HLA-DR이 접촉하면서 T 세포가 활성화할 때 특이적으로 IL-18을 분비하는 것을 특징으로 할 수 있다.
본 발명은 또 다른 관점에서, 상기 면역세포를 포함하는 암 예방 또는 치료용 약학 조성물에 관한 것이다.
본 발명은 또 다른 관점에서, 상기 면역세포를 대상체에 투여하는 단계를 포함하는 암 예방 또는 치료방법에 관한 것이다.
본 발명은 또 다른 관점에서, 암 예방 또는 치료를 위한 상기 면역세포의 용도에 관한 것이다.
본 발명은 또 다른 관점에서, 암 예방 또는 치료용 약제 제조를 위한 상기 면역세포의 용도에 관한 것이다.
상기 약학 조성물; 암 예방 또는 치료방법; 암 예방 치료를 위한 면역세포의 용도; 및 암 예방 또는 치료용 약제 제조를 위한 면역세포의 용도와 관련해서, 동일한 기재의 중복을 피하기 위해, 상기 핵산, 벡터 및 면역세포에 대한 설명을 그대로 준용할 수 있다.
상기 대상체는 종양을 가진 포유류일 수 있으며, 구체적으로는 인간일 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 용어, "예방"은 본 발명의 조성물의 투여로 암을 억제시키거나 진행을 지연시키는 모든 행위를 의미하며, "치료"는 암의 발전의 억제, 증상의 경감 또는 제거를 의미한다.
본 발명에 있어서, "암"과 "종양"은 동일한 의미로 사용되며, 전형적으로 조절되지 않은 세포 성장/증식을 특징으로 하는 포유동물의 생리학적 상태를 지칭하거나 의미한다.
본 발명의 CAR로 치료될 수 있는 암은 혈관 생성된 종양 뿐만 아니라 혈관이 생성되지 않거나 아직까지 실질적으로 혈관이 생성되지 않는 종양을 포함한다. 상기 암은 비-고형 종양(예를 들어, 혈액학적 종양, 예를 들어 백혈병 및 림프종)을 포함할 수 있거나, 고형 종양을 포함할 수 있다. 본 발명의 CAR로 치료될 수 있는 암의 유형으로는 암종, 아세포종, 및 육종, 및 특정 백혈병 또는 림프성 악성 종양, 양성 및 악성 종양, 예를 들어, 육종, 암종 및 흑색종을 들 수 있지만, 이에 제한되지 않는다. 성인성 종양/암 및 소아성 종양/암이 또한 포함된다.
혈액암은 혈액 또는 골수의 암이다. 혈액(또는 조혈성) 암의 예로는 급성 백혈병(예를 들어, 급성 림프구성 백혈병, 급성 골수성 백혈병 및 골수모세포성, 전림프구성, 골수 단구성, 단구성 및 적백혈병), 만성 백혈병(예를 들어, 만성 림프구성(과립구성) 백혈병, 만성 골수성 백혈병, 및 만성 림프구성 백혈병), 진성 적혈구 증가증, 림프종, 호지킨병, 비-호지킨 림프종(지연형 및 높은 단계의 형태), 다발성 골수종, 왈덴스트룀 마크로글로불린 혈증(Waldenstrom's macroglobulinemia), 중쇄 질병, 골수이형성 증후군, 모발 세포 백혈병 및 골수이형성증를 포함한 백혈병을 들 수 있다.
고형 종양(고형암)은 일반적으로 피낭 또는 액체 구역을 포함하지 않는 비정상적인 조직 덩어리이다. 고형 종양은 양성 또는 악성일 수 있다. 상이한 유형의 고형 종양은 이들(예를 들어, 육종, 암종 및 림프종)을 형성하는 세포의 유형에 대해 명명되어 있다. 육종 및 암종과 같은 고형 종양의 예로는 섬유육종, 점액육종, 지방육종, 연골육종, 골육종, 및 기타 육종, 윤활막종(synovioma), 중피종(mesothelioma), 유위(Ewing) 종양, 평할근육종, 횡문근육종, 직장 암종, 림프성 악성 종양, 대장암, 위암, 췌장암, 유방암, 폐암, 난소암, 전립선암, 인후두암, 간세포성 암종, 편평 세포 암종, 기저 세포 암종, 선암, 땀샘 암종, 수질 갑상선 암종, 유두성 갑상선 암종, 갈색 세포종, 피지선 암종, 유두성 암종, 유두성 선암, 수질성 암종, 기관지 암종, 신장 세포 암종, 간종양, 담관 암종, 융모막암종, 윌름즈 종양(Wilms' tumor), 자궁 경부암, 고환 종양, 정상피종(seminoma), 방광암, 흑색종, 및 CNS 종양(예를 들어, 신경교종(예를 들어,뇌간 신경교종 및 혼합형 신경교종), 교아세포종(다형성 교아세포종으로도 공지됨), 성상세포종, CNS 림프종, 배아세포종, 수질아세포종, 신경초종 두개인두종(Schwannoma craniopharyogioma), 상의세포종(ependymoma), 송과체종(pinealoma), 혈관모세포종, 청신경종(acoustic neuroma), 희소돌기 아교세포종(oligodendroglioma), 수막종, 신경아세포종, 망막아세포종 및 뇌전이)을 들 수 있다.
바람직하게는, 상기 암은 식도선암, 대장암, 흑색종양, 안구흑색종, 소세포폐암, 신경모세포종, 기형암종, 태생기암, 편평상피암, 머리 및 목 편평 세포 암종, 흉선종, 림프모구백혈병, B세포림프종, 비만성거대B세포림프종, 백혈병 및 급성골수성백혈병으로 구성된 군에서 선택되는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 조성물은 약학적으로 허용 가능한 담체를 추가로 포함할 수 있다.
본 발명에서 용어, "약학적으로 허용 가능한 담체"란 생물체를 자극하지 않고 투여 화합물의 생물학적 활성 및 특성을 저해하지 않는 담체 또는 희석제를 말한다. 액상 용액으로 제제화되는 조성물에 있어서 약학적으로 허용가능한 담체로는, 멸균 및 생체에 적합한 것으로서, 식염수, 멸균수, 완충식염수, 알부민 주사용액, 덱스트로즈 용액, 말토덱스트린 용액, 글리세롤 및 이들 성분 중 1 성분 이상을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주사용 제형, 환약, 캡슐, 과립 또는 정제로 제제화할 수 있다.
본 발명의 상기 약학 조성물은 경구 또는 비경구의 여러 가지 제형일 수 있다. 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다. 경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 하나 이상의 화합물에 적어도 하나 이상의 부형제 예를 들면, 전분, 탄산칼슘, 수크로오스(sucrose) 또는 락토오스(lactose), 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 스테아린산 마그네슘, 탈크 등과 같은 윤활제들도 사용된다. 경구투여를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수성용제, 현탁용제로는 프로필렌글리콜(propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테로 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로젤라틴 등이 사용될 수 있다.
이러한 약학적으로 허용가능한 담체 및 제제는 Remington's Pharmaceutical Sciences에 상세히 기재되어 있다.
본 발명의 조성물은 경구 또는 비경구로 투여할 수 있고, 비경구 투여인 경우에는 주입(infusion), 정맥내 투여(intravenous injection), 피하 투여(subcutaneous injection), 근육내 투여(intramuscular injection), 복강내 투여(intraperitoneal injection), 내피 투여, 국소 투여(topical administration), 비내 투여(intranasal injection), 폐내 투여 및 직장내 투여(Intrarectal administration) 등으로 투여할 수 있으나, 이에 한정되는 것은 아니다. 경구 투여시, 단백질 또는 펩타이드는 소화가 되기 때문에 경구용 조성물은 활성 약제를 코팅하거나 위에서의 분해로부터 보호되도록 제형화 될 수 있으며, 본 발명의 조성물은 활성 물질이 표적 세포로 이동할 수 있는 임의의 장치에 의해 투여될 수 있다.
본 발명의 암 예방 또는 치료용 조성물의 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다.
본 발명의 조성물은 개별 치료제로 투여하거나 암 증상을 예방, 개선 또는 치료하는 효과를 가지는 공지의 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로서, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예 1: Lentiviral transfer plasmid 제작
실시예 1-1: MVR CAR를 위한 렌티바이러스 전달 플라스미드 종류
본 발명에 따른 CAR 제작을 위한 렌티바이러스 전달 벡터의 구조는 하기 표 1에 나타내었다.
렌티바이러스 전달 벡터
Name scFv 세포 내 도메인
선별 마커
전달 벡터 종류
Truncated MVR MVR None Flag pELPS4
MVR MVR euBBz Flag pELPS4
MVR-g540 MVR euBBz-g540 Flag pELPS4
MVR-g540-NFAT-IL-18 MVR euBBz-g540-NFAT-IL-18 Flag pELPS4
실시예 1-2: 유전자 합성
MVR CAR-T의 세포 내 도메인에 540bp 크기로 자른 Glyceraldehyde 3-phosphate dehydrogenase(GAPDH, NCBI Reference Sequence; NM_002046.7) (본 명세서에서, "gapdh540" 또는 "g540"으로 약칭)을 추가하여 (주) IDT에 유전자 합성을 의뢰하였다. MVR scFv 유전자 서열 및 세포 내 도메인을 포함한 CAR 구조의 유전자 서열 정보는 하기 표 2에 나타내었다(도 1).
Name Sequence 서열
번호
MVR scFv Nucleotide GATATTCAGATGACCCAGTCCCCGAGCTCCCTGTCCGCCTCTGTGGGCGATAGGGTCACCATCACCTGCAAGGCCAGTGACCACATCAACAACTGGCTGGCCTGGTATCAACAGAAACCAGGAAAAGCTCCGAAACTACTGATCAGCGGCGCCACCTCTCTGGAAACCGGAGTCCCTTCTCGCTTCTCTGGTTCCGGATCTGGGAAGGATTACACTCTGACCATCAGCAGTCTGCAGCCGGAAGACTTCGCAACTTATTACTGTCAGCAGTACTGGTCCACCCCCTTCACCTTCGGACAGGGTACCAAGGTGGAGATCAAAGGCGGAGGCGGATCTGGCGGCGGAGGAAGTGGCGGAGGGGGATCTCAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCACTGTCTCTGGTTTCTCCCTGAGTCGGTACTCTGTGCATTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGCTGGGGATGATCTGGGGAGGCGGCAGCACCGACTACAACAGCGCCCTGAAGTCCCGACTGACCATATCAAAGGACAACTCCAAGAACCAGGTGTCCTTGAAGCTGAGCTCTGTGACCGCTGCGGACACGGCCGTGTATTACTGTGCGAGAAATGAGGGCGATACCACCGCCGGCACTTGGTTTGCCTATTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA 1
Amino acid DIQMTQSPSSLSASVGDRVTITCKASDHINNWLAWYQQKPGKAPKLLISGATSLETGVPSRFSGSGSGKDYTLTISSLQPEDFATYYCQQYWSTPFTFGQGTKVEIKGGGGSGGGGSGGGGSQVQLQESGPGLVKPSETLSLTCTVSGFSLSRYSVHWIRQPPGKGLEWLGMIWGGGSTDYNSALKSRLTISKDNSKNQVSLKLSSVTAADTAVYYCARNEGDTTAGTWFAYWGQGTLVTVSS 2
Heavy chain variable region(VH) QVQLQESGPGLVKPSETLSLTCTVSGFSLSRYSVHWIRQPPGKGLEWLGMIWGGGSTDYNSALKSRLTISKDNSKNQVSLKLSSVTAADTAVYYCARNEGDTTAGTWFAYWGQGTLVTVSS 3
Light chain variable region(VL) DIQMTQSPSSLSASVGDRVTITCKASDHINNWLAWYQQKPGKAPKLLISGATSLETGVPSRFSGSGSGKDYTLTISSLQPEDFATYYCQQYWSTPFTFGQGTKVEIK 4
Linker GGGGSGGGGSGGGGS 5
eu4-1BB
(5개 Amino Acids
+4-1BB)		 Nucleotide CGTTTCTCTGTTGTTAAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTG 6
Amino acid RFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL 7
CD3z(ζ) Nucleotide AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC 8
Amino acid RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 9
gapdh540 Nucleotide ATGGGGAAGGTGAAGGTCGGAGTCAACGGATTTGGTCGTATTGGGCGCCTGGTCACCAGGGCTGCTTTTAACTCTGGTAAAGTGGATATTGTTGCCATCAATGACCCCTTCATTGACCTCAACTACATGGTTTACATGTTCCAATATGATTCCACCCATGGCAAATTCCATGGCACCGTCAAGGCTGAGAACGGGAAGCTTGTCATCAATGGAAATCCCATCACCATCTTCCAGGAGCGAGATCCCTCCAAAATCAAGTGGGGCGATGCTGGCGCTGAGTACGTCGTGGAGTCCACTGGCGTCTTCACCACCATGGAGAAGGCTGGGGCTCATTTGCAGGGGGGAGCCAAAAGGGTCATCATCTCTGCCCCCTCTGCTGATGCCCCCATGTTCGTCATGGGTGTGAACCATGAGAAGTATGACAACAGCCTCAAGATCATCAGCAATGCCTCCTGCACCACCAACTGCTTAGCACCCCTGGCCAAGGTCATCCATGACAACTTTGGTATCGTGGAAGGACTCATGACCACAGTCCATGCCTAA 10
Amino acid MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA 11
NFAT Nucleotide ACGCCTTCTGTATGAAACAGTTTTTCCTCCACGCCTTCTGTATGAAACAGTTTTTCCTCCACGCCTTCTGTATGAAACAGTTTTTCCTCCACGCCTTCTGTATGAAACAGTTTTTCCTCCACGCCTTCTGTATGAAACAGTTTTTCCTCCACGCCTTCTGTATGAAACAGTTTTTCCTCCTCGAGGACATTTTGACACCCCCATAATATTTTTCCAGAATTAACAGTATAAATTGCATCTCTTGTTCAAGAGTTCCCTATCACTCTCTTTAATCACTACTCACAGTAACCTCAACTCCTGC 12
IL-2 SS
(secretion signal sequence) 		Nucleotide ATGTACAGGATGCAACTCCTGTCTTGCATTGCACTAAGTCTTGCACTTGTCACAAACAGT 13
Amino acid MYRMQLLSCIALSLALVTNS 14
IL-18 Nucleotide TACTTTGGCAAGCTTGAATCTAAATTATCAGTCATAAGAAATTTGAATGACCAAGTTCTCTTCATTGACCAAGGAAATCGGCCTCTATTTGAAGATATGACTGATTCTGACTGTAGAGATAATGCACCCCGGACCATATTTATTATAAGTATGTATAAAGATAGCCAGCCTAGAGGTATGGCTGTAACTATCTCTGTGAAGTGTGAGAAAATTTCAACTCTCTCCTGTGAGAACAAAATTATTTCCTTTAAGGAAATGAATCCTCCTGATAACATCAAGGATACAAAAAGTGACATCATATTCTTTCAGAGAAGTGTCCCAGGACATGATAATAAGATGCAATTTGAATCTTCATCATACGAAGGATACTTTCTAGCTTGTGAAAAAGAGAGAGACCTTTTTAAACTCATTTTGAAAAAAGAGGATGAATTGGGGGATAGATCTATAATGTTCACTGTTCAAAACGAAGACTAG 15
Amino acid YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED 16
실시예 1-3: 컴피턴트 세포(Competent cell)인 Stbl III를 이용한 클로닝(Cloning)
pELPS4-MVR-euBBz의 CAR 구조체(construct) 내부에 있는 제한효소인 EcoRV, SalI을 이용하여 벡터를 선형화(linearization)하였다. 합성한 삽입 유전자(Insert gene) 역시 동일한 제한효소 처리 후 벡터와 결찰(ligation)하였다.
실시예 1-4: 클로닝(Cloning) 결과
클로닝한 pELPS4-MVR-euBBz-g540 플라스미드의 구조 분석을 위해 플라스미드를 확인할 수 있는 적정 효소(Enzyme)을 선정하였다(도 2).
실시예 1-5: IL-18 발현 MVR CAR-T 제작을 위한 렌티바이러스 전달 플라스미드(Lentiviral transfer plasmid) 클로닝
(1) 유전자 합성
활성화된 T 세포에서만 IL-18 발현을 유도하기 위해 활성화된 T 세포 핵인자(NFAT)결합부위-IL-2 최소 프로모터 (Nuclear Factor of activated T cells(NFAT)-IL-2 minimal promoter)를 도입하여 IL-18을 조절하고자 하였다. NFAT 결합부위는 pGL3-NFAT 루시퍼레이즈(luciferase; snapgene, Nature. 1992 Jun 25. 357(6380):695-7)에 있는 서열을 이용하였으며, 6개의 NFAT 결합 부위를 사용하였다. NFAT-IL-18 유전자 서열 정보는 상기 표 2에 나타내었다.
(2) 인퓨전 클로닝(Infusion cloning)
pELPS4-MVR-euBBz의 CAR 구조체(construct) 내부에 있는 제한효소인 SalI을 이용하여 벡터를 선형화(linearization)시킨 후 증폭한 NFAT-IL-18 PCR 산물(product)을 삽입하고자 스텔라 컴피턴트 세포(Stellar CompetenT 세포(Clontech)에서 인퓨전 클로닝(infusion cloning)을 진행하였다.
(3) 클로닝(Cloning) 결과
클로닝한 pELPS4-MVR-euBBz-g540-NFAT-IL-18 플라스미드의 구조 분석을 위해 플라스미드를 확인할 수 있는 적정 효소(Enzyme)를 선정하였으며(도 3), 플라스미드에 대한 서열분석(Sequencing)을 진행하였다(Macrogen). 서열분석(Sequencing) 결과, 제작한 플라스미드의 염기서열에 문제가 없음을 확인하였다.
실시예 2: 렌티바이러스 생산 및 역가 측정
렌티바이러스 플라스미드(Lentiviral plasmid)를 이용하여 생산한 MVR CAR 바이러스에 대한 역가 측정 결과는 하기 표 3에 나타내었다.
Name scFv 세포 내 도메인
역가 측정 결과 (단위 TU/mL)
제조일 역가
truncated MVR MVR None 20190916 2.21 x 109
MVR-g540 MVR euBBz-g540 20200114
20200713		 3.96 x 108
3.27 x 108
MVR-g540-NFAT-IL-18 MVR euBBz-g540-NFAT-IL-18 20200525 1.85 x 108
실시예 3: MVR, MVR-g540 CAR-T의 In vitro 분석
실시예 3-1: T 세포 분리(isolation)
PBMCs를 CD4, CD8 마이크로비드(MicroBeads)와 인큐베이션(incubation) 진행하고, 자석(Magnetic)을 이용하여 CD4+, CD8+ T 세포를 분리하였다.
실시예 3-2: T 세포 활성화(activation)
1L OpTmizer™ T-Cell 확장 기본 배지(T-Cell Expansion Basal Medium), 25mL OpTmizer™ T-Cell 확장 보충성분(T-Cell Expansion Supplement), 50mL CTS쪠 Immune Cell SR, 10mL Pen-Strep(10,000 U/mL), 10mL CTS쪠 GlutaMAX™-I 보충성분(Supplement)을 섞어 배양액을 만들었다. 분리된 CD4+, CD8+ T 세포를 세포농도(1x106 cells/mL)로 하고 IL-2(400 IU/mL)로 하여 5% CO2, 37℃ 인큐베이터(incubator)에서 배양하였다.
실시예 3-3: 활성화된 T 세포 형질전환(Activated T cell transduction)
활성화된 T 세포에 렌티바이러스로 형질전환(Transduction)을 진행하고, 세포성장을 2일부터 9일까지 측정하였다. 9일에 세포들을 수집하여 in vitro 실험에 사용하였다.
실시예 3-4: In vitro 배양 및 분석
MVR, MVR-g540 CAR-T를 9일동안 세포배양하면서 확장(Fold expansion)을 비교하였다(도 4A 및 도 4B).
2일부터 9일까지 세포생존율을 비교하였다. 7일부터 Untd와 절단된 MVR(Truncated MVR)은 90% 이상의 세포생존율을 나타냈다. MVR CAR-T는 배양 7일에는 66.8%, 배양 9일에는 68.7%의 세포생존율을 나타냈다. MVR-g540 CAR-T는 배양 7일에는 79.7%, 배양 9일에는 79.6%의 세포생존율을 나타냈다(도 5).
도 5 를 통해, MVR-g540 CAR-T가 MVR CAR-T 세포 생존율인 69% 대비 약 10% 이상 세포 생존율 증가를 나타냄을 확인하였다. 이러한 결과는 T 세포 활성화시 발현되는 HLA-DR 과 CAR-T 세포의 결합에 의해 세포 생존율이 낮아지게 되는 Fratricide 현상을, g540 서열에 의해 CAR 발현 패턴의 변화가 유도된 MVR-g540 CAR-T 가 개선할 수 있음을 보여주는 결과이다.
유세포 분석기(Flow cytometer)로 배양 9일에 CAR 발현(CAR expression), T 세포 비율, 세포 군(Cell population)을 확인한 결과, MVR과 MVR-g540 CAR-T의 유의미한 차이는 없었다(도 6).
실시예 3-5: In vitro 킬링 분석(killing assay)
HLA-DR이 발현하고 있는 LCL(B-Lymphoblastoid Cell Line)을 표적 세포(Target cell)로 사용하고 CAR-T 세포를 이펙터 세포(Effector cell)로 사용하여 루시페라아제 기반 세포 독성 검사(Luciferase based cytotoxicity assay)를 진행하였다. 세포는 E:T(effector (E): target(T))의 비율에 따라 96-well 흰색 폴리스티렌 마이크로플레이트(white polystyrene microplate)에서 공배양(coculture)을 진행하고, 루시페라아제 분석 시약(Bright-GloTM)을 넣고 5분간 반응시킨 후, 광도계(Luminometer)를 이용하여 형광을 측정하였다. 음성대조군인 Untd, 절단된 MVR(truncated MVR)과 양성대조군인 MVR, MVR-g540 CAR-T에서는 큰 차이를 볼 수 있었으나, MVR과 MVR-g540 CAR-T에서는 큰 차이는 볼 수 없었다(도 7).
실시예 4: MVR-g540, MVR-g540-NFAT-IL-18 CAR-T의 In vitro 분석
실시예 4-1: T 세포 분리(isolation)
PBMCs를 CD4, CD8 마이크로비드(MicroBeads)와 인큐베이션하고, 자석(Magnetic)을 이용하여 CD4+, CD8+ T 세포를 분리하였다.
실시예 4-2: T 세포 활성화(activation)
1L OpTmizer™ T-Cell 확장 기본 배지(T-Cell Expansion Basal Medium), 25mL OpTmizer™ T-Cell 확장 보충성분(T-Cell Expansion Supplement), 50mL CTS™ Immune Cell SR, 10mL 10 mL Pen-Strep(10,000 U/mL), 10mL CTS™ GlutaMAX™-I 보충성분(Supplement)을 섞어 배양액을 만들었다. 분리된 CD4+, CD8+ T 세포를 세포농도(1 x 106 cells/mL)로 하고, IL-2(400 IU/mL)로 하여 5% CO2, 37℃ 인큐베이터(incubator)에서 배양하였다.
실시예 4-3: 활성화된 T 세포로의 형질전환(Activated T cell transduction)
활성화된 T 세포를 렌티바이러스(Lenti-virus)로 형질전환(Transduction)하고, 세포성장을 2일부터 9일까지 측정하였다. 9일에 세포들을 수집하여 in vitro 실험에 사용하였다.
실시예 4-4: In vitro 배양 및 분석
MVR-g540, MVR-g540-NFAT-IL-18 CAR-T를 9일동안 세포배양하면서 확장(Fold expansion)을 비교하였다(도 8).
2일부터 9일까지 세포생존율을 비교하였다. 7일부터 Untd와 절단된 MVR(Truncated MVR)은 90% 이상의 세포생존율을 나타냈고, MVR-g540 CAR-T와 MVR-g540-NFAT-IL-18 CAR-T는 약 80% 이상의 세포생존율을 보였다(도 9).
유세포 분석기(Flow cytometer)로 배양 7일, 9일에 CAR 발현(CAR expression), T 세포 비율, 세포 표현형(Cell phenotype)을 확인한 결과, MVR-g540과 MVR-g540-NFAT-IL-18 CAR-T의 유의미한 차이는 없었다(도 10A 및 도 10B).
실시예 4-5: In vitro 킬링 분석(killing assay)
HLA-DR이 발현하고 있는 Daudi, NALM6 세포를 표적 세포(Target cell)로 사용하고, CAR-T 세포를 이펙터 세포(Effector cell)로 사용하여 루시페라아제 기반 세포 독성 검사(Luciferase based cytotoxicity assay)를 진행하였다. 세포는 E:T(effector (E): target(T))의 비율에 따라 96-well 흰색 폴리스티렌 마이크로플레이트(white polystyrene microplate)에서 공배양(coculture)을 진행하고, 루시페라아제 분석 시약(Bright-GloTM)을 넣고 5분간 반응시킨 후, 광도계(Luminometer)를 이용하여 형광을 측정하였다. 음성대조군인 절단된 MVR(truncated MVR)과 MVR-g540, MVR-g540-NFAT-IL-18 CAR-T 사이의 큰 차이를 볼 수 있었으나, MVR-g540과 MVR-g540-NFAT-IL-18 CAR-T에서 큰 차이는 볼 수 없었다(도 11A 및 도 11B).
실시예 5: MVR, MVR-g540 CAR-T의 In vivo 분석
실시예 5-1: 세포 배양
동물모델을 이용하여 MVR CAR-T와 MVR-g540 CAR-T의 효력을 확인하기 위해 LCL-Luc(B-Lymphoblastoid Cell Line)을 이용하여 동물 모델을 제작하였다. LCL-Luc 세포주를 2-3일에 한 번씩 계대배양하면서, 37℃, CO2 인큐베이터(incubator)에서 배양하였다.
실시예 5-2: 동물 투여용 세포 준비
배양이 완료된 절단된 MVR CAR-T(truncated MVR CAR-T), MVR CAR-T, MVR-g540 CAR-T를 전달받은 후, 투여용 세포를 준비하였다. 175T 플라스크에 배양 중인 MVR CAR-T 세포 현탁액을 50mL 튜브에 옮겨 담은 후, 원심분리기를 이용하여 1500rpm에서 5분동안 원심분리하였다. 상층액을 제거한 후, 5% 알부민이 포함된 생리식염수(5% Human Serum Albumin, 5% HSA) 3mL에 현탁시켰다. 현탁액 일부를 20배 희석하고 세포 계수를 위해 염색 용액 2μL와 희석된 세포 현탁액 18μL를 섞은 후, LUNA-FL 자동 형광 세포 계수기(Automated Fluorescence cell counter)를 이용하여 세포수를 측정하였다. 측정 후, MVR CAR-T를 CAR 양성 세포(CAR positive cell) 0.5 x 106 cells/100μL, 및 1 x 106 cells/100μL 농도로 각각 600μL씩 준비한다.
실시예 5-3: 동물실험
6-8 주령 NSG 마우스에 LCL-Luc 4 x 106 cells/200μL를 피하주사를 통해 종양 유도한 후, 14일 뒤 암이 성장하면 평균 80mm3 크기로 분류하였다. 5마리씩 6개 그룹으로 나눈 후, 음성 대조군 그룹에는 5% HSA을, CAR-T 투여 그룹에는 각각의 MVR CAR-T를 꼬리의 정맥으로 투여하였다. 일주일에 2회씩 TM900을 이용하여 암 크기를 측정하여 암 성장을 확인하였다(표 4).
Figure PCTKR2022005485-appb-img-000001
실시예 5-4: 채혈 및 FACS 분석
일주일에 1회씩 안와채혈을 통해 120μL씩 채혈한 후, 12,000rpm에서 10분동안 원심분리하였다. 원심분리 후 상층액 55μL를 분리하여 -20℃에 보관하였다. 여기에 1X DPBS(Dulbecco's Phosphate-Buffered Saline) 50μL를 넣고 섞은 후, FACS 튜브에 혈액 100μL를 넣어준다. 먼저 생존/사멸 세포(Live/Dead cell) 구분을 위해 Zombie NIR™ Fixable Viability Kit, APC/H7를 0.1μL/tube/100μL의 농도로 제작한 후, 혈액이 담겨 있는 튜브에 넣고 상온에서 10분간 염색하였다. 10분 뒤 카운팅 비드(Counting beads) 25μL, CD45 0.5μL, CD8 0.5μL, CD45RO 1.0μL, CD62L 1.0μL, PD-1 1.0μL, Tim-3 1.0μL, CD4 0.5μL, CD69 0.5μL, Flag 0.125μL를 FACS 완충액(buffer) 100μL에 혼합한 후, 각각의 튜브에 넣고 30분간 상온에서 염색한다. RBC 제거를 위해 10X RBC 용해 완충액(lysis buffer)을 멸균 증류수로 희석한 후, 염색이 완료된 튜브에 2 mL씩 넣고 5분동안 상온에서 빛을 차단시킨 후 반응시킨다. 5분 뒤 2,000 rpm 5분간 원심 분리하고 상층액을 버린 다음 FACS 완충액(buffer) 300μl를 넣는다. 염색이 완료된 시료는 FACS Celesta를 이용하여 분석한다.
실시예 5-5: MVR, MVR-g540 투여군의 암 크기 측정 결과
NSG 30마리를 이용하여 MVR CAR-T와 MVR-g540 CAR-T의 효력시험을 진행하였다. 암 크기가 80mm3 정도 됐을 때 그룹을 나누고 MVR CAR-T를 투여하였고, Auto caliper(TM900)를 이용하여 32일동안 주 2회씩 종양 크기를 측정하였다. 크기 측정 결과, 음성 대조군의 경우 14일차에 모든 개체가 사망하였고, MVR CAR-T 0.5 x 106과 MVR CAR-T 1 x 106, MVR-g540 CAR-T 0.5 x 106 모두 종양 크기가 감소하다가 몇몇 개체의 경우 28일차에 다시 종양 크기가 증가하였다. MVR-g540 CAR-T 1 x 106에서 5마리 모두 CAR-T 투여 4일차부터 종양 크기가 감소하기 시작하여 실험 종료일까지 지속적으로 감소하였다(도 12).
실시예 5-6: MVR, MVR-g540 투여군의 혈액분석
MVR CAR-T 보다 MVR-g540 CAR-T에서 혈액내 CAR-T 수가 더 많은 것을 확인할 수 있었다. MVR CAR-T 1 x 106 보다 MVR-g540 CAR-T 0.5 x 106에서 투여한 CAR-T의 수가 절반 낮음에도 불구하고 거의 2배가량 체내 세포수가 많았다(도 13).
실시예 6: MVR-g540, MVR-g540-NFAT-IL-18 CAR-T의 In vivo 분석
실시예 6-1: B lymphoma 세포주에서 MVR 결합 확인
B lymphoma 동물모델을 개발을 위해 루시페라아제(Luciferase)를 발현하는 안정한 세포주(stable cell line)를 제작하였다. 본 실험에서는 MVR과 결합을 하는 세포주 1종을 선정하였다. Daudi 세포주를 이용하여 MVR 결합을 확인하였다.
실시예 6-2: 루시페라아제(Luciferase) 유전자 발현 세포주 개발
B Lymphoma 세포주를 이용하여 루시페라아제-GFP 발현 세포주를 제작하였다. 렌티 바이러스를 이용하여 형질전환(transduction)을 유도하고 GFP 발현 확인을 통해 형질전환 효율(transduction efficiency)을 확인하였다. 이후 푸로마이신(puromycin)을 이용하여 루시페라아제-GFP 유전자가 삽입된 세포주만 선택적으로 선발한 후, 루시페라아제 기능 평가(luciferase function test)를 진행하였다. 본 실험 결과 세포주 수에 따른 RLU 값의 변화를 확인했을 때, 세포주의 수가 50%씩 감소할수록 RLU의 값이 50%씩 감소하는 것을 확인하였으며, 이후 동물모델 제작에 이용하였다. 개발된 세포주는 동물모델 제작에 사용하였다.
실시예 6-3: MVR-g540 및 MVR-g540-NFAT-IL-18 CAR-T 효력 검증
Daudi_GFP-Luc를 이용하여 1 x 106 cells/head 및 2 x 106 cells/head씩 NSG 마우스에 꼬리 정맥으로 투여하여 마우스 체내에서 종양이 유도되는 기간을 확인하였다. 본 실험 결과 Daudi_GFP-Luc를 이용하여 종양을 유도했을 때 1 x 106 cells/head와 2 x 106 cells/head간의 큰 차이가 없어 1 x 106 cells/head의 농도로 종양 유도하여 실험 진행하였다. Daudi_GFP-Luc 세포 1 x 106 cells/head를 NSG 마우스 꼬리 정맥으로 투여하여 종양을 유도한 후, 광자(photon) 값이 1 x 107에 도달했을 때 각각의 CAR-T를 투여하였다(표 5).
Figure PCTKR2022005485-appb-img-000002
실시예 6-4: 동물모델 유도 후 효력 비교
동물 실험 결과, 음성대조군과 절단된 MVR(truncated MVR) CAR-T 그룹의 경우 CAR-T 투여 14일 만에 모든 개체가 사망하였다. MVR-g540 그룹과 MVR-g540-NFAT-IL-18 그룹의 경우 모두 투여 3일차부터 광자(photon) 값이 감소하나, 7일차부터 다시 증가하였다.
생존율 확인 결과, MVR-g540 CAR-T 0.5 x 106과 1 x 106의 경우 투여 21일차에 각각 50%, 66.7%의 사망률을 보였으나 MVR-g540-NFAT-IL-18 CAR-T 의 경우 두 농도 모두 35일까지 사망한 개체는 없었다(도 14).
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.

Claims (19)

  1. (a) HLA-DR(Human Leukocyte Antigen - antigen D Related) 특이적 항원 결합 도메인(antigen binding domain), 막횡단 도메인(transmembrane domain) 및 세포내 신호전달 도메인(intracellular signaling domain)을 포함하는 키메라 항원 수용체(chimeric antigen receptor: CAR); 및 (b) 절단된 GAPDH(glyceraldehyde 3-phosphate dehydrogenase)를 코딩하는 핵산.
  2. 제1항에 있어서, 상기 HLA-DR 특이적 항원 결합 도메인은 서열번호 2로 표시되는 아미노산 서열을 포함하는 것인, 핵산.
  3. 제1항에 있어서, 상기 막횡단 도메인은 T-세포 수용체(TCR)의 알파(α), 베타(β) 또는 제타(ζ) 사슬, CD28, CD3 엡실론(ε), CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 및 CD154로 구성된 군에서 선택되는 것인, 핵산.
  4. 제1항에 있어서, 상기 세포내 신호전달 도메인은
    T-세포 수용체(TCR) 제타(ζ), FcR 감마(γ), FcR 베타(β), CD3 감마(γ), CD3 델타(δ), CD3 엡실론(ε), CD3 제타(ζ), CD5, CD22, CD79a, CD79b 및 CD66d로 구성된 군에서 선택되는 1차 신호전달 도메인(primary signaling domain); 및/또는
    CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB(CD137), OX40(CD134), CDS, ICAM-1, ICOS(CD278), LFA-1(CD11a/CD18), GITR, MyD88, DAP1, PD-1, LIGHT, NKG2C, B7-H3 및 CD83과 특이적으로 결합하는 리간드로 구성된 군에서 선택되는 공자극 신호전달 도메인(co-stimulatory signaling domain)을 포함하는 것인, 핵산.
  5. 제1항에 있어서, 상기 절단된 GAPDH(glyceraldehyde 3-phosphate dehydrogenase)는 서열번호 11로 표시되는 폴리펩티드를 포함하는 것인, 핵산.
  6. 제1항에 있어서, 신호 펩타이드(signal peptide) 및 힌지(hinge)로 이루어진 군에서 선택된 1종 이상을 코딩하는 핵산을 더 포함하는 핵산.
  7. 제4항에 있어서, 상기 세포내 신호전달 도메인은 CD3 제타(ζ)로부터의 1차 신호전달 도메인; 및 4-1BB(CD137)로부터의 공자극 신호전달 도메인을 포함하는 것 인, 핵산.
  8. 제1항 내지 제7항 중 어느 한 항에 있어서, 인터루킨 18(IL-18)을 코딩하는 핵산을 더 포함하는 핵산.
  9. 제8항에 있어서, 상기 인터루킨 18을 코딩하는 핵산은 분비 신호 서열(secretion signal sequence)을 포함하는 것인, 핵산.
  10. 제9항에 있어서, 상기 분비 신호 서열은 IL-2 분비 신호 서열인 것인, 핵산.
  11. 제8항에 있어서, 상기 인터루킨 18을 코딩하는 핵산은 결합부위와 작동가능하게 연결된 것인, 핵산.
  12. 제11항에 있어서, 상기 결합부위는 NFAT 결합부위인 것인, 핵산.
  13. 제12항에 있어서, 상기 NFAT 결합부위는 서열번호 12로 표시되는 핵산 서열로 이루어진 것인, 핵산.
  14. 제1항의 핵산을 포함하는 벡터.
  15. 제1항의 핵산 또는 이를 포함하는 벡터를 포함하는 면역세포.
  16. 제15항에 있어서, 상기 면역세포는 T 세포, NK 세포, NKT 세포, 사이토카인 유도 살해세포(Cytokine Induced Killer cell, CIK), 대식세포 및 수지상세포로 구성된 군에서 선택되는 것인, 면역세포.
  17. 제1항의 핵산; 상기 핵산을 포함하는 벡터; 또는 상기 핵산 또는 벡터를 포함하는 면역세포를 포함하는 암 예방 또는 치료용 약학 조성물.
  18. 제17항에 있어서, 상기 암은 식도선암, 대장암, 흑색종양, 안구흑색종, 소세포폐암, 신경모세포종, 기형암종, 태생기암, 편평상피암, 머리 및 목 편평 세포 암종, 흉선종, 림프모구백혈병, B세포림프종, 비만성거대B세포림프종, 백혈병 및 급성골수성백혈병으로 구성된 군에서 선택되는 것인, 암 예방 또는 치료용 조성물.
  19. 제1항의 핵산; 상기 핵산을 포함하는 벡터; 또는 상기 핵산 또는 벡터를 포함하는 면역세포를 개체에 투여하는 단계를 포함하는, 암 예방 또는 치료방법.
PCT/KR2022/005485 2021-04-15 2022-04-15 Hla-dr 특이적 키메라 항원 수용체 및 이의 용도 WO2022220648A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2021-0049349 2021-04-15
KR20210049349 2021-04-15

Publications (1)

Publication Number Publication Date
WO2022220648A1 true WO2022220648A1 (ko) 2022-10-20

Family

ID=83640876

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/005485 WO2022220648A1 (ko) 2021-04-15 2022-04-15 Hla-dr 특이적 키메라 항원 수용체 및 이의 용도

Country Status (2)

Country Link
KR (1) KR20220144327A (ko)
WO (1) WO2022220648A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20150104478A (ko) * 2014-03-05 2015-09-15 국립암센터 B 세포 림프종 세포를 특이적으로 인지하는 단일클론항체 및 이의 용도
JP2018518459A (ja) * 2015-04-30 2018-07-12 ユニバーシティ オブ サザン カリフォルニア 分泌性ｔｎｔ ｃａｒ細胞免疫療法
CN108949695A (zh) * 2018-08-14 2018-12-07 杭州荣泽生物科技有限公司 一种非病毒载体共表达il18的car-t细胞构建及其应用
WO2020032784A1 (ko) * 2018-08-10 2020-02-13 주식회사 유틸렉스 Hla-dr에 결합하는 키메라 항원 수용체 및 car-t 세포
WO2020190737A1 (en) * 2019-03-15 2020-09-24 Cartesian Therapeutics, Inc. Anti-bcma chimeric antigen receptors

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20150104478A (ko) * 2014-03-05 2015-09-15 국립암센터 B 세포 림프종 세포를 특이적으로 인지하는 단일클론항체 및 이의 용도
JP2018518459A (ja) * 2015-04-30 2018-07-12 ユニバーシティ オブ サザン カリフォルニア 分泌性ｔｎｔ ｃａｒ細胞免疫療法
WO2020032784A1 (ko) * 2018-08-10 2020-02-13 주식회사 유틸렉스 Hla-dr에 결합하는 키메라 항원 수용체 및 car-t 세포
CN108949695A (zh) * 2018-08-14 2018-12-07 杭州荣泽生物科技有限公司 一种非病毒载体共表达il18的car-t细胞构建及其应用
WO2020190737A1 (en) * 2019-03-15 2020-09-24 Cartesian Therapeutics, Inc. Anti-bcma chimeric antigen receptors

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
CHUNGYONG HAN, SIM SU-JUNG, KIM SEON-HEE, SINGH ROHIT, HWANG SUNHEE, KIM YU I., PARK SANG H., KIM KWANG H., LEE DON G., OH HO S., : "Desensitized chimeric antigen receptor T cells selectively recognize target cells with enhanced antigen expression", NATURE COMMUNICATIONS, vol. 9, no. 1, 1 December 2018 (2018-12-01), pages 1 - 13, XP055528807, DOI: 10.1038/s41467-018-02912-x *
DATABASE Protein 25 July 2016 (2016-07-25), ANONYMOUS: "Homo sapiens glyceraldehyde-3-phosphate dehydrogenase, partial [synthetic construct]", XP055977066, retrieved from Genbank Database accession no. AAP36549 *

Also Published As

Publication number Publication date
KR20220144327A (ko) 2022-10-26

Similar Documents

Publication Publication Date Title
WO2018124766A2 (ko) 키메라 항원 수용체 및 이를 발현하는 자연 살해 세포
WO2019182425A1 (ko) 신규 키메라 항원 수용체 암호화 유전자가 형질도입된 유전자 변형 nk 세포주 및 그의 용도
WO2018217064A2 (ko) 형질전환된 t세포를 이용한 자연살해세포의 배양방법
WO2020032784A1 (ko) Hla-dr에 결합하는 키메라 항원 수용체 및 car-t 세포
WO2021256724A1 (ko) Bcma를 표적으로 하는 키메라 항원 수용체 및 이의 용도
WO2020153605A1 (ko) 메소텔린 특이적인 키메라 항원 수용체 및 이를 발현하는 t 세포
WO2017023138A1 (ko) 키메라 항원 수용체 및 키메라 항원 수용체가 발현된 t 세포
WO2019112347A2 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2021235696A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2018199593A1 (ko) Her3 및 cd3에 결합하는 이중특이적 항체
WO2019203600A1 (ko) 스위치 분자 및 스위처블 키메라 항원 수용체
WO2021210939A1 (ko) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체
WO2020101361A1 (ko) 형질전환된 t세포를 이용한 제대혈 유래 자연살해세포의 배양방법
WO2023277361A1 (ko) 메소텔린 특이적 항체 및 이의 용도
WO2022025638A1 (ko) 면역시냅스를 안정화시키는 키메라 항원 수용체(car) t 세포
WO2019216675A1 (ko) 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체
WO2022231032A1 (ko) 항-cntn4 특이적 항체 및 그의 용도
WO2021153979A1 (ko) 항-taa 항체, 항-pd-l1 항체 및 il-2를 포함하는 융합단백질 및 이의 용도
WO2022220648A1 (ko) Hla-dr 특이적 키메라 항원 수용체 및 이의 용도
WO2022231298A1 (ko) 신규한 항-cd5 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2022250440A1 (ko) Erbb3 특이적인 키메라 항원 수용체 및 이를 발현하는 면역세포 치료제
WO2021235697A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2022145739A1 (en) Humanized antibody specific for cd22 and chimeric antigen receptor using the same
WO2021162394A1 (ko) B세포 성숙화 항원을 표적으로 하는 키메라 항원 수용체 및 이의 용도
WO2021107635A1 (ko) Il-2 단백질 및 cd80 단백질을 포함하는 융합단백질 및 nk 세포를 포함하는 항암 치료용 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22788503

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 22788503

Country of ref document: EP

Kind code of ref document: A1