WO2021162394A1 - B세포 성숙화 항원을 표적으로 하는 키메라 항원 수용체 및 이의 용도 - Google Patents
B세포 성숙화 항원을 표적으로 하는 키메라 항원 수용체 및 이의 용도 Download PDFInfo
- Publication number
- WO2021162394A1 WO2021162394A1 PCT/KR2021/001681 KR2021001681W WO2021162394A1 WO 2021162394 A1 WO2021162394 A1 WO 2021162394A1 KR 2021001681 W KR2021001681 W KR 2021001681W WO 2021162394 A1 WO2021162394 A1 WO 2021162394A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- bcma
- polypeptide
- amino acid
- chain variable
- Prior art date
Links
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 title claims abstract description 77
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 title claims abstract description 58
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 title claims abstract description 56
- 230000008685 targeting Effects 0.000 title description 12
- 206010035226 Plasma cell myeloma Diseases 0.000 claims abstract description 28
- 208000034578 Multiple myelomas Diseases 0.000 claims abstract description 23
- 210000003719 b-lymphocyte Anatomy 0.000 claims abstract description 21
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 15
- 238000011282 treatment Methods 0.000 claims abstract description 15
- 201000010099 disease Diseases 0.000 claims abstract description 12
- 210000002865 immune cell Anatomy 0.000 claims abstract description 9
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 claims abstract description 6
- 230000002265 prevention Effects 0.000 claims abstract description 6
- 210000004027 cell Anatomy 0.000 claims description 77
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 75
- 229920001184 polypeptide Polymers 0.000 claims description 68
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 68
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 52
- 230000003834 intracellular effect Effects 0.000 claims description 44
- 239000000427 antigen Substances 0.000 claims description 42
- 102000036639 antigens Human genes 0.000 claims description 42
- 108091007433 antigens Proteins 0.000 claims description 42
- 239000013598 vector Substances 0.000 claims description 28
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 25
- 150000007523 nucleic acids Chemical class 0.000 claims description 25
- 230000011664 signaling Effects 0.000 claims description 24
- 108020004707 nucleic acids Proteins 0.000 claims description 23
- 102000039446 nucleic acids Human genes 0.000 claims description 23
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 21
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 21
- 206010028980 Neoplasm Diseases 0.000 claims description 18
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 claims description 16
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 claims description 16
- 201000011510 cancer Diseases 0.000 claims description 14
- 238000000034 method Methods 0.000 claims description 14
- 239000008194 pharmaceutical composition Substances 0.000 claims description 12
- 230000000139 costimulatory effect Effects 0.000 claims description 11
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 claims description 10
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 claims description 10
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 claims description 10
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 9
- 239000012634 fragment Substances 0.000 claims description 7
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 5
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 claims description 5
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 claims description 5
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 claims description 5
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 claims description 5
- 230000019491 signal transduction Effects 0.000 claims description 5
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 claims description 4
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 4
- 230000036210 malignancy Effects 0.000 claims description 4
- 230000003211 malignant effect Effects 0.000 claims description 4
- 208000002267 Anti-neutrophil cytoplasmic antibody-associated vasculitis Diseases 0.000 claims description 3
- 208000021386 Sjogren Syndrome Diseases 0.000 claims description 3
- 230000004663 cell proliferation Effects 0.000 claims description 3
- 208000035475 disorder Diseases 0.000 claims description 3
- 230000002519 immonomodulatory effect Effects 0.000 claims description 3
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 claims description 2
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 claims description 2
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 claims description 2
- 208000011200 Kawasaki disease Diseases 0.000 claims description 2
- 206010025323 Lymphomas Diseases 0.000 claims description 2
- 208000010190 Monoclonal Gammopathy of Undetermined Significance Diseases 0.000 claims description 2
- 201000011152 Pemphigus Diseases 0.000 claims description 2
- 206010039710 Scleroderma Diseases 0.000 claims description 2
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 claims description 2
- 206010002022 amyloidosis Diseases 0.000 claims description 2
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 claims description 2
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 claims description 2
- 208000025750 heavy chain disease Diseases 0.000 claims description 2
- 230000004068 intracellular signaling Effects 0.000 claims description 2
- 201000005328 monoclonal gammopathy of uncertain significance Diseases 0.000 claims description 2
- 208000001725 mucocutaneous lymph node syndrome Diseases 0.000 claims description 2
- 201000006417 multiple sclerosis Diseases 0.000 claims description 2
- 206010028417 myasthenia gravis Diseases 0.000 claims description 2
- 201000001976 pemphigus vulgaris Diseases 0.000 claims description 2
- 201000008158 rapidly progressive glomerulonephritis Diseases 0.000 claims description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 claims description 2
- 201000006292 polyarteritis nodosa Diseases 0.000 claims 1
- 208000017805 post-transplant lymphoproliferative disease Diseases 0.000 claims 1
- 210000000822 natural killer cell Anatomy 0.000 description 56
- 108090000623 proteins and genes Proteins 0.000 description 14
- 230000000694 effects Effects 0.000 description 9
- 108020004999 messenger RNA Proteins 0.000 description 7
- 102000004169 proteins and genes Human genes 0.000 description 7
- 230000010076 replication Effects 0.000 description 7
- 230000028327 secretion Effects 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 102000001398 Granzyme Human genes 0.000 description 5
- 108060005986 Granzyme Proteins 0.000 description 5
- 230000001093 anti-cancer Effects 0.000 description 5
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 5
- 231100000135 cytotoxicity Toxicity 0.000 description 5
- 230000003013 cytotoxicity Effects 0.000 description 5
- 201000000050 myeloid neoplasm Diseases 0.000 description 5
- 241000282693 Cercopithecidae Species 0.000 description 4
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 108091033319 polynucleotide Proteins 0.000 description 4
- 102000040430 polynucleotide Human genes 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 229940099039 velcade Drugs 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 3
- 108091027974 Mature messenger RNA Proteins 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 229940049595 antibody-drug conjugate Drugs 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 230000005880 cancer cell killing Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 210000004698 lymphocyte Anatomy 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 230000009257 reactivity Effects 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 210000003289 regulatory T cell Anatomy 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 230000004614 tumor growth Effects 0.000 description 3
- 238000001262 western blot Methods 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 2
- 241000713704 Bovine immunodeficiency virus Species 0.000 description 2
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 2
- 108091007741 Chimeric antigen receptor T cells Proteins 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 241000713730 Equine infectious anemia virus Species 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 241000713800 Feline immunodeficiency virus Species 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 2
- 241000713340 Human immunodeficiency virus 2 Species 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 2
- 239000004698 Polyethylene Substances 0.000 description 2
- 101100064044 Schizosaccharomyces pombe (strain 972 / ATCC 24843) pol1 gene Proteins 0.000 description 2
- 241000713311 Simian immunodeficiency virus Species 0.000 description 2
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- XLOMVQKBTHCTTD-UHFFFAOYSA-N Zinc monoxide Chemical compound [Zn]=O XLOMVQKBTHCTTD-UHFFFAOYSA-N 0.000 description 2
- 101150063416 add gene Proteins 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 239000000611 antibody drug conjugate Substances 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- -1 carrier Substances 0.000 description 2
- 230000003833 cell viability Effects 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000012790 confirmation Methods 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 2
- 238000002784 cytotoxicity assay Methods 0.000 description 2
- 231100000263 cytotoxicity test Toxicity 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- MMXKVMNBHPAILY-UHFFFAOYSA-N ethyl laurate Chemical compound CCCCCCCCCCCC(=O)OCC MMXKVMNBHPAILY-UHFFFAOYSA-N 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- BRZYSWJRSDMWLG-CAXSIQPQSA-N geneticin Chemical compound O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](C(C)O)O2)N)[C@@H](N)C[C@H]1N BRZYSWJRSDMWLG-CAXSIQPQSA-N 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 229930027917 kanamycin Natural products 0.000 description 2
- 229960000318 kanamycin Drugs 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 229930182823 kanamycin A Natural products 0.000 description 2
- 229960004942 lenalidomide Drugs 0.000 description 2
- GOTYRUGSSMKFNF-UHFFFAOYSA-N lenalidomide Chemical compound C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O GOTYRUGSSMKFNF-UHFFFAOYSA-N 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 210000004180 plasmocyte Anatomy 0.000 description 2
- 101150088264 pol gene Proteins 0.000 description 2
- 101150055096 polA gene Proteins 0.000 description 2
- 238000011533 pre-incubation Methods 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 229960003433 thalidomide Drugs 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- 206010067484 Adverse reaction Diseases 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 108010083359 Antigen Receptors Proteins 0.000 description 1
- 102000006306 Antigen Receptors Human genes 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- OBMZMSLWNNWEJA-XNCRXQDQSA-N C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 Chemical compound C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 OBMZMSLWNNWEJA-XNCRXQDQSA-N 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 241000713756 Caprine arthritis encephalitis virus Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 239000004097 EU approved flavor enhancer Substances 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- 108091092584 GDNA Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000801255 Homo sapiens Tumor necrosis factor receptor superfamily member 17 Proteins 0.000 description 1
- 101100321817 Human parvovirus B19 (strain HV) 7.5K gene Proteins 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 1
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 240000007019 Oxalis corniculata Species 0.000 description 1
- 206010034016 Paronychia Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 101710176384 Peptide 1 Proteins 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229940079156 Proteasome inhibitor Drugs 0.000 description 1
- 235000019485 Safflower oil Nutrition 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 description 1
- 102000008579 Transposases Human genes 0.000 description 1
- 108010020764 Transposases Proteins 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 208000010094 Visna Diseases 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 206010003230 arteritis Diseases 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 229940018964 belantamab mafodotin Drugs 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 239000000440 bentonite Substances 0.000 description 1
- 229910000278 bentonite Inorganic materials 0.000 description 1
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 229960003669 carbenicillin Drugs 0.000 description 1
- FPPNZSSZRUTDAP-UWFZAAFLSA-N carbenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C(O)=O)C1=CC=CC=C1 FPPNZSSZRUTDAP-UWFZAAFLSA-N 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 235000005687 corn oil Nutrition 0.000 description 1
- 239000002285 corn oil Substances 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000007402 cytotoxic response Effects 0.000 description 1
- 229960002204 daratumumab Drugs 0.000 description 1
- 229940094732 darzalex Drugs 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 206010014599 encephalitis Diseases 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 235000019441 ethanol Nutrition 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 235000019264 food flavour enhancer Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 210000004475 gamma-delta t lymphocyte Anatomy 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 238000011134 hematopoietic stem cell transplantation Methods 0.000 description 1
- 102000046935 human TNFRSF17 Human genes 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 230000001589 lymphoproliferative effect Effects 0.000 description 1
- VTHJTEIRLNZDEV-UHFFFAOYSA-L magnesium dihydroxide Chemical compound [OH-].[OH-].[Mg+2] VTHJTEIRLNZDEV-UHFFFAOYSA-L 0.000 description 1
- 239000000347 magnesium hydroxide Substances 0.000 description 1
- 229910001862 magnesium hydroxide Inorganic materials 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 210000000581 natural killer T-cell Anatomy 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 239000008055 phosphate buffer solution Substances 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920001296 polysiloxane Polymers 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 239000003207 proteasome inhibitor Substances 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 235000005713 safflower oil Nutrition 0.000 description 1
- 239000003813 safflower oil Substances 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- RMAQACBXLXPBSY-UHFFFAOYSA-N silicic acid Chemical compound O[Si](O)(O)O RMAQACBXLXPBSY-UHFFFAOYSA-N 0.000 description 1
- 235000012239 silicon dioxide Nutrition 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 108091007466 transmembrane glycoproteins Proteins 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 235000019871 vegetable fat Nutrition 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 239000011787 zinc oxide Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4613—Natural-killer cells [NK or NK-T]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4631—Chimeric Antigen Receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
- A61K39/464416—Receptors for cytokines
- A61K39/464417—Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR], CD30
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70514—CD4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0646—Natural killers cells [NK], NKT cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5156—Animal cells expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15041—Use of virus, viral particle or viral elements as a vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/90—Vectors containing a transposable element
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to a chimeric antigen receptor targeting B cell maturation antigen (BCMA) and uses thereof.
- BCMA B cell maturation antigen
- Multiple myeloma (multiple myeloma) or plasma cell myeloma (plasma cell myeloma) is a cancer of plasma cells, a type of white blood cells that are usually responsible for producing antibodies.
- plasma cell myeloma (plasma cell myeloma) is a cancer of plasma cells, a type of white blood cells that are usually responsible for producing antibodies.
- normal plasma cells are transformed into abnormal cancer cells, myeloma cells, and proliferate rapidly. Damaged myeloma cells gradually produce large amounts of malignant myeloma cells in the bone marrow, a process that destroys the body's normal immune system.
- Treatments for multiple myeloma include melphalan, vincristine, doxorubicin, cyclophosphamide, corticosteroids (Steroids), boltezomib/velcade, and thalidomide.
- Thialidomide chemotherapy such as lenalidomide (Lenalidomide), radiation therapy, hematopoietic stem cell transplantation and surgical treatment, etc.
- Chimeric antigen receptor T cells are T cells that have been genetically engineered to create engineered T cell receptors for use in immunotherapy.
- Chimeric antigen receptors are receptor proteins engineered to confer new functions targeting specific proteins to T cells.
- the chimeric antigen receptor is composed of an external domain (ecto domain), a transmembrane domain and an internal domain (endo domain), and depending on the configuration of the internal domain that transmits the activation signal to the cell, the first generation, the second generation, It is evolving into 3rd and 4th generation.
- BCMA B cell maturation antigen
- TNFRSF17 tumor necrosis factor receptor superfamily 17
- MM multiple myeloma
- BCMA is an antigen targeted by chimeric antigen receptor (CAR) T-cells that have shown significant therapeutic effects in clinical trials.
- CAR chimeric antigen receptor
- anti-BCMA antibody-drug conjugate also meant for patients who had weak therapeutic effects with therapeutic agents such as anti-CD38 antibody, proteosome inhibitor, and immunomodulatory agent. clinical results were obtained.
- CAR chimeric antigen receptor
- the present invention seeks to provide a chimeric antigen receptor (CAR) anti-BCMA CAR that specifically recognizes BCMA.
- CAR chimeric antigen receptor
- the present invention seeks to provide a nucleic acid molecule encoding an anti-BCMA CAR and a vector comprising the nucleic acid molecule.
- the present invention is to provide a cell expressing an anti-BCMA CAR comprising the nucleic acid molecule or the vector.
- the present invention seeks to provide a composition comprising a cell expressing an anti-BCMA CAR.
- An object of the present invention is to provide a pharmaceutical composition for the treatment or prevention of B cell-related diseases, including cells expressing anti-BCMA CAR.
- the present invention seeks to provide the use of cells expressing anti-BCMA CARs for the treatment of diseases related to B cells.
- An object of the present invention is to provide a method of treating a B cell-related disease using a cell expressing an anti-BCMA CAR.
- CAR chimeric antigen receptor
- BCMA B cell maturation antigen
- nucleic acid molecule encoding the chimeric antigen receptor.
- a vector comprising the polynucleotide.
- a cell comprising the nucleic acid molecule or the vector.
- a pharmaceutical composition for the treatment or prevention of B cell-related diseases comprising a pharmaceutically effective amount of cells containing the vector.
- Immune cells expressing the chimeric antigen receptor of the present invention can be effectively used for treatment and prevention of B-cell-related diseases, particularly multiple myeloma or non-Hodgkin's lymphoma.
- FIG. 1A shows a BCMA-chimeric antigen receptor (CAR) structure according to an embodiment of the present invention.
- SP is signal peptide
- TM is transmembrane domain
- CS1-ICD is costimulatory 1-intracellular signaling domain
- CS2-ICD is a costimulatory 2-intracellular signaling domain.
- Figure 1b is a diagram showing the structure of the BCMA-CAR according to an embodiment of the present invention in more detail schematically.
- CGT301, CGT302, CGT303, and CGT304 are NK cells transduced with BCMA-CAR1, BCMA-CAR2, BCMA-CAR3, and BCMA-CAR4 of the present invention, respectively.
- Figure 4a is the result of measuring the cancer cell killing ability of BCMA-CAR NK cells
- Figure 4b is the result of measuring the amount of IFN ⁇ secretion of BCMA-CAR NK cells
- Figure 4c is the secretion amount of Granzyme B of BCMA-CAR NK cells is the measurement result.
- 6A and 6B are results confirming the antigen specificity of the BCMA-CAR of the present invention for BCMA derived from human (hu1, hu2), monkey (Rh), mouse (Ms) and rat (Rat).
- BCMA-CAR NK cells is a BCMA-specific reaction through a competition assay with rhBCMA protein.
- Figures 10a to 10d are the results of confirming the stability of BCMA-CAR NK cells
- Figure 10a is the result of measuring cell viability
- Figure 10b is the result of measuring the population doubling time
- Figure 10c is the measurement of BCMA-CAR expression Results
- Figure 10d is a result of measuring the cytotoxicity.
- the present invention provides a chimeric antigen receptor (CAR) comprising the following polypeptide:
- BCMA B cell maturation antigen
- the extracellular antigen binding domain comprises an anti-BCMA antibody or antigen binding fragment thereof.
- the antigen-binding fragment is a Fab fragment, Fab' fragment, F(ab)'2 fragment, F(ab)'3 fragment, Fv, single chain Fv antibody ("scFv"), bis-scFv, (scFv)2 , minibodies, diabodies, triabodies, tetrabodies, disulfide stabilized Fv proteins (“dsFv”), and single-domain antibodies (sdAbs, Nanobodies).
- the extracellular antigen binding domain comprises (i) a light chain variable region of an anti-BCMA antibody comprising a complementarity determining region (L-CDR)1, L-CDR2, and L-CDR3; V L );
- V H a heavy chain variable region of an anti-BCMA antibody comprising H-CDR1, H-CDR2, and H-CDR3;
- the term “specifically binds” means that an antibody or antigen-binding fragment thereof, or a construct such as an scFv, forms a relatively stable complex with an antigen under physiological conditions.
- variable region refers to the domain of an antibody heavy or light chain involved in binding an antibody to an antigen.
- the heavy chain variable region (V H ) and light chain variable region (V L ) of a native antibody generally have a similar structure, and each domain has four conserved framework regions (FR) and three hypervariable regions (hypervariable regions). regions, HVR).
- CDR complementarity determining region
- the heavy chain variable region (V H ) and the light chain variable region (V L ) each have three CDRs (heavy chain: H-CDR1, H-CDR2 and H-CDR3; light chain: L-CDR1, L-CDR2 and L-CDR3). Included. CDRs provide key contact residues for the binding of an antibody to an antigen or epitope.
- the extracellular antigen binding domain may include one or more light chain variable regions (V L ), or one or more heavy chain variable regions (V H ), for example, (V L ), ( V L )-(V L ), (V L )-(V L )-(V L ), (V L )-(V L )-(V L ), (V L )-( V L )-(V L ), (V L )-( V L )-(V L )-(V L ), or (V L )-(V L )-(V L )-(V L )-(V L ) (V H ), (V H )-(V H ), (V H )-(V H )-(V H ), (V H )-(V H )-(V H ) )-(V H ), (V H )-(V H )-(V H )-(V H ), (V H )-(V H )-(V H
- the extracellular antigen binding domain may include a form in which one light chain variable region (V L ) and one heavy chain variable region (V H ) are linked, (V L )-(V H ) and It may include a form connected together, or a form connected such as (V H )-(V L ) in the opposite direction.
- the extracellular antigen-binding domain is one or more heavy chain variable regions (V H ) linked to two or more light chain variable regions (V L );
- one or two or more light chain variable regions (V L ) may include a form in which two or more heavy chain variable regions (V H ) are linked.
- the extracellular antigen-binding domain is two or more heavy chain variable regions (V H ), one or two or more light chain variable regions (V L ) are linked to;
- one or two or more light chain variable regions (V L ) may include a form in which two or more heavy chain variable regions (V H ) are linked.
- the heavy chain variable region (V H ) and the light chain variable region (V L ) may include a form in which they are alternately connected.
- L-CDR1 is a polypeptide of the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 7, SEQ ID NO: 13, or SEQ ID NO: 19;
- the L-CDR2 is a polypeptide of the amino acid sequence of SEQ ID NO: 2, SEQ ID NO: 8, SEQ ID NO: 14, or SEQ ID NO: 20;
- the L-CDR3 is a polypeptide of the amino acid sequence of SEQ ID NO: 3, SEQ ID NO: 9, SEQ ID NO: 15, or SEQ ID NO: 21;
- H-CDR1 is a polypeptide of the amino acid sequence of SEQ ID NO: 4, SEQ ID NO: 10, SEQ ID NO: 16, or SEQ ID NO: 22;
- the H-CDR2 is a polypeptide of the amino acid sequence of SEQ ID NO: 5, SEQ ID NO: 11, SEQ ID NO: 17, or SEQ ID NO: 23;
- the H-CDR3 is a polypeptide of the amino acid sequence of SEQ ID NO: 6, SEQ ID NO: 12, SEQ ID NO: 18, or SEQ ID NO: 24.
- the extracellular antigen binding domain comprises a heavy chain variable region (V H) of an anti-BCMA antibody comprising H-CDR1 of SEQ ID NO: 4, H-CDR2 of SEQ ID NO: 5, and H-CDR3 of SEQ ID NO: 6 ); and a light chain variable region (V L ) of an anti-BCMA antibody comprising L-CDR1 of SEQ ID NO: 1, L-CDR2 of SEQ ID NO: 2, and L-CDR3 of SEQ ID NO: 3.
- V H heavy chain variable region
- V L light chain variable region
- the extracellular antigen binding domain comprises a heavy chain variable region (V H) of an anti-BCMA antibody comprising H-CDR1 of SEQ ID NO: 10, H-CDR2 of SEQ ID NO: 11, and H-CDR3 of SEQ ID NO: 12 ); and a light chain variable region (V L ) of an anti-BCMA antibody comprising L-CDR1 of SEQ ID NO: 7, L-CDR2 of SEQ ID NO: 8, and L-CDR3 of SEQ ID NO: 9.
- V H heavy chain variable region
- V L light chain variable region
- the extracellular antigen binding domain comprises a heavy chain variable region (V H) of an anti-BCMA antibody comprising H-CDR1 of SEQ ID NO: 16, H-CDR2 of SEQ ID NO: 17, and H-CDR3 of SEQ ID NO: 18 ); and a light chain variable region (V L ) of an anti-BCMA antibody comprising L-CDR1 of SEQ ID NO: 13, L-CDR2 of SEQ ID NO: 14, and L-CDR3 of SEQ ID NO: 15.
- V H heavy chain variable region
- V L light chain variable region
- the extracellular antigen binding domain comprises a heavy chain variable region (V H) of an anti-BCMA antibody comprising H-CDR1 of SEQ ID NO: 22, H-CDR2 of SEQ ID NO: 23, and H-CDR3 of SEQ ID NO: 24 ); and a light chain variable region (V L ) of an anti-BCMA antibody comprising L-CDR1 of SEQ ID NO: 19, L-CDR2 of SEQ ID NO: 20, and L-CDR3 of SEQ ID NO: 21.
- V H heavy chain variable region
- V L light chain variable region
- the extracellular antigen binding domain is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoe
- V L the light chain variable region of at least one anti-BCMA antibody selected from the group consisting of the polypeptides of SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 29, and SEQ ID NO: 31; and
- V H heavy chain variable regions
- the combination of the light chain variable region (V L ) and the heavy chain variable region (V H ) is the same as the above-described combination.
- V L may comprise one or more light chain variable regions (V L ), or may comprise one or more heavy chain variable regions (V H ), for example, (V L ), (V L )-(V L ), (V L )-(V L )-(V L ), (V L )-(V L )-(V L ), (V L )-(V L )-(V L ), (V L )-(V L )-(V L ), or (V L )-(V L )-(V L )-(V L )-(V L )-(V L ), and also (V L )-(V L ) H ), (V H )-(V H ), (V H )-(V H )-(V H ), (V H )-(V H )-(V H ), (V H )-(V H )-(V H ), (V H )-(V H )-(V H )-(V H
- one light chain variable region (V L ) and one heavy chain variable region (V H ) may include a linked form, such as (V L )-(V H ), or the opposite direction ( V H )-(V L ) may be in a connected form.
- the heavy chain variable region (V H ) and the light chain variable region (V L ) may include a form in which they are alternately connected.
- the extracellular antigen binding domain comprises a heavy chain variable region (V H ) of an anti-BCMA antibody of SEQ ID NO: 26; and a light chain variable region (V L ) of an anti-BCMA antibody of SEQ ID NO: 25.
- the extracellular antigen binding domain comprises a heavy chain variable region (V H ) of an anti-BCMA antibody of SEQ ID NO: 28; and a light chain variable region (V L ) of an anti-BCMA antibody of SEQ ID NO: 27.
- the extracellular antigen binding domain comprises a heavy chain variable region (V H ) of an anti-BCMA antibody of SEQ ID NO: 30; and a light chain variable region (V L ) of an anti-BCMA antibody of SEQ ID NO: 29.
- the extracellular antigen binding domain comprises a heavy chain variable region (V H ) of an anti-BCMA antibody of SEQ ID NO: 32; and a light chain variable region (V L ) of an anti-BCMA antibody of SEQ ID NO: 31.
- the chimeric antigen receptor of the present invention may further comprise a linker positioned between two or more light or heavy chain variable regions.
- the linker may be a polypeptide of the amino acid sequence of SEQ ID NO: 37 or SEQ ID NO: 38.
- the extracellular antigen binding domain of the present invention may further include a hinge region connected to the transmembrane domain.
- the hinge region comprises a hinge region of IgG1, IgG4, or CD8 ⁇ .
- the IgG1 hinge region comprises a polypeptide of the amino acid sequence of SEQ ID NO:39; wherein said IgG4 hinge region comprises a polypeptide of the amino acid sequence of SEQ ID NO:40;
- the CD8 ⁇ hinge region comprises a polypeptide of the amino acid sequence of SEQ ID NO: 41.
- the transmembrane domain comprises a transmembrane region of CD8 alpha or CD28.
- the CD8 alpha transmembrane region comprises a polypeptide of the amino acid sequence of SEQ ID NO: 42
- the CD28 transmembrane region comprises a polypeptide of the amino acid sequence of SEQ ID NO: 43.
- the intracellular co-stimulatory signaling domain comprises an intracellular co-stimulatory signaling domain of CD28, DAP10, or CD137 (4-1BB).
- the CD28 intracellular co-stimulatory signal transduction domain comprises a polypeptide of the amino acid sequence of SEQ ID NO: 44.
- the DAP10 intracellular co-stimulatory signal transduction domain comprises a polypeptide of the amino acid sequence of SEQ ID NO: 45.
- the CD137(4-1BB) intracellular costimulatory signaling domain comprises a polypeptide of the amino acid sequence of SEQ ID NO:46.
- the intracellular major signaling domain comprises the intracellular domain of CD3 zeta ( ⁇ ).
- the CD3 zeta ( ⁇ ) intracellular domain comprises a polypeptide of the amino acid sequence of SEQ ID NO:47.
- the intracellular co-stimulatory signaling domain and/or the intracellular major signaling domain may be linked by a linker.
- the linker connecting the intracellular co-stimulatory signal transduction domain and/or the intracellular major signal transduction domain is a polypeptide of the amino acid sequence of SEQ ID NO: 38.
- the extracellular antigen binding domain further comprises a signal peptide.
- the signal peptide comprises a signal peptide of CD16, GM-CSF, human IgG, or CD8.
- the signal peptide of CD16 comprises a polypeptide of the amino acid sequence of SEQ ID NO:33; the signal peptide of GM-CSF comprises a polypeptide of the amino acid sequence of SEQ ID NO: 34; the signal peptide of human IgG comprises a polypeptide of the amino acid sequence of SEQ ID NO: 35; The signal peptide of CD8 comprises a polypeptide of the amino acid sequence of SEQ ID NO: 36.
- the chimeric antigen receptor of the present invention comprises a heavy chain variable region (V H ) and a light chain variable region (V L ) of the aforementioned anti-BCMA antibody; CD8 ⁇ hinge region; CD28 transmembrane region; CD137(4-1BB) co-stimulatory signaling domain; and a CD3 zeta ( ⁇ ) intracellular domain.
- FIG. 1B the configuration of a polypeptide constituting a more specific chimeric antigen receptor of the present invention may be shown in FIG. 1B, but the chimeric antigen receptor of the present invention is not limited to the configuration of FIG. 1B.
- the invention provides a nucleic acid molecule encoding the above-described chimeric antigen receptor.
- nucleic acid molecule is a polynucleotide, and is meant to include DNA and RNA, the DNA includes gDNA (genomic DNA) and cDNA (complementary DNA), and the RNA includes mRNA (messenger RNA) do.
- the mRNA is a nucleic acid molecule capable of directing translation of the chimeric antigen receptor of the present invention, and may include a primary transcript mRNA (mRNA) molecule or a mature mRNA (mature mRNA) molecule.
- the nucleotide which is the basic structural unit of the nucleic acid molecule, includes not only natural nucleotides but also analogs in which sugar or base sites are modified (Scheit, Nucleotide Analogs, John Wiley, New York (1980); Uhlman and Peyman, Chemical Reviews). , 90:543-584 (1990)).
- Nucleic acid molecules or polynucleotides of the present invention can be obtained using chemical synthesis, recombinant methods or PCR, and methods for chemical synthesis of nucleic acid molecules are well known in the art, so those of ordinary skill in the art will be familiar with the present specification. Nucleic acid molecules of a desired sequence can be easily synthesized using the provided sequences and commercial nucleic acid molecule synthesizers.
- the present invention provides a vector comprising the nucleic acid molecule.
- the vector may be a cloning vector or an expression vector stably expressing the chimeric antigen receptor.
- the vector may include an origin of replication, such as f1 origin of replication, SV origin of replication, pMB1 origin of replication, Adeno origin of replication, AAV origin of replication and BBV origin of replication operating in eukaryotic cells.
- an origin of replication such as f1 origin of replication, SV origin of replication, pMB1 origin of replication, Adeno origin of replication, AAV origin of replication and BBV origin of replication operating in eukaryotic cells.
- the vector includes an antibiotic resistance gene commonly used in the art as a selection marker, for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin, puromycin and It may contain a resistance gene for tetracycline.
- the nucleic acid molecule encoding the above-described chimeric antigen receptor may be operably linked with a promoter sequence that initiates its expression.
- the promoter may be a promoter derived from the genome of a mammalian cell (eg, metallotionine promoter, EF-1 alpha promoter) or a promoter derived from a mammalian virus (eg, adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus (CMV) promoter, and HSV tk promoter) may be used, and a polyadenylation sequence may be included as a transcription termination sequence, for example, an SV40 polA sequence and a BGH polA sequence may be included. .
- the vector or recombinant vector is a transposon vector, an episomal vector, or a viral vector.
- the viral vector is a retroviral vector or a lentiviral vector.
- the lentiviral vector comprises human immunodeficiency virus 1 (HIV-1); human immunodeficiency virus 2 (HIV-2), visna-maedi virus (VMV) virus; goat arthritis-encephalitis virus (CAEV); Equine Infectious Anemia Virus (EIAV); Feline Immunodeficiency Virus (FIV); bovine immunodeficiency virus (BIV); and simian immunodeficiency virus (SIV).
- HV-1 human immunodeficiency virus 1
- HMV-2 human immunodeficiency virus 2
- VMV visna-maedi virus
- CAEV goat arthritis-encephalitis virus
- EIAV Equine Infectious Anemia Virus
- FV Feline Immunodeficiency Virus
- BIV bovine immunodeficiency virus
- SIV simian immunodeficiency virus
- the invention provides a cell comprising the nucleic acid molecule, or a cell comprising the vector described above.
- the vector may be introduced into a cell.
- a method for introducing a vector into a cell may use a known transfection method, for example, a microinjection method (Capecchi, MR, Cell 22, 479 (1980)), calcium phosphate precipitation method (Graham, FL et al.) al., Virology 52, 456 (1973)), electroporation (Neumann, E. et al., EMBO J. 1, 841 (1982)), liposome-mediated transfection (Wong, TK et al., Gene) , 10, 87 (1980)), DEAE-dextran treatment (Gopal, Mol. Cell Biol. 5, 1188-1190 (1985)), and gene bambadment (Yang et al., Proc. Natl. Acad. Sci) USA 87, 9568-9572 (1990)), but is not limited thereto.
- a vector introduced into a cell may be maintained in the cell as a non-integrating vector (eg, a plasmid), or it may be integrated as part of the chromosomal DNA of the host cell.
- a non-integrating vector eg, a plasmid
- a cell comprising a vector comprising a nucleic acid molecule (polynucleotide) encoding the above-described chimeric antigen receptor of the present invention stably expresses the chimeric antigen receptor in a cell, and the expressed chimeric antigen receptor is located in the cell membrane region. stably positioned.
- cells can be provided comprising a nucleic acid molecule (eg, cDNA or mRNA molecule) encoding a chimeric antigen receptor of the invention.
- a nucleic acid molecule eg, cDNA or mRNA molecule
- Cells containing cDNA capable of instructing transcription and translation of the chimeric antigen receptor of the present invention can stably express the chimeric antigen receptor in the cell.
- Intracellular expression of the chimeric antigen receptor can be induced by directly introducing a primary transcript mRNA or a mature mRNA capable of directing translation of the chimeric antigen receptor of the present invention into a cell.
- the cells into which the vector is introduced are immune cells, preferably NK (Natural Killer) cells, T cells, cytotoxic T cells or regulatory T cells.
- the cells are human-derived immune cells, more preferably human-derived NK cells.
- T cell refers to a type of lymphocyte that matures in the thymus. T cells play an important role in cell-mediated immunity and are distinguished from other lymphocytes such as B lymphocytes by the presence of T cell receptors on the cell surface. T cells can also be isolated or obtained from commercially available sources. T cells are of any type expressing CD3, including helper T cells (CD4+ cells), cytotoxic T cells (CD8+ cells), natural killer T cells, regulatory T cells (Tregs) and gamma-delta T cells. contains immune cells. “Cytotoxic cells” include CD8+ T cells, natural-killer (NK) cells, and neutrophils that are capable of mediating a cytotoxic response.
- NK cells refers to a type of lymphocytes derived from the bone marrow, which are natural killer cells (NK cells), which play an important role in the innate immune system. Even in the absence of major histocompatibility complexes or antibodies on the cell surface, NK cells provide a rapid immune response against virus-infected cells, tumor cells or other stressed cells.
- NK-92 ATCC® CRL-2407TM
- NK-92MI ATCC® CRL-2408TM
- Additional examples include, but are not limited to, the NK cell lines HANK1, KHYG-1, NKL, NK-YS, NOI-90, YT and NK101.
- Non-limiting exemplary sources of such commercially available cell lines are the American Type Culture Collection, or ATCC, (http://www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures (https://www.dsmz). .de/).
- the invention provides a pharmaceutical composition comprising (i) a pharmaceutically effective amount of a cell comprising a nucleic acid molecule encoding a chimeric antigen receptor as described above, or a cell comprising a vector comprising said nucleic acid molecule; And (ii) provides a pharmaceutical composition for the treatment or prevention of a B cell-related disease comprising a pharmaceutically acceptable carrier.
- composition refers to a composition formulated in a pharmaceutically acceptable or physiologically acceptable solution for administration to a cell or animal, alone or in combination with one or more other therapeutic modalities.
- the term “pharmaceutically effective amount” refers to an “effective amount” or “effective amount” of genetically modified therapeutic cells, e.g., NK cells, to achieve beneficial or desired prophylactic or therapeutic results, including clinical results. " refers to
- the term "pharmaceutically acceptable carrier, diluent or excipient” means any adjuvant, carrier, excipient, lubricant, sweetening agent, diluent, preservative, dyes/colorants, flavor enhancers, surfactants, wetting agents, dispersing agents, suspending agents, stabilizers, isotonic agents, solvents, surfactants or emulsifiers.
- pharmaceutically acceptable carriers include sugars such as lactose, glucose and sucrose; starches such as corn starch and potato starch; cellulose and its derivatives such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; tragacanth; malt; gelatin; talc; cocoa butter, wax, animal and vegetable fats, paraffin, silicone, bentonite, silicic acid, zinc oxide; oils such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols such as propylene glycol; polyols such as glycerin, sorbitol, mannitol and polyethylene glycol; esters such as ethyl oleate and ethyl laurate; Baby; buffers such as magnesium hydroxide and aluminum hydroxide; alginic acid; number of pyrogen-free; isotonic saline; Ringer's solution; ethyl alcohol
- pharmaceutically acceptable means that it does not cause allergic reactions or similar adverse reactions when administered to humans or animals.
- Such carriers include specific solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like. The use of such media and agents for pharmaceutically active substances is known in the art.
- composition of the present invention may preferably be administered by parenteral, intraperitoneal, intradermal, intramuscular, or intravenous routes.
- compositions of the present invention are administered in a therapeutically effective amount in a manner compatible with the formulation.
- dosage may be adjusted according to the condition or condition of the subject to be treated.
- parenteral administration as an aqueous injectable solution, the solution must be suitably buffered as required, first rendered isotonic with the liquid diluent with sufficient saline or glucose.
- aqueous solutions are particularly suitable for intravenous, intramuscular, subcutaneous, intradermal and intraperitoneal administration.
- Carriers, agents, and media that can be used in the pharmaceutical compositions of the present invention are known in the art (see “Remington's Pharmaceutical Sciences", 1995, 15th edition).
- the B cell related disease to be treated by the composition of the present invention is multiple myeloma, non-Hodgkin's lymphoma, B cell proliferation of uncertain malignant potential, lymphomatous granulomatosis, post-transplant lymphoproliferative.
- the B cell related disease is a B cell malignancy.
- the B cell malignancy is multiple myeloma or non-Hodgkin's lymphoma.
- a third-generation chimeric antigen receptor (CAR) structure comprising an scFv region derived from a monoclonal antibody that specifically binds BCMA was designed ( FIG. 1 ).
- the CAR of the present invention comprises (i) a signal peptide; (ii) a BCMA recognition and binding domain; (iii) a hinge region; (iv) a transmembrane domain; and a third generation chimeric antigen receptor (CAR), consisting of (v) a CD3 zeta ( ⁇ ) signaling domain as an intracellular signaling domain, and (vi) two costimulatory domains.
- CAR third generation chimeric antigen receptor
- amino acid sequence of each domain or polypeptide constituting the CAR is shown in Table 1 below.
- each domain of BCMA-CAR used in the experiment was designed as follows: (i) CD16 signal peptide; (ii) a polypeptide comprising a heavy chain variable region (VH), a light chain variable region (VL) of a single chain variant fragment (scFv) targeting BCMA, and a linker connecting the VH and VL; (iii) a CD8 ⁇ hinge region polypeptide; (iv) a transmembrane domain polypeptide of CD28; (v) intracellular domain of CD28 (costimulatory domain), linker (GGGGS), intracellular domain of CD137 (costimulatory domain), linker (GGGS), intracellular domain of CD3 zeta ( ⁇ ) (costimulatory domain) polypeptides was composed of 1b schematically shows the structure of the BCMA-CAR of the present invention.
- BCMA-CAR1 was prepared by sequentially linking the following polypeptides (i) to (v).
- VH heavy chain variable region
- VL light chain variable region
- amino acid sequences of VL and VH of scFV of BCMA-CAR1 are as follows.
- V L Light chain variable region
- L-CDR1 SGSSSNIGSNSVS (SEQ ID NO: 1)
- L-CDR2 ADSKRPS (SEQ ID NO: 2)
- L-CDR3 GSWDYSLSGYV (SEQ ID NO: 3)
- V H Heavy chain variable region
- H-CDR1 NYDMS (SEQ ID NO: 4)
- H-CDR2 WIYPSDSSIYYADSVKG (SEQ ID NO: 5)
- H-CDR3 RGPFANKYRQFDY (SEQ ID NO: 6)
- BCMA-CAR1 The entire amino acid sequence of BCMA-CAR1 is shown in SEQ ID NO: 48.
- BCMA-CAR2 was prepared by sequentially linking the following polypeptides (i) to (v).
- VH heavy chain variable region
- SEQ ID NO: 28 of scFv targeting BCMA - linker peptide (GSTSGSGKPSGEGSTKG, SEQ ID NO: 37) - light chain variable region (VL) of scFv targeting BCMA (SEQ ID NO: 27) ;
- amino acid sequences of VL and VH of scFV of BCMA-CAR2 are as follows.
- V L Light chain variable region
- L-CDR1 QGDSLRSYYVN (SEQ ID NO: 7)
- L-CDR2 DHSKRPT (SEQ ID NO: 8)
- L-CDR3 QSYDSSTV (SEQ ID NO: 9)
- V H Heavy chain variable region
- H-CDR1 NYGVH (SEQ ID NO: 10)
- H-CDR2 YISYSGGTYYNPSLKS (SEQ ID NO: 11)
- H-CDR3 RDSDDFGFDY (SEQ ID NO: 12)
- BCMA-CAR3 was prepared by sequentially linking the following polypeptides (i) to (v).
- VH heavy chain variable region (SEQ ID NO: 30) of scFv targeting BCMA - linker peptide (GSTSGSGKPSGEGSTKG, SEQ ID NO: 37) - light chain variable region (VL) of scFv targeting BCMA (SEQ ID NO: 29) ;
- amino acid sequences of VL and VH of BCMA-CAR3 scFV are as follows.
- V L Light chain variable region
- L-CDR1 KASQDIDDDIN (SEQ ID NO: 13)
- L-CDR2 DASLRAT (SEQ ID NO: 14)
- V H Heavy chain variable region
- H-CDR1 DYGLS (SEQ ID NO: 16)
- H-CDR2 LIDSSGSSTFYADSVKG (SEQ ID NO: 17)
- H-CDR3 KEHGLFDS (SEQ ID NO: 18)
- BCMA-CAR3 The entire amino acid sequence of BCMA-CAR3 is shown in SEQ ID NO: 50.
- BCMA-CAR4 was prepared by sequentially linking the following polypeptides (i) to (v).
- VH heavy chain variable region
- SEQ ID NO: 32 of scFv targeting BCMA - linker peptide (GSTSGSGKPSGEGSTKG, SEQ ID NO: 37) - light chain variable region (VL) of scFv targeting BCMA (SEQ ID NO: 31) ;
- amino acid sequences of VL and VH of scFV of BCMA-CAR4 are as follows.
- V L Light chain variable region
- EIVLTQSPGTLSLSPGERATLSC RASQGIDSYVA WYQQKPGQAPRLLIY DASLRAT GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYC QQYNSWPI TFGQGTKLEIKR (SEQ ID NO: 31)
- L-CDR1 RASQGIDSYVA (SEQ ID NO: 19)
- L-CDR2 DASLRAT (SEQ ID NO: 20)
- V H Heavy chain variable region
- H-CDR1 GHYWS (SEQ ID NO: 22)
- H-CDR2 TVSGSGGDTFYADSVKG (SEQ ID NO: 23)
- H-CDR3 RGHSVMDV (SEQ ID NO: 24)
- the polypeptide sequence of BCMA-CAR composed of the above is converted into a nucleic acid sequence by codon optimization to be suitable for protein expression in animal cells, and pSBbi-Neo (Addgene, Catalog No. 60525) was cloned and used.
- the pSBbi-Noe vector into which the four types of anti-BCMA chimeric antigen receptor (CAR) coding nucleic acid sequences (genes) BCMA-CAR1, BCMA-CAR2, BCMA-CAR3, BCMA-CAR4 were cloned in Example 1 was NK-92 Electroporation using Lonza's Nucleofector and Cell line Nucleofector Kit together with pCMV(CAT)T7-SB100 (Addgene, Catalog No. 34879), a sleeping beauty transposase expression vector, was performed on cells 4 BCMA-CAR NK cells of the species CGT301, CGT302, CGT303, and CGT304 were prepared, respectively.
- CAR chimeric antigen receptor
- CAR of the same structure including the scFv based on the J6MO antibody sequence of BMCA-ADC was used as a reference to prepare comparative NK cells (Ref).
- NK-92 cells expressing the BCMA-CAR gene were selected by treatment with kanamycin at a concentration of 200 ⁇ g/ml for 2 weeks or more.
- the BCMA-CAR NK cells thus prepared were first confirmed for expression of BCMA-CAR in the NK cells by Western blotting using an anti-phospho-CD3 ⁇ antibody ( FIG. 2 ).
- BCMA-CAR expression on the surface of NK cells was confirmed by flow cytometry using human IgG(ab')2 antibody or Hig tag conjugated-BCMA recombinant protein and PE-conjugated His antibody (FIG. 3) .
- Example 3 In vitro efficacy evaluation of BCMA-CAR expressing NK cells
- BCMA-CAR NK cells were treated with multiple myeloma cells including H929, MM1.R, OPM-2 and K562. , After reacting with other cancer cells of Jurkat, cytotoxicity assay and secretion of Granzyme B and IFN ⁇ were confirmed.
- BCMA-CAR designed in Example 1
- target cell lines expressing BCMA antigens derived from different species were prepared.
- the BCMA gene expressing myc at the BCMA terminus derived from human (h), monkey (Rh), mouse (Ms), and rat (Rat) was introduced into K562 cancer cells in which BCMA is not expressed, respectively, and analyzed by flow cytometry and Western blot analysis. Its expression was confirmed by the Ting method (FIG. 5).
- K562 K562 expressing BCMA derived from human (hu1, hu2), monkey (Rh), mouse (Ms) and rat (Rat) BCMA) cell line or K562 parent cells and BCMA-CAR1 NK, BCMA-CAR2 NK, BCMA-CAR3 NK, BCMA-CAR4 NK cells were reacted with each other, and then a cytotoxicity assay was performed and the secretion of Granzyme B and IFN ⁇ was measured. analyzed.
- BCMA-CAR1 NK cells expressing BCMA-CAR1 showed specific activity only to human-derived BCMA, and NK cells expressing BCMA-CAR2, BCMA-CAR3, and BCMA-CAR4, respectively, were reactive to non-human BCMA antigens. was shown (FIGS. 6a and 6b). Meanwhile, BCMA-CAR (Ref) derived from GSK's BCMA antibody (J6MO) used as a reference showed similar reactivity to BCMA-CAR-2, BCMA-CAR-3, and BCMA-CAR-4.
- BCMA-CAR1 NK cells In order to confirm whether the activity exhibited by BCMA-CAR1 NK cells is a BCMA-specific response, a competition assay using rhBCMA was performed. First, 1 ⁇ g of rhBCMA protein was added to BCMA-CAR NK cells (4 x 10 4 cells) and pre-incubated for 1 hour. After adding BCMA cells (aK562, 4 x 10 4 cells) and reacting for 4 hours, cytotoxicity was confirmed. As a result, it was confirmed that when the rhBCMA protein was present, the cancer cell killing ability of BCMA-CAR NK cells was reduced by about 40% ( FIG. 7 ).
- Example 5 Evaluation of in vivo anticancer efficacy of BCMA-CAR NK cells
- BCMA-CAR NK cells expressing BCMA-CAR1 was evaluated in a xenograft animal model using NOD.Cg-Prkdcscid Il2rgtm1Wjl/SzJ (NSG) mice (Jackson Laboratory, Jax #00557 strain).
- the test group (BCMA-CAR1 NK) administered with BCMA-CAR NK cells increased 20-fold compared to the size of the tumor before treatment, whereas the untreated group (Vehicle) increased it by 26-fold, In the group treated with NK cells (NKctrl) that do not express the therapeutic gene, the increase was 25-fold.
- BCMA-CAR NK cells For characterization of BCMA-CAR NK cells, cell viability, proliferation, CAR expression, cytotoxicity, etc. were evaluated while continuously cultured for 60 days. As a result, CAR expression in BCMA-CAR NK cells was maintained at over 95% even after 60 days, proliferated three-fold every 2 days, and the cytotoxicity of killing cancer cells expressing BCMA antigen was also over 60%. was kept constant as The BCMA-CAR NK cells of the present invention confirmed the characteristics of stably maintaining CAR expression and cell activity for more than 60 days as well as cell proliferation ( FIGS. 10a to 10d ).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- General Engineering & Computer Science (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Plant Pathology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Hematology (AREA)
- Physics & Mathematics (AREA)
- Oncology (AREA)
- Virology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명은 B세포 성숙화 항원(BCMA)를 표적으로 하는 키메라 항원 수용체 및 이의 용도에 관한 것이다. 본 발명의 키메라 항원 수용체를 발현하는 면역 세포는 B세포 관련 질환 특히 다발성 골수종 또는 비-호지킨 림프종의 치료 및 예방에 효과적으로 사용될 수 있다.
Description
본 발명은 B세포 성숙화 항원(BCMA)를 표적으로 하는 키메라 항원 수용체 및 이의 용도에 관한 것이다.
다발성 골수종(multiple myeloma) 또는 형질세포골수종(plasma cell myeloma)은 일반적으로 항체를 생성하는 역할을 담당하는 백혈구의 일종인 형질 세포의 암이다. 다발성 골수종 환자에서는 정상적인 형질세포가 비정상적인 암세포인 골수종 세포로 변형되어 빠르게 증식한다. 손상된 골수종세포가 골수에 점차 많은 양의 악성 골수종세포를 만들어내며, 이러한 과정은 몸의 정상적인 면역체계를 파괴한다.
다발성 골수종에 대한 치료는 멜팔란(Melphalan), 빈크리스틴(Vincristine), 독소루비신(Doxorubicin), 사이클로포스파마이드(cyclophosphamide), 부신피질호르몬제(Steroid), 볼테죠밉/벨케이드(Bortezomib/velcade), 탈리도마이드(Thalidomide), 레날리도마이드(Lenalidomide)와 같은 항암제 치료, 방사선 치료, 조혈모세포이식 및 수술적 치료 등이 있다.
키메라 항원 수용체 T 세포(Chimeric antigen receptor T cell, CAR T 세포)는 면역요법에 사용하기 위해 가공의 T 세포 수용체를 만들기 위해 유전학적으로 조작된 T 세포이다. 키메라 항원 수용체(CAR)는 T 세포에 특정 단백질을 대상으로 하는 새로운 기능을 부여하도록 조작된 수용체 단백질이다. 키메라 항원 수용체는 외부도메인(ecto domain), 막통과도메인(transmembrane domain) 및 내부도메인(endo domain)으로 구성되어 있고, 세포에 활성화 신호를 전달하는 내부도메인의 구성에 따라, 1세대, 2세대, 3세대 및 4세대로 진화하고 있다.
TNFRSF17(tumor necrosis factor receptor superfamily 17)의 일원에 속하는 막통과 당단백질인 B세포 성숙화 항원(BCMA, B cell maturation antigen)은 환자의 다발성 골수종(Multiple Myeloma, MM) 세포에서 상당히 높은 수준으로 발현된다. 또한, BCMA는 악성 B 세포, 호지킨 림프종 및 만성 림프구성 백혈병과 같은 B 림프구를 수반하는 여러 암에서 발현된다.
BCMA는 임상시험에서 유의한 치료 효과를 보여준 키메라 항원 수용체(CAR) T-세포가 표적으로 삼는 항원이다. 또한, 최근 최초의 항-BCMA 항체-약물 컨쥬게이트(anti-BCMA antibody-drug conjugate)도 항-CD38 항체, 프로테오좀(proteosome) 억제제 및 면역조절제와 같은 치료제로 치료 효과가 미약하였던 환자에게서 의미있는 임상 결과를 얻었다. 그러나, 현재까지 항-BCMA 키메라 항원 수용체(CAR)를 갖는 NK 세포의 개발 및 연구는 많은 진전이 이루어지지 않고 있다.
[선행기술문헌]
[특허문헌]
PCT/US2015/041722
PCT/US2015/064269
PCT/IB2016/051808
PCT/CN2017/096938
본 발명은 BCMA를 특이적으로 인식하는 키메라 항원 수용체(CAR) 항-BCMA CAR를 제공하고자 한다.
본 발명은 항-BCMA CAR를 인코딩하는 핵산 분자 및 상기 핵산 분자를 포함하는 벡터를 제공하고자 한다.
본 발명은 상기 핵산 분자 또는 상기 벡터를 포함하여 항-BCMA CAR를 발현하는 세포를 제공하고자 한다.
본 발명은 항-BCMA CAR를 발현하는 세포를 포함하는 조성물을 제공하고자 한다.
본 발명은 항-BCMA CAR를 발현하는 세포를 포함하는 B세포 관련 질환의 치료 또는 예방용 약학적 조성물을 제공하고자 한다.
본 발명은 항-BCMA CAR를 발현하는 세포의 B세포 관련 질환의 치료 용도를 제공하고자 한다.
본 발명은 항-BCMA CAR를 발현하는 세포를 이용한 B세포 관련 질환의 치료 방법을 제공하고자 한다.
본 발명의 일 양태에 따르면, 다음의 폴리펩티드를 포함하는 키메라 항원 수용체(Chimeric antigen receptor, CAR)를 제공한다:
(i) BCMA (B cell maturation antigen)에 특이적으로 결합하는 세포외 항원 결합 도메인;
(ii) 막 관통 도메인;
(iii) 세포내 보조 자극 신호 전달 도메인(co-stimulatory signaling domain); 및
(iv) 세포내 주요 신호 전달 도메인(primary signaling domain).
본 발명의 다른 양태에 따르면, 상기 키메라 항원 수용체를 인코딩하는 핵산 분자를 제공한다.
본 발명의 또 다른 양태에 따르면, 상기 폴리뉴클레오티드를 포함하는 벡터를 제공한다.
본 발명의 또 다른 양태에 따르면, 상기 핵산 분자 또는 상기 벡터를 포함하는 세포를 제공한다.
본 발명의 또 다른 양태에 따르면, 상기 벡터를 포함하는 세포의 약학적 유효량을 포함하는 B 세포 관련 질환의 치료 또는 예방용 약학적 조성물을 제공한다.
본 발명의 키메라 항원 수용체를 발현하는 면역 세포는 B세포 관련 질환 특히 다발성 골수종 또는 비-호지킨 림프종의 치료 및 예방에 효과적으로 사용될 수 있다.
도 1a은 본 발명의 일 구현예에 따른 BCMA-키메라 항원 수용체(CAR) 구조를 보여준다. SP는 신호 펩티드, TM은 막 관통 도메인(transmembrane domain), CS1-ICD은 세포내 보조 자극 신호전달 도메인-1(costimulatory 1-intracellular signaling domain); CS2-ICD은 세포내 보조 자극 신호전달 도메인-2(costimulatory 2-intracellular signaling domain)이다.
도 1b은 본 발명의 일 실시예에 따른 BCMA-CAR의 구조를 보다 구체적으로 도식화하여 나타낸 도면이다.
도 2는 항-phospho-CD3ζ 항체를 이용한 웨스턴 블로팅 방법으로 NK세포에 도입된 BCMA-CAR의 발현을 확인한 결과이다. CGT301, CGT302, CGT303, 및 CGT304는 각각 본 발명의 BCMA-CAR1, BCMA-CAR2, BCMA-CAR3, BCMA-CAR4를 형질 도입한 NK 세포이다.
도 3은 인간 IgG(ab')2 항체 및 Hig tag conjugated-BCMA 재조합 단백질과 PE-conjugated His 항체를 사용한 유세포 분석 방법(flow cytometry)으로 NK 세포 표면에서의 BCMA-CAR 발현을 확인한 결과이다.
도 4a는 BCMA-CAR NK 세포들의 암세포 살해능을 측정한 결과이고, 도 4b는 BCMA-CAR NK 세포들의 IFNγ 분비양을 측정한 결과이며, 도 4c는 BCMA-CAR NK 세포들의 Granzyme B의 분비양을 측정한 결과이다.
도 5는 BCMA가 발현되지 않는 K562 암세포에 인간(h), 원숭이(Rh) 또는 쥐(Ms), 랫드(Rat)유래 BCMA 유전자를 각각 도입하고 그 발현을 확인한 결과이다.
도 6a 및 도 6b은 인간(hu1, hu2), 원숭이(Rh), 마우스(Ms) 및 랫드(Rat) 유래 BCMA에 대한, 본 발명의 BCMA-CAR의 항원특이성을 확인한 결과이다.
도 7은 BCMA-CAR NK 세포의 활성이 BCMA 특이적인 반응인지를 rhBCMA 단백질과의 경쟁분석(competition assay)을 통해 확인한 결과이다.
도 8은 BCMA-CAR NK 세포의 활성이 BCMA 특이적인 반응인지를 BCMA mAb를 이용한 경쟁분석(competition assay)을 통해 확인한 결과이다.
도 9는 BCMA-CAR NK 세포의 인 비보(in vivo) 항암 효능을 측정한 결과이다.
도 10a 내지 도 10d는 BCMA-CAR NK세포의 안정성를 확인한 결과로서, 도 10a는 세포 생존능을 측정한 결과이고, 도 10b는 Population doubling time을 측정한 결과이며, 도 10c는 BCMA-CAR 발현을 측정한 결과이며, 도 10d는 세포독성을 측정한 결과이다.
본 발명의 일 양태에서, 본 발명은 다음의 폴리펩티드를 포함하는 키메라 항원 수용체(Chimeric antigen receptor, CAR)를 제공한다:
(i) BCMA (B cell maturation antigen)에 특이적으로 결합하는 세포외 항원 결합 도메인;
(ii) 막 관통 도메인;
(iii) 세포내 보조 자극 신호 전달 도메인(co-stimulatory signaling domain); 및
(iv) 세포내 주요 신호 전달 도메인(primary signaling domain).
일 구현예에서, 상기 세포외 항원 결합 도메인은 항-BCMA 항체 또는 이의 항원 결합 단편을 포함한다. 구체적으로, 상기 항원 결합 단편은 Fab 단편, Fab' 단편, F(ab)'2 단편, F(ab)'3 단편, Fv, 단쇄 Fv 항체("scFv"), 비스-scFv, (scFv)2, 미니바디, 다이아바디, 트라이아바디, 테트라바디, 다이설파이드 안정화된 Fv 단백질("dsFv"), 및 단일-도메인 항체(sdAb, 나노바디)로 이루어진 군으로부터 선택될 수 있다.
일 구현예에서, 상기 세포외 항원 결합 도메인은 (i) L-CDR(complementarity determining region)1, L-CDR2, 및 L-CDR3을 포함하는 항-BCMA 항체의 경쇄 가변 영역(light chain variable region, VL);
(ii) H-CDR1, H-CDR2, 및 H-CDR3을 포함하는 항-BCMA 항체의 중쇄 가변 영역(heavy chain variable region, VH); 또는
(iii) 하나 이상의 상기 경쇄 가변 영역(VL) 및 하나 이상의 상기 중쇄 가변 영역(VH)을 포함한다.
본 명세서에서, 용어 "특이적으로 결합한다"는 항체 또는 그의 항원 결합 단편, 또는 scFv와 같은 구성물이 생리적 조건 하에서 항원과 비교적 안정한 복합체를 형성한다는 것을 의미한다.
본 명세서에서, 용어 "가변 영역(variable region)" 은 항체를 항원에 결합시키는 것에 관련되는 항체 중쇄 또는 경쇄의 도메인을 의미한다. Native 항체의 중쇄 가변 영역(VH) 및 경쇄 가변 영역(VL)은 일반적으로 유사한 구조를 가지며, 각 도메인은 4 개의 보존된 프레임워크 영역 (framework regions, FR) 및 3 개의 초가변 영역 (hypervariable regions, HVR)을 포함한다. (Kindt et al., Kuby Immunology, 제 6 판, W.H. Freeman and Co., page 91 (2007)).
본 명세서에서, 용어 “CDR(complementarity determining region)”은 면역글로불린 중쇄 및 경쇄의 초가변 영역(hypervariable region)의 아미노산 서열을 의미한다(Kabat et al., Sequences of Proteins of Immunological Interest, 4th Ed., U.S. Department of Health and Human Services, National Institutes of Health (1987)).
중쇄 가변 영역(VH) 및 경쇄 가변 영역(VL)에는 각각 3개의 CDR (중쇄: H-CDR1, H-CDR2 및 H-CDR3; 경쇄: L-CDR1, L-CDR2 및 L-CDR3)이 포함되어 있다. CDR은 항체가 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공한다.
일 구현예에서, 상기 세포외 항원 결합도메인은 하나 이상 경쇄 가변 영역(VL)을 포함하거나, 하나 이상의 중쇄 가변 영역(VH)을 포함할 수 있으며, 예를 들어, (VL), (VL)-(VL), (VL)-(VL)-(VL), (VL)-(VL)-(VL)-(VL), (VL)-(VL)-(VL)-(VL)-(VL), 또는 (VL)-(VL)-(VL)-(VL)-(VL)-(VL)을 포함할 수 있고, 또한, (VH), (VH)-(VH), (VH)-(VH)-(VH), (VH)-(VH)-(VH)-(VH), (VH)-(VH)-(VH)-(VH)-(VH), 또는 (VH)-(VH)-(VH)-(VH)-(VH)-(VH)의 형태를 포함할 수 있다.
일 구현예에서, 상기 세포외 항원 결합도메인은 하나의 경쇄 가변 영역(VL) 및 하나의 중쇄 가변 영역(VH)이 연결된 형태를 포함할 수 있고, (VL)-(VH)와 같이 연결된 형태이거나, 그 반대 방향인 (VH)-(VL)와 같이 연결된 형태를 포함할 수 있다.
일 구현예에서, 상기 세포외 항원 결합도메인은 두개 이상의 경쇄 가변 영역(VL)에 하나 또는 두개 이상의 중쇄 가변 영역(VH)이 연결된 형태; 또는 하나 또는 두개 이상의 경쇄 가변 영역(VL)에 두 개 이상의 중쇄 가변 영역(VH)이 연결된 형태를 포함할 수 있다.
예를 들어, (VL)-(VL)-(VH), (VL)-(VL)-(VH)-(VH), (VL)-(VL)-(VH)-(VH)-(VH), (VL)-(VL)-(VH)-(VH)-(VH)-(VH), (VL)-(VL)-(VL)-(VH), (VL)-(VL)-(VL)-(VH)-(VH), (VL)-(VL)-(VL)-(VH)-(VH)-(VH), (VL)-(VH)-(VH), 또는 (VL)-(VH)-(VH)-(VH)의 형태를 포함할 수 있다.
일 구현예에서, 상기 세포외 항원 결합도메인은 두개 이상의 중쇄 가변 영역(VH)에 하나 또는 두개 이상의 경쇄 가변 영역(VL)이 연결된 형태; 또는 하나 또는 두개 이상의 경쇄 가변 영역(VL)에 두 개 이상의 중쇄 가변 영역(VH)이 연결된 형태를 포함할 수 있다. 예를 들어, (VH)-(VH)-(VL), (VH)-(VH)-(VL)-(VL), (VH)-(VH)-(VL)-(VL)-(VL), (VH)-(VH)-(VL)-(VL)-(VL)-(VL), (VH)-(VH)-(VH)-(VL), (VH)-(VH)-(VH)-(VL)-(VL), (VH)-(VH)-(VH)-(VL)-(VL)-(VL), (VL)-(VH)-(VH), (VL)-(VL)-(VH)-(VH), (VL)-(VL)-(VL)-(VH)-(VH), (VL)-(VL)-(VL)-(VL)-(VH)-(VH), 또는 (VL)-(VL)-(VL)-(VL)-(VH)-(VH)-(VH)의 형태를 포함할 수 있다.
일 구현예에서, 중쇄 가변 영역(VH)과 경쇄 가변 영역(VL)이 번갈아 가며 연결된 형태를 포함할 수 있다. 예를 들어, (VH)-(VL)-(VH), (VH)-(VL)-(VH)-(VL), (VH)-(VL)-(VH)-(VL)-(VH), (VL)-(VH)-(VL), (VL)-(VH)-(VL)-(VH), (VL)-(VH)-(VL)-(VH)-(VL)의 형태를 포함할 수 있다.
일 구현예에서,
상기 L-CDR1은 서열번호 1, 서열번호 7, 서열번호 13, 또는 서열번호 19의 아미노산 서열의 폴리펩티드이고;
상기 L-CDR2은 서열번호 2, 서열번호 8, 서열번호 14, 또는 서열번호 20의 아미노산 서열의 폴리펩티드이고;
상기 L-CDR3은 서열번호 3, 서열번호 9, 서열번호 15, 또는 서열번호 21의 아미노산 서열의 폴리펩티드이고;
상기 H-CDR1은 서열번호 4, 서열번호 10, 서열번호 16, 또는 서열번호 22의 아미노산 서열의 폴리펩티드이고;
상기 H-CDR2은 서열번호 5, 서열번호 11, 서열번호 17, 또는 서열번호 23의 아미노산 서열의 폴리펩티드이고;
상기 H-CDR3은 서열번호 6, 서열번호 12, 서열번호 18, 또는 서열번호 24의 아미노산 서열의 폴리펩티드이다.
일 구현예에서, 상기 세포외 항원 결합 도메인은 서열번호 4의 H-CDR1, 서열번호 5의 H-CDR2, 및 서열번호 6의 H-CDR3를 포함하는 항-BCMA 항체의 중쇄 가변 영역(VH); 및 서열번호 1의 L-CDR1, 서열번호 2의 L-CDR2, 및 서열번호 3의 L-CDR3를 포함하는 항-BCMA 항체의 경쇄 가변 영역(VL)을 포함할 수 있다.
일 구현예에서, 상기 세포외 항원 결합 도메인은 서열번호 10의 H-CDR1, 서열번호 11의 H-CDR2, 및 서열번호 12의 H-CDR3를 포함하는 항-BCMA 항체의 중쇄 가변 영역(VH); 및 서열번호 7의 L-CDR1, 서열번호 8의 L-CDR2, 및 서열번호 9의 L-CDR3를 포함하는 항-BCMA 항체의 경쇄 가변 영역(VL)을 포함할 수 있다.
일 구현예에서, 상기 세포외 항원 결합 도메인은 서열번호 16의 H-CDR1, 서열번호 17의 H-CDR2, 및 서열번호 18의 H-CDR3를 포함하는 항-BCMA 항체의 중쇄 가변 영역(VH); 및 서열번호 13의 L-CDR1, 서열번호 14의 L-CDR2, 및 서열번호 15의 L-CDR3를 포함하는 항-BCMA 항체의 경쇄 가변 영역(VL)을 포함할 수 있다.
일 구현예에서, 상기 세포외 항원 결합 도메인은 서열번호 22의 H-CDR1, 서열번호 23의 H-CDR2, 및 서열번호 24의 H-CDR3를 포함하는 항-BCMA 항체의 중쇄 가변 영역(VH); 및 서열번호 19의 L-CDR1, 서열번호 20의 L-CDR2, 및 서열번호 21의 L-CDR3를 포함하는 항-BCMA 항체의 경쇄 가변 영역(VL)을 포함할 수 있다.
일 구현예에서, 상기 세포외 항원 결합 도메인은
(i) 서열번호 25, 서열번호 27, 서열번호 29, 및 서열번호 31의 폴리펩티드로 이루어지는 군에서 선택되는 하나 이상의 항-BCMA 항체의 경쇄 가변 영역(VL); 및
(ii) 서열번호 26, 서열번호 28, 서열번호 30, 및 서열번호 32의 폴리펩티드로 이루어지는 군에서 선택되는 하나 이상의 항-BCMA 항체의 중쇄 가변 영역(VH) 중 하나 또는 둘 이상을 포함한다.
본 발명에서 상기 경쇄 가변 영역(VL) 및 중쇄 가변 영역(VH)의 조합은 상술한 조합과 같다.
구체적으로, 하나 이상 경쇄 가변 영역(VL)을 포함하거나, 하나 이상의 중쇄 가변 영역(VH)을 포함할 수 있으며, 예를 들어, (VL), (VL)-(VL), (VL)-(VL)-(VL), (VL)-(VL)-(VL)-(VL), (VL)-(VL)-(VL)-(VL)-(VL), 또는 (VL)-(VL)-(VL)-(VL)-(VL)-(VL)을 포함할 수 있고, 또한, (VH), (VH)-(VH), (VH)-(VH)-(VH), (VH)-(VH)-(VH)-(VH), (VH)-(VH)-(VH)-(VH)-(VH), 또는 (VH)-(VH)-(VH)-(VH)-(VH)-(VH)의 형태를 포함할 수 있다.
또한, 하나의 경쇄 가변 영역(VL) 및 하나의 중쇄 가변 영역(VH)이 연결된 형태를 포함할 수 있고, (VL)-(VH)와 같이 연결된 형태이거나, 그 반대 방향인 (VH)-(VL)와 같이 연결된 형태일 수 있다.
또한, (VL)-(VL)-(VH), (VL)-(VL)-(VH)-(VH), (VL)-(VL)-(VH)-(VH)-(VH), (VL)-(VL)-(VH)-(VH)-(VH)-(VH), (VL)-(VL)-(VL)-(VH), (VL)-(VL)-(VL)-(VH)-(VH), (VL)-(VL)-(VL)-(VH)-(VH)-(VH), (VL)-(VH)-(VH), (VL)-(VH)-(VH)-(VH), 또는 (VL)-(VH)-(VH)-(VH)-(VH)의 형태를 포함할 수 있으며,
또한, (VH)-(VH)-(VL), (VH)-(VH)-(VL)-(VL), (VH)-(VH)-(VL)-(VL)-(VL), (VH)-(VH)-(VL)-(VL)-(VL)-(VL), (VH)-(VH)-(VH)-(VL), (VH)-(VH)-(VH)-(VL)-(VL), (VL)-(VH)-(VH), (VL)-(VL)-(VH)-(VH), (VL)-(VL)-(VL)-(VH)-(VH), (VL)-(VL)-(VL)-(VL)-(VH)-(VH), (VL)-(VL)-(VL)-(VL)-(VH)-(VH)-(VH)의 형태를 포함할 수 있다.
일 구현예에서, 중쇄 가변 영역(VH)과 경쇄 가변 영역(VL)이 번갈아 가며 연결된 형태를 포함할 수 있다. 예를 들어, (VH)-(VL)-(VH), (VH)-(VL)-(VH)-(VL), (VH)-(VL)-(VH)-(VL)-(VH), (VL)-(VH)-(VL), (VL)-(VH)-(VL)-(VH), (VL)-(VH)-(VL)-(VH)-(VL)의 형태를 포함할 수 있다.
일 구현예에서, 상기 세포외 항원 결합 도메인은 서열번호 26의 항-BCMA 항체의 중쇄 가변 영역(VH); 및 서열번호 25의 항-BCMA 항체의 경쇄 가변 영역(VL)을 포함할 수 있다.
일 구현예에서, 상기 세포외 항원 결합 도메인은 서열번호 28의 항-BCMA 항체의 중쇄 가변 영역(VH); 및 서열번호 27의 항-BCMA 항체의 경쇄 가변 영역(VL)을 포함할 수 있다.
일 구현예에서, 상기 세포외 항원 결합 도메인은 서열번호 30의 항-BCMA 항체의 중쇄 가변 영역(VH); 및 서열번호 29의 항-BCMA 항체의 경쇄 가변 영역(VL)을 포함할 수 있다.
일 구현예에서, 상기 세포외 항원 결합 도메인은 서열번호 32의 항-BCMA 항체의 중쇄 가변 영역(VH); 및 서열번호 31의 항-BCMA 항체의 경쇄 가변 영역(VL)을 포함할 수 있다.
일 구현예에서, 본 발명의 키메라 항원 수용체는 둘 이상의 경쇄 또는 중쇄 가변 영역 사이에 위치하는 링커를 더 포함할 수 있다.
일 구현예에서, 상기 링커는 서열번호 37 또는 서열번호 38의 아미노산 서열의 폴리펩티드일 수 있다.
일 구현예에서, 본 발명의 상기 세포외 항원 결합 도메인은 막 관통 도메인과 연결되는 힌지 영역(hinge region)을 더 포함할 수 있다.
일 구현예에서, 상기 힌지 영역은 IgG1, IgG4, 또는 CD8α의 힌지 영역을 포함한다.
일 구현예에서, 상기 IgG1 힌지 영역은 서열번호 39의 아미노산 서열의 폴리펩티드를 포함하고; 상기 IgG4 힌지 영역은 서열번호 40의 아미노산 서열의 폴리펩티드를 포함하고; 상기 CD8α 힌지 영역은 서열번호 41의 아미노산 서열의 폴리펩티드를 포함한다.
일 구현예에서, 상기 막 관통 도메인은 CD8 알파 또는 CD28의 막 관통 영역을 포함한다.
일 구현예에서, 상기 CD8 알파 막 관통 영역은 서열번호 42의 아미노산 서열의 폴리펩티드를 포함하고, 상기 CD28 막 관통 영역은 서열번호 43의 아미노산 서열의 폴리펩티드를 포함한다.
일 구현예에서, 상기 세포내 보조 자극 신호 전달 도메인은 CD28, DAP10, 또는 CD137(4-1BB)의 세포내 보조 자극 신호 전달 도메인을 포함한다.
일 구현예에서, 상기 CD28 세포내 보조 자극 신호 전달 도메인은 서열번호 44의 아미노산 서열의 폴리펩티드를 포함한다.
상기 DAP10 세포내 보조 자극 신호 전달 도메인은 서열번호 45의 아미노산 서열의 폴리펩티드를 포함한다.
상기 CD137(4-1BB) 세포내 보조 자극 신호 전달 도메인은 서열번호 46의 아미노산 서열의 폴리펩티드를 포함한다.
일 구현예에서, 세포내 주요 신호 전달 도메인은 CD3 제타(ζ)의 세포내 도메인을 포함한다.
일 구현예에서, 상기 CD3 제타(ζ) 세포내 도메인은 서열번호 47의 아미노산 서열의 폴리펩티드를 포함한다.
일 구현예에서, 상기 세포내 보조 자극 신호 전달 도메인 및/또는 상기 세포내 주요 신호 전달 도메인은 링커에 의해 연결될 수 있다.
일 구현예에서, 상기 세포내 보조 자극 신호 전달 도메인 및/또는 상기 세포내 주요 신호 전달 도메인을 연결하는 상기 링커는 서열번호 38의 아미노산 서열의 폴리펩티드이다.
일 구현예에서, 상기 세포외 항원 결합 도메인은 신호 펩티드(signal peptide)를 더 포함한다.
일 구현예에서, 상기 신호 펩티드는 CD16, GM-CSF, 인간 IgG, 또는 CD8의 신호 펩티드를 포함한다.
일 구현예에서, 상기 CD16의 신호 펩티드는 서열번호 33의 아미노산 서열의 폴리펩티드를 포함하고; 상기 GM-CSF의 신호 펩티드는 서열번호 34의 아미노산 서열의 폴리펩티드를 포함하고; 상기 인간 IgG의 신호 펩티드는 서열번호 35의 아미노산 서열의 폴리펩티드를 포함하고; 상기 CD8의 신호 펩티드는 서열번호 36의 아미노산 서열의 폴리펩티드를 포함한다.
일 구현예에서, 본 발명의 키메라 항원 수용체는 상술한 항-BCMA 항체의 중쇄 가변 영역(VH) 및 경쇄 가변 영역(VL); CD8α 힌지 영역; CD28 막 관통 영역; CD137(4-1BB) 보조 자극 신호전달도메인; 및 CD3 제타(ζ) 세포내 도메인을 포함할 수 있다.
본 발명의 하기 실시예를 참조하여 본 발명의 보다 구체적인 키메라 항원 수용체를 구성하는 폴리펩티드의 구성은 도 1b로 표현될 수 있으나, 본 발명의 키메라 항원 수용체가 도 1b의 구성으로 한정되는 것은 아니다.
본 발명의 다른 양태에서, 본 발명은 상기 설명된 키메라 항원 수용체를 인코딩하는 핵산 분자를 제공한다.
본 명세서에서 용어 “핵산 분자”는 폴리뉴클레오타이드로서, DNA 및 RNA를 포함하는 의미이고, 상기 DNA는 gDNA(genomic DNA) 및 cDNA(complementary DNA)를 포함하고, 상기 RNA는 mRNA (messenger RNA)을 포함한다. 상기 mRNA는 본 발명의 키메라 항원 수용체의 번역(translation)을 지시할 수 있는 핵산 분자로서 프라이머리 전사 mRNA(primary transcript mRNA) 분자 또는 성숙 mRNA (mature mRNA) 분자를 포함할 수 있다. 상기 핵산 분자의 기본 구성 단위인 뉴클레오타이드는 자연의 뉴클레오타이드 뿐만 아니라 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다(Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews, 90:543-584(1990)).
본 발명의 핵산 분자 또는 폴리뉴클레오타이드는 화학적 합성, 재조합 방법 또는 PCR을 사용하여 얻을 수 있으며, 핵산 분자의 화학적 합성 방법은 관련 기술분야에 널리 공지되어 있으므로, 관련 기술분야의 통상의 기술자는 본 명세서에서 제공되는 서열 및 상업적 핵산 분자 합성기를 이용하여 목적하는 서열의 핵산 분자를 용이하게 합성할 수 있다.
본 발명의 다른 양태에서, 본 발명은 상기 핵산 분자를 포함하는 벡터를 제공한다.
상기 벡터는 클로닝 벡터 또는 상기 키메라 항원 수용체를 안정적으로 발현하는 발현 벡터일 수 있다.
상기 벡터는 복제원점(origin of replication)을 포함할 수 있으며, 예컨대 진핵세포에서 작동하는 f1 복제원점, SV 복제원점, pMB1 복제원점, Adeno 복제원점, AAV 복제원점 및 BBV 복제원점 등을 포함할 수 있으나, 이에 한정되지 않는다. 상기 벡터는 선택표지로서 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함하며, 예를 들어 앰피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 게네티신, 네오마이신, 푸로마이신 및 테트라사이클린에 대한 내성 유전자를 포함할 수 있다.
본 발명의 벡터에서 상술한 키메라 항원 수용체를 인코딩하는 핵산 분자는 이의 발현을 개시하는 프로모터 서열과 작동 가능하게 연결될 수 있다. 상기 프로모터는 포유동물 세포의 게놈으로부터 유래된 프로모터 (예: 메탈로티오닌 프로모터, EF-1 alpha 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터 (예: 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스(CMV) 프로모터 및 HSV의 tk 프로모터)가 이용될 수 있고, 전사 종결서열로서 폴리아데닐화 서열이 포함되며, 예를 들어 SV40 polA 서열 및 BGH polA 서열 등을 포함할 수 있다.
일 구현예에서, 상기 벡터 또는 재조합 벡터는 트랜스포존 벡터, 에피솜 벡터, 또는 바이러스 벡터이다.
다른 구현예에서, 상기 바이러스 벡터는 레트로바이러스 벡터 또는 렌티바이러스 벡터이다.
특정 실시형태에서, 렌티바이러스 벡터는 인간 면역결핍 바이러스 1(HIV-1); 인간 면역결핍 바이러스2(HIV-2), 비스나-매디 바이러스(visna-maedi virus: VMV) 바이러스; 염소 관절염-뇌염 바이러스(CAEV); 말 전염성 빈혈 바이러스(EIAV); 고양이 면역결핍 바이러스(FIV); 소 면역 결핍 바이러스(BIV); 및 유인원 면역결핍바이러스(SIV)로 본질적으로 이루어진 군으로부터 선택된다.
본 발명의 다른 양태에서, 본 발명은 상기 핵산 분자를 포함하는 세포, 또는 상기 설명된 벡터를 포함하는 세포를 제공한다.
본 발명에서 벡터는 세포내로 도입될 수 있다. 벡터를 세포내로 도입하는 방법은 공지된 트랜스펙션(transfection) 방법을 사용할 수 있으며, 예를 들어 미세 주입법 (Capecchi, M.R., Cell 22, 479 (1980)), 칼슘 포스페이트 침전법 (Graham, F.L. et al., Virology 52, 456 (1973)), 전기 천공법 (Neumann, E. et al., EMBO J. 1, 841 (1982)), 리포좀-매개 형질감염법 (Wong, T.K. et al., Gene, 10, 87 (1980)), DEAE-덱스트란 처리법 (Gopal, Mol. Cell Biol. 5, 1188-1190 (1985)), 및 유전자 밤바드먼트 (Yang et al., Proc. Natl. Acad. Sci. USA 87, 9568-9572 (1990)) 등이 있으나, 이에 한정되지 않는다.
세포내로 도입된 벡터는 세포내에서 비-통합 벡터(예컨대, 플라스미드)로서 유지될 수 있거나, 또는 숙주 세포의 염색체 DNA의 일부분으로 통합될 수 있다.
본 발명의 상기 설명된 키메라 항원 수용체를 인코딩하는 핵산 분자(폴리뉴클레오티드)를 포함하는 벡터를 포함하는 세포는, 상기 키메라 항원 수용체를 세포내에서 안정적으로 발현하고, 발현된 키메라 항원 수용체는 세포막 부위에 안정적으로 위치한다.
일 구현예에서, 본 발명의 키메라 항원 수용체를 인코딩하는 핵산 분자(예를 들어, cDNA 또는 mRNA 분자)를 포함하는 세포를 제공할 수 있다.
본 발명의 키메라 항원 수용체의 전사 및 번역(translation)을 지시할 수 있는 cDNA가 포함된 세포는 키메라 항원 수용체를 세포 내에서 안정적으로 발현할 수 있다.
본 발명의 키메라 항원 수용체의 번역을 지시할 수 있는 프라이머리 전사 mRNA(primary transcript mRNA), 또는 성숙 mRNA (mature mRNA)를 직접 세포 내로 도입하여 키메라 항원 수용체의 세포 내 발현을 유도할 수 있다.
일 구현예에서, 상기 벡터가 도입되는 세포는 면역세포이고, 바람직하게는 NK (Natural Killer) 세포, T 세포, 세포독성 (cytotoxic) T 세포 또는 조절 (regulatory) T 세포일 수 있다. 바람직하게는 상기 세포는 인간 유래 면역 세포이며, 보다 바람직하게는 인간 유래 NK 세포일 수 있다.
본 발명에서 “T 세포”는 흉선에서 성숙하는 림프구의 종류를 지칭한다. T 세포는 세포-매개 면역에서 중요한 역할을 하며, 세포 표면에 T 세포 수용체의 존재에 의해 B 림프구와 같은 다른 림프구와 구별된다. T 세포는 또한 분리되거나 상업적으로 이용가능한 공급원으로부터 얻을 수 있다. T 세포는 헬퍼 T 세포(CD4+ 세포), 세포독성(cytotoxic) T 세포(CD8+ cells), 자연살해 T 세포, 조절 T 세포(Treg) 및 감마-델타 T 세포를 포함하여 CD3를 발현하는 모든 종류의 면역세포를 포함한다. “세포독성 세포”는 세포독성 반응을 매개할 수 있는 CD8+ T 세포, NK(natural-killer) 세포, 및 호중구를 포함한다.
본 발명에서 “NK 세포”는 자연살해세포(natural killer cell, NK cell)로서, 선천성 면역 체계(innate immune system)에서 중요한 역할을 하는, 골수에서 유래한 림프구의 종류를 지칭한다. 세포 표면에 주요 조직 적합 유전자 복합체(major histocompatibility complex) 또는 항체가 없어도, NK 세포는 바이러스 감염된 세포, 종양 세포 또는 다른 스트레스를 받은 세포(stressed cell)에 대한 빠른 면역 반응을 제공한다. 상업적 NK 세포주의 비제한적 예시는 NK-92 (ATCC® CRL-2407™), NK-92MI (ATCC® CRL-2408™)을 포함한다. 추가적인 예시는 NK 세포주 HANK1, KHYG-1, NKL, NK-YS, NOI-90, YT 및 NK101를 포함하지만 이에 한정되지는 않는다. 이러한 상업적으로 이용가능한 세포주의 비제한적 예시적 공급원은 American Type Culture Collection, 또는 ATCC, (http://www.atcc.org/) 및 the German Collection of Microorganisms and Cell Cultures (https://www.dsmz.de/)를 포함한다.
본 발명의 다른 양태에서, 본 발명은 (i) 상기 설명된 키메라 항원 수용체를 인코딩하는 핵산 분자를 포함하는 세포, 또는 상기 핵산 분자를 포함하는 벡터를 포함하는 세포의 약학적 유효량; 및 (ii) 약학적으로 허용되는 담체를 포함하는 B 세포 관련 질환의 치료 또는 예방용 약학적 조성물을 제공한다.
본 명세서에서 용어 "약학적 조성물"은 세포 또는 동물에게 단독으로 또는 하나 이상의 다른 치료 방식과 함께 투여하기 위한 약학적으로 허용 가능한 또는 생리학적으로 허용 가능한 용액 중에 제형화된 조성물을 지칭한다.
본 명세서에서, "약학적 유효량" 이라는 용어는 임상 결과를 비롯하여 이롭거나 목적하는 예방학적 또는 치료학적 결과를 성취하기 위한 유전자 변형된 치료학적 세포, 예를 들어 NK 세포의 "유효한 양" 또는 "유효량"을 지칭한다.
본 명세서에서 용어 "약제학적으로 허용 가능한 담체, 희석제 또는 부형제"는 미국 식품 의약품 안전청에서 인간 또는 가축에 사용하기에 허용 가능한 것으로서 승인된 임의의 보조제, 담체, 부형제, 윤활제, 감미제, 희석제, 보존제, 염료/착색제, 풍미 증진제, 계면활성제, 습윤제, 분산제, 현탁제, 안정제, 등장화제, 용매, 계면활성제 또는 유화제를 포함하지만 이들로 제한되는 것은 아니다. 예컨대, 약학적으로 허용 가능한 담체는 당, 예를 들어 락토스, 글루코스 및 수크로스; 전분, 예를 들어 옥수수 전분 및 감자 전분; 셀룰로스 및 이의 유도체, 예를 들어 나트륨 카복시메틸 셀룰로스, 에틸 셀룰로스 및 셀룰로스 아세테이트; 트라가칸트; 맥아; 젤라틴; 활석; 코코아 버터, 왁스, 동물 및 식물성 지방, 파라핀, 실리콘, 벤토나이트, 규산, 산화 아연; 오일, 예를 들어 땅콩유, 면실유, 잇꽃유, 참깨유, 올리브유, 옥수수유 및 대두유; 글리콜, 예를 들어 프로필렌 글리콜; 폴리올, 예를 들어 글리세린, 소르톨, 만니톨 및 폴리에틸렌 글리콜; 에스터, 예를 들어 에틸 올레에이트 및 에틸 라우레이트; 아가; 완충제, 예를 들어 수산화 마그네슘 및 수산화 알루미늄; 알긴산; 무-발열원 수; 등장성 염수; 링거액; 에틸 알콜; 포스페이트 완충 용액; 및 약제학적 제형에 사용되는 임의의 다른 상용성 물질을 포함하지만 이들로 제한되는 것은 아니다.
상기 용어 "약학적으로 허용되는"은 사람 또는 동물에게 투여되었을 때 알레르기 반응이나 유사한 불리한 반응을 야기하지 않는다는 것을 의미한다. 이러한 담체로는 특정 용매, 분산매질, 코팅제, 항균제 및 항진균제, 등장제 및 흡수지연제 등을 포함한다. 약학적으로 활성인 물질에 이러한 매질 및 제제를 사용하는 것은 당업계에 공지되어 있다.
본 발명의 약학적 조성물은 바람직하게는 비경구, 복강내, 진피내, 근육내, 정맥내 경로로 투여될 수 있다.
본 발명의 약학적 조성물은 제형과 양립되는 방식으로 치료적으로 효과적인 양으로 투여된다. 또한, 치료될 대상의 상태 또는 조건에 따라 투여량을 조절할 수 있다. 수성의 주사 용액으로 비경구 투여하기 위하여, 용액은 필요에 따라 적합하게 완충되어야 하며, 먼저 액체 희석제를 충분한 식염수 또는 글루코오스로 등장성으로 만든다. 이들 특수한 수성 용액은 특히 정맥내, 근육내, 피하, 진피내 및 복강내 투여에 적합하다.
본 발명의 약학적 조성물에 사용될 수 있는 담체 및 제제, 매질에 대한 내용은 당업계에 공지되어 있다 ("Remington's Pharmaceutical Sciences", 1995, 15판 참조).
일 구현예에서, 본 발명 조성물의 치료 대상인 B 세포 관련 질환은 다발성 골수종, 비-호지킨 림프종(non-Hodgkin's lymphoma), 불확실한 악성 잠재성의 B 세포 증식, 림프종모양 육아종증, 이식-후 림프증식성 장애, 면역조절 장애, 류마티스성 관절염, 중증 근무력증, 특발성 혈소판감소성 자반증, 항-인지질 증후군, 샤가스병(Chagas' diease), 그레이브스병(Grave's diease), 베게너 육아종증(Wegener's granulomatosis), 결절성 다발동맥염, 쇼그렌 증후군(Sjogren's syndrome), 심상성 천포창, 피부경화증, 다발성 경화증, 항-인지질 증후군, ANCA 연관 혈관염, 굿파스쳐병(Goodpasture's diease), 가와사키병, 자가면역 용혈성 빈혈, 및 급속 진행성 사구체신염, 중쇄병, 원발성 또는 면역세포-연관 아밀로이드증, 또는 미확정 단클론성 감마병증(monoclonal gammopathy of undetermined significance)이다.
일 구현예에서, 상기 B 세포 관련 질환은 B 세포 악성 종양이다.
일 구현예에서, 상기 B 세포 악성 종양은 다발성 골수종 또는 비-호지킨 림프종이다.
본 명세서에서 설명된 하기의 구체적인 실시예는 본 발명의 바람직한 구현예 또는 예시를 대표하는 의미이며, 이에 의해 본 발명의 범위가 한정되지는 않는다. 본 발명의 변형과 다른 용도가 본 명세서 특허청구범위에 기재된 발명의 범위로부터 벗어나지 않는다는 것은 당업자에게 명백하다.
실시예
실시예 1. BCMA-CAR의 제작
BCMA-CAR의 디자인
BCMA에 특이적으로 결합하는 단일클론항체로부터 유래한 scFv 부위를 포함하는 3세대 키메라 항원 수용체(CAR) 구조를 디자인하였다(도 1).
본 발명의 CAR는 다음과 같이 (i) 신호 펩타이드; (ii) BCMA 인식 및 결합 도메인; (iii) 힌지 영역; (iv) 막 관통 도메인; 및 세포내 신호전달 도메인으로서 (v) CD3 제타(ζ) 신호전달 도메인, 및 (vi) 두 개의 보조 자극 도메인으로 구성된, 제3 세대 키메라 항원 수용체(CAR)이다.
상기 CAR를 구성할 수 있는 각각의 도메인 또는 폴리펩티드의 아미노산 서열은 하기 표 1에 나타내었다.
서 열 정 보 | 설명 | 서열번호 |
MWQLLLPTALLLLVSA | CD16 신호 펩타이드 | 33 |
MWLQSLLLLGTVACSIS | GM-CSF 신호 펩타이드 | 34 |
MDWTWRILFLVAAATGAHS | 인간 IgG 신호 펩타이드 | 35 |
MALPVTALLLPLALLLHAARP | CD8 신호 펩타이드 | 36 |
QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNSVSWYQQLPGTAPKLLIYADSKRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGSWDYSLSGYVFGGGTKLTVL | scFv의 VL (경쇄가변영역 1) |
25 |
QSVLTQPPSASGTPGQRVTISCQGDSLRSYYVNWYQQLPGTAPKLLIYDHSKRPTGVPDRFSGSKSGTSASLAISGLRSEDEADYYCQSYDSSTVVFGGGTKLTVLG | scFv의 VL (경쇄가변영역 2) |
27 |
EIVLTQSPGTLSLSPGERATLSCKASQDIDDDINWYQQKPGQAPRLLIYDASLRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQSLRTPITFGQGTKLEIKR | scFv의 VL (경쇄가변영역 3) | 29 |
EIVLTQSPGTLSLSPGERATLSCRASQGIDSYVAWYQQKPGQAPRLLIYDASLRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYNSWPITFGQGTKLEIKR | scFv의 VL (경쇄가변영역 4) | 31 |
EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYDMSWVRQAPGKGLEWVSWIYPSDSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGPFANKYRQFDYWGQGTLVTVSS | scFv의 VH (중쇄가변영역 1) | 26 |
EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYGVHWVRQAPGKGLEWVSYISYSGGTYYNPSLKSRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDSDDFGFDYWGQGTLVTVSS | scFv의 VH (중쇄가변영역 2) | 28 |
EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYGLSWVRQAPGKGLEWVSLIDSSGSSTFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEHGLFDSWGQGTLVTVSS | scFv의 VH (중쇄가변영역 3) | 30 |
EVQLLESGGGLVQPGGSLRLSCAASGFTFSGHYWSWVRQAPGKGLEWVSTVSGSGGDTFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGHSVMDVWGQGTLVTVSS | scFv의 VH (중쇄가변영역 4) | 32 |
GSTSGSGKPSGEGSTKG | 링커 펩타이드 1 Whitlow Linker |
37 |
GGGGS | 링커 펩타이드 2 | 38 |
EPKSCDKTHTCPPCP | IgG1 알파 힌지 영역 | 39 |
ESKYGPPCPSCP | IgG4 알파 힌지 영역 | 40 |
ALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEASRPAAGGAVHTRGLD | CD8 알파 힌지 영역 | 41 |
AWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEE | CD8 알파 막 관통 도메인 | 42 |
KPFWVLVVVGGVLACYSLLVTVAFIIFWV | CD28 막 관통 도메인 | 43 |
RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS | CD28 보조 자극 도메인 | 44 |
GGGGS | 링커 펩타이드 2 | 38 |
LCARPRRSPAQEDGKVYINMPGRG | DAP10 보조 자극 도메인 | 45 |
KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL | CD137 보조 자극 도메인 | 46 |
GGGGS | 링커 펩타이드 2 | 38 |
RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR | CD3제타 신호전달 도메인 | 47 |
4종류의 BCMA-CAR의 설계
구체적으로, 제작하여 실험에 사용한 BCMA-CAR의 각각의 도메인은 다음과 같이 설계하였다: (i) CD16 신호 펩타이드(signal peptide); (ii) BCMA를 표적으로 하는 scFv (single chain variant fragment)의 중쇄가변영역(VH), 경쇄가변영역(VL) 및 상기 VH 와 VL를 연결하는 링커를 포함하는 폴리펩티드; (iii) CD8α 힌지 영역(hinge region) 폴리펩티드; (iv) CD28의 막 관통 도메인(transmembrane domain) 폴리펩티드; (v) CD28의 세포내 도메인(보조 자극 도메인), 링커(GGGGS), CD137의 세포내 도메인(보조 자극 도메인), 링커(GGGS), CD3 제타(ζ)의 세포내 도메인(보조 자극 도메인) 폴리펩티드로 구성하였다. 도 1b에 본 발명의 BCMA-CAR의 구조를 도식화하여 나타내었다.
BCMA-CAR1의 제조
BCMA-CAR1은 다음의 폴리펩티드 (i) 내지 (v)를 순차적으로 연결한 구성으로 제조하였다.
(i) CD16 신호 펩타이드(서열번호 33);
(ii) BCMA를 표적으로 하는 scFv의 중쇄가변영역(VH)(서열번호 26) - 링커 펩티드(GSTSGSGKPSGEGSTKG, 서열번호 37) - BCMA를 표적으로 하는 scFv의 경쇄가변영역(VL)(서열번호 25);
(iii) CD8α 힌지 영역(hinge region) 폴리펩티드(서열번호 41);
(iv) CD28의 막 관통 도메인(transmembrane domain) 폴리펩티드 (서열번호 43);
(v) CD28의 세포내 도메인(서열번호 44)- 링커(GGGGS) - CD137의 세포내 도메인(서열번호 46) - 링커(GGGGS) - CD3 제타(ζ) 세포내 도메인(서열번호 47)
BCMA-CAR1의 scFV의 VL 및 VH의 아미노산 서열은 다음과 같다.
- Light chain variable region (VL) aa sequence (110 aa):
QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNSVSWYQQLPGTAPKLLIYADSKRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGSWDYSLSGYVFGGGTKLTVL (서열번호 25)
L-CDR1 : SGSSSNIGSNSVS (서열번호 1)
L-CDR2 : ADSKRPS (서열번호 2)
L-CDR3 : GSWDYSLSGYV (서열번호 3)
- Heavy chain variable region (VH) aa sequence (121 aa):
EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYDMSWVRQAPGKGLEWVSWIYPSDSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGPFANKYRQFDYWGQGTLVTVSS (서열번호 26)
H-CDR1 : NYDMS (서열번호 4)
H-CDR2 : WIYPSDSSIYYADSVKG (서열번호 5)
H-CDR3 : RGPFANKYRQFDY (서열번호 6)
BCMA-CAR1의 전체 아미노산 서열은 서열번호 48에 나타내었다.
BCMA-CAR2의 제조
BCMA-CAR2는 다음의 폴리펩티드 (i) 내지 (v)를 순차적으로 연결한 구성으로 제조하였다.
(i) CD16 신호 펩타이드(서열번호 33);
(ii) BCMA를 표적으로 하는 scFv의 중쇄가변영역(VH)(서열번호 28) - 링커 펩티드(GSTSGSGKPSGEGSTKG, 서열번호 37) - BCMA를 표적으로 하는 scFv의 경쇄가변영역(VL)(서열번호 27);
(iii) CD8α 힌지 영역(hinge region) 폴리펩티드(서열번호 41);
(iv) CD28의 막 관통 도메인(transmembrane domain) 폴리펩티드 (서열번호 43);
(v) CD28의 세포내 도메인(서열번호 44)- 링커(GGGGS) - CD137의 세포내 도메인(서열번호 46) - 링커(GGGGS) - CD3 제타(ζ) 세포내 도메인(서열번호 47)
BCMA-CAR2의 scFV의 VL 및 VH의 아미노산 서열은 다음과 같다.
- Light chain variable region (VL) aa sequence (107 aa):
QSVLTQPPSASGTPGQRVTISCQGDSLRSYYVNWYQQLPGTAPKLLIYDHSKRPTGVPDRFSGSKSGTSASLAISGLRSEDEADYYCQSYDSSTVVFGGGTKLTVLG (서열번호 27)
L-CDR1 : QGDSLRSYYVN (서열번호 7)
L-CDR2 : DHSKRPT (서열번호 8)
L-CDR3 : QSYDSSTV (서열번호 9)
- Heavy chain variable region (VH) aa sequence (117 aa):
EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYGVHWVRQAPGKGLEWVSYISYSGGTYYNPSLKSRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDSDDFGFDYWGQGTLVTVSS (서열번호 28)
H-CDR1 : NYGVH (서열번호 10)
H-CDR2 : YISYSGGTYYNPSLKS (서열번호 11)
H-CDR3 : RDSDDFGFDY (서열번호 12)
BCMA-CAR2의 전체 아미노산 서열은 서열번호 49에 나타내었다.
BCMA-CAR3의 제조
BCMA-CAR3은 다음의 폴리펩티드 (i) 내지 (v)를 순차적으로 연결한 구성으로 제조하였다.
(i) CD16 신호 펩타이드(서열번호 33);
(ii) BCMA를 표적으로 하는 scFv의 중쇄가변영역(VH)(서열번호 30) - 링커 펩티드(GSTSGSGKPSGEGSTKG, 서열번호 37) - BCMA를 표적으로 하는 scFv의 경쇄가변영역(VL)(서열번호 29);
(iii) CD8α 힌지 영역(hinge region) 폴리펩티드(서열번호 41);
(iv) CD28의 막 관통 도메인(transmembrane domain) 폴리펩티드 (서열번호 43);
(v) CD28의 세포내 도메인(서열번호 44)- 링커(GGGGS) - CD137의 세포내 도메인(서열번호 46) - 링커(GGGGS) - CD3 제타(ζ) 세포내 도메인(서열번호 47)
BCMA-CAR3의 scFV의 VL 및 VH의 아미노산 서열은 다음과 같다.
- Light chain variable region (VL) aa sequence (108 aa):
EIVLTQSPGTLSLSPGERATLSCKASQDIDDDINWYQQKPGQAPRLLIYDASLRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQSLRTPITFGQGTKLEIKR (서열번호 29)
L-CDR1 : KASQDIDDDIN (서열번호 13)
L-CDR2 : DASLRAT (서열번호 14)
L-CDR3 : QQSLRTPI (서열번호 15)
- Heavy chain variable region (VH) aa sequence (121 aa):
EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYGLSWVRQAPGKGLEWVSLIDSSGSSTFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEHGLFDSWGQGTLVTVSS (서열번호 30)
H-CDR1 : DYGLS (서열번호 16)
H-CDR2 : LIDSSGSSTFYADSVKG (서열번호 17)
H-CDR3 : KEHGLFDS (서열번호 18)
BCMA-CAR3의 전체 아미노산 서열은 서열번호 50에 나타내었다.
BCMA-CAR4의 제조
BCMA-CAR4는 다음의 폴리펩티드 (i) 내지 (v)를 순차적으로 연결한 구성으로 제조하였다.
(i) CD16 신호 펩타이드(서열번호 33);
(ii) BCMA를 표적으로 하는 scFv의 중쇄가변영역(VH)(서열번호 32) - 링커 펩티드(GSTSGSGKPSGEGSTKG, 서열번호 37) - BCMA를 표적으로 하는 scFv의 경쇄가변영역(VL)(서열번호 31);
(iii) CD8α 힌지 영역(hinge region) 폴리펩티드(서열번호 41);
(iv) CD28의 막 관통 도메인(transmembrane domain) 폴리펩티드 (서열번호 43);
(v) CD28의 세포내 도메인(서열번호 44)- 링커(GGGGS) - CD137의 세포내 도메인(서열번호 46) - 링커(GGGGS) - CD3 제타(ζ) 세포내 도메인(서열번호 47)
BCMA-CAR4의 scFV의 VL 및 VH의 아미노산 서열은 다음과 같다.
- Light chain variable region (VL) aa sequence (108 aa):
EIVLTQSPGTLSLSPGERATLSCRASQGIDSYVAWYQQKPGQAPRLLIYDASLRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYNSWPITFGQGTKLEIKR (서열번호 31)
L-CDR1 : RASQGIDSYVA (서열번호 19)
L-CDR2 : DASLRAT (서열번호 20)
L-CDR3 : QQYNSWPI (서열번호 21)
- Heavy chain variable region (VH) aa sequence (116 aa):
EVQLLESGGGLVQPGGSLRLSCAASGFTFSGHYWSWVRQAPGKGLEWVSTVSGSGGDTFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGHSVMDVWGQGTLVTVSS (서열번호 32)
H-CDR1 : GHYWS (서열번호 22)
H-CDR2 : TVSGSGGDTFYADSVKG (서열번호 23)
H-CDR3 : RGHSVMDV (서열번호 24)
BCMA-CAR4의 전체 아미노산 서열은 서열번호 51에 나타내었다.
상기 구성으로 이루어진 BCMA-CAR의 폴리펩타이드 서열을 동물 세포에서의 단백질 발현에 적합하도록 코돈 최적화(Codon optimization)하여 핵산 서열로 변환하고 EF1a 프로모터를 포함하는 트랜스포존 벡터인 pSBbi-Neo(Addgene, Catalog No. 60525)에 클로닝하여 사용하였다.
실시예 2: BCMA-CAR NK 세포의 제조
4종의 BCMA-CAR 발현 NK 세포의 제조
실시예 1에서 제작한 4종류의 항-BCMA 키메라 항원 수용체(CAR) 코딩 핵산 서열(유전자) BCMA-CAR1, BCMA-CAR2, BCMA-CAR3, BCMA-CAR4가 클로닝된 pSBbi-Noe 벡터를 NK-92 세포에 슬리핑 뷰티(Sleeping beauty) 전이효소(transposase) 발현 벡터인 pCMV(CAT)T7-SB100(Addgene, Catalog No. 34879)와 함께 Lonza사의 Nucleofector와 Cell line Nucleofector Kit를 이용한 전기천공법을 수행하여 4종의 BCMA-CAR NK 세포 CGT301, CGT302, CGT303, CGT304를 각각 제조하였다.
한편, BMCA-ADC(GSK2857916, BLENREP)의 J6MO 항체 서열 기반의 scFv를 포함하는 동일 구조의 CAR를 참조(Reference)로 사용하여 비교군 NK 세포(Ref)를 제조하였다.
형질전환 후 세포는 12.5 % FBS, 12.5 % Horse serum, 0.1 mM 2-머캅토에탄올(mercaptoethanol), 1 % penicillin/streptomycin, IL-2 100 IU/ml이 포함된 α-MEM 배지에서 48시간 안정화시킨 다음 200μg/ml 농도의 카나마이신 (Kanamycin)을 2주 이상 처리함으로써 BCMA-CAR 유전자를 발현하는 NK-92 세포만을 선별(selection) 하였다.
이와 같이 제작한 BCMA-CAR NK 세포들을 먼저, 항-phospho-CD3ζ 항체를 이용한 웨스턴 블로팅 방법으로 NK 세포에서 BCMA-CAR의 발현을 확인하였다(도 2). 또한, 인간 IgG(ab')2 항체 또는 Hig tag conjugated-BCMA 재조합 단백질과 PE-conjugated His 항체를 사용한 유세포 분석 방법(flow cytometry)으로 NK 세포 표면에서의 BCMA-CAR 발현을 확인하였다(도 3).
실시예 3: BCMA-CAR 발현 NK세포의 인 비트로(in vitro) 유효성 평가
BCMA-CAR NK의 다발골수종 암세포에 대한 세포 사멸 효과
상기 실시예 2에서 제작한 4종의 BCMA-CAR NK 세포의 다발골수종에 대한 선택성 및 반응성을 평가하기 위해, BCMA-CAR NK 세포를 H929, MM1.R, OPM-2를 비롯한 다발골수종 세포 및 K562, Jurkat의 다른 암세포와 반응시킨 후, 세포독성 시험 (cytotoxicity assay)과 Granzyme B, 및 IFNγ의 분비량을 확인하였다. 그 결과, BCMA를 발현하지 않는 K562, Jurkat 등의 암세포주에 대해서는 BCMA-CAR NK 세포의 반응성이 대조군(Ctrl)인 NK 세포(NKvec)와 차이가 없는 반면, H929, MM1.R, OPM-2와 같이 BCMA 발현양이 높은 다발골수종 세포주에 대해서는 BCMA-CAR NK 세포의 세포 사멸능이 비교군인 NK 세포(NKvec)에 비해 3-4배 이상 높은 것을 확인할 수 있었다(도 4a). 이러한 BCMA-CAR NK의 특이적인 다발골수종 암세포 사멸 효과는 IFNγ 및 Granzyme B의 분비량 증가에 의한 것임을 확인할 수 있었다(도 4b, 도 4c).
K562-BCMA 타겟 세포주의 제작
상기 실시예 1에서 설계한 BCMA-CAR의 BCMA 항원 특이적 효능을 평가하기 위하여 먼저 각기 다른 종(species) 유래 BCMA 항원을 발현하는 타겟 세포주를 제작하였다. BCMA가 발현되지 않는 K562 암세포에 인간(h), 원숭이(Rh) 또는 쥐(Ms), 랫드(Rat) 유래 BCMA 말단에 myc을 발현하는 BCMA 유전자를 각각 도입하고 유세포 분석(Flow cytometry)과 웨스턴 블로팅 방법으로 그 발현을 확인하였다(도 5).
4종류 BCMA-CAR의 BCMA 항원특이성 분석
상기 실시예 1에서 제작한 4 종류의 BCMA-CAR의 항원특이성을 분석하기 위해 인간(hu1, hu2), 원숭이(Rh), 마우스(Ms) 및 랫드(Rat) 유래 BCMA를 발현하는 K562(K562-BCMA) 세포주 또는 K562 모세포와 BCMA-CAR1 NK, BCMA-CAR2 NK, BCMA-CAR3 NK, BCMA-CAR4 NK 세포들을 서로 반응시킨 후, 세포독성 시험(Cytotoxicity assay)을 수행하고 Granzyme B, IFNγ의 분비량을 분석하였다.
BCMA-CAR1을 발현하는 BCMA-CAR1 NK 세포는 인간 유래 BCMA에만 특이적으로 활성을 나타냈으며, 각각 BCMA-CAR2, BCMA-CAR3, BCMA-CAR4을 발현하는 NK 세포들은 인간 이외의 BCMA 항원에 대해서 반응성을 나타냈다(도 6a 및 도 6b). 한편, 참조(Reference)로 사용한 GSK사의 BCMA 항체(J6MO) 유래 BCMA-CAR(Ref)는 BCMA-CAR-2, BCMA-CAR-3, BCMA-CAR-4와 유사한 반응성을 보여주었다.
실시예 4: BCMA-CAR NK 세포의 BCMA 특이적 세포 사멸 효과 검증
BCMA 재조합 단백질을 이용한 BCMA-CAR NK의 BCMA 특이적 활성 확인
BCMA-CAR1 NK 세포가 나타내는 활성이 BCMA 특이적인 반응인지 확인하기 위하여, rhBCMA를 이용한 경쟁 분석(competition assay)을 수행하였다. 먼저, BCMA-CAR NK 세포(4 x 104 cells)에 1 μg의 rhBCMA 단백질을 넣어주고 1시간 동안 사전-인큐베이션(pre-incubation)을 행한 후에 타겟 세포로 인간 BCMA를 과발현하는 K562 세포인 K562-BCMA 세포(aK562, 4 x 104 cells)를 추가하여 4시간 반응시킨 후, 세포 독성(cytotoxicity)을 확인하였다. 그 결과, rhBCMA 단백질이 존재할 경우 BCMA-CAR NK 세포의 암세포 살해능이 약 40% 감소함을 확인하였다(도 7).
BCMA 항체를 이용한 BCMA-CAR NK의 BCMA 특이적 활성 확인
또한, BCMA의 발현이 높은 것으로 확인된 다발골수종 세포인 OPM-2를 타겟 암세포로 이용하여 OPM-2 세포(4 x 104 cells)에 30 μg의 anti-BCMA mAb(J6M0)을 넣어주고 1시간 동안 사전-인큐베이션(pre-incubation)을 행한 후 BCMA-CAR1 NK 세포(4 x 104 cells)를 추가하여 4시간 반응 후 세포 독성(cytotoxicity)을 확인하였다. 그 결과, BCMA 항체(anti-BCMA mAb)가 존재하에서는 BCMA-CAR NK 세포의 OPM-2 다발골수종 세포 살해능이 약 50% 정도 억제되었고, 이와 유사하게 Granzyme B의 분비량도 50% 정도 감소하였으며, 특히 IFNγ의 분비량은 1/20로 감소하였다(도 8). 이러한 실험결과는 다발골수종 암세포 표면에 특이적으로 발현하는 항원인 BCMA와 NK 세포 표면에 발현하는 BCMA-CAR1 수용체와의 결합에 의한 BCMA-CAR NK 세포의 BCMA 특이적 항암 활성에 의한 것이다.
실시예 5: BCMA-CAR NK 세포의 인 비보(in vivo) 항암 효능 평가
NOD.Cg-Prkdcscid Il2rgtm1Wjl/SzJ (NSG) 마우스(Jackson Laboratory, Jax #00557 strain)를 사용한 이종이식(xenograft) 동물 모델에서 BCMA-CAR1을 발현하는 BCMA-CAR NK 세포의 항암 효능을 평가하였다.
BCMA 발현이 높은 다발골수종 세포주 H929를 피하 이식한 후 종양 크기가 150 mm3에 도달했을 때(10 days post implantation), 무작위로 그룹당 5 마리씩 분류하였고 5 일에 한 번씩, 총 3회 BCMA-CAR NK 세포 또는 대조군(control) NK 세포(NKvec)를 1 x 107 cells씩 미정맥 투여(i.v.) 하였다. 이때 다발골수종 환자의 치료제로 사용되고 있는 프로테아솜 억제제인 벨케이드(Velcade®, 성분명 Bortezomib)와 항체 치료제인 다잘렉스(Darzalex®, 성분명 Daratumumab)를 대조 약물로 이용하였으며, 벨케이드®(Vel)과 다잘렉스®(Dara)는 각각 0.5 mg/kg의 농도로 3~4 일에 한 번씩, 총 5회 복강투여(i.p.) 하였다.
시험 17일째의 종양 크기를 비교해 본 결과, BCMA-CAR NK 세포를 투여한 시험군(BCMA-CAR1 NK)에서는 치료 전의 종양 크기 대비 20배가 증가한 반면, 비처리군(Vehicle) 에서는 26배 증가하였고, 치료용 유전자를 발현하지 않는 NK 세포(NKctrl)를 처리한 군에서는 25배 증가하였다. 시험 종료일(17일)에 비처리군(Vehicle) 대비 각 치료군의 종양 성장 억제능(growth inhibition rate; GIR(%))을 비교한 결과, BCMA-CAR NK 세포를 투여한 시험군(BCMA-CAR1 NK)에서는 25%의 종양 성장 억제 효능을 보여준 반면, 대조군(Control) NK 세포를 투여한 군(NKctrl)에서는 6%, 벨케이드®를 투여한 군(Vel)에서는 39%, 다잘렉스®를 투여한 군(Dara)에서는 23%의 종양 성장 억제 효과를 보여주었다(도 9). MM의 1차 치료제로 사용되고 있는 벨케이드는 항암 효능이 39%로 뛰어난 반면 체중감소 등의 독성을 나타냈으며, BCMA-CAR NK 세포는 독성 없이 항체 치료제인 다잘렉스와 유사한 수준의 항암 효능을 보여주었다.
실시예 6: BCMA-CAR NK 세포의 특성 분석
BCMA-CAR NK 세포의 특성 분석을 위해 60일간 지속적으로 배양하면서 세포 생존능(cell viability), 증식(proliferation), CAR 발현, 세포활성(cytotoxicity) 등을 평가하였다. 그 결과, BCMA-CAR NK 세포에서의 CAR 발현은 60일이 지나도 95% 이상이 유지되었으며, 2일에 3배씩 증식하였으며, BCMA 항원을 발현하는 암세포를 살해하는 세포 독성(cytotoxicity)도 60% 이상으로 일정하게 유지되었다. 본 발명의 BCMA-CAR NK 세포는 세포의 증식뿐만 아니라 CAR 발현 및 세포활성도 60일 이상 안정적으로 유지되는 특성을 확인하였다(도 10a 내지 도 10d).
Claims (31)
- 다음의 폴리펩티드를 포함하는 키메라 항원 수용체(Chimeric antigen receptor, CAR):(i) BCMA (B cell maturation antigen)에 특이적으로 결합하는 세포외 항원 결합 도메인;(ii) 막 관통 도메인;(iii) 세포내 보조 자극 신호 전달 도메인(co-stimulatory signaling domain); 및(iv) 세포내 주요 신호 전달 도메인(primary signaling domain).
- 제 1 항에 있어서, 상기 세포외 항원 결합 도메인은 항-BCMA 항체 또는 이의 항원 결합 단편을 포함하는 것인, 키메라 항원 수용체.
- 제 1 항에 있어서, 상기 세포외 항원 결합 도메인은,(i) L-CDR(complementarity determining region)1, L-CDR2, 및 L-CDR3을 포함하는 항-BCMA 항체의 경쇄 가변 영역(light chain variable region, VL);(ii) H-CDR1, H-CDR2, 및 H-CDR3을 포함하는 항-BCMA 항체의 중쇄 가변 영역(heavy chain variable region, VH); 또는(iii) 하나 이상의 상기 경쇄 가변 영역(VL) 및 하나 이상의 상기 중쇄 가변 영역(VH)을 포함하는, 키메라 항원 수용체.
- 제 3 항에 있어서,상기 L-CDR1은 서열번호 1, 서열번호 7, 서열번호 13, 또는 서열번호 19의 아미노산 서열의 폴리펩티드이고;상기 L-CDR2은 서열번호 2, 서열번호 8, 서열번호 14, 또는 서열번호 20의 아미노산 서열의 폴리펩티드이고;상기 L-CDR3은 서열번호 3, 서열번호 9, 서열번호 15, 또는 서열번호 21의 아미노산 서열의 폴리펩티드이고;상기 H-CDR1은 서열번호 4, 서열번호 10, 서열번호 16, 또는 서열번호 22의 아미노산 서열의 폴리펩티드이고;상기 H-CDR2은 서열번호 5, 서열번호 11, 서열번호 17, 또는 서열번호 23의 아미노산 서열의 폴리펩티드이고;상기 H-CDR3은 서열번호 6, 서열번호 12, 서열번호 18, 또는 서열번호 24의 아미노산 서열의 폴리펩티드인 것인, 키메라 항원 수용체.
- 제 3 항에 있어서, 상기 세포외 항원 결합 도메인은서열번호 4의 H-CDR1, 서열번호 5의 H-CDR2, 및 서열번호 6의 H-CDR3를 포함하는 항-BCMA 항체의 중쇄 가변 영역(VH), 및 서열번호 1의 L-CDR1, 서열번호 2의 L-CDR2, 및 서열번호 3의 L-CDR3를 포함하는 항-BCMA 항체의 경쇄 가변 영역(VL);서열번호 10의 H-CDR1, 서열번호 11의 H-CDR2, 및 서열번호 12의 H-CDR3을 포함하는 항-BCMA 항체의 중쇄 가변 영역(VH), 및 서열번호 7의 L-CDR1, 서열번호 8의 L-CDR2, 및 서열번호 9의 L-CDR3를 포함하는 항-BCMA 항체의 경쇄 가변 영역(VL);서열번호 16의 H-CDR1, 서열번호 17의 H-CDR2, 및 서열번호 18의 H-CDR3를 포함하는 항-BCMA 항체의 중쇄 가변 영역(VH) 및 서열번호 13의 L-CDR1, 서열번호 14의 L-CDR2, 및 서열번호 15의 L-CDR3를 포함하는 항-BCMA 항체의 경쇄 가변 영역(VL); 또는서열번호 22의 H-CDR1, 서열번호 23의 H-CDR2, 및 서열번호 24의 H-CDR3를 포함하는 항-BCMA 항체의 중쇄 가변 영역(VH), 및 서열번호 19의 L-CDR1, 서열번호 20의 L-CDR2, 및 서열번호 21의 L-CDR3를 포함하는 항-BCMA 항체의 경쇄 가변 영역(VL)을 포함하는 것인, 키메라 항원 수용체.
- 제 1 항에 있어서, 상기 세포외 항원 결합 도메인은(i) 서열번호 25, 서열번호 27, 서열번호 29, 및 서열번호 31의 폴리펩티드로 이루어지는 군에서 선택되는 하나 이상의 항-BCMA 항체의 경쇄 가변 영역(VL); 및(ii) 서열번호 26, 서열번호 28, 서열번호 30, 및 서열번호 32의 폴리펩티드로 이루어지는 군에서 선택되는 하나 이상의 항-BCMA 항체의 중쇄 가변 영역(VH) 중 하나 또는 둘 이상을 포함하는, 키메라 항원 수용체.
- 제 3 항 내지 제 6 항 중 어느 한 항에 있어서, 둘 이상의 경쇄 또는 중쇄 가변 영역 사이에 위치하는 링커를 더 포함하는, 키메라 항원 수용체.
- 제 7 항에 있어서, 상기 링커는 서열번호 37 또는 서열번호 38의 아미노산 서열의 폴리펩티드인, 키메라 항원 수용체.
- 제 1 항에 있어서, 상기 세포외 항원 결합 도메인은 막 관통 도메인에 연결되는 힌지 영역(hinge region)을 더 포함하는, 키메라 항원 수용체.
- 제 9 항에 있어서, 상기 힌지 영역은 IgG1, IgG4, 또는 CD8α의 힌지 영역을 포함하는 것인, 키메라 항원 수용체.
- 제 10 항에 있어서,상기 IgG1 힌지 영역은 서열번호 39의 아미노산 서열의 폴리펩티드이고;상기 IgG4 힌지 영역은 서열번호 40의 아미노산 서열의 폴리펩티드이고;상기 CD8α 힌지 영역은 서열번호 41의 아미노산 서열의 폴리펩티드인 것인, 키메라 항원 수용체.
- 제 1 항에 있어서, 상기 막 관통 도메인은 CD8 알파 또는 CD28의 막 관통 영역을 포함하는 것인, 키메라 항원 수용체.
- 제 12 항에 있어서, 상기 CD8 알파 막 관통 영역은 서열번호 42의 아미노산 서열의 폴리펩티드이고, 상기 CD28 막 관통 영역은 서열번호 43의 아미노산 서열의 폴리펩티드인, 키메라 항원 수용체.
- 제 1 항에 있어서, 상기 세포내 보조 자극 신호 전달 도메인은 CD28, DAP10, 또는 CD137(4-1BB)의 세포내 보조 자극 신호 전달 도메인을 포함하는 것인, 키메라 항원 수용체.
- 제 14 항에 있어서,상기 CD28 세포내 보조 자극 신호 전달 도메인은 서열번호 44의 아미노산 서열의 폴리펩티드이고;상기 DAP10 세포내 보조 자극 신호 전달 도메인은 서열번호 45의 아미노산 서열의 폴리펩티드이고;상기 CD137(4-1BB) 세포내 보조 자극 신호 전달 도메인은 서열번호 46의 아미노산 서열의 폴리펩티드인, 키메라 항원 수용체.
- 제 1 항에 있어서, 상기 세포내 주요 신호 전달 도메인은 CD3 제타(ζ)의 세포내 도메인을 포함하는 것인, 키메라 항원 수용체.
- 제 16 항에 있어서, 상기 CD3 제타(ζ) 세포내 신호 전달 도메인은 서열번호 47의 아미노산 서열의 폴리펩티드인, 키메라 항원 수용체.
- 제 1 항에 있어서, 상기 세포내 보조 자극 신호 전달 도메인 및 상기 세포내 주요 신호 전달 도메인은 링커에 의해 연결되는 것인, 키메라 항원 수용체.
- 제 18 항에 있어서, 상기 링커는 서열번호 38의 아미노산 서열의 폴리펩티드인, 키메라 항원 수용체.
- 제 1 항에 있어서, 상기 세포외 항원 결합 도메인은 신호 펩티드(signal peptide)를 더 포함하는 것인, 키메라 항원 수용체.
- 제 20 항에 있어서, 상기 신호 펩티드는 CD16, GM-CSF, 인간 IgG, 또는 CD8의 신호 펩티드를 포함하는 것인, 키메라 항원 수용체.
- 제 21 항에 있어서,상기 CD16의 신호 펩티드는 서열번호 33의 아미노산 서열의 폴리펩티드이고;상기 GM-CSF의 신호 펩티드는 서열번호 34의 아미노산 서열의 폴리펩티드이고;상기 인간 IgG의 신호 펩티드는 서열번호 35의 아미노산 서열의 폴리펩티드이고;상기 CD8의 신호 펩티드는 서열번호 36의 아미노산 서열의 폴리펩티드인, 키메라 항원 수용체.
- 제 1 항 내지 제 22 항 중 어느 한 항의 키메라 항원 수용체를 인코딩하는 핵산 분자.
- 제 23 항의 핵산 분자를 포함하는 벡터.
- 제 23 항의 핵산 분자 또는 제 24 항의 벡터를 포함하는 세포.
- 제 25 항에 있어서, 상기 세포는 면역 세포인 것인, 세포.
- 제 26 항에 있어서, 상기 면역세포는 NK (Natural Killer) 세포 또는 T 세포인, 세포.
- (i) 제 25 항 내지 제 27 항 중 어느 한 항의 세포의 약학적 유효량; 및 (ii) 약학적으로 허용되는 담체를 포함하는 B 세포 관련 질환의 치료 또는 예방용 약학적 조성물.
- 제 28 항에 있어서, 상기 B 세포 관련 질환은 다발성 골수종, 비-호지킨 림프종(non-Hodgkin's lymphoma), 불확실한 악성 잠재성의 B 세포 증식, 림프종모양 육아종증, 이식-후 림프증식성 장애, 면역조절 장애, 류마티스성 관절염, 중증 근무력증, 특발성 혈소판감소성 자반증, 항-인지질 증후군, 샤가스병(Chagas' diease), 그레이브스병(Grave's diease), 베게너 육아종증(Wegener's granulomatosis), 결절성 다발동맥염, 쇼그렌 증후군(Sjogren's syndrome), 심상성 천포창, 피부경화증, 다발성 경화증, 항-인지질 증후군, ANCA 연관 혈관염, 굿파스쳐병(Goodpasture's diease), 가와사키병, 자가면역 용혈성 빈혈, 및 급속 진행성 사구체신염, 중쇄병, 원발성 또는 면역세포-연관 아밀로이드증, 또는 미확정 단클론성 감마병증(monoclonal gammopathy of undetermined significance)인, 약학적 조성물.
- 제 28 항에 있어서, 상기 B 세포 관련 질환은 B 세포 악성 종양인 것인, 약학적 조성물.
- 제 30 항에 있어서, 상기 B 세포 악성 종양은 다발성 골수종 또는 비-호지킨 림프종인, 약학적 조성물.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/904,057 US20230114854A1 (en) | 2020-02-14 | 2021-02-09 | Chimeric antigen receptor targeting b-cell maturation antigen and use thereof |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR10-2020-0018317 | 2020-02-14 | ||
KR20200018317 | 2020-02-14 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2021162394A1 true WO2021162394A1 (ko) | 2021-08-19 |
Family
ID=77292892
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2021/001681 WO2021162394A1 (ko) | 2020-02-14 | 2021-02-09 | B세포 성숙화 항원을 표적으로 하는 키메라 항원 수용체 및 이의 용도 |
Country Status (3)
Country | Link |
---|---|
US (1) | US20230114854A1 (ko) |
KR (1) | KR102626782B1 (ko) |
WO (1) | WO2021162394A1 (ko) |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20170036021A (ko) * | 2014-07-24 | 2017-03-31 | 블루버드 바이오, 인코포레이티드. | Bcma 키메릭 항원 수용체 |
KR20190015733A (ko) * | 2016-06-07 | 2019-02-14 | 맥스-델브뤼크-센트럼 퓌어 몰레쿨라레 메디친 | Bcma에 결합하는 키메라 항원 수용체 및 car-t 세포 |
WO2019090003A1 (en) * | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for b-cell maturation antigen (bcma) |
US20190382500A1 (en) * | 2018-06-13 | 2019-12-19 | Novartis Ag | Bcma chimeric antigen receptors and uses thereof |
WO2020004934A1 (ko) * | 2018-06-26 | 2020-01-02 | 에이비엘바이오 주식회사 | 항-bcma 항체 및 그 용도 |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2015041722A1 (en) | 2013-09-17 | 2015-03-26 | Kryptonite Group, Ltd | Enhanced artemisinin-based combination therapy for treating parasitic mediated disease |
JP6019364B2 (ja) | 2013-10-29 | 2016-11-02 | 兵神装備株式会社 | 吐出システム、及び流動体の補充方法 |
JP6617110B2 (ja) | 2014-10-01 | 2019-12-04 | 国立研究開発法人農業・食品産業技術総合研究機構 | 遺伝子組換えカイコにより生産したビオチン化酸化ldl受容体・終末糖化産物受容体 |
CN105390067A (zh) | 2015-12-11 | 2016-03-09 | 京东方科技集团股份有限公司 | 一种透明显示装置及其控制方法 |
-
2021
- 2021-02-09 US US17/904,057 patent/US20230114854A1/en active Pending
- 2021-02-09 WO PCT/KR2021/001681 patent/WO2021162394A1/ko active Application Filing
- 2021-02-09 KR KR1020210018073A patent/KR102626782B1/ko active IP Right Grant
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20170036021A (ko) * | 2014-07-24 | 2017-03-31 | 블루버드 바이오, 인코포레이티드. | Bcma 키메릭 항원 수용체 |
KR20190015733A (ko) * | 2016-06-07 | 2019-02-14 | 맥스-델브뤼크-센트럼 퓌어 몰레쿨라레 메디친 | Bcma에 결합하는 키메라 항원 수용체 및 car-t 세포 |
WO2019090003A1 (en) * | 2017-11-01 | 2019-05-09 | Juno Therapeutics, Inc. | Chimeric antigen receptors specific for b-cell maturation antigen (bcma) |
US20190382500A1 (en) * | 2018-06-13 | 2019-12-19 | Novartis Ag | Bcma chimeric antigen receptors and uses thereof |
WO2020004934A1 (ko) * | 2018-06-26 | 2020-01-02 | 에이비엘바이오 주식회사 | 항-bcma 항체 및 그 용도 |
Also Published As
Publication number | Publication date |
---|---|
KR20210103962A (ko) | 2021-08-24 |
KR102626782B1 (ko) | 2024-01-19 |
US20230114854A1 (en) | 2023-04-13 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2015058573A1 (zh) | 拮抗抑制程序性死亡受体pd-1与其配体结合的单克隆抗体及其编码序列与用途 | |
WO2018030806A1 (ko) | 항체 중쇄불변부위 이종이중체에 융합된 사이토카인 및 이를 포함하는 약제학적 조성물 | |
WO2015133817A1 (ko) | B 세포 림프종 세포를 특이적으로 인지하는 단일클론항체 및 이의 용도 | |
WO2018194381A1 (ko) | Lrig-1 단백질에 특이적인 결합 분자 및 이의 용도 | |
WO2016137108A1 (en) | Novel antibody binding to tfpi and composition comprising the same | |
WO2017023138A1 (ko) | 키메라 항원 수용체 및 키메라 항원 수용체가 발현된 t 세포 | |
WO2019112347A2 (ko) | 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도 | |
WO2020032784A1 (ko) | Hla-dr에 결합하는 키메라 항원 수용체 및 car-t 세포 | |
WO2019135668A1 (ko) | Ige fc 수용체의 알파 서브유닛의 세포외 도메인, 이를 포함하는 약학적 조성물 및 이의 제조방법 | |
WO2020153605A1 (ko) | 메소텔린 특이적인 키메라 항원 수용체 및 이를 발현하는 t 세포 | |
WO2018222019A1 (ko) | 신규한 항-cd40 항체 및 이의 용도 | |
WO2020080908A1 (ko) | 항-l1cam 항체 또는 그의 항원결합 단편, 및 이를 포함하는 키메라 항원 수용체 | |
WO2019203600A1 (ko) | 스위치 분자 및 스위처블 키메라 항원 수용체 | |
WO2021235696A1 (ko) | Cd22에 특이적인 항체 및 이의 용도 | |
WO2021107689A1 (ko) | Il-2 단백질 및 cd80 단백질을 포함하는 융합단백질 및 면역관문 억제제를 포함하는 암 치료용 약학 조성물 | |
WO2023277361A1 (ko) | 메소텔린 특이적 항체 및 이의 용도 | |
WO2020080854A1 (ko) | Lrig-1 단백질에 특이적인 결합 분자 및 이의 용도 | |
WO2022025638A1 (ko) | 면역시냅스를 안정화시키는 키메라 항원 수용체(car) t 세포 | |
WO2021210939A1 (ko) | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 | |
WO2019125070A1 (ko) | 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도 | |
WO2019135666A1 (ko) | Ige fc 수용체의 알파 서브유닛의 세포외 도메인을 포함하는 약학적 조성물 | |
WO2021162394A1 (ko) | B세포 성숙화 항원을 표적으로 하는 키메라 항원 수용체 및 이의 용도 | |
WO2022145739A1 (en) | Humanized antibody specific for cd22 and chimeric antigen receptor using the same | |
WO2022035200A1 (ko) | Il-12 및 항-cd20 항체를 포함하는 융합단백질 및 이의 용도 | |
WO2018026249A1 (ko) | 프로그램화된 세포 사멸 단백질 리간드-1 (pd-l1)에 대한 항체 및 이의 용도 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21753342 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 21753342 Country of ref document: EP Kind code of ref document: A1 |