WO2018224951A2 - Anticorps multispécifiques modifiés et autres protéines multimères avec des mutations de région ch2-ch3 asymétriques - Google Patents
Anticorps multispécifiques modifiés et autres protéines multimères avec des mutations de région ch2-ch3 asymétriques Download PDFInfo
- Publication number
- WO2018224951A2 WO2018224951A2 PCT/IB2018/053997 IB2018053997W WO2018224951A2 WO 2018224951 A2 WO2018224951 A2 WO 2018224951A2 IB 2018053997 W IB2018053997 W IB 2018053997W WO 2018224951 A2 WO2018224951 A2 WO 2018224951A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- nos
- region
- protein
- antibody
- Prior art date
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 261
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 258
- 230000035772 mutation Effects 0.000 title claims abstract description 244
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 claims abstract description 354
- 238000000034 method Methods 0.000 claims abstract description 74
- 230000027455 binding Effects 0.000 claims description 95
- 210000004027 cell Anatomy 0.000 claims description 86
- 102000040430 polynucleotide Human genes 0.000 claims description 74
- 108091033319 polynucleotide Proteins 0.000 claims description 74
- 239000002157 polynucleotide Substances 0.000 claims description 74
- 150000001413 amino acids Chemical group 0.000 claims description 69
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 claims description 64
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 claims description 63
- 239000003446 ligand Substances 0.000 claims description 61
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 60
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 54
- 125000000539 amino acid group Chemical group 0.000 claims description 52
- 229920001184 polypeptide Polymers 0.000 claims description 52
- 239000013598 vector Substances 0.000 claims description 50
- 239000000427 antigen Substances 0.000 claims description 48
- 108091007433 antigens Proteins 0.000 claims description 47
- 102000036639 antigens Human genes 0.000 claims description 47
- 239000012634 fragment Substances 0.000 claims description 41
- -1 KIRa Proteins 0.000 claims description 33
- 230000000087 stabilizing effect Effects 0.000 claims description 32
- 238000001042 affinity chromatography Methods 0.000 claims description 22
- 238000004519 manufacturing process Methods 0.000 claims description 18
- 102000002090 Fibronectin type III Human genes 0.000 claims description 15
- 108050009401 Fibronectin type III Proteins 0.000 claims description 15
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical group NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 claims description 15
- 229960003151 mercaptamine Drugs 0.000 claims description 15
- 102000005962 receptors Human genes 0.000 claims description 14
- 108020003175 receptors Proteins 0.000 claims description 14
- 239000003638 chemical reducing agent Substances 0.000 claims description 13
- 239000008194 pharmaceutical composition Substances 0.000 claims description 12
- 230000002829 reductive effect Effects 0.000 claims description 8
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 claims description 7
- 210000004408 hybridoma Anatomy 0.000 claims description 7
- 108010088160 Staphylococcal Protein A Proteins 0.000 claims description 6
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 claims description 6
- VHJLVAABSRFDPM-ZXZARUISSA-N dithioerythritol Chemical compound SC[C@H](O)[C@H](O)CS VHJLVAABSRFDPM-ZXZARUISSA-N 0.000 claims description 6
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 claims description 6
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 claims description 5
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 claims description 5
- 108091008794 FGF receptors Proteins 0.000 claims description 5
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 5
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 claims description 5
- 206010028980 Neoplasm Diseases 0.000 claims description 5
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 5
- 102000052178 fibroblast growth factor receptor activity proteins Human genes 0.000 claims description 5
- 102100022464 5'-nucleotidase Human genes 0.000 claims description 4
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 claims description 4
- 101000678236 Homo sapiens 5'-nucleotidase Proteins 0.000 claims description 4
- 101000998120 Homo sapiens Interleukin-3 receptor subunit alpha Proteins 0.000 claims description 4
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 claims description 4
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 claims description 4
- 102100033493 Interleukin-3 receptor subunit alpha Human genes 0.000 claims description 4
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 claims description 4
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 claims description 4
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 4
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 claims description 4
- 238000012258 culturing Methods 0.000 claims description 4
- 201000000050 myeloid neoplasm Diseases 0.000 claims description 4
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 claims description 3
- 102100027207 CD27 antigen Human genes 0.000 claims description 3
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 claims description 3
- 102100029722 Ectonucleoside triphosphate diphosphohydrolase 1 Human genes 0.000 claims description 3
- 108010024636 Glutathione Proteins 0.000 claims description 3
- 101000691214 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) 50S ribosomal protein L44e Proteins 0.000 claims description 3
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 claims description 3
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 3
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 claims description 3
- 101001012447 Homo sapiens Ectonucleoside triphosphate diphosphohydrolase 1 Proteins 0.000 claims description 3
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 claims description 3
- 101001103039 Homo sapiens Inactive tyrosine-protein kinase transmembrane receptor ROR1 Proteins 0.000 claims description 3
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 claims description 3
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 claims description 3
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 claims description 3
- 101001103036 Homo sapiens Nuclear receptor ROR-alpha Proteins 0.000 claims description 3
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 claims description 3
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 claims description 3
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 claims description 3
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 claims description 3
- 102100038005 Immunoglobulin alpha Fc receptor Human genes 0.000 claims description 3
- 102100040061 Indoleamine 2,3-dioxygenase 1 Human genes 0.000 claims description 3
- 239000004201 L-cysteine Substances 0.000 claims description 3
- 235000013878 L-cysteine Nutrition 0.000 claims description 3
- 102000017578 LAG3 Human genes 0.000 claims description 3
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 claims description 3
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 claims description 3
- 102000003735 Mesothelin Human genes 0.000 claims description 3
- 108090000015 Mesothelin Proteins 0.000 claims description 3
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 claims description 3
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 claims description 3
- 102100035268 T-cell surface protein tactile Human genes 0.000 claims description 3
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 claims description 3
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 claims description 3
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 claims description 3
- 239000006143 cell culture medium Substances 0.000 claims description 3
- 239000007979 citrate buffer Substances 0.000 claims description 3
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 claims description 3
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 claims description 3
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 claims description 3
- 229960003180 glutathione Drugs 0.000 claims description 3
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 claims description 3
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 claims description 3
- 108091008875 B cell receptors Proteins 0.000 claims description 2
- 101000840545 Bacillus thuringiensis L-isoleucine-4-hydroxylase Proteins 0.000 claims description 2
- 102100038077 CD226 antigen Human genes 0.000 claims description 2
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 claims description 2
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 claims description 2
- 101001037256 Homo sapiens Indoleamine 2,3-dioxygenase 1 Proteins 0.000 claims description 2
- 101000960952 Homo sapiens Interleukin-1 receptor accessory protein Proteins 0.000 claims description 2
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 claims description 2
- 102100039880 Interleukin-1 receptor accessory protein Human genes 0.000 claims description 2
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 claims description 2
- 101001037255 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) Indoleamine 2,3-dioxygenase Proteins 0.000 claims description 2
- 108091008874 T cell receptors Proteins 0.000 claims description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 claims description 2
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 claims description 2
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 2
- 101000928515 Xenopus laevis Homeobox protein DLL-1 Proteins 0.000 claims description 2
- 102100026882 Alpha-synuclein Human genes 0.000 claims 1
- 101000834898 Homo sapiens Alpha-synuclein Proteins 0.000 claims 1
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 claims 1
- 101000652359 Homo sapiens Spermatogenesis-associated protein 2 Proteins 0.000 claims 1
- 102100039615 Inactive tyrosine-protein kinase transmembrane receptor ROR1 Human genes 0.000 claims 1
- 101000607575 Mus musculus Unknown protein from 2D-PAGE of fibroblasts Proteins 0.000 claims 1
- 101001113905 Rice tungro bacilliform virus (isolate Philippines) Protein P4 Proteins 0.000 claims 1
- 235000018102 proteins Nutrition 0.000 description 208
- 241000282414 Homo sapiens Species 0.000 description 52
- 238000010828 elution Methods 0.000 description 33
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 33
- 238000004458 analytical method Methods 0.000 description 32
- 238000005516 engineering process Methods 0.000 description 26
- 238000000746 purification Methods 0.000 description 26
- 239000006228 supernatant Substances 0.000 description 26
- 210000002966 serum Anatomy 0.000 description 23
- 108060003951 Immunoglobulin Proteins 0.000 description 21
- 102000018358 immunoglobulin Human genes 0.000 description 21
- 230000003993 interaction Effects 0.000 description 19
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 17
- 239000000203 mixture Substances 0.000 description 17
- 239000012636 effector Substances 0.000 description 16
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 15
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 15
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical compound C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 14
- 238000003556 assay Methods 0.000 description 14
- 238000004587 chromatography analysis Methods 0.000 description 13
- 230000014509 gene expression Effects 0.000 description 13
- 238000000926 separation method Methods 0.000 description 13
- 241000699666 Mus <mouse, genus> Species 0.000 description 12
- 230000000694 effects Effects 0.000 description 11
- 238000002474 experimental method Methods 0.000 description 11
- 239000012515 MabSelect SuRe Substances 0.000 description 9
- 241001465754 Metazoa Species 0.000 description 9
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 9
- 231100000673 dose–response relationship Toxicity 0.000 description 9
- 230000006870 function Effects 0.000 description 9
- 238000000338 in vitro Methods 0.000 description 9
- 238000011534 incubation Methods 0.000 description 9
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 8
- 238000003016 alphascreen Methods 0.000 description 8
- 239000000872 buffer Substances 0.000 description 8
- 230000003247 decreasing effect Effects 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 150000002482 oligosaccharides Chemical class 0.000 description 7
- 230000001225 therapeutic effect Effects 0.000 description 7
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 6
- 241000288950 Callithrix jacchus Species 0.000 description 6
- 241000282577 Pan troglodytes Species 0.000 description 6
- 230000003213 activating effect Effects 0.000 description 6
- 239000011324 bead Substances 0.000 description 6
- 229940098773 bovine serum albumin Drugs 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 6
- 210000004602 germ cell Anatomy 0.000 description 6
- 229920001542 oligosaccharide Polymers 0.000 description 6
- 239000012071 phase Substances 0.000 description 6
- 238000010561 standard procedure Methods 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 5
- 108010067306 Fibronectins Proteins 0.000 description 5
- 239000004472 Lysine Substances 0.000 description 5
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 5
- 102100040247 Tumor necrosis factor Human genes 0.000 description 5
- 229940024606 amino acid Drugs 0.000 description 5
- 235000001014 amino acid Nutrition 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 230000009260 cross reactivity Effects 0.000 description 5
- 239000013604 expression vector Substances 0.000 description 5
- 230000028993 immune response Effects 0.000 description 5
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- PXHVJJICTQNCMI-UHFFFAOYSA-N nickel Substances [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 5
- 239000012562 protein A resin Substances 0.000 description 5
- 102100036302 C-C chemokine receptor type 6 Human genes 0.000 description 4
- 102100036305 C-C chemokine receptor type 8 Human genes 0.000 description 4
- 241000282693 Cercopithecidae Species 0.000 description 4
- 102100037362 Fibronectin Human genes 0.000 description 4
- 101000716068 Homo sapiens C-C chemokine receptor type 6 Proteins 0.000 description 4
- 101000716063 Homo sapiens C-C chemokine receptor type 8 Proteins 0.000 description 4
- 101001040964 Homo sapiens Interleukin-36 receptor antagonist protein Proteins 0.000 description 4
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 4
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 4
- 102100021150 Interleukin-36 receptor antagonist protein Human genes 0.000 description 4
- 230000005888 antibody-dependent cellular phagocytosis Effects 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 238000011143 downstream manufacturing Methods 0.000 description 4
- 230000002708 enhancing effect Effects 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 108091022928 glucosylglycerol-phosphate synthase Proteins 0.000 description 4
- 150000004676 glycans Chemical class 0.000 description 4
- 230000002998 immunogenetic effect Effects 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 210000002540 macrophage Anatomy 0.000 description 4
- 239000011159 matrix material Substances 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 229920000936 Agarose Polymers 0.000 description 3
- 102100022718 Atypical chemokine receptor 2 Human genes 0.000 description 3
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 3
- 102100036846 C-C motif chemokine 21 Human genes 0.000 description 3
- 102100036849 C-C motif chemokine 24 Human genes 0.000 description 3
- 102100021936 C-C motif chemokine 27 Human genes 0.000 description 3
- 102100028990 C-X-C chemokine receptor type 3 Human genes 0.000 description 3
- 102100025618 C-X-C chemokine receptor type 6 Human genes 0.000 description 3
- 102100025279 C-X-C motif chemokine 11 Human genes 0.000 description 3
- 102100032937 CD40 ligand Human genes 0.000 description 3
- 102100035294 Chemokine XC receptor 1 Human genes 0.000 description 3
- 101150021185 FGF gene Proteins 0.000 description 3
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 3
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 3
- 101000678892 Homo sapiens Atypical chemokine receptor 2 Proteins 0.000 description 3
- 101000713085 Homo sapiens C-C motif chemokine 21 Proteins 0.000 description 3
- 101000916050 Homo sapiens C-X-C chemokine receptor type 3 Proteins 0.000 description 3
- 101000804783 Homo sapiens Chemokine XC receptor 1 Proteins 0.000 description 3
- 101000998140 Homo sapiens Interleukin-36 alpha Proteins 0.000 description 3
- 101000998126 Homo sapiens Interleukin-36 beta Proteins 0.000 description 3
- 101000998122 Homo sapiens Interleukin-37 Proteins 0.000 description 3
- 241000282567 Macaca fascicularis Species 0.000 description 3
- 206010057249 Phagocytosis Diseases 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 3
- 108010090804 Streptavidin Proteins 0.000 description 3
- 102000007000 Tenascin Human genes 0.000 description 3
- 108010008125 Tenascin Proteins 0.000 description 3
- 102100026890 Tumor necrosis factor ligand superfamily member 4 Human genes 0.000 description 3
- 102100031988 Tumor necrosis factor ligand superfamily member 6 Human genes 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 230000030833 cell death Effects 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 239000012228 culture supernatant Substances 0.000 description 3
- 238000000502 dialysis Methods 0.000 description 3
- 238000000113 differential scanning calorimetry Methods 0.000 description 3
- 230000008030 elimination Effects 0.000 description 3
- 238000003379 elimination reaction Methods 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 241001515942 marmosets Species 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 210000000822 natural killer cell Anatomy 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 230000008782 phagocytosis Effects 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 102100022716 Atypical chemokine receptor 3 Human genes 0.000 description 2
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 2
- 102100023995 Beta-nerve growth factor Human genes 0.000 description 2
- 102100031172 C-C chemokine receptor type 1 Human genes 0.000 description 2
- 102100024167 C-C chemokine receptor type 3 Human genes 0.000 description 2
- 102100037853 C-C chemokine receptor type 4 Human genes 0.000 description 2
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 description 2
- 102100036301 C-C chemokine receptor type 7 Human genes 0.000 description 2
- 102100023702 C-C motif chemokine 13 Human genes 0.000 description 2
- 102100023700 C-C motif chemokine 16 Human genes 0.000 description 2
- 102100023701 C-C motif chemokine 18 Human genes 0.000 description 2
- 102100036842 C-C motif chemokine 19 Human genes 0.000 description 2
- 102100036848 C-C motif chemokine 20 Human genes 0.000 description 2
- 102100036850 C-C motif chemokine 23 Human genes 0.000 description 2
- 102100021933 C-C motif chemokine 25 Human genes 0.000 description 2
- 102100021935 C-C motif chemokine 26 Human genes 0.000 description 2
- 102100032367 C-C motif chemokine 5 Human genes 0.000 description 2
- 102100032366 C-C motif chemokine 7 Human genes 0.000 description 2
- 102100028989 C-X-C chemokine receptor type 2 Human genes 0.000 description 2
- 102100036150 C-X-C motif chemokine 5 Human genes 0.000 description 2
- 102100036170 C-X-C motif chemokine 9 Human genes 0.000 description 2
- 108010029697 CD40 Ligand Proteins 0.000 description 2
- 102100025221 CD70 antigen Human genes 0.000 description 2
- 102100039196 CX3C chemokine receptor 1 Human genes 0.000 description 2
- 102100022480 Cadherin-20 Human genes 0.000 description 2
- 206010057248 Cell death Diseases 0.000 description 2
- 102100026098 Claudin-7 Human genes 0.000 description 2
- 102100032887 Clusterin Human genes 0.000 description 2
- 108090000197 Clusterin Proteins 0.000 description 2
- 102100036329 Cyclin-dependent kinase 3 Human genes 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 102100023688 Eotaxin Human genes 0.000 description 2
- 108010039471 Fas Ligand Protein Proteins 0.000 description 2
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 2
- 102100028417 Fibroblast growth factor 12 Human genes 0.000 description 2
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 2
- 102100028072 Fibroblast growth factor 4 Human genes 0.000 description 2
- 102100028075 Fibroblast growth factor 6 Human genes 0.000 description 2
- 102100028071 Fibroblast growth factor 7 Human genes 0.000 description 2
- 102000003817 Fos-related antigen 1 Human genes 0.000 description 2
- 108090000123 Fos-related antigen 1 Proteins 0.000 description 2
- 102100020997 Fractalkine Human genes 0.000 description 2
- 102000004878 Gelsolin Human genes 0.000 description 2
- 108090001064 Gelsolin Proteins 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100040895 Growth/differentiation factor 10 Human genes 0.000 description 2
- NTYJJOPFIAHURM-UHFFFAOYSA-N Histamine Chemical compound NCCC1=CN=CN1 NTYJJOPFIAHURM-UHFFFAOYSA-N 0.000 description 2
- 101000678890 Homo sapiens Atypical chemokine receptor 3 Proteins 0.000 description 2
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 2
- 101001111439 Homo sapiens Beta-nerve growth factor Proteins 0.000 description 2
- 101000777558 Homo sapiens C-C chemokine receptor type 10 Proteins 0.000 description 2
- 101000716070 Homo sapiens C-C chemokine receptor type 9 Proteins 0.000 description 2
- 101000978375 Homo sapiens C-C motif chemokine 16 Proteins 0.000 description 2
- 101000978371 Homo sapiens C-C motif chemokine 18 Proteins 0.000 description 2
- 101000713106 Homo sapiens C-C motif chemokine 19 Proteins 0.000 description 2
- 101000897480 Homo sapiens C-C motif chemokine 2 Proteins 0.000 description 2
- 101000713099 Homo sapiens C-C motif chemokine 20 Proteins 0.000 description 2
- 101000713081 Homo sapiens C-C motif chemokine 23 Proteins 0.000 description 2
- 101000713078 Homo sapiens C-C motif chemokine 24 Proteins 0.000 description 2
- 101000897486 Homo sapiens C-C motif chemokine 25 Proteins 0.000 description 2
- 101000897494 Homo sapiens C-C motif chemokine 27 Proteins 0.000 description 2
- 101000916059 Homo sapiens C-X-C chemokine receptor type 2 Proteins 0.000 description 2
- 101000856683 Homo sapiens C-X-C chemokine receptor type 6 Proteins 0.000 description 2
- 101000858060 Homo sapiens C-X-C motif chemokine 11 Proteins 0.000 description 2
- 101000947186 Homo sapiens C-X-C motif chemokine 5 Proteins 0.000 description 2
- 101000899459 Homo sapiens Cadherin-20 Proteins 0.000 description 2
- 101000917234 Homo sapiens Fibroblast growth factor 12 Proteins 0.000 description 2
- 101000854520 Homo sapiens Fractalkine Proteins 0.000 description 2
- 101000746367 Homo sapiens Granulocyte colony-stimulating factor Proteins 0.000 description 2
- 101000843810 Homo sapiens Hydroxycarboxylic acid receptor 1 Proteins 0.000 description 2
- 101001017968 Homo sapiens Leukotriene B4 receptor 1 Proteins 0.000 description 2
- 101001128431 Homo sapiens Myeloid-derived growth factor Proteins 0.000 description 2
- 101000947178 Homo sapiens Platelet basic protein Proteins 0.000 description 2
- 101000582950 Homo sapiens Platelet factor 4 Proteins 0.000 description 2
- 101000613343 Homo sapiens Polycomb group RING finger protein 2 Proteins 0.000 description 2
- 101000617130 Homo sapiens Stromal cell-derived factor 1 Proteins 0.000 description 2
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 2
- 101000635938 Homo sapiens Transforming growth factor beta-1 proprotein Proteins 0.000 description 2
- 101000830568 Homo sapiens Tumor necrosis factor alpha-induced protein 2 Proteins 0.000 description 2
- 101000830596 Homo sapiens Tumor necrosis factor ligand superfamily member 15 Proteins 0.000 description 2
- 101000764263 Homo sapiens Tumor necrosis factor ligand superfamily member 4 Proteins 0.000 description 2
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 description 2
- 102100030642 Hydroxycarboxylic acid receptor 1 Human genes 0.000 description 2
- 102100036678 Interleukin-27 subunit alpha Human genes 0.000 description 2
- 102100033420 Keratin, type I cytoskeletal 19 Human genes 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 102000016267 Leptin Human genes 0.000 description 2
- 108010092277 Leptin Proteins 0.000 description 2
- 102100033374 Leukotriene B4 receptor 1 Human genes 0.000 description 2
- 102100035304 Lymphotactin Human genes 0.000 description 2
- 102100028123 Macrophage colony-stimulating factor 1 Human genes 0.000 description 2
- 102100037273 Mammaglobin-A Human genes 0.000 description 2
- 102100037267 Mammaglobin-B Human genes 0.000 description 2
- 102100030335 Midkine Human genes 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 102100031789 Myeloid-derived growth factor Human genes 0.000 description 2
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 2
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 2
- 102100039614 Nuclear receptor ROR-alpha Human genes 0.000 description 2
- 102000000447 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Human genes 0.000 description 2
- 108010055817 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Proteins 0.000 description 2
- 108010022233 Plasminogen Activator Inhibitor 1 Proteins 0.000 description 2
- 102100039418 Plasminogen activator inhibitor 1 Human genes 0.000 description 2
- 102100036154 Platelet basic protein Human genes 0.000 description 2
- 102100030304 Platelet factor 4 Human genes 0.000 description 2
- 102100040919 Polycomb group RING finger protein 2 Human genes 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 102100038280 Prostaglandin G/H synthase 2 Human genes 0.000 description 2
- 108010005173 SERPIN-B5 Proteins 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 102100030333 Serpin B5 Human genes 0.000 description 2
- 102100021669 Stromal cell-derived factor 1 Human genes 0.000 description 2
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 2
- 102100036034 Thrombospondin-1 Human genes 0.000 description 2
- 101710120037 Toxin CcdB Proteins 0.000 description 2
- 102100030742 Transforming growth factor beta-1 proprotein Human genes 0.000 description 2
- 102000012883 Tumor Necrosis Factor Ligand Superfamily Member 14 Human genes 0.000 description 2
- 108010065158 Tumor Necrosis Factor Ligand Superfamily Member 14 Proteins 0.000 description 2
- 102100024595 Tumor necrosis factor alpha-induced protein 2 Human genes 0.000 description 2
- 102100024598 Tumor necrosis factor ligand superfamily member 10 Human genes 0.000 description 2
- 102100024568 Tumor necrosis factor ligand superfamily member 11 Human genes 0.000 description 2
- 102100024584 Tumor necrosis factor ligand superfamily member 12 Human genes 0.000 description 2
- 102100036922 Tumor necrosis factor ligand superfamily member 13B Human genes 0.000 description 2
- 102100024587 Tumor necrosis factor ligand superfamily member 15 Human genes 0.000 description 2
- 102100035283 Tumor necrosis factor ligand superfamily member 18 Human genes 0.000 description 2
- 102100032100 Tumor necrosis factor ligand superfamily member 8 Human genes 0.000 description 2
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 description 2
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 2
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 2
- 102100031358 Urokinase-type plasminogen activator Human genes 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 102100038234 Vascular endothelial growth factor D Human genes 0.000 description 2
- 239000008351 acetate buffer Substances 0.000 description 2
- 230000001270 agonistic effect Effects 0.000 description 2
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 238000004364 calculation method Methods 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 229960001231 choline Drugs 0.000 description 2
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 2
- 238000012761 co-transfection Methods 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 230000002596 correlated effect Effects 0.000 description 2
- 230000000875 corresponding effect Effects 0.000 description 2
- 239000000287 crude extract Substances 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 230000022811 deglycosylation Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 239000000833 heterodimer Substances 0.000 description 2
- 238000000589 high-performance liquid chromatography-mass spectrometry Methods 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 108010044426 integrins Proteins 0.000 description 2
- 102000006495 integrins Human genes 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 description 2
- 229940039781 leptin Drugs 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 102000004311 liver X receptors Human genes 0.000 description 2
- 108090000865 liver X receptors Proteins 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 230000006674 lysosomal degradation Effects 0.000 description 2
- 238000000816 matrix-assisted laser desorption--ionisation Methods 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 238000001823 molecular biology technique Methods 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- 229910052759 nickel Inorganic materials 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 230000005180 public health Effects 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- 238000001946 ultra-performance liquid chromatography-mass spectrometry Methods 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 1
- HWFKCAFKXZFOQT-UHFFFAOYSA-N 1-(3,6-dibromocarbazol-9-yl)-3-piperazin-1-ylpropan-2-ol;dihydrochloride Chemical compound Cl.Cl.C12=CC=C(Br)C=C2C2=CC(Br)=CC=C2N1CC(O)CN1CCNCC1 HWFKCAFKXZFOQT-UHFFFAOYSA-N 0.000 description 1
- 102100036933 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor Human genes 0.000 description 1
- WVAKRQOMAINQPU-UHFFFAOYSA-N 2-[4-[2-[5-(2,2-dimethylbutyl)-1h-imidazol-2-yl]ethyl]phenyl]pyridine Chemical compound N1C(CC(C)(C)CC)=CN=C1CCC1=CC=C(C=2N=CC=CC=2)C=C1 WVAKRQOMAINQPU-UHFFFAOYSA-N 0.000 description 1
- SXXLKZCNJHJYFL-UHFFFAOYSA-N 4,5,6,7-tetrahydro-[1,2]oxazolo[4,5-c]pyridin-5-ium-3-olate Chemical compound C1CNCC2=C1ONC2=O SXXLKZCNJHJYFL-UHFFFAOYSA-N 0.000 description 1
- 108010082808 4-1BB Ligand Proteins 0.000 description 1
- WBSMIPAMAXNXFS-UHFFFAOYSA-N 5-Nitro-2-(3-phenylpropylamino)benzoic acid Chemical compound OC(=O)C1=CC([N+]([O-])=O)=CC=C1NCCCC1=CC=CC=C1 WBSMIPAMAXNXFS-UHFFFAOYSA-N 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- 102100026802 72 kDa type IV collagenase Human genes 0.000 description 1
- 102100031912 A-kinase anchor protein 1, mitochondrial Human genes 0.000 description 1
- 102100031901 A-kinase anchor protein 2 Human genes 0.000 description 1
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 1
- 108010029988 AICDA (activation-induced cytidine deaminase) Proteins 0.000 description 1
- 101150054149 ANGPTL4 gene Proteins 0.000 description 1
- 101150037123 APOE gene Proteins 0.000 description 1
- 102100020979 ATP-binding cassette sub-family F member 1 Human genes 0.000 description 1
- 102100028249 Acetyl-coenzyme A transporter 1 Human genes 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 102100034111 Activin receptor type-1 Human genes 0.000 description 1
- 102100034134 Activin receptor type-1B Human genes 0.000 description 1
- 102100021886 Activin receptor type-2A Human genes 0.000 description 1
- 102100027647 Activin receptor type-2B Human genes 0.000 description 1
- 102100022089 Acyl-[acyl-carrier-protein] hydrolase Human genes 0.000 description 1
- 102100034540 Adenomatous polyposis coli protein Human genes 0.000 description 1
- 102100035990 Adenosine receptor A2a Human genes 0.000 description 1
- 102100032605 Adhesion G protein-coupled receptor B1 Human genes 0.000 description 1
- 102100036601 Aggrecan core protein Human genes 0.000 description 1
- 108010067219 Aggrecans Proteins 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 102100040121 Allograft inflammatory factor 1 Human genes 0.000 description 1
- 229940086568 Alpha mannosidase I inhibitor Drugs 0.000 description 1
- 102100021266 Alpha-(1,6)-fucosyltransferase Human genes 0.000 description 1
- 102100022524 Alpha-1-antichymotrypsin Human genes 0.000 description 1
- 102100022712 Alpha-1-antitrypsin Human genes 0.000 description 1
- 102100024581 Alpha-taxilin Human genes 0.000 description 1
- 102100022749 Aminopeptidase N Human genes 0.000 description 1
- 102100026468 Androgen-induced gene 1 protein Human genes 0.000 description 1
- 102100034594 Angiopoietin-1 Human genes 0.000 description 1
- 102100034608 Angiopoietin-2 Human genes 0.000 description 1
- 108700042530 Angiopoietin-Like Protein 4 Proteins 0.000 description 1
- 102100025668 Angiopoietin-related protein 3 Human genes 0.000 description 1
- 102100025674 Angiopoietin-related protein 4 Human genes 0.000 description 1
- 102100031936 Anterior gradient protein 2 homolog Human genes 0.000 description 1
- 102100025511 Anti-Muellerian hormone type-2 receptor Human genes 0.000 description 1
- 102100036451 Apolipoprotein C-I Human genes 0.000 description 1
- 102100029470 Apolipoprotein E Human genes 0.000 description 1
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 1
- 101100279540 Arabidopsis thaliana EIN2 gene Proteins 0.000 description 1
- 101100129499 Arabidopsis thaliana MAX2 gene Proteins 0.000 description 1
- 101100480809 Arabidopsis thaliana TCP10 gene Proteins 0.000 description 1
- 102100024003 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 Human genes 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 102100022717 Atypical chemokine receptor 1 Human genes 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 108010028006 B-Cell Activating Factor Proteins 0.000 description 1
- 208000004736 B-Cell Leukemia Diseases 0.000 description 1
- 102100027205 B-cell antigen receptor complex-associated protein alpha chain Human genes 0.000 description 1
- 102100027203 B-cell antigen receptor complex-associated protein beta chain Human genes 0.000 description 1
- 102100025218 B-cell differentiation antigen CD72 Human genes 0.000 description 1
- 102100035634 B-cell linker protein Human genes 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 102100021631 B-cell lymphoma 6 protein Human genes 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 102100037152 BAG family molecular chaperone regulator 1 Human genes 0.000 description 1
- 108091012583 BCL2 Proteins 0.000 description 1
- 241000304886 Bacilli Species 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 102100027314 Beta-2-microglobulin Human genes 0.000 description 1
- 102100029945 Beta-galactoside alpha-2,6-sialyltransferase 1 Human genes 0.000 description 1
- 102100025142 Beta-microseminoprotein Human genes 0.000 description 1
- 102100038495 Bile acid receptor Human genes 0.000 description 1
- 101100396232 Bombyx mori EN03 gene Proteins 0.000 description 1
- 102100024506 Bone morphogenetic protein 2 Human genes 0.000 description 1
- 102100024505 Bone morphogenetic protein 4 Human genes 0.000 description 1
- 102100022525 Bone morphogenetic protein 6 Human genes 0.000 description 1
- 102100022545 Bone morphogenetic protein 8B Human genes 0.000 description 1
- 102100025422 Bone morphogenetic protein receptor type-2 Human genes 0.000 description 1
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 description 1
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 description 1
- 101710149814 C-C chemokine receptor type 1 Proteins 0.000 description 1
- 102100031174 C-C chemokine receptor type 10 Human genes 0.000 description 1
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 description 1
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 description 1
- 101710149862 C-C chemokine receptor type 3 Proteins 0.000 description 1
- 101710149863 C-C chemokine receptor type 4 Proteins 0.000 description 1
- 101710149870 C-C chemokine receptor type 5 Proteins 0.000 description 1
- 101710149858 C-C chemokine receptor type 7 Proteins 0.000 description 1
- 102100036303 C-C chemokine receptor type 9 Human genes 0.000 description 1
- 102100025074 C-C chemokine receptor-like 2 Human genes 0.000 description 1
- 101710112613 C-C motif chemokine 13 Proteins 0.000 description 1
- 102100023703 C-C motif chemokine 15 Human genes 0.000 description 1
- 102100023698 C-C motif chemokine 17 Human genes 0.000 description 1
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 1
- 101710112538 C-C motif chemokine 27 Proteins 0.000 description 1
- 102100021942 C-C motif chemokine 28 Human genes 0.000 description 1
- 101710155834 C-C motif chemokine 7 Proteins 0.000 description 1
- 102100034871 C-C motif chemokine 8 Human genes 0.000 description 1
- 102100036166 C-X-C chemokine receptor type 1 Human genes 0.000 description 1
- 102100031650 C-X-C chemokine receptor type 4 Human genes 0.000 description 1
- 102100031658 C-X-C chemokine receptor type 5 Human genes 0.000 description 1
- 101710098272 C-X-C motif chemokine 11 Proteins 0.000 description 1
- 102100025277 C-X-C motif chemokine 13 Human genes 0.000 description 1
- 102100025250 C-X-C motif chemokine 14 Human genes 0.000 description 1
- 102100039396 C-X-C motif chemokine 16 Human genes 0.000 description 1
- 102100039398 C-X-C motif chemokine 2 Human genes 0.000 description 1
- 102100036189 C-X-C motif chemokine 3 Human genes 0.000 description 1
- 102100036153 C-X-C motif chemokine 6 Human genes 0.000 description 1
- 101710085500 C-X-C motif chemokine 9 Proteins 0.000 description 1
- 102100032957 C5a anaphylatoxin chemotactic receptor 1 Human genes 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 102100034798 CCAAT/enhancer-binding protein beta Human genes 0.000 description 1
- 108010049990 CD13 Antigens Proteins 0.000 description 1
- 108010046080 CD27 Ligand Proteins 0.000 description 1
- 108010017987 CD30 Ligand Proteins 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100032912 CD44 antigen Human genes 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 102100027221 CD81 antigen Human genes 0.000 description 1
- 101150116779 CD82 gene Proteins 0.000 description 1
- 102100035793 CD83 antigen Human genes 0.000 description 1
- 102100040531 CKLF-like MARVEL transmembrane domain-containing protein 2 Human genes 0.000 description 1
- 102100040527 CKLF-like MARVEL transmembrane domain-containing protein 3 Human genes 0.000 description 1
- 102100040529 CKLF-like MARVEL transmembrane domain-containing protein 4 Human genes 0.000 description 1
- 102100040525 CKLF-like MARVEL transmembrane domain-containing protein 5 Human genes 0.000 description 1
- 102100040528 CKLF-like MARVEL transmembrane domain-containing protein 6 Human genes 0.000 description 1
- 102100040855 CKLF-like MARVEL transmembrane domain-containing protein 7 Human genes 0.000 description 1
- 102100039553 CKLF-like MARVEL transmembrane domain-containing protein 8 Human genes 0.000 description 1
- 102100028228 COUP transcription factor 1 Human genes 0.000 description 1
- 102100028226 COUP transcription factor 2 Human genes 0.000 description 1
- 108091011896 CSF1 Proteins 0.000 description 1
- 108090000835 CX3C Chemokine Receptor 1 Proteins 0.000 description 1
- 108010061304 CXCR6 Receptors Proteins 0.000 description 1
- 102000000905 Cadherin Human genes 0.000 description 1
- 108050007957 Cadherin Proteins 0.000 description 1
- 102100024156 Cadherin-12 Human genes 0.000 description 1
- 102100024154 Cadherin-13 Human genes 0.000 description 1
- 102100029761 Cadherin-5 Human genes 0.000 description 1
- 102100025331 Cadherin-8 Human genes 0.000 description 1
- 102100025332 Cadherin-9 Human genes 0.000 description 1
- 101100314454 Caenorhabditis elegans tra-1 gene Proteins 0.000 description 1
- 101100293794 Canis lupus familiaris NME1 gene Proteins 0.000 description 1
- 101001110283 Canis lupus familiaris Ras-related C3 botulinum toxin substrate 1 Proteins 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 102100032145 Carbohydrate sulfotransferase 10 Human genes 0.000 description 1
- 102000005367 Carboxypeptidases Human genes 0.000 description 1
- 108010006303 Carboxypeptidases Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 102100025632 Caspase recruitment domain-containing protein 18 Human genes 0.000 description 1
- 102100035904 Caspase-1 Human genes 0.000 description 1
- 102100025597 Caspase-4 Human genes 0.000 description 1
- 108090000712 Cathepsin B Proteins 0.000 description 1
- 102000004225 Cathepsin B Human genes 0.000 description 1
- 102100021633 Cathepsin B Human genes 0.000 description 1
- 102100035888 Caveolin-1 Human genes 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 1
- 102100025745 Cerberus Human genes 0.000 description 1
- 102100031011 Chemerin-like receptor 1 Human genes 0.000 description 1
- 108010083647 Chemokine CCL24 Proteins 0.000 description 1
- 108010083698 Chemokine CCL26 Proteins 0.000 description 1
- 108010055166 Chemokine CCL5 Proteins 0.000 description 1
- 102000012286 Chitinases Human genes 0.000 description 1
- 108010022172 Chitinases Proteins 0.000 description 1
- 108010038447 Chromogranin A Proteins 0.000 description 1
- 102100031186 Chromogranin-A Human genes 0.000 description 1
- 108010044213 Class 5 Receptor-Like Protein Tyrosine Phosphatases Proteins 0.000 description 1
- 102100038423 Claudin-3 Human genes 0.000 description 1
- 108050007296 Claudin-7 Proteins 0.000 description 1
- 101710094648 Coat protein Proteins 0.000 description 1
- 102100033601 Collagen alpha-1(I) chain Human genes 0.000 description 1
- 102100031519 Collagen alpha-1(VI) chain Human genes 0.000 description 1
- 102100031162 Collagen alpha-1(XVIII) chain Human genes 0.000 description 1
- 102100033780 Collagen alpha-3(IV) chain Human genes 0.000 description 1
- 102100032768 Complement receptor type 2 Human genes 0.000 description 1
- 102100030291 Cornifin-B Human genes 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 108050006400 Cyclin Proteins 0.000 description 1
- 108010058546 Cyclin D1 Proteins 0.000 description 1
- 102100025176 Cyclin-A1 Human genes 0.000 description 1
- 102100025191 Cyclin-A2 Human genes 0.000 description 1
- 108010024986 Cyclin-Dependent Kinase 2 Proteins 0.000 description 1
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 1
- 108010025454 Cyclin-Dependent Kinase 5 Proteins 0.000 description 1
- 108010025468 Cyclin-Dependent Kinase 6 Proteins 0.000 description 1
- 108010009356 Cyclin-Dependent Kinase Inhibitor p15 Proteins 0.000 description 1
- 102000009512 Cyclin-Dependent Kinase Inhibitor p15 Human genes 0.000 description 1
- 108010009392 Cyclin-Dependent Kinase Inhibitor p16 Proteins 0.000 description 1
- 108010009367 Cyclin-Dependent Kinase Inhibitor p18 Proteins 0.000 description 1
- 102000009503 Cyclin-Dependent Kinase Inhibitor p18 Human genes 0.000 description 1
- 108010016788 Cyclin-Dependent Kinase Inhibitor p21 Proteins 0.000 description 1
- 108010016777 Cyclin-Dependent Kinase Inhibitor p27 Proteins 0.000 description 1
- 102000000577 Cyclin-Dependent Kinase Inhibitor p27 Human genes 0.000 description 1
- 108010017222 Cyclin-Dependent Kinase Inhibitor p57 Proteins 0.000 description 1
- 102000004480 Cyclin-Dependent Kinase Inhibitor p57 Human genes 0.000 description 1
- 102100036239 Cyclin-dependent kinase 2 Human genes 0.000 description 1
- 102100036252 Cyclin-dependent kinase 4 Human genes 0.000 description 1
- 102100026804 Cyclin-dependent kinase 6 Human genes 0.000 description 1
- 102100026810 Cyclin-dependent kinase 7 Human genes 0.000 description 1
- 102100024457 Cyclin-dependent kinase 9 Human genes 0.000 description 1
- 102100033270 Cyclin-dependent kinase inhibitor 1 Human genes 0.000 description 1
- 102100024458 Cyclin-dependent kinase inhibitor 2A Human genes 0.000 description 1
- 102100026805 Cyclin-dependent-like kinase 5 Human genes 0.000 description 1
- 108010037462 Cyclooxygenase 2 Proteins 0.000 description 1
- 102100031051 Cysteine and glycine-rich protein 1 Human genes 0.000 description 1
- 102100031655 Cytochrome b5 Human genes 0.000 description 1
- 102100035298 Cytokine SCM-1 beta Human genes 0.000 description 1
- 102100026234 Cytokine receptor common subunit gamma Human genes 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- 102100036952 Cytoplasmic protein NCK2 Human genes 0.000 description 1
- 102000010831 Cytoskeletal Proteins Human genes 0.000 description 1
- 108010037414 Cytoskeletal Proteins Proteins 0.000 description 1
- 108010014790 DAX-1 Orphan Nuclear Receptor Proteins 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 102100033587 DNA topoisomerase 2-alpha Human genes 0.000 description 1
- 101100481404 Danio rerio tie1 gene Proteins 0.000 description 1
- 102100031817 Delta-type opioid receptor Human genes 0.000 description 1
- 108700022150 Designed Ankyrin Repeat Proteins Proteins 0.000 description 1
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 1
- 102100028571 Disabled homolog 2-interacting protein Human genes 0.000 description 1
- 102100023332 Dual specificity mitogen-activated protein kinase kinase 7 Human genes 0.000 description 1
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 102100040565 Dynein light chain 1, cytoplasmic Human genes 0.000 description 1
- 102100036254 E3 SUMO-protein ligase PIAS2 Human genes 0.000 description 1
- 102100022183 E3 ubiquitin-protein ligase MIB1 Human genes 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 102100033267 Early placenta insulin-like peptide Human genes 0.000 description 1
- 102100037241 Endoglin Human genes 0.000 description 1
- 241000588921 Enterobacteriaceae Species 0.000 description 1
- 108010092408 Eosinophil Peroxidase Proteins 0.000 description 1
- 102100028471 Eosinophil peroxidase Human genes 0.000 description 1
- 101710139422 Eotaxin Proteins 0.000 description 1
- 108010055323 EphB4 Receptor Proteins 0.000 description 1
- 102100031983 Ephrin type-B receptor 4 Human genes 0.000 description 1
- 108010043945 Ephrin-A1 Proteins 0.000 description 1
- 102000020086 Ephrin-A1 Human genes 0.000 description 1
- 102100033940 Ephrin-A3 Human genes 0.000 description 1
- 102100023721 Ephrin-B2 Human genes 0.000 description 1
- 102000009024 Epidermal Growth Factor Human genes 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 102100038595 Estrogen receptor Human genes 0.000 description 1
- 102100029951 Estrogen receptor beta Human genes 0.000 description 1
- 101000837299 Euglena gracilis Trans-2-enoyl-CoA reductase Proteins 0.000 description 1
- 229910052693 Europium Inorganic materials 0.000 description 1
- 102100026693 FAS-associated death domain protein Human genes 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 108010008177 Fd immunoglobulins Proteins 0.000 description 1
- 102000003971 Fibroblast Growth Factor 1 Human genes 0.000 description 1
- 102100031706 Fibroblast growth factor 1 Human genes 0.000 description 1
- 102100028412 Fibroblast growth factor 10 Human genes 0.000 description 1
- 102100028413 Fibroblast growth factor 11 Human genes 0.000 description 1
- 102100035290 Fibroblast growth factor 13 Human genes 0.000 description 1
- 102100035292 Fibroblast growth factor 14 Human genes 0.000 description 1
- 102100035308 Fibroblast growth factor 17 Human genes 0.000 description 1
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 1
- 102100031361 Fibroblast growth factor 20 Human genes 0.000 description 1
- 108090000376 Fibroblast growth factor 21 Proteins 0.000 description 1
- 102000003973 Fibroblast growth factor 21 Human genes 0.000 description 1
- 102100024804 Fibroblast growth factor 22 Human genes 0.000 description 1
- 102100024802 Fibroblast growth factor 23 Human genes 0.000 description 1
- 102100028043 Fibroblast growth factor 3 Human genes 0.000 description 1
- 108090000381 Fibroblast growth factor 4 Proteins 0.000 description 1
- 102100028073 Fibroblast growth factor 5 Human genes 0.000 description 1
- 108090000382 Fibroblast growth factor 6 Proteins 0.000 description 1
- 108090000385 Fibroblast growth factor 7 Proteins 0.000 description 1
- 102100037680 Fibroblast growth factor 8 Human genes 0.000 description 1
- 108090000368 Fibroblast growth factor 8 Proteins 0.000 description 1
- 102100037665 Fibroblast growth factor 9 Human genes 0.000 description 1
- 102100027842 Fibroblast growth factor receptor 3 Human genes 0.000 description 1
- 101710182396 Fibroblast growth factor receptor 3 Proteins 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- 102100024165 G1/S-specific cyclin-D1 Human genes 0.000 description 1
- 102100037854 G1/S-specific cyclin-E2 Human genes 0.000 description 1
- 102000017700 GABRP Human genes 0.000 description 1
- 101150019176 GDF10 gene Proteins 0.000 description 1
- 102100033417 Glucocorticoid receptor Human genes 0.000 description 1
- 102000058058 Glucose Transporter Type 2 Human genes 0.000 description 1
- 102100030943 Glutathione S-transferase P Human genes 0.000 description 1
- 102100033366 Glutathione hydrolase 1 proenzyme Human genes 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 1
- 102100034221 Growth-regulated alpha protein Human genes 0.000 description 1
- 102100035379 Growth/differentiation factor 5 Human genes 0.000 description 1
- 102100032610 Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas Human genes 0.000 description 1
- 102100028972 HLA class I histocompatibility antigen, A alpha chain Human genes 0.000 description 1
- 102100030595 HLA class II histocompatibility antigen gamma chain Human genes 0.000 description 1
- 102100040505 HLA class II histocompatibility antigen, DR alpha chain Human genes 0.000 description 1
- 108010075704 HLA-A Antigens Proteins 0.000 description 1
- 108010067802 HLA-DR alpha-Chains Proteins 0.000 description 1
- 102100028006 Heme oxygenase 1 Human genes 0.000 description 1
- 108010007707 Hepatitis A Virus Cellular Receptor 2 Proteins 0.000 description 1
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 1
- 102100034676 Hepatocyte cell adhesion molecule Human genes 0.000 description 1
- 102100021866 Hepatocyte growth factor Human genes 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102100038006 High affinity immunoglobulin epsilon receptor subunit alpha Human genes 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 102000000543 Histamine Receptors Human genes 0.000 description 1
- 108010002059 Histamine Receptors Proteins 0.000 description 1
- 102100021454 Histone deacetylase 4 Human genes 0.000 description 1
- 102100021453 Histone deacetylase 5 Human genes 0.000 description 1
- 102100038719 Histone deacetylase 7 Human genes 0.000 description 1
- 102100038720 Histone deacetylase 9 Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101001071349 Homo sapiens 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor Proteins 0.000 description 1
- 101000627872 Homo sapiens 72 kDa type IV collagenase Proteins 0.000 description 1
- 101000774717 Homo sapiens A-kinase anchor protein 1, mitochondrial Proteins 0.000 description 1
- 101000774738 Homo sapiens A-kinase anchor protein 2 Proteins 0.000 description 1
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 1
- 101000783783 Homo sapiens ATP-binding cassette sub-family F member 1 Proteins 0.000 description 1
- 101000799140 Homo sapiens Activin receptor type-1 Proteins 0.000 description 1
- 101000799189 Homo sapiens Activin receptor type-1B Proteins 0.000 description 1
- 101000970954 Homo sapiens Activin receptor type-2A Proteins 0.000 description 1
- 101000937269 Homo sapiens Activin receptor type-2B Proteins 0.000 description 1
- 101000824278 Homo sapiens Acyl-[acyl-carrier-protein] hydrolase Proteins 0.000 description 1
- 101000924577 Homo sapiens Adenomatous polyposis coli protein Proteins 0.000 description 1
- 101000783751 Homo sapiens Adenosine receptor A2a Proteins 0.000 description 1
- 101000796780 Homo sapiens Adhesion G protein-coupled receptor B1 Proteins 0.000 description 1
- 101000890626 Homo sapiens Allograft inflammatory factor 1 Proteins 0.000 description 1
- 101000819490 Homo sapiens Alpha-(1,6)-fucosyltransferase Proteins 0.000 description 1
- 101000678026 Homo sapiens Alpha-1-antichymotrypsin Proteins 0.000 description 1
- 101000823116 Homo sapiens Alpha-1-antitrypsin Proteins 0.000 description 1
- 101000760787 Homo sapiens Alpha-taxilin Proteins 0.000 description 1
- 101000718108 Homo sapiens Androgen-induced gene 1 protein Proteins 0.000 description 1
- 101000924552 Homo sapiens Angiopoietin-1 Proteins 0.000 description 1
- 101000924533 Homo sapiens Angiopoietin-2 Proteins 0.000 description 1
- 101000693085 Homo sapiens Angiopoietin-related protein 3 Proteins 0.000 description 1
- 101000775021 Homo sapiens Anterior gradient protein 2 homolog Proteins 0.000 description 1
- 101000693801 Homo sapiens Anti-Muellerian hormone type-2 receptor Proteins 0.000 description 1
- 101000928628 Homo sapiens Apolipoprotein C-I Proteins 0.000 description 1
- 101000678879 Homo sapiens Atypical chemokine receptor 1 Proteins 0.000 description 1
- 101000798902 Homo sapiens Atypical chemokine receptor 4 Proteins 0.000 description 1
- 101000914489 Homo sapiens B-cell antigen receptor complex-associated protein alpha chain Proteins 0.000 description 1
- 101000914491 Homo sapiens B-cell antigen receptor complex-associated protein beta chain Proteins 0.000 description 1
- 101000934359 Homo sapiens B-cell differentiation antigen CD72 Proteins 0.000 description 1
- 101000803266 Homo sapiens B-cell linker protein Proteins 0.000 description 1
- 101000971234 Homo sapiens B-cell lymphoma 6 protein Proteins 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000740062 Homo sapiens BAG family molecular chaperone regulator 1 Proteins 0.000 description 1
- 101000863864 Homo sapiens Beta-galactoside alpha-2,6-sialyltransferase 1 Proteins 0.000 description 1
- 101000576812 Homo sapiens Beta-microseminoprotein Proteins 0.000 description 1
- 101000603876 Homo sapiens Bile acid receptor Proteins 0.000 description 1
- 101000762366 Homo sapiens Bone morphogenetic protein 2 Proteins 0.000 description 1
- 101000762379 Homo sapiens Bone morphogenetic protein 4 Proteins 0.000 description 1
- 101000899390 Homo sapiens Bone morphogenetic protein 6 Proteins 0.000 description 1
- 101000899368 Homo sapiens Bone morphogenetic protein 8B Proteins 0.000 description 1
- 101000934635 Homo sapiens Bone morphogenetic protein receptor type-2 Proteins 0.000 description 1
- 101000980744 Homo sapiens C-C chemokine receptor type 3 Proteins 0.000 description 1
- 101000738584 Homo sapiens C-C chemokine receptor type 4 Proteins 0.000 description 1
- 101000946926 Homo sapiens C-C chemokine receptor type 5 Proteins 0.000 description 1
- 101000716065 Homo sapiens C-C chemokine receptor type 7 Proteins 0.000 description 1
- 101000934394 Homo sapiens C-C chemokine receptor-like 2 Proteins 0.000 description 1
- 101000978379 Homo sapiens C-C motif chemokine 13 Proteins 0.000 description 1
- 101000978376 Homo sapiens C-C motif chemokine 15 Proteins 0.000 description 1
- 101000978362 Homo sapiens C-C motif chemokine 17 Proteins 0.000 description 1
- 101000897493 Homo sapiens C-C motif chemokine 26 Proteins 0.000 description 1
- 101000897477 Homo sapiens C-C motif chemokine 28 Proteins 0.000 description 1
- 101000797762 Homo sapiens C-C motif chemokine 5 Proteins 0.000 description 1
- 101000797758 Homo sapiens C-C motif chemokine 7 Proteins 0.000 description 1
- 101000946794 Homo sapiens C-C motif chemokine 8 Proteins 0.000 description 1
- 101000947174 Homo sapiens C-X-C chemokine receptor type 1 Proteins 0.000 description 1
- 101000922348 Homo sapiens C-X-C chemokine receptor type 4 Proteins 0.000 description 1
- 101000922405 Homo sapiens C-X-C chemokine receptor type 5 Proteins 0.000 description 1
- 101000858064 Homo sapiens C-X-C motif chemokine 13 Proteins 0.000 description 1
- 101000858068 Homo sapiens C-X-C motif chemokine 14 Proteins 0.000 description 1
- 101000889133 Homo sapiens C-X-C motif chemokine 16 Proteins 0.000 description 1
- 101000889128 Homo sapiens C-X-C motif chemokine 2 Proteins 0.000 description 1
- 101000947193 Homo sapiens C-X-C motif chemokine 3 Proteins 0.000 description 1
- 101000947177 Homo sapiens C-X-C motif chemokine 6 Proteins 0.000 description 1
- 101000947172 Homo sapiens C-X-C motif chemokine 9 Proteins 0.000 description 1
- 101000867983 Homo sapiens C5a anaphylatoxin chemotactic receptor 1 Proteins 0.000 description 1
- 101000945963 Homo sapiens CCAAT/enhancer-binding protein beta Proteins 0.000 description 1
- 101000868215 Homo sapiens CD40 ligand Proteins 0.000 description 1
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000914479 Homo sapiens CD81 antigen Proteins 0.000 description 1
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 1
- 101000749427 Homo sapiens CKLF-like MARVEL transmembrane domain-containing protein 2 Proteins 0.000 description 1
- 101000749433 Homo sapiens CKLF-like MARVEL transmembrane domain-containing protein 3 Proteins 0.000 description 1
- 101000749431 Homo sapiens CKLF-like MARVEL transmembrane domain-containing protein 4 Proteins 0.000 description 1
- 101000749437 Homo sapiens CKLF-like MARVEL transmembrane domain-containing protein 5 Proteins 0.000 description 1
- 101000749435 Homo sapiens CKLF-like MARVEL transmembrane domain-containing protein 6 Proteins 0.000 description 1
- 101000749308 Homo sapiens CKLF-like MARVEL transmembrane domain-containing protein 7 Proteins 0.000 description 1
- 101000888512 Homo sapiens CKLF-like MARVEL transmembrane domain-containing protein 8 Proteins 0.000 description 1
- 101000860854 Homo sapiens COUP transcription factor 1 Proteins 0.000 description 1
- 101000860860 Homo sapiens COUP transcription factor 2 Proteins 0.000 description 1
- 101100275686 Homo sapiens CR2 gene Proteins 0.000 description 1
- 101000762238 Homo sapiens Cadherin-12 Proteins 0.000 description 1
- 101000762243 Homo sapiens Cadherin-13 Proteins 0.000 description 1
- 101000899410 Homo sapiens Cadherin-19 Proteins 0.000 description 1
- 101000794587 Homo sapiens Cadherin-5 Proteins 0.000 description 1
- 101000935111 Homo sapiens Cadherin-7 Proteins 0.000 description 1
- 101000935095 Homo sapiens Cadherin-8 Proteins 0.000 description 1
- 101000935098 Homo sapiens Cadherin-9 Proteins 0.000 description 1
- 101000775595 Homo sapiens Carbohydrate sulfotransferase 10 Proteins 0.000 description 1
- 101000933105 Homo sapiens Caspase recruitment domain-containing protein 18 Proteins 0.000 description 1
- 101000715398 Homo sapiens Caspase-1 Proteins 0.000 description 1
- 101000933112 Homo sapiens Caspase-4 Proteins 0.000 description 1
- 101000898449 Homo sapiens Cathepsin B Proteins 0.000 description 1
- 101000715467 Homo sapiens Caveolin-1 Proteins 0.000 description 1
- 101000914195 Homo sapiens Cerberus Proteins 0.000 description 1
- 101000919756 Homo sapiens Chemerin-like receptor 1 Proteins 0.000 description 1
- 101000882908 Homo sapiens Claudin-3 Proteins 0.000 description 1
- 101000912652 Homo sapiens Claudin-7 Proteins 0.000 description 1
- 101000941581 Homo sapiens Collagen alpha-1(VI) chain Proteins 0.000 description 1
- 101000940068 Homo sapiens Collagen alpha-1(XVIII) chain Proteins 0.000 description 1
- 101000710873 Homo sapiens Collagen alpha-3(IV) chain Proteins 0.000 description 1
- 101000702152 Homo sapiens Cornifin-B Proteins 0.000 description 1
- 101000934314 Homo sapiens Cyclin-A1 Proteins 0.000 description 1
- 101000934320 Homo sapiens Cyclin-A2 Proteins 0.000 description 1
- 101000715946 Homo sapiens Cyclin-dependent kinase 3 Proteins 0.000 description 1
- 101000911952 Homo sapiens Cyclin-dependent kinase 7 Proteins 0.000 description 1
- 101000980930 Homo sapiens Cyclin-dependent kinase 9 Proteins 0.000 description 1
- 101000945639 Homo sapiens Cyclin-dependent kinase inhibitor 3 Proteins 0.000 description 1
- 101000922386 Homo sapiens Cytochrome b5 Proteins 0.000 description 1
- 101000804771 Homo sapiens Cytokine SCM-1 beta Proteins 0.000 description 1
- 101001055227 Homo sapiens Cytokine receptor common subunit gamma Proteins 0.000 description 1
- 101001024712 Homo sapiens Cytoplasmic protein NCK2 Proteins 0.000 description 1
- 101000992305 Homo sapiens Delta-type opioid receptor Proteins 0.000 description 1
- 101000908391 Homo sapiens Dipeptidyl peptidase 4 Proteins 0.000 description 1
- 101000915396 Homo sapiens Disabled homolog 2-interacting protein Proteins 0.000 description 1
- 101000624594 Homo sapiens Dual specificity mitogen-activated protein kinase kinase 7 Proteins 0.000 description 1
- 101001057612 Homo sapiens Dual specificity protein phosphatase 5 Proteins 0.000 description 1
- 101000966403 Homo sapiens Dynein light chain 1, cytoplasmic Proteins 0.000 description 1
- 101001074629 Homo sapiens E3 SUMO-protein ligase PIAS2 Proteins 0.000 description 1
- 101000973503 Homo sapiens E3 ubiquitin-protein ligase MIB1 Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101000998777 Homo sapiens Early placenta insulin-like peptide Proteins 0.000 description 1
- 101000881679 Homo sapiens Endoglin Proteins 0.000 description 1
- 101000978392 Homo sapiens Eotaxin Proteins 0.000 description 1
- 101000925241 Homo sapiens Ephrin-A3 Proteins 0.000 description 1
- 101001049392 Homo sapiens Ephrin-B2 Proteins 0.000 description 1
- 101000882584 Homo sapiens Estrogen receptor Proteins 0.000 description 1
- 101001010910 Homo sapiens Estrogen receptor beta Proteins 0.000 description 1
- 101000911074 Homo sapiens FAS-associated death domain protein Proteins 0.000 description 1
- 101000917237 Homo sapiens Fibroblast growth factor 10 Proteins 0.000 description 1
- 101000917236 Homo sapiens Fibroblast growth factor 11 Proteins 0.000 description 1
- 101000878181 Homo sapiens Fibroblast growth factor 14 Proteins 0.000 description 1
- 101000878124 Homo sapiens Fibroblast growth factor 17 Proteins 0.000 description 1
- 101000846532 Homo sapiens Fibroblast growth factor 20 Proteins 0.000 description 1
- 101001051971 Homo sapiens Fibroblast growth factor 22 Proteins 0.000 description 1
- 101001051973 Homo sapiens Fibroblast growth factor 23 Proteins 0.000 description 1
- 101001060280 Homo sapiens Fibroblast growth factor 3 Proteins 0.000 description 1
- 101001060274 Homo sapiens Fibroblast growth factor 4 Proteins 0.000 description 1
- 101001060267 Homo sapiens Fibroblast growth factor 5 Proteins 0.000 description 1
- 101001060265 Homo sapiens Fibroblast growth factor 6 Proteins 0.000 description 1
- 101001060261 Homo sapiens Fibroblast growth factor 7 Proteins 0.000 description 1
- 101001027382 Homo sapiens Fibroblast growth factor 8 Proteins 0.000 description 1
- 101001027380 Homo sapiens Fibroblast growth factor 9 Proteins 0.000 description 1
- 101001027128 Homo sapiens Fibronectin Proteins 0.000 description 1
- 101000738575 Homo sapiens G1/S-specific cyclin-E2 Proteins 0.000 description 1
- 101000822394 Homo sapiens Gamma-aminobutyric acid receptor subunit pi Proteins 0.000 description 1
- 101000876511 Homo sapiens General transcription and DNA repair factor IIH helicase subunit XPD Proteins 0.000 description 1
- 101000926939 Homo sapiens Glucocorticoid receptor Proteins 0.000 description 1
- 101001010139 Homo sapiens Glutathione S-transferase P Proteins 0.000 description 1
- 101000997558 Homo sapiens Glutathione hydrolase 1 proenzyme Proteins 0.000 description 1
- 101000746373 Homo sapiens Granulocyte-macrophage colony-stimulating factor Proteins 0.000 description 1
- 101001069921 Homo sapiens Growth-regulated alpha protein Proteins 0.000 description 1
- 101000893563 Homo sapiens Growth/differentiation factor 10 Proteins 0.000 description 1
- 101001023988 Homo sapiens Growth/differentiation factor 5 Proteins 0.000 description 1
- 101001014590 Homo sapiens Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas Proteins 0.000 description 1
- 101001014594 Homo sapiens Guanine nucleotide-binding protein G(s) subunit alpha isoforms short Proteins 0.000 description 1
- 101001082627 Homo sapiens HLA class II histocompatibility antigen gamma chain Proteins 0.000 description 1
- 101001079623 Homo sapiens Heme oxygenase 1 Proteins 0.000 description 1
- 101000872875 Homo sapiens Hepatocyte cell adhesion molecule Proteins 0.000 description 1
- 101000898034 Homo sapiens Hepatocyte growth factor Proteins 0.000 description 1
- 101000878611 Homo sapiens High affinity immunoglobulin epsilon receptor subunit alpha Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101000899259 Homo sapiens Histone deacetylase 4 Proteins 0.000 description 1
- 101000899255 Homo sapiens Histone deacetylase 5 Proteins 0.000 description 1
- 101001032113 Homo sapiens Histone deacetylase 7 Proteins 0.000 description 1
- 101001032092 Homo sapiens Histone deacetylase 9 Proteins 0.000 description 1
- 101001035752 Homo sapiens Hydroxycarboxylic acid receptor 3 Proteins 0.000 description 1
- 101001019455 Homo sapiens ICOS ligand Proteins 0.000 description 1
- 101001002508 Homo sapiens Immunoglobulin-binding protein 1 Proteins 0.000 description 1
- 101001076604 Homo sapiens Inhibin alpha chain Proteins 0.000 description 1
- 101000998783 Homo sapiens Insulin-like 3 Proteins 0.000 description 1
- 101001034652 Homo sapiens Insulin-like growth factor 1 receptor Proteins 0.000 description 1
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 1
- 101001076292 Homo sapiens Insulin-like growth factor II Proteins 0.000 description 1
- 101001044940 Homo sapiens Insulin-like growth factor-binding protein 2 Proteins 0.000 description 1
- 101001044927 Homo sapiens Insulin-like growth factor-binding protein 3 Proteins 0.000 description 1
- 101000840582 Homo sapiens Insulin-like growth factor-binding protein 6 Proteins 0.000 description 1
- 101001078158 Homo sapiens Integrin alpha-1 Proteins 0.000 description 1
- 101001078133 Homo sapiens Integrin alpha-2 Proteins 0.000 description 1
- 101000994378 Homo sapiens Integrin alpha-3 Proteins 0.000 description 1
- 101000994365 Homo sapiens Integrin alpha-6 Proteins 0.000 description 1
- 101001046677 Homo sapiens Integrin alpha-V Proteins 0.000 description 1
- 101001015004 Homo sapiens Integrin beta-3 Proteins 0.000 description 1
- 101001015006 Homo sapiens Integrin beta-4 Proteins 0.000 description 1
- 101001002695 Homo sapiens Integrin-linked protein kinase Proteins 0.000 description 1
- 101000959820 Homo sapiens Interferon alpha-1/13 Proteins 0.000 description 1
- 101000959794 Homo sapiens Interferon alpha-2 Proteins 0.000 description 1
- 101000959708 Homo sapiens Interferon alpha-4 Proteins 0.000 description 1
- 101000959704 Homo sapiens Interferon alpha-5 Proteins 0.000 description 1
- 101000959714 Homo sapiens Interferon alpha-6 Proteins 0.000 description 1
- 101000961126 Homo sapiens Interferon alpha-7 Proteins 0.000 description 1
- 101001054334 Homo sapiens Interferon beta Proteins 0.000 description 1
- 101001002470 Homo sapiens Interferon lambda-1 Proteins 0.000 description 1
- 101001002469 Homo sapiens Interferon lambda-2 Proteins 0.000 description 1
- 101001002466 Homo sapiens Interferon lambda-3 Proteins 0.000 description 1
- 101000999370 Homo sapiens Interferon omega-1 Proteins 0.000 description 1
- 101001033249 Homo sapiens Interleukin-1 beta Proteins 0.000 description 1
- 101001076386 Homo sapiens Interleukin-1 family member 10 Proteins 0.000 description 1
- 101001076418 Homo sapiens Interleukin-1 receptor type 1 Proteins 0.000 description 1
- 101001076422 Homo sapiens Interleukin-1 receptor type 2 Proteins 0.000 description 1
- 101000852255 Homo sapiens Interleukin-1 receptor-associated kinase-like 2 Proteins 0.000 description 1
- 101000852965 Homo sapiens Interleukin-1 receptor-like 2 Proteins 0.000 description 1
- 101001083151 Homo sapiens Interleukin-10 receptor subunit alpha Proteins 0.000 description 1
- 101001003149 Homo sapiens Interleukin-10 receptor subunit beta Proteins 0.000 description 1
- 101001003147 Homo sapiens Interleukin-11 receptor subunit alpha Proteins 0.000 description 1
- 101001003142 Homo sapiens Interleukin-12 receptor subunit beta-1 Proteins 0.000 description 1
- 101001003138 Homo sapiens Interleukin-12 receptor subunit beta-2 Proteins 0.000 description 1
- 101001010600 Homo sapiens Interleukin-12 subunit alpha Proteins 0.000 description 1
- 101000852992 Homo sapiens Interleukin-12 subunit beta Proteins 0.000 description 1
- 101001003135 Homo sapiens Interleukin-13 receptor subunit alpha-1 Proteins 0.000 description 1
- 101001003132 Homo sapiens Interleukin-13 receptor subunit alpha-2 Proteins 0.000 description 1
- 101001003140 Homo sapiens Interleukin-15 receptor subunit alpha Proteins 0.000 description 1
- 101001019598 Homo sapiens Interleukin-17 receptor A Proteins 0.000 description 1
- 101000998146 Homo sapiens Interleukin-17A Proteins 0.000 description 1
- 101000998181 Homo sapiens Interleukin-17B Proteins 0.000 description 1
- 101000998178 Homo sapiens Interleukin-17C Proteins 0.000 description 1
- 101000961065 Homo sapiens Interleukin-18 receptor 1 Proteins 0.000 description 1
- 101001019615 Homo sapiens Interleukin-18 receptor accessory protein Proteins 0.000 description 1
- 101001019591 Homo sapiens Interleukin-18-binding protein Proteins 0.000 description 1
- 101000960946 Homo sapiens Interleukin-19 Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101001055145 Homo sapiens Interleukin-2 receptor subunit beta Proteins 0.000 description 1
- 101001010591 Homo sapiens Interleukin-20 Proteins 0.000 description 1
- 101001044893 Homo sapiens Interleukin-20 receptor subunit alpha Proteins 0.000 description 1
- 101001010626 Homo sapiens Interleukin-22 Proteins 0.000 description 1
- 101001044883 Homo sapiens Interleukin-22 receptor subunit alpha-1 Proteins 0.000 description 1
- 101001044887 Homo sapiens Interleukin-22 receptor subunit alpha-2 Proteins 0.000 description 1
- 101000853009 Homo sapiens Interleukin-24 Proteins 0.000 description 1
- 101000853002 Homo sapiens Interleukin-25 Proteins 0.000 description 1
- 101000853000 Homo sapiens Interleukin-26 Proteins 0.000 description 1
- 101000852998 Homo sapiens Interleukin-27 subunit alpha Proteins 0.000 description 1
- 101001033279 Homo sapiens Interleukin-3 Proteins 0.000 description 1
- 101001033312 Homo sapiens Interleukin-4 receptor subunit alpha Proteins 0.000 description 1
- 101000960936 Homo sapiens Interleukin-5 receptor subunit alpha Proteins 0.000 description 1
- 101001076408 Homo sapiens Interleukin-6 Proteins 0.000 description 1
- 101000599048 Homo sapiens Interleukin-6 receptor subunit alpha Proteins 0.000 description 1
- 101000599056 Homo sapiens Interleukin-6 receptor subunit beta Proteins 0.000 description 1
- 101001043809 Homo sapiens Interleukin-7 receptor subunit alpha Proteins 0.000 description 1
- 101001055219 Homo sapiens Interleukin-9 receptor Proteins 0.000 description 1
- 101000605522 Homo sapiens Kallikrein-1 Proteins 0.000 description 1
- 101001008919 Homo sapiens Kallikrein-10 Proteins 0.000 description 1
- 101000605516 Homo sapiens Kallikrein-12 Proteins 0.000 description 1
- 101000605514 Homo sapiens Kallikrein-13 Proteins 0.000 description 1
- 101000605520 Homo sapiens Kallikrein-14 Proteins 0.000 description 1
- 101000605518 Homo sapiens Kallikrein-15 Proteins 0.000 description 1
- 101001091379 Homo sapiens Kallikrein-5 Proteins 0.000 description 1
- 101001091385 Homo sapiens Kallikrein-6 Proteins 0.000 description 1
- 101001091356 Homo sapiens Kallikrein-9 Proteins 0.000 description 1
- 101000998011 Homo sapiens Keratin, type I cytoskeletal 19 Proteins 0.000 description 1
- 101001026977 Homo sapiens Keratin, type II cuticular Hb6 Proteins 0.000 description 1
- 101001046960 Homo sapiens Keratin, type II cytoskeletal 1 Proteins 0.000 description 1
- 101001046936 Homo sapiens Keratin, type II cytoskeletal 2 epidermal Proteins 0.000 description 1
- 101001046952 Homo sapiens Keratin, type II cytoskeletal 2 oral Proteins 0.000 description 1
- 101000934753 Homo sapiens Keratin, type II cytoskeletal 75 Proteins 0.000 description 1
- 101000716729 Homo sapiens Kit ligand Proteins 0.000 description 1
- 101001139130 Homo sapiens Krueppel-like factor 5 Proteins 0.000 description 1
- 101001139126 Homo sapiens Krueppel-like factor 6 Proteins 0.000 description 1
- 101001008527 Homo sapiens Laminin subunit alpha-5 Proteins 0.000 description 1
- 101001059438 Homo sapiens Leucine-rich repeat transmembrane protein FLRT1 Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101001017969 Homo sapiens Leukotriene B4 receptor 2 Proteins 0.000 description 1
- 101000927946 Homo sapiens LisH domain-containing protein ARMC9 Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000804764 Homo sapiens Lymphotactin Proteins 0.000 description 1
- 101000739159 Homo sapiens Mammaglobin-A Proteins 0.000 description 1
- 101000739168 Homo sapiens Mammaglobin-B Proteins 0.000 description 1
- 101000990902 Homo sapiens Matrix metalloproteinase-9 Proteins 0.000 description 1
- 101000628547 Homo sapiens Metalloreductase STEAP1 Proteins 0.000 description 1
- 101000628535 Homo sapiens Metalloreductase STEAP2 Proteins 0.000 description 1
- 101000990990 Homo sapiens Midkine Proteins 0.000 description 1
- 101000615613 Homo sapiens Mineralocorticoid receptor Proteins 0.000 description 1
- 101000976899 Homo sapiens Mitogen-activated protein kinase 15 Proteins 0.000 description 1
- 101001030211 Homo sapiens Myc proto-oncogene protein Proteins 0.000 description 1
- 101000616778 Homo sapiens Myelin-associated glycoprotein Proteins 0.000 description 1
- 101001013159 Homo sapiens Myeloid leukemia factor 2 Proteins 0.000 description 1
- 101000928278 Homo sapiens Natriuretic peptides B Proteins 0.000 description 1
- 101000979293 Homo sapiens Negative elongation factor C/D Proteins 0.000 description 1
- 101000995164 Homo sapiens Netrin-4 Proteins 0.000 description 1
- 101001014610 Homo sapiens Neuroendocrine secretory protein 55 Proteins 0.000 description 1
- 101000979338 Homo sapiens Nuclear factor NF-kappa-B p100 subunit Proteins 0.000 description 1
- 101000979342 Homo sapiens Nuclear factor NF-kappa-B p105 subunit Proteins 0.000 description 1
- 101000978937 Homo sapiens Nuclear receptor subfamily 0 group B member 2 Proteins 0.000 description 1
- 101000978926 Homo sapiens Nuclear receptor subfamily 1 group D member 1 Proteins 0.000 description 1
- 101000633503 Homo sapiens Nuclear receptor subfamily 2 group E member 1 Proteins 0.000 description 1
- 101000633516 Homo sapiens Nuclear receptor subfamily 2 group F member 6 Proteins 0.000 description 1
- 101001109700 Homo sapiens Nuclear receptor subfamily 4 group A member 1 Proteins 0.000 description 1
- 101001109698 Homo sapiens Nuclear receptor subfamily 4 group A member 2 Proteins 0.000 description 1
- 101001109689 Homo sapiens Nuclear receptor subfamily 4 group A member 3 Proteins 0.000 description 1
- 101001109685 Homo sapiens Nuclear receptor subfamily 5 group A member 2 Proteins 0.000 description 1
- 101001109682 Homo sapiens Nuclear receptor subfamily 6 group A member 1 Proteins 0.000 description 1
- 101000979629 Homo sapiens Nucleoside diphosphate kinase A Proteins 0.000 description 1
- 101001098352 Homo sapiens OX-2 membrane glycoprotein Proteins 0.000 description 1
- 101001114057 Homo sapiens P antigen family member 1 Proteins 0.000 description 1
- 101001114052 Homo sapiens P antigen family member 4 Proteins 0.000 description 1
- 101001098175 Homo sapiens P2X purinoceptor 7 Proteins 0.000 description 1
- 101001074571 Homo sapiens PIN2/TERF1-interacting telomerase inhibitor 1 Proteins 0.000 description 1
- 101000613565 Homo sapiens PRKC apoptosis WT1 regulator protein Proteins 0.000 description 1
- 101001095231 Homo sapiens Peptidyl-prolyl cis-trans isomerase D Proteins 0.000 description 1
- 101001073025 Homo sapiens Peroxisomal targeting signal 1 receptor Proteins 0.000 description 1
- 101000595751 Homo sapiens Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Proteins 0.000 description 1
- 101000633511 Homo sapiens Photoreceptor-specific nuclear receptor Proteins 0.000 description 1
- 101001073422 Homo sapiens Pigment epithelium-derived factor Proteins 0.000 description 1
- 101000595923 Homo sapiens Placenta growth factor Proteins 0.000 description 1
- 101001091365 Homo sapiens Plasma kallikrein Proteins 0.000 description 1
- 101000605403 Homo sapiens Plasminogen Proteins 0.000 description 1
- 101001116302 Homo sapiens Platelet endothelial cell adhesion molecule Proteins 0.000 description 1
- 101001096065 Homo sapiens Plexin domain-containing protein 1 Proteins 0.000 description 1
- 101001056707 Homo sapiens Proepiregulin Proteins 0.000 description 1
- 101000904173 Homo sapiens Progonadoliberin-1 Proteins 0.000 description 1
- 101000610543 Homo sapiens Prokineticin-2 Proteins 0.000 description 1
- 101000945496 Homo sapiens Proliferation marker protein Ki-67 Proteins 0.000 description 1
- 101001117314 Homo sapiens Prostaglandin D2 receptor 2 Proteins 0.000 description 1
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 description 1
- 101000605534 Homo sapiens Prostate-specific antigen Proteins 0.000 description 1
- 101000797903 Homo sapiens Protein ALEX Proteins 0.000 description 1
- 101000740825 Homo sapiens Protein C10 Proteins 0.000 description 1
- 101001021281 Homo sapiens Protein HEXIM1 Proteins 0.000 description 1
- 101000986265 Homo sapiens Protein MTSS 1 Proteins 0.000 description 1
- 101000861454 Homo sapiens Protein c-Fos Proteins 0.000 description 1
- 101000994437 Homo sapiens Protein jagged-1 Proteins 0.000 description 1
- 101000602015 Homo sapiens Protocadherin gamma-B4 Proteins 0.000 description 1
- 101000655540 Homo sapiens Protransforming growth factor alpha Proteins 0.000 description 1
- 101000668165 Homo sapiens RNA-binding motif, single-stranded-interacting protein 1 Proteins 0.000 description 1
- 101001110313 Homo sapiens Ras-related C3 botulinum toxin substrate 2 Proteins 0.000 description 1
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101001132698 Homo sapiens Retinoic acid receptor beta Proteins 0.000 description 1
- 101000739195 Homo sapiens Secretoglobin family 1D member 2 Proteins 0.000 description 1
- 101000716809 Homo sapiens Secretogranin-1 Proteins 0.000 description 1
- 101001026870 Homo sapiens Serine/threonine-protein kinase D1 Proteins 0.000 description 1
- 101001133085 Homo sapiens Sialomucin core protein 24 Proteins 0.000 description 1
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 description 1
- 101000651890 Homo sapiens Slit homolog 2 protein Proteins 0.000 description 1
- 101000651893 Homo sapiens Slit homolog 3 protein Proteins 0.000 description 1
- 101000910249 Homo sapiens Soluble calcium-activated nucleotidase 1 Proteins 0.000 description 1
- 101000868152 Homo sapiens Son of sevenless homolog 1 Proteins 0.000 description 1
- 101000693265 Homo sapiens Sphingosine 1-phosphate receptor 1 Proteins 0.000 description 1
- 101000689224 Homo sapiens Src-like-adapter 2 Proteins 0.000 description 1
- 101000684994 Homo sapiens Stromal cell-derived factor 2 Proteins 0.000 description 1
- 101000713602 Homo sapiens T-box transcription factor TBX21 Proteins 0.000 description 1
- 101000716124 Homo sapiens T-cell surface glycoprotein CD1c Proteins 0.000 description 1
- 101000946860 Homo sapiens T-cell surface glycoprotein CD3 epsilon chain Proteins 0.000 description 1
- 101000738413 Homo sapiens T-cell surface glycoprotein CD3 gamma chain Proteins 0.000 description 1
- 101000738335 Homo sapiens T-cell surface glycoprotein CD3 zeta chain Proteins 0.000 description 1
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 1
- 101000666340 Homo sapiens Tenascin Proteins 0.000 description 1
- 101000800639 Homo sapiens Teneurin-1 Proteins 0.000 description 1
- 101000835745 Homo sapiens Teratocarcinoma-derived growth factor 1 Proteins 0.000 description 1
- 101000799461 Homo sapiens Thrombopoietin Proteins 0.000 description 1
- 101000659879 Homo sapiens Thrombospondin-1 Proteins 0.000 description 1
- 101000633605 Homo sapiens Thrombospondin-2 Proteins 0.000 description 1
- 101000633617 Homo sapiens Thrombospondin-4 Proteins 0.000 description 1
- 101000845170 Homo sapiens Thymic stromal lymphopoietin Proteins 0.000 description 1
- 101000796134 Homo sapiens Thymidine phosphorylase Proteins 0.000 description 1
- 101000830560 Homo sapiens Toll-interacting protein Proteins 0.000 description 1
- 101000763537 Homo sapiens Toll-like receptor 10 Proteins 0.000 description 1
- 101000831567 Homo sapiens Toll-like receptor 2 Proteins 0.000 description 1
- 101000831496 Homo sapiens Toll-like receptor 3 Proteins 0.000 description 1
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 description 1
- 101000669460 Homo sapiens Toll-like receptor 5 Proteins 0.000 description 1
- 101000669406 Homo sapiens Toll-like receptor 6 Proteins 0.000 description 1
- 101000669402 Homo sapiens Toll-like receptor 7 Proteins 0.000 description 1
- 101000800483 Homo sapiens Toll-like receptor 8 Proteins 0.000 description 1
- 101000819111 Homo sapiens Trans-acting T-cell-specific transcription factor GATA-3 Proteins 0.000 description 1
- 101000904152 Homo sapiens Transcription factor E2F1 Proteins 0.000 description 1
- 101001050288 Homo sapiens Transcription factor Jun Proteins 0.000 description 1
- 101000635958 Homo sapiens Transforming growth factor beta-2 proprotein Proteins 0.000 description 1
- 101000894525 Homo sapiens Transforming growth factor-beta-induced protein ig-h3 Proteins 0.000 description 1
- 101000795117 Homo sapiens Triggering receptor expressed on myeloid cells 2 Proteins 0.000 description 1
- 101000801701 Homo sapiens Tropomyosin alpha-1 chain Proteins 0.000 description 1
- 101000851892 Homo sapiens Tropomyosin beta chain Proteins 0.000 description 1
- 101000830565 Homo sapiens Tumor necrosis factor ligand superfamily member 10 Proteins 0.000 description 1
- 101000830603 Homo sapiens Tumor necrosis factor ligand superfamily member 11 Proteins 0.000 description 1
- 101000830598 Homo sapiens Tumor necrosis factor ligand superfamily member 12 Proteins 0.000 description 1
- 101000830600 Homo sapiens Tumor necrosis factor ligand superfamily member 13 Proteins 0.000 description 1
- 101000597779 Homo sapiens Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 description 1
- 101000638161 Homo sapiens Tumor necrosis factor ligand superfamily member 6 Proteins 0.000 description 1
- 101000638255 Homo sapiens Tumor necrosis factor ligand superfamily member 8 Proteins 0.000 description 1
- 101000638251 Homo sapiens Tumor necrosis factor ligand superfamily member 9 Proteins 0.000 description 1
- 101000801228 Homo sapiens Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 1
- 101000801232 Homo sapiens Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 101000679921 Homo sapiens Tumor necrosis factor receptor superfamily member 21 Proteins 0.000 description 1
- 101000679857 Homo sapiens Tumor necrosis factor receptor superfamily member 3 Proteins 0.000 description 1
- 101000611185 Homo sapiens Tumor necrosis factor receptor superfamily member 5 Proteins 0.000 description 1
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 description 1
- 101000850748 Homo sapiens Tumor necrosis factor receptor type 1-associated DEATH domain protein Proteins 0.000 description 1
- 101000997835 Homo sapiens Tyrosine-protein kinase JAK1 Proteins 0.000 description 1
- 101000934996 Homo sapiens Tyrosine-protein kinase JAK3 Proteins 0.000 description 1
- 101000753253 Homo sapiens Tyrosine-protein kinase receptor Tie-1 Proteins 0.000 description 1
- 101000638886 Homo sapiens Urokinase-type plasminogen activator Proteins 0.000 description 1
- 101000742579 Homo sapiens Vascular endothelial growth factor B Proteins 0.000 description 1
- 101000742596 Homo sapiens Vascular endothelial growth factor C Proteins 0.000 description 1
- 101000742599 Homo sapiens Vascular endothelial growth factor D Proteins 0.000 description 1
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 description 1
- 101000666856 Homo sapiens Vasoactive intestinal polypeptide receptor 1 Proteins 0.000 description 1
- 101001125402 Homo sapiens Vitamin K-dependent protein C Proteins 0.000 description 1
- 101000868549 Homo sapiens Voltage-dependent calcium channel gamma-like subunit Proteins 0.000 description 1
- 101000994810 Homo sapiens X-linked interleukin-1 receptor accessory protein-like 2 Proteins 0.000 description 1
- 101001059220 Homo sapiens Zinc finger protein Gfi-1 Proteins 0.000 description 1
- 101000931371 Homo sapiens Zinc finger protein ZFPM2 Proteins 0.000 description 1
- 101000669028 Homo sapiens Zinc phosphodiesterase ELAC protein 2 Proteins 0.000 description 1
- 101000818517 Homo sapiens Zinc-alpha-2-glycoprotein Proteins 0.000 description 1
- 101001026578 Hordeum vulgare Ent-kaurenoic acid oxidase 1 Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 102100039356 Hydroxycarboxylic acid receptor 3 Human genes 0.000 description 1
- 102100034980 ICOS ligand Human genes 0.000 description 1
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 1
- 108091058536 IL1F9 Proteins 0.000 description 1
- 102000026633 IL6 Human genes 0.000 description 1
- 108091058560 IL8 Proteins 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 102000009490 IgG Receptors Human genes 0.000 description 1
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 1
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 102100021042 Immunoglobulin-binding protein 1 Human genes 0.000 description 1
- 102100025885 Inhibin alpha chain Human genes 0.000 description 1
- 102100027004 Inhibin beta A chain Human genes 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 108010001127 Insulin Receptor Proteins 0.000 description 1
- 102100036721 Insulin receptor Human genes 0.000 description 1
- 102100033262 Insulin-like 3 Human genes 0.000 description 1
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 1
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 1
- 102100025947 Insulin-like growth factor II Human genes 0.000 description 1
- 102100022710 Insulin-like growth factor-binding protein 2 Human genes 0.000 description 1
- 102100022708 Insulin-like growth factor-binding protein 3 Human genes 0.000 description 1
- 102100029180 Insulin-like growth factor-binding protein 6 Human genes 0.000 description 1
- 102100025323 Integrin alpha-1 Human genes 0.000 description 1
- 102100025305 Integrin alpha-2 Human genes 0.000 description 1
- 102100032819 Integrin alpha-3 Human genes 0.000 description 1
- 102100032816 Integrin alpha-6 Human genes 0.000 description 1
- 102100022337 Integrin alpha-V Human genes 0.000 description 1
- 108010008212 Integrin alpha4beta1 Proteins 0.000 description 1
- 102100032999 Integrin beta-3 Human genes 0.000 description 1
- 102100033000 Integrin beta-4 Human genes 0.000 description 1
- 102100020944 Integrin-linked protein kinase Human genes 0.000 description 1
- 102100040019 Interferon alpha-1/13 Human genes 0.000 description 1
- 102100040018 Interferon alpha-2 Human genes 0.000 description 1
- 102100039949 Interferon alpha-4 Human genes 0.000 description 1
- 102100039948 Interferon alpha-5 Human genes 0.000 description 1
- 102100040007 Interferon alpha-6 Human genes 0.000 description 1
- 102100039350 Interferon alpha-7 Human genes 0.000 description 1
- 102100026720 Interferon beta Human genes 0.000 description 1
- 102100020990 Interferon lambda-1 Human genes 0.000 description 1
- 102100020989 Interferon lambda-2 Human genes 0.000 description 1
- 102100020992 Interferon lambda-3 Human genes 0.000 description 1
- 102100036479 Interferon omega-1 Human genes 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102100039065 Interleukin-1 beta Human genes 0.000 description 1
- 102100026015 Interleukin-1 family member 10 Human genes 0.000 description 1
- 102100026016 Interleukin-1 receptor type 1 Human genes 0.000 description 1
- 102100026017 Interleukin-1 receptor type 2 Human genes 0.000 description 1
- 102100036433 Interleukin-1 receptor-associated kinase-like 2 Human genes 0.000 description 1
- 102100036697 Interleukin-1 receptor-like 2 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 102000003814 Interleukin-10 Human genes 0.000 description 1
- 102100030236 Interleukin-10 receptor subunit alpha Human genes 0.000 description 1
- 102100020788 Interleukin-10 receptor subunit beta Human genes 0.000 description 1
- 108090000177 Interleukin-11 Proteins 0.000 description 1
- 102000003815 Interleukin-11 Human genes 0.000 description 1
- 102100020787 Interleukin-11 receptor subunit alpha Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 102100020790 Interleukin-12 receptor subunit beta-1 Human genes 0.000 description 1
- 102100020792 Interleukin-12 receptor subunit beta-2 Human genes 0.000 description 1
- 102100030698 Interleukin-12 subunit alpha Human genes 0.000 description 1
- 102100036701 Interleukin-12 subunit beta Human genes 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 102000003816 Interleukin-13 Human genes 0.000 description 1
- 102100020791 Interleukin-13 receptor subunit alpha-1 Human genes 0.000 description 1
- 102100020793 Interleukin-13 receptor subunit alpha-2 Human genes 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 102000003812 Interleukin-15 Human genes 0.000 description 1
- 102100020789 Interleukin-15 receptor subunit alpha Human genes 0.000 description 1
- 101800003050 Interleukin-16 Proteins 0.000 description 1
- 102000049772 Interleukin-16 Human genes 0.000 description 1
- 102100035018 Interleukin-17 receptor A Human genes 0.000 description 1
- 102100033461 Interleukin-17A Human genes 0.000 description 1
- 102100033101 Interleukin-17B Human genes 0.000 description 1
- 102100033105 Interleukin-17C Human genes 0.000 description 1
- 102000003810 Interleukin-18 Human genes 0.000 description 1
- 108090000171 Interleukin-18 Proteins 0.000 description 1
- 102100039340 Interleukin-18 receptor 1 Human genes 0.000 description 1
- 102100035010 Interleukin-18 receptor accessory protein Human genes 0.000 description 1
- 102100035017 Interleukin-18-binding protein Human genes 0.000 description 1
- 102100039879 Interleukin-19 Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 1
- 102100026879 Interleukin-2 receptor subunit beta Human genes 0.000 description 1
- 102100030692 Interleukin-20 Human genes 0.000 description 1
- 102100022706 Interleukin-20 receptor subunit alpha Human genes 0.000 description 1
- 108010017411 Interleukin-21 Receptors Proteins 0.000 description 1
- 102100030699 Interleukin-21 receptor Human genes 0.000 description 1
- 102100030703 Interleukin-22 Human genes 0.000 description 1
- 102100022723 Interleukin-22 receptor subunit alpha-1 Human genes 0.000 description 1
- 102100022703 Interleukin-22 receptor subunit alpha-2 Human genes 0.000 description 1
- 102000013264 Interleukin-23 Human genes 0.000 description 1
- 108010065637 Interleukin-23 Proteins 0.000 description 1
- 102100036671 Interleukin-24 Human genes 0.000 description 1
- 102100036679 Interleukin-26 Human genes 0.000 description 1
- 108010066979 Interleukin-27 Proteins 0.000 description 1
- 102100039064 Interleukin-3 Human genes 0.000 description 1
- 102100033474 Interleukin-36 alpha Human genes 0.000 description 1
- 102100033498 Interleukin-36 beta Human genes 0.000 description 1
- 102100033503 Interleukin-36 gamma Human genes 0.000 description 1
- 102100033502 Interleukin-37 Human genes 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 102000004388 Interleukin-4 Human genes 0.000 description 1
- 102100039078 Interleukin-4 receptor subunit alpha Human genes 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 102000000743 Interleukin-5 Human genes 0.000 description 1
- 102100039881 Interleukin-5 receptor subunit alpha Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 1
- 102100037795 Interleukin-6 receptor subunit beta Human genes 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 102000000704 Interleukin-7 Human genes 0.000 description 1
- 102100021593 Interleukin-7 receptor subunit alpha Human genes 0.000 description 1
- 102000004890 Interleukin-8 Human genes 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 102000000585 Interleukin-9 Human genes 0.000 description 1
- 102100026244 Interleukin-9 receptor Human genes 0.000 description 1
- 102000002698 KIR Receptors Human genes 0.000 description 1
- 108010043610 KIR Receptors Proteins 0.000 description 1
- 102100027613 Kallikrein-10 Human genes 0.000 description 1
- 102100038318 Kallikrein-12 Human genes 0.000 description 1
- 102100038315 Kallikrein-13 Human genes 0.000 description 1
- 102100038298 Kallikrein-14 Human genes 0.000 description 1
- 102100038301 Kallikrein-15 Human genes 0.000 description 1
- 102100034872 Kallikrein-4 Human genes 0.000 description 1
- 102100034868 Kallikrein-5 Human genes 0.000 description 1
- 102100034866 Kallikrein-6 Human genes 0.000 description 1
- 102100034876 Kallikrein-9 Human genes 0.000 description 1
- 108700032443 Kangai-1 Proteins 0.000 description 1
- 102000057159 Kangai-1 Human genes 0.000 description 1
- 102100037382 Keratin, type II cuticular Hb6 Human genes 0.000 description 1
- 102100022905 Keratin, type II cytoskeletal 1 Human genes 0.000 description 1
- 102100022854 Keratin, type II cytoskeletal 2 epidermal Human genes 0.000 description 1
- 102100022926 Keratin, type II cytoskeletal 2 oral Human genes 0.000 description 1
- 102100025367 Keratin, type II cytoskeletal 75 Human genes 0.000 description 1
- 108010066302 Keratin-19 Proteins 0.000 description 1
- YINZYTTZHLPWBO-UHFFFAOYSA-N Kifunensine Natural products COC1C(O)C(O)C(O)C2NC(=O)C(=O)N12 YINZYTTZHLPWBO-UHFFFAOYSA-N 0.000 description 1
- 102100020880 Kit ligand Human genes 0.000 description 1
- 102100020680 Krueppel-like factor 5 Human genes 0.000 description 1
- 102100020679 Krueppel-like factor 6 Human genes 0.000 description 1
- 125000000415 L-cysteinyl group Chemical group O=C([*])[C@@](N([H])[H])([H])C([H])([H])S[H] 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- 102000007330 LDL Lipoproteins Human genes 0.000 description 1
- 108010007622 LDL Lipoproteins Proteins 0.000 description 1
- 101150030213 Lag3 gene Proteins 0.000 description 1
- 102100027450 Laminin subunit alpha-5 Human genes 0.000 description 1
- 102100038269 Large neutral amino acids transporter small subunit 3 Human genes 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100028919 Leucine-rich repeat transmembrane protein FLRT1 Human genes 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 102100033375 Leukotriene B4 receptor 2 Human genes 0.000 description 1
- 102100036882 LisH domain-containing protein ARMC9 Human genes 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 1
- 102000034655 MIF Human genes 0.000 description 1
- 108060004872 MIF Proteins 0.000 description 1
- 101150053046 MYD88 gene Proteins 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 108010031030 Mammaglobin A Proteins 0.000 description 1
- 108010031029 Mammaglobin B Proteins 0.000 description 1
- 102100030412 Matrix metalloproteinase-9 Human genes 0.000 description 1
- 102100026261 Metalloproteinase inhibitor 3 Human genes 0.000 description 1
- 102100026712 Metalloreductase STEAP1 Human genes 0.000 description 1
- 102100026711 Metalloreductase STEAP2 Human genes 0.000 description 1
- 101000726683 Metarhizium anisopliae Cuticle-degrading protease Proteins 0.000 description 1
- 108010092801 Midkine Proteins 0.000 description 1
- 102100021316 Mineralocorticoid receptor Human genes 0.000 description 1
- 102100023483 Mitogen-activated protein kinase 15 Human genes 0.000 description 1
- 102100030173 Muellerian-inhibiting factor Human genes 0.000 description 1
- 101710122877 Muellerian-inhibiting factor Proteins 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 101000934396 Mus musculus C-C chemokine receptor-like 2 Proteins 0.000 description 1
- 101100219997 Mus musculus Ccr1 gene Proteins 0.000 description 1
- 101100005657 Mus musculus Ccr7 gene Proteins 0.000 description 1
- 101100275687 Mus musculus Cr2 gene Proteins 0.000 description 1
- 101100446506 Mus musculus Fgf3 gene Proteins 0.000 description 1
- 101000969137 Mus musculus Metallothionein-1 Proteins 0.000 description 1
- 101100027996 Mus musculus Omg gene Proteins 0.000 description 1
- 101100481406 Mus musculus Tie1 gene Proteins 0.000 description 1
- 101100425751 Mus musculus Tnfrsf19 gene Proteins 0.000 description 1
- 101000597780 Mus musculus Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 102100026784 Myelin proteolipid protein Human genes 0.000 description 1
- 101710094913 Myelin proteolipid protein Proteins 0.000 description 1
- 102100024134 Myeloid differentiation primary response protein MyD88 Human genes 0.000 description 1
- 102100029687 Myeloid leukemia factor 2 Human genes 0.000 description 1
- OVRNDRQMDRJTHS-RTRLPJTCSA-N N-acetyl-D-glucosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-RTRLPJTCSA-N 0.000 description 1
- 108010082695 NADPH Oxidase 5 Proteins 0.000 description 1
- 102100021871 NADPH oxidase 5 Human genes 0.000 description 1
- 102100036836 Natriuretic peptides B Human genes 0.000 description 1
- 108010004217 Natural Cytotoxicity Triggering Receptor 1 Proteins 0.000 description 1
- 102100023069 Negative elongation factor C/D Human genes 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 108010032605 Nerve Growth Factor Receptors Proteins 0.000 description 1
- 108010043296 Neurocan Proteins 0.000 description 1
- 102100030466 Neurocan core protein Human genes 0.000 description 1
- 108090000772 Neuropilin-1 Proteins 0.000 description 1
- 108090000770 Neuropilin-2 Proteins 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 108010077641 Nogo Proteins Proteins 0.000 description 1
- 102000010410 Nogo Proteins Human genes 0.000 description 1
- 102100023059 Nuclear factor NF-kappa-B p100 subunit Human genes 0.000 description 1
- 102100023050 Nuclear factor NF-kappa-B p105 subunit Human genes 0.000 description 1
- 102100039019 Nuclear receptor subfamily 0 group B member 1 Human genes 0.000 description 1
- 102100023172 Nuclear receptor subfamily 0 group B member 2 Human genes 0.000 description 1
- 102100023170 Nuclear receptor subfamily 1 group D member 1 Human genes 0.000 description 1
- 102100023171 Nuclear receptor subfamily 1 group D member 2 Human genes 0.000 description 1
- 102100028470 Nuclear receptor subfamily 2 group C member 1 Human genes 0.000 description 1
- 102100028448 Nuclear receptor subfamily 2 group C member 2 Human genes 0.000 description 1
- 102100029534 Nuclear receptor subfamily 2 group E member 1 Human genes 0.000 description 1
- 102100029528 Nuclear receptor subfamily 2 group F member 6 Human genes 0.000 description 1
- 102100022679 Nuclear receptor subfamily 4 group A member 1 Human genes 0.000 description 1
- 102100022676 Nuclear receptor subfamily 4 group A member 2 Human genes 0.000 description 1
- 102100022673 Nuclear receptor subfamily 4 group A member 3 Human genes 0.000 description 1
- 102100022669 Nuclear receptor subfamily 5 group A member 2 Human genes 0.000 description 1
- 102100022670 Nuclear receptor subfamily 6 group A member 1 Human genes 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- 102100023252 Nucleoside diphosphate kinase A Human genes 0.000 description 1
- 102100037589 OX-2 membrane glycoprotein Human genes 0.000 description 1
- 108010042215 OX40 Ligand Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 102100040557 Osteopontin Human genes 0.000 description 1
- 102100023219 P antigen family member 1 Human genes 0.000 description 1
- 102100023240 P antigen family member 4 Human genes 0.000 description 1
- 102100037602 P2X purinoceptor 7 Human genes 0.000 description 1
- 102100040853 PRKC apoptosis WT1 regulator protein Human genes 0.000 description 1
- 101150084398 PTAFR gene Proteins 0.000 description 1
- 108010011536 PTEN Phosphohydrolase Proteins 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 108010030544 Peptidyl-Lys metalloendopeptidase Proteins 0.000 description 1
- 102100037827 Peptidyl-prolyl cis-trans isomerase D Human genes 0.000 description 1
- 102100036598 Peroxisomal targeting signal 1 receptor Human genes 0.000 description 1
- 102100032543 Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN Human genes 0.000 description 1
- 102100036052 Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform Human genes 0.000 description 1
- 102100029533 Photoreceptor-specific nuclear receptor Human genes 0.000 description 1
- 241000235648 Pichia Species 0.000 description 1
- 102100035846 Pigment epithelium-derived factor Human genes 0.000 description 1
- 102100035194 Placenta growth factor Human genes 0.000 description 1
- 102100034869 Plasma kallikrein Human genes 0.000 description 1
- 102100038124 Plasminogen Human genes 0.000 description 1
- 102100024616 Platelet endothelial cell adhesion molecule Human genes 0.000 description 1
- 108700023400 Platelet-activating factor receptors Proteins 0.000 description 1
- 102100037596 Platelet-derived growth factor subunit A Human genes 0.000 description 1
- 102100040990 Platelet-derived growth factor subunit B Human genes 0.000 description 1
- 102100030477 Plectin Human genes 0.000 description 1
- 108010054050 Plectin Proteins 0.000 description 1
- 102100037891 Plexin domain-containing protein 1 Human genes 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 101710098940 Pro-epidermal growth factor Proteins 0.000 description 1
- 101710083689 Probable capsid protein Proteins 0.000 description 1
- 102100025498 Proepiregulin Human genes 0.000 description 1
- 102100024028 Progonadoliberin-1 Human genes 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- 102100040125 Prokineticin-2 Human genes 0.000 description 1
- 102100036691 Proliferating cell nuclear antigen Human genes 0.000 description 1
- 102100034836 Proliferation marker protein Ki-67 Human genes 0.000 description 1
- 102100024218 Prostaglandin D2 receptor 2 Human genes 0.000 description 1
- 108050003267 Prostaglandin G/H synthase 2 Proteins 0.000 description 1
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102100038957 Protein C10 Human genes 0.000 description 1
- 108010015499 Protein Kinase C-theta Proteins 0.000 description 1
- 102100028951 Protein MTSS 1 Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 102100027584 Protein c-Fos Human genes 0.000 description 1
- 102100032702 Protein jagged-1 Human genes 0.000 description 1
- 102100021566 Protein kinase C theta type Human genes 0.000 description 1
- 102100023068 Protein kinase C-binding protein NELL1 Human genes 0.000 description 1
- 102100034433 Protein kinase C-binding protein NELL2 Human genes 0.000 description 1
- 108010019674 Proto-Oncogene Proteins c-sis Proteins 0.000 description 1
- 102100032350 Protransforming growth factor alpha Human genes 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 108010007100 Pulmonary Surfactant-Associated Protein A Proteins 0.000 description 1
- 102100027773 Pulmonary surfactant-associated protein A2 Human genes 0.000 description 1
- 108010025832 RANK Ligand Proteins 0.000 description 1
- 102100022129 Ras-related C3 botulinum toxin substrate 2 Human genes 0.000 description 1
- 108010038036 Receptor Activator of Nuclear Factor-kappa B Proteins 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 102100028508 Receptor-type tyrosine-protein phosphatase zeta Human genes 0.000 description 1
- 102100021269 Regulator of G-protein signaling 1 Human genes 0.000 description 1
- 101710140408 Regulator of G-protein signaling 1 Proteins 0.000 description 1
- 101710148333 Regulator of G-protein signaling 13 Proteins 0.000 description 1
- 102100021035 Regulator of G-protein signaling 18 Human genes 0.000 description 1
- 102100037415 Regulator of G-protein signaling 3 Human genes 0.000 description 1
- 101710140411 Regulator of G-protein signaling 3 Proteins 0.000 description 1
- 102100033909 Retinoic acid receptor beta Human genes 0.000 description 1
- 108091008770 Rev-ErbAß Proteins 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 102000000395 SH3 domains Human genes 0.000 description 1
- 108050008861 SH3 domains Proteins 0.000 description 1
- 108091006299 SLC2A2 Proteins 0.000 description 1
- 108091006570 SLC33A1 Proteins 0.000 description 1
- 108091006993 SLC43A1 Proteins 0.000 description 1
- 108010011005 STAT6 Transcription Factor Proteins 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 101100184049 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) MID2 gene Proteins 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 102100037279 Secretoglobin family 1D member 2 Human genes 0.000 description 1
- 102100020867 Secretogranin-1 Human genes 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 102100037310 Serine/threonine-protein kinase D1 Human genes 0.000 description 1
- 241000607720 Serratia Species 0.000 description 1
- 108010089417 Sex Hormone-Binding Globulin Proteins 0.000 description 1
- 102100030758 Sex hormone-binding globulin Human genes 0.000 description 1
- 102100034258 Sialomucin core protein 24 Human genes 0.000 description 1
- 102100038081 Signal transducer CD24 Human genes 0.000 description 1
- 102100023980 Signal transducer and activator of transcription 6 Human genes 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 102100022433 Single-stranded DNA cytosine deaminase Human genes 0.000 description 1
- 102100027339 Slit homolog 3 protein Human genes 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 102100024397 Soluble calcium-activated nucleotidase 1 Human genes 0.000 description 1
- 102100025750 Sphingosine 1-phosphate receptor 1 Human genes 0.000 description 1
- 101710168942 Sphingosine-1-phosphate phosphatase 1 Proteins 0.000 description 1
- 102100024510 Src-like-adapter 2 Human genes 0.000 description 1
- 102100030511 Stanniocalcin-1 Human genes 0.000 description 1
- 101710142157 Stanniocalcin-1 Proteins 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 101000582398 Staphylococcus aureus Replication initiation protein Proteins 0.000 description 1
- 108010048349 Steroidogenic Factor 1 Proteins 0.000 description 1
- 102100029856 Steroidogenic factor 1 Human genes 0.000 description 1
- 102100023184 Stromal cell-derived factor 2 Human genes 0.000 description 1
- 102100036840 T-box transcription factor TBX21 Human genes 0.000 description 1
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 description 1
- 102100036014 T-cell surface glycoprotein CD1c Human genes 0.000 description 1
- 102100035794 T-cell surface glycoprotein CD3 epsilon chain Human genes 0.000 description 1
- 102100037911 T-cell surface glycoprotein CD3 gamma chain Human genes 0.000 description 1
- 102100037906 T-cell surface glycoprotein CD3 zeta chain Human genes 0.000 description 1
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 1
- 239000006180 TBST buffer Substances 0.000 description 1
- 102100033456 TGF-beta receptor type-1 Human genes 0.000 description 1
- 102100033455 TGF-beta receptor type-2 Human genes 0.000 description 1
- 108090000925 TNF receptor-associated factor 2 Proteins 0.000 description 1
- 102000004399 TNF receptor-associated factor 3 Human genes 0.000 description 1
- 108090000922 TNF receptor-associated factor 3 Proteins 0.000 description 1
- 102000003715 TNF receptor-associated factor 4 Human genes 0.000 description 1
- 108090000008 TNF receptor-associated factor 4 Proteins 0.000 description 1
- 102000003718 TNF receptor-associated factor 5 Human genes 0.000 description 1
- 108090000001 TNF receptor-associated factor 5 Proteins 0.000 description 1
- 102000003714 TNF receptor-associated factor 6 Human genes 0.000 description 1
- 108090000009 TNF receptor-associated factor 6 Proteins 0.000 description 1
- 108700012411 TNFSF10 Proteins 0.000 description 1
- 102100034779 TRAF family member-associated NF-kappa-B activator Human genes 0.000 description 1
- 102100033213 Teneurin-1 Human genes 0.000 description 1
- 102100026404 Teratocarcinoma-derived growth factor 1 Human genes 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 108010000499 Thromboplastin Proteins 0.000 description 1
- 102100034195 Thrombopoietin Human genes 0.000 description 1
- 108010046722 Thrombospondin 1 Proteins 0.000 description 1
- 102100029529 Thrombospondin-2 Human genes 0.000 description 1
- 102100029219 Thrombospondin-4 Human genes 0.000 description 1
- 102100031294 Thymic stromal lymphopoietin Human genes 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 102100031372 Thymidine phosphorylase Human genes 0.000 description 1
- 108010031429 Tissue Inhibitor of Metalloproteinase-3 Proteins 0.000 description 1
- 102100030859 Tissue factor Human genes 0.000 description 1
- 108010060818 Toll-Like Receptor 9 Proteins 0.000 description 1
- 102100024652 Toll-interacting protein Human genes 0.000 description 1
- 102000002689 Toll-like receptor Human genes 0.000 description 1
- 108020000411 Toll-like receptor Proteins 0.000 description 1
- 102100027009 Toll-like receptor 10 Human genes 0.000 description 1
- 102100024333 Toll-like receptor 2 Human genes 0.000 description 1
- 102100024324 Toll-like receptor 3 Human genes 0.000 description 1
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 1
- 102100039357 Toll-like receptor 5 Human genes 0.000 description 1
- 102100039387 Toll-like receptor 6 Human genes 0.000 description 1
- 102100039390 Toll-like receptor 7 Human genes 0.000 description 1
- 102100033110 Toll-like receptor 8 Human genes 0.000 description 1
- 102100033117 Toll-like receptor 9 Human genes 0.000 description 1
- 101710183280 Topoisomerase Proteins 0.000 description 1
- 102100021386 Trans-acting T-cell-specific transcription factor GATA-3 Human genes 0.000 description 1
- 102100024026 Transcription factor E2F1 Human genes 0.000 description 1
- 102100023132 Transcription factor Jun Human genes 0.000 description 1
- 108010033576 Transferrin Receptors Proteins 0.000 description 1
- 102100026144 Transferrin receptor protein 1 Human genes 0.000 description 1
- 108010011702 Transforming Growth Factor-beta Type I Receptor Proteins 0.000 description 1
- 108010082684 Transforming Growth Factor-beta Type II Receptor Proteins 0.000 description 1
- 102100033663 Transforming growth factor beta receptor type 3 Human genes 0.000 description 1
- 102100030737 Transforming growth factor beta-2 proprotein Human genes 0.000 description 1
- 102000056172 Transforming growth factor beta-3 Human genes 0.000 description 1
- 108090000097 Transforming growth factor beta-3 Proteins 0.000 description 1
- 102100021398 Transforming growth factor-beta-induced protein ig-h3 Human genes 0.000 description 1
- 108050001421 Transient receptor potential channel, canonical 6 Proteins 0.000 description 1
- 102000011213 Transient receptor potential channel, canonical 6 Human genes 0.000 description 1
- 102100029678 Triggering receptor expressed on myeloid cells 2 Human genes 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 102100033632 Tropomyosin alpha-1 chain Human genes 0.000 description 1
- 102100036471 Tropomyosin beta chain Human genes 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 108010047933 Tumor Necrosis Factor alpha-Induced Protein 3 Proteins 0.000 description 1
- 108010078814 Tumor Suppressor Protein p53 Proteins 0.000 description 1
- 102100024596 Tumor necrosis factor alpha-induced protein 3 Human genes 0.000 description 1
- 101710097155 Tumor necrosis factor ligand superfamily member 12 Proteins 0.000 description 1
- 102100024585 Tumor necrosis factor ligand superfamily member 13 Human genes 0.000 description 1
- 101710181056 Tumor necrosis factor ligand superfamily member 13B Proteins 0.000 description 1
- 102100028787 Tumor necrosis factor receptor superfamily member 11A Human genes 0.000 description 1
- 102100033725 Tumor necrosis factor receptor superfamily member 16 Human genes 0.000 description 1
- 102100033732 Tumor necrosis factor receptor superfamily member 1A Human genes 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 102100022205 Tumor necrosis factor receptor superfamily member 21 Human genes 0.000 description 1
- 102100022156 Tumor necrosis factor receptor superfamily member 3 Human genes 0.000 description 1
- 102100040403 Tumor necrosis factor receptor superfamily member 6 Human genes 0.000 description 1
- 102100033081 Tumor necrosis factor receptor type 1-associated DEATH domain protein Human genes 0.000 description 1
- 108010046308 Type II DNA Topoisomerases Proteins 0.000 description 1
- 108010089374 Type II Keratins Proteins 0.000 description 1
- 102000007962 Type II Keratins Human genes 0.000 description 1
- 102100033438 Tyrosine-protein kinase JAK1 Human genes 0.000 description 1
- 102100025387 Tyrosine-protein kinase JAK3 Human genes 0.000 description 1
- 102100022007 Tyrosine-protein kinase receptor Tie-1 Human genes 0.000 description 1
- 108010073919 Vascular Endothelial Growth Factor D Proteins 0.000 description 1
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 102100038217 Vascular endothelial growth factor B Human genes 0.000 description 1
- 102100038232 Vascular endothelial growth factor C Human genes 0.000 description 1
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 102100029477 Vitamin K-dependent protein C Human genes 0.000 description 1
- 102100032336 Voltage-dependent calcium channel gamma-like subunit Human genes 0.000 description 1
- 102100034412 X-linked interleukin-1 receptor accessory protein-like 2 Human genes 0.000 description 1
- PTFCDOFLOPIGGS-UHFFFAOYSA-N Zinc dication Chemical compound [Zn+2] PTFCDOFLOPIGGS-UHFFFAOYSA-N 0.000 description 1
- 102100029004 Zinc finger protein Gfi-1 Human genes 0.000 description 1
- 102100020996 Zinc finger protein ZFPM2 Human genes 0.000 description 1
- 102100039877 Zinc phosphodiesterase ELAC protein 2 Human genes 0.000 description 1
- 102100021144 Zinc-alpha-2-glycoprotein Human genes 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 108010076089 accutase Proteins 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 108010029483 alpha 1 Chain Collagen Type I Proteins 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 238000011091 antibody purification Methods 0.000 description 1
- 102000025171 antigen binding proteins Human genes 0.000 description 1
- 108091000831 antigen binding proteins Proteins 0.000 description 1
- 230000005775 apoptotic pathway Effects 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- KMGARVOVYXNAOF-UHFFFAOYSA-N benzpiperylone Chemical compound C1CN(C)CCC1N1C(=O)C(CC=2C=CC=CC=2)=C(C=2C=CC=CC=2)N1 KMGARVOVYXNAOF-UHFFFAOYSA-N 0.000 description 1
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 1
- 108010079292 betaglycan Proteins 0.000 description 1
- 239000012148 binding buffer Substances 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 238000009933 burial Methods 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 108091006374 cAMP receptor proteins Proteins 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 238000012754 cardiac puncture Methods 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000003610 charcoal Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 230000024203 complement activation Effects 0.000 description 1
- 108010047295 complement receptors Proteins 0.000 description 1
- 102000006834 complement receptors Human genes 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 102000003675 cytokine receptors Human genes 0.000 description 1
- 108010057085 cytokine receptors Proteins 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- FOCAHLGSDWHSAH-UHFFFAOYSA-N difluoromethanethione Chemical compound FC(F)=S FOCAHLGSDWHSAH-UHFFFAOYSA-N 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 229940090124 dipeptidyl peptidase 4 (dpp-4) inhibitors for blood glucose lowering Drugs 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 230000009982 effect on human Effects 0.000 description 1
- 230000001516 effect on protein Effects 0.000 description 1
- 230000001094 effect on targets Effects 0.000 description 1
- 230000002121 endocytic effect Effects 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 150000002085 enols Chemical class 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000006862 enzymatic digestion Effects 0.000 description 1
- OGPBJKLSAFTDLK-UHFFFAOYSA-N europium atom Chemical compound [Eu] OGPBJKLSAFTDLK-UHFFFAOYSA-N 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 102000003684 fibroblast growth factor 13 Human genes 0.000 description 1
- 108090000047 fibroblast growth factor 13 Proteins 0.000 description 1
- 108090000370 fibroblast growth factor 18 Proteins 0.000 description 1
- 102000003977 fibroblast growth factor 18 Human genes 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 238000001917 fluorescence detection Methods 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 125000003827 glycol group Chemical group 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 229960001340 histamine Drugs 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 102000043381 human DUSP5 Human genes 0.000 description 1
- 102000057345 human TNC Human genes 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 239000012642 immune effector Substances 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 108010019691 inhibin beta A subunit Proteins 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 238000005305 interferometry Methods 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 238000006317 isomerization reaction Methods 0.000 description 1
- 108010024383 kallikrein 4 Proteins 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- OIURYJWYVIAOCW-VFUOTHLCSA-N kifunensine Chemical compound OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H]2NC(=O)C(=O)N12 OIURYJWYVIAOCW-VFUOTHLCSA-N 0.000 description 1
- 238000012004 kinetic exclusion assay Methods 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 238000001499 laser induced fluorescence spectroscopy Methods 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000008263 liquid aerosol Substances 0.000 description 1
- 235000015250 liver sausages Nutrition 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 230000001050 lubricating effect Effects 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 108010019677 lymphotactin Proteins 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 239000012516 mab select resin Substances 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 230000008774 maternal effect Effects 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- AEUKDPKXTPNBNY-XEYRWQBLSA-N mcp 2 Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)C1=CC=CC=C1 AEUKDPKXTPNBNY-XEYRWQBLSA-N 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000000302 molecular modelling Methods 0.000 description 1
- 210000004980 monocyte derived macrophage Anatomy 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 239000006199 nebulizer Substances 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 108010068617 neonatal Fc receptor Proteins 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 238000004305 normal phase HPLC Methods 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 239000003002 pH adjusting agent Substances 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- RLBIQVVOMOPOHC-UHFFFAOYSA-N parathion-methyl Chemical compound COP(=S)(OC)OC1=CC=C([N+]([O-])=O)C=C1 RLBIQVVOMOPOHC-UHFFFAOYSA-N 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000013618 particulate matter Substances 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 102000030769 platelet activating factor receptor Human genes 0.000 description 1
- 108010017843 platelet-derived growth factor A Proteins 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 238000005498 polishing Methods 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 108040000983 polyphosphate:AMP phosphotransferase activity proteins Proteins 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 102000003998 progesterone receptors Human genes 0.000 description 1
- 108090000468 progesterone receptors Proteins 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000000611 regression analysis Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 102220094399 rs777971423 Human genes 0.000 description 1
- XYSQXZCMOLNHOI-UHFFFAOYSA-N s-[2-[[4-(acetylsulfamoyl)phenyl]carbamoyl]phenyl] 5-pyridin-1-ium-1-ylpentanethioate;bromide Chemical compound [Br-].C1=CC(S(=O)(=O)NC(=O)C)=CC=C1NC(=O)C1=CC=CC=C1SC(=O)CCCC[N+]1=CC=CC=C1 XYSQXZCMOLNHOI-UHFFFAOYSA-N 0.000 description 1
- 239000004576 sand Substances 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 230000009450 sialylation Effects 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 239000004055 small Interfering RNA Substances 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000012321 sodium triacetoxyborohydride Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 230000003068 static effect Effects 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 108091008744 testicular receptors 2 Proteins 0.000 description 1
- 108091008743 testicular receptors 4 Proteins 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 230000010512 thermal transition Effects 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000037317 transdermal delivery Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 239000003656 tris buffered saline Substances 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- 238000004704 ultra performance liquid chromatography Methods 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 230000036325 urinary excretion Effects 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000003313 weakening effect Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1027—Paramyxoviridae, e.g. respiratory syncytial virus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1036—Retroviridae, e.g. leukemia viruses
- C07K16/1045—Lentiviridae, e.g. HIV, FIV, SIV
- C07K16/1063—Lentiviridae, e.g. HIV, FIV, SIV env, e.g. gp41, gp110/120, gp160, V3, PND, CD4 binding site
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/241—Tumor Necrosis Factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/72—Increased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present invention relates to engineered multispecific antibodies and other multimeric proteins with asymmetrical CH2-CH3 region mutations and methods of making and using them. SEQUENCE LISTING
- bispecific antibodies for dual- targeting, cell redirection efforts, and immune checkpoint modulation; indeed many bispecific therapeutics are currently in clinical trials (Jachimowicz et al. BioDrugs. 2014 (4):331-43).
- the development of bispecific antibodies has been limited by the difficulty of both upstream and downstream processes, being able to generate high titers and pure product in a reproducible and scalable manner, and separating bispecific molecules from excess parental or intermediate molecules.
- Methods for specifically pairing IgG heavy chains or half molecules have been developed, and include knob-in-holes, controlled Fab arm exchange, CrossMAb, and common light chains and orthogonal Fab interface.
- Production of Fv-based molecules i.e. BiTEs, Diabodies
- non-IgG based scaffolds i.e. DARPins, Adnectins, fynomers, and centyrins
- Fv-based molecules i.e. BiTEs, Diabodies
- non-IgG based scaffolds
- Fv-only or alternative scaffold-based molecules are their typically shorter serum lifetimes resulting from urinary excretion or from lysosomal degradation due to their inability to be recycled by FcRn.
- IgG-based multispecific molecules containing an intact Fc domain are attractive based on their longer serum half-lives, ability to facilitate effector functions, and induction of apoptotic pathways.
- bispecific antibodies can be challenging due to the multiple steps required to remove residual parental and other intermediate mAbs and Ab fragment molecules. Such molecules can have biophysical characteristics that are similar to the derived bispecific antibodies and thus cannot be easily separated by chromatographic methods. This difficulty in purification can lead to either a decrease in yield or purity of the bispecific molecule.
- the invention provides for an isolated multispecific antibody comprising a first CH2- CH3 region comprising a mutation Q311R, Q31 IK, T307P/L309Q, T307P/V309Q,
- the invention also provides for an isolated multispecific antibody comprising a first CH2-CH3 region comprising a mutation Q311R and a second CH2-CH3 region comprising a wild-type amino acid residue at position 311, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated multispecific antibody comprising a first CH2-CH3 region comprising a mutation Q31 IK and a second CH2-CH3 region comprising a wild-type amino acid residue at position 311, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated multispecific antibody comprising a first
- CH2-CH3 region comprising a mutation T307P/L309Q and a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307 and 309, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated multispecific antibody comprising a first CH2-CH3 region comprising a mutation T307P/V309Q and a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307 and 309, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated multispecific antibody comprising a first CH2-CH3 region comprising a mutation T307P/L309Q/Q311R and a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated multispecific antibody comprising a first CH2-CH3 region comprising a mutation T307P/V309Q/Q311R and a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated polynucleotide comprising the polynucleotide encoding the first CH2-CH3 region comprising a mutation Q31 IR.
- T307P/V309Q/Q31 IR and the second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311; or
- the invention also provides for a vector comprising
- the isolated polynucleotide encoding the first CH2-CH3 region comprising a mutation Q31 IR, Q31 IK, T307P/L309Q, T307P/V309Q, T307P/L309Q/Q31 IR or
- the isolated polynucleotide comprising a polynucleotide sequence of SEQ ID NOs: 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 87, 88 or 91;
- the isolated polynucleotide comprising the polynucleotide encoding the first CH2-CH3 region comprising a mutation Q31 IR, Q31 IK, T307P/L309Q, T307P/V309Q.
- the invention also provides for a host cell comprising the vector of the invention.
- the invention also provides for a method of making the isolated multispecific antibody of the invention, comprising
- the invention also provides for a method of making an isolated multispecific antibody comprising a first heavy chain comprising a mutation Q31 IR, Q31 IK, T307P/L309Q,
- T307P/V309Q T307P L309Q/Q31 IR or T307P/V309Q/Q31 IR and a second heavy chain comprising wild-type amino acid residue at positions 307, 309 and 311, comprising
- a second parental antibody comprising the second heavy chain comprising wild-type amino acid residue at positions 307, 309 and 311 and a second light chain; contacting the first parental antibody and the second parental antibody in a sample; incubating the sample; and
- the invention also provides for an isolated antibody comprising two heavy chains or fragments thereof having identical amino acid sequences and two light chains or fragments thereof, wherein the two heavy chains comprise a mutation Q31 IR, Q31 IK, T307P/L309Q, T307P/V309Q, T307P L309Q/Q31 IR or T307P/V309Q/Q31 IR, wherein residue numbering is according to the EU Index.
- the invention also provides for a polynucleotide encoding the antibody heavy chain comprising the CH2-CH3 region of SEQ ID NOs: 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 52, 53 or 56; or
- the invention also provides for a multimeric protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises a first CH2-CH3 region comprising a mutation Q311R, Q31 IK, T307P L309Q, T307P/V309Q, T307P L309Q/Q311R or
- T307P/V309Q/Q311R and the second polypeptide comprises a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311, wherein residue numbering is according to the EU Index.
- the invention also provides for pharmaceutical composition comprising the multimeric protein of the invention.
- the invention also provides for a method of making an isolated multimeric protein comprising a first CH2-CH3 region comprising a mutation Q311R, Q31 IK, T307P/L309Q,
- T307P/V309Q T307P L309Q/Q311R or T307P/V309Q/Q311R and a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311, comprising
- a first parental protein comprising the first CH2-CH3 region comprising the mutation Q311R, Q311K, T307P L309Q, T307P/V309Q, T307P L309Q/Q311R or T307P/V309Q/Q311R;
- Figure 1A shows the alignment between human IgGl and mouse IgG2a CH2 domains from amino acid residues 305 to 315; residue numbering according to the EU Index.
- Figure IB shows the interactions of IgGl CH2 residues T307, L309, and Q311 (underlined residues in the Figure) with FcRn or Z-domain (Z34C peptide). Each residue made side-chain interactions with residues in FcRn and with Z-domain. T307 interacted with II on the ⁇ 2 microglobulin domain of FcRn. L309 and Q311R were responsible for interactions with both FcRn and Z-domain (dashed and solid lines for L309 and Q311, respectively).
- IQRT SEQ ID NO: 102 (portion of ⁇ 2 chain of FcRn); LNGEEFMDFDLKQGTWGGDWPEA: SEQ ID NO: 103 (portion of a chain of FcRn); VLTVLHQDWLN: SEQ ID NO: 104 (portion of IgGl CH2 domain); FNMQCQRRFYE ALHDPNLNEEQRNAKIKSIRDD C : SEQ ID NO: 99.
- Figure 2A shows a dose response curve of competition binding of indicated monospecific antibodies with the mAb RSV-L for FcRn using AlphaScreen assay.
- the graph displays % maximum signal plotted vs concentration of competitor.
- Figure 2B shows a dose response curve of competition binding of indicated monospecific or bispecific antibodies with the mAb RSV-L for FcRn using AlphaScreen assay.
- the graph displays % maximum signal plotted vs concentration of competitor.
- Figure 3A shows a dose response curve of competition binding of indicated monospecific or bispecific antibodies with the mAb RSV-L for FcyRI using AlphaScreen assay.
- the graph displays % maximum signal plotted vs concentration of competitor.
- Figure 3B shows a dose response curve of competition binding of indicated monospecific or bispecific antibodies with the mAb RSV-L for FcyRIIa using AlphaScreen assay.
- the graph displays % maximum signal plotted vs concentration of competitor.
- Figure 3C shows a dose response curve of competition binding of indicated monospecific or bispecific antibodies with the mAb RSV-L for FcyRIIb using AlphaScreen assay.
- the graph displays % maximum signal plotted vs concentration of competitor.
- Figure 3D shows a dose response curve of competition binding of indicated monospecific or bispecific antibodies with the mAb RSV-L for FcyRIIIa using AlphaScreen assay.
- the graph displays % maximum signal plotted vs concentration of competitor.
- Figure 4A shows hydrophobic interaction chromatography (HIC) chromatogram demonstrating that a bispecific antibody can be separated from parental monospecific mAbs under conditions developed.
- HIC hydrophobic interaction chromatography
- Figure 4B shows HIC chromatogram of the sample of mixture of equimolar amount of antibodies RSV-L[TLQ] and gpl20-R and bsRSV-L[TLQ] generated using Fab arm exchange.
- Figure 4C shows the elution profile of a sample of a mixture of antibodies RSV-L[TLQ], gpl20- R and bsRSV-L[TLQ] generated using Fab arm exchange from protein A resin.
- Figure 4D shows HIC chromatogram of protein A elution peaks.
- Figure 5A shows the elution profile of a sample of in-supernatant Fab arm exchanged bsRSV- L[TLQ].
- Figure 5B shows HIC analyses of protein A affinity column pH 4.7 eluates of a sample from in- supernatant Fab arm exchanged bsRSV-L[TLQ].
- Figure 5C shows HIC analyses of protein A affinity column pH 4.2 eluates of a sample from in- supernatant Fab arm exchanged bsRSV-L[TLQ].
- Figure 5D shows HIC analyses of protein A affinity column pH 3.4 eluates of a sample from in- supernatant Fab arm exchanged bsRSV-L[TLQ].
- Figure 6A shows protein A chromatogram of a sample of in-supernatant Fab arm exchanged bsRSV-L[Q311R] showing three distinct peaks eluting at pH 4.6, 4.2 and 3.4.
- Figure 6B shows HIC analyses of protein A affinity column pH 4.6 eluates of a sample from in- supernatant Fab arm exchanged bsRSV-L[Q311R].
- Figure 6C shows HIC analyses of protein A affinity column pH 4.2 eluates of a sample from in- supernatant Fab arm exchanged bsRSV-L[Q311R].
- Figure 6D shows HIC analyses of protein A affinity column pH 3.4 eluates of a sample from in- supernatant Fab arm exchanged bsRS V-L [Q311R] .
- Figure 7A shows protein A chromatogram of a sample of bsTNF-[TLQ] generated using common light chain technology.
- Figure 7B shows HIC analyses of protein A affinity column pH 4.7 eluates of a sample of bsTNF-[TLQ] generated using common light chain technology.
- Figure 7C shows HIC analyses of protein A affinity column pH 4.2 eluates of a sample of bsTNF-[TLQ] generated using common light chain technology.
- Figure 7D shows HIC analyses of protein A affinity column pH 3.4 eluates of a sample of bsTNF-[TLQ] generated using common light chain technology.
- Figure 8 shows the pharmacokinetic analysis of indicated antibodies in Tg32 hemizygous mice.
- the graph displays the concentration of each mAb normalized to the initial time point of the linear phase plotted vs time. Each point represents mean + standard error of four animals per group.
- Multimeric protein refers to a protein that is composed of two or more separate polypeptide chains that combine to form a single protein.
- the polypeptide chains may be coupled non-covalently or covalently for example via disulfide bonds.
- Bind refers to specific binding of two proteins, such as binding of an antibody to an antigen or binding of a multispecific protein to its ligand.
- Specific binding refers to preferential binding of the two proteins with typically an equilibrium dissociation constant (K D ) of about lxlO "8 M or less, for example about lxlO "9 M or less, about lxlO "10 M or less, about lxlO "11 M or less, or about lxlO "12 M or less, typically with the K D that is at least one hundredfold less than its K D for binding to a non-specific antigen (e.g., BSA, casein).
- K D equilibrium dissociation constant
- Reduced binding refers to a measurable reduction in binding of the antibodies or the multispecific proteins of the invention having at least one mutation in the CH2-CH3 region to protein A ligand when compared to the binding of the parental molecule without the mutation.
- Modulates binding refers to a measurable difference in binding of the antibodies or the multispecific proteins of the invention having at least one mutation in the CH2-CH3 region to FcyR or FcRn.
- Antigen refers to a molecule, such as protein or a fragment of a protein that is capable of mounting an immune response in a subject.
- Asymmetric stabilizing mutations refers to mutations in a first CH2-CH3 region and in a second CH2-CH3 region which are at different positions in the first and in the second CH2- CH3 region and favor (e.g. stabilize) heterodimer formation between the first CH2-CH3 region and the second CH2-CH3 region over homodimer formation between the first CH2-CH3 region or the second CH2-CH3 region.
- Heterologous protein refers to a polypeptide or protein that is not naturally part or portion of a polypeptide comprising a CH2-CH3 region in an endogenous cell.
- Fib ronectin type III (FN3) domain refers to a domain occurring frequently in proteins including fibronectins, tenascin, intracellular cytoskeletal proteins, cytokine receptors and prokaryotic enzymes (Bork and Doolittle, Proc Nat Acad Sci USA 89:8990-8994, 1992; Meinke et al., J Bacteriol 175: 1910-1918, 1993; Watanabe et al, J Biol Chem 265: 15659-15665, 1990).
- Exemplary FN3 domains are the 15 different FN3 domains present in human tenascin C, the 15 different FN3 domains present in human fib ronectin (FN), and non-natural synthetic FN3 domains as described for example in U.S. Pat. No. 8,278,419.
- Individual FN3 domains are referred to by domain number and protein name, e.g., the 3 rd FN3 domain of tenascin (TN3), or the 10 FN3 domain of fibronectin (FN10).
- FN3 domains can ben engineered to bind an antigen with high specificity and affinity.
- “Fynomer” refers to an antigen-binding protein derived from human Fyn SH3 domain that can be engineered to bind an antigen with high specificity and affinity.
- Antibodies is meant in a broad sense and includes immunoglobulin molecules including monoclonal antibodies including murine, rabbit, human, humanized and chimeric monoclonal antibodies, antigen-binding fragments, monospecific, bispecific or multispecific antibodies, dimeric, tetrameric or multimeric antibodies, single chain antibodies, domain antibodies and any other modified configuration of the immunoglobulin molecule that comprises an antigen binding site of the required specificity.
- Fully length antibodies are comprised of two heavy chains (HC) and two light chains (LC) inter-connected by disulfide bonds as well as multimers thereof (for example IgM).
- Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (comprised of domains CHI, hinge CH2 and CH3).
- Each light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL).
- the VH and the VL may be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FR segments, arranged from amino-terminus to carboxyl-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
- CDR complementarity determining regions
- ImMunoGeneTics database; Web resources, http://www_imgt_org). Available programs such as abYsis by UCL Business PLC may be used to delineate CDRs.
- IMGT ImMunoGeneTics
- CDR CDR
- HCDR1 CDR1
- HCDR2 CDR3
- LCDRl CDR 2
- LCDR3 CDR3
- Immunoglobulins may be assigned to five major classes, IgA, IgD, IgE, IgG and IgM, depending on the heavy chain constant region amino acid sequence.
- IgA and IgG are further sub-classified as the isotypes IgAl, IgA2, IgGl, IgG2, IgG3 and IgG4.
- Antibody light chains of any vertebrate species may be assigned to one of two clearly distinct types, namely kappa ( ) and lambda ( ⁇ ), based on the amino acid sequences of their constant regions.
- Antigen-binding fragment refers to a portion of an immunoglobulin molecule that retains the antigen binding properties of the parental full length antibody.
- Exemplary antigen- binding fragments are heavy chain complementarity determining regions (HCDR) 1, 2 and/or 3, light chain complementarity determining regions (LCDR) 1, 2 and/or 3, the VH, the VL, the VH and the VL, Fab, F(ab')2, Fd and Fv fragments as well as domain antibodies (dAb) consisting of either one VH domain or one VL domain.
- the VH and the VL domains may be linked together via a synthetic linker to form various types of single chain antibody designs in which the VH/VL domains pair intramolecularly, or intermolecularly in those cases when the VH and VL domains are expressed by separate chains, to form a monovalent antigen binding site, such as single chain Fv (scFv) or diabody; described for example in Int. Pat. Publ. No. WO1998/44001, Int. Pat. Publ. No. WO1988/01649; Int. Pat. Publ. No. WO1994/13804; Int. Pat. Publ. No. WO1992/01047.
- scFv single chain Fv
- CH2-CH3 region refers to a portion of a human antibody constant domain and includes amino acid residues 231-446 (residue numbering according to the EU Index).
- the CH2-CH3 region may have the C-terminal lysine at position 447 deleted.
- “Monoclonal antibody” refers to an antibody population with single amino acid composition in each heavy and each light chain, except for possible well known alterations such as removal of C-terminal lysine from the antibody heavy chain.
- Monoclonal antibodies typically specifically bind one antigenic epitope, except that bispecific or multispecific monoclonal antibodies specifically bind two or more distinct antigenic epitopes.
- Monoclonal antibodies may have heterogeneous glycosylation within the antibody population.
- Monoclonal antibody may be monospecific or multispecific, or monovalent, bivalent or multivalent. A bispecific antibody is included in the term monoclonal antibody.
- Isolated refers to a homogenous population of molecules (such as synthetic polynucleotides or a protein such as an antibody) which have been substantially separated and/or purified away from other components of the system the molecules are produced in, such as a recombinant cell, as well as a protein that has been subjected to at least one purification or isolation step.
- molecules such as synthetic polynucleotides or a protein such as an antibody
- Isolated antibody refers to an antibody that is substantially free of other cellular material and/or chemicals and encompasses antibodies that are isolated to a higher purity, such as to 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% purity.
- Humanized antibody refers to an antibody in which CDR sequences are derived from non-human species and the frameworks are derived from human immunoglobulin sequences. Humanized antibody may include substitutions in the framework so that the framework may not be an exact copy of expressed human immunoglobulin or human immunoglobulin germline gene sequences.
- Human antibody refers to an antibody that is optimized to have minimal immune response when administered to a human subject. Variable regions of human antibody are derived from human germline immunoglobulin sequences. If the antibody contains a constant region or a portion of the constant region, the constant region is also derived from human germline immunoglobulin sequences.
- Human antibody comprises heavy or light chain variable regions that are "derived from” human germline immunoglobulin sequences if the variable regions of the antibody are obtained from a system that uses human germline immunoglobulin genes.
- Such exemplary systems are human immunoglobulin gene libraries displayed on phage or mammalian cells, and transgenic non-human animals such as mice or rats carrying human immunoglobulin loci.
- "Human antibody” typically contains amino acid differences when compared to the immunoglobulins expressed in humans due to, for example introduction of somatic mutations, intentional introduction of substitutions into the framework or CDRs, and amino acid changes introduced during cloning and VJD recombination in non-human animals.
- Human antibody is typically about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical in amino acid sequence to an amino acid sequence encoded by human germline immunoglobulin sequences.
- human antibody may contain consensus framework sequences derived from human framework sequence analyses, for example as described in Knappik et al., JMol Biol 296: 57-86, 2000, or synthetic HCDR3 incorporated into human immunoglobulin gene libraries displayed on phage, for example as described in Shi et al, JMol Biol 397: 385-396, 2010 and in Int. Patent Publ. No.
- Recombinant refers to antibodies and other proteins that are prepared, expressed, created or isolated by recombinant means.
- Multispecific refers to a protein, such as an antibody, that specifically binds two or more distinct antigens or two or more distinct epitopes within the same antigen. Multispecific protein may have cross-reactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example Macaca fascicularis
- Bispecific refers to a protein, such as an antibody, that specifically binds two distinct antigens or two distinct epitopes within the same antigen.
- Bispecific protein may have cross- reactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno), Pan troglodytes (chimpanzee, chimp) or Callithrix jacchus (common marmoset, marmoset), or may bind an epitope that is shared between two or more distinct antigens.
- homologs such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno), Pan troglodytes (chimpanzee, chimp) or Callithrix jacchus (common marmoset, marmoset), or may bind an epitope that is shared between two or more distinct antigens.
- “Monospecific” refers to a protein, such as an antibody, that specifically binds one distinct antigen or a distinct epitope.
- Monospecific protein may have cross-reactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno), Pan troglodytes (chimpanzee, chimp) or Callithrix jacchus (common marmoset, marmoset), or may bind an epitope that is shared between two or more distinct antigens.
- homologs such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno), Pan troglodytes (chimpanzee, chimp) or Callithrix jacchus (common marmoset, marmoset), or may bind an epitope that is shared between two or more distinct antigens.
- Vector refers to a polynucleotide capable of being duplicated within a biological system or that can be moved between such systems.
- Vector polynucleotides typically contain elements, such as origins of replication, polyadenylation signal or selection markers, that function to facilitate the duplication or maintenance of these polynucleotides in a biological system, such as a cell, virus, animal, plant, and reconstituted biological systems
- Protein A ligand affinity chromatography refers to an affinity chromatographic method that makes use of the affinity of the IgG binding domains of Protein A ligand for the Fc region of an immunoglobulin molecule. This Fc region comprises human or animal immunoglobulin constant domains CH2 and CH3 or immunoglobulin domains substantially similar to these. Protein A ligand encompasses native protein A from the cell wall of
- Protein A ligand chromatography involves using Protein A ligand immobilized to a solid support. See Gagnon, Protein A Affinity Chromatography, Purification Tools for Monoclonal Antibodies, pp. 155-198, Validated Biosystems, 1996.
- the solid support is a non-aqueous matrix onto which Protein A ligand adheres.
- Such well-known supports include agarose, sepharose, glass, silica, polystyrene, nitrocellulose, charcoal, sand, cellulose and any other suitable material.
- any suitable well-known method can be used to affix the second protein to the solid support.
- Such solid supports, with and without immobilized Protein A ligand are readily available from many commercial sources including such as Vector Laboratory (Burlingame, Calif), Santa Cruz Biotechnology (Santa Cruz, Calif.), BioRad (Hercules, Calif), Amersham Biosciences (part of GE Healthcare, Uppsala, Sweden), Pall (Port Washington, N.Y.) and EMD-Millipore (Billerica, Mass.).
- Protein A ligand immobilized to a pore glass matrix is commercially available as PROSEP®-A (Millipore).
- the solid phase may also be an agarose-based matrix.
- Expression vector refers to a vector that can be utilized in a biological system or in a reconstituted biological system to direct the translation of a polypeptide encoded by a polynucleotide sequence present in the expression vector.
- Polynucleotide refers to a synthetic molecule comprising a chain of nucleotides covalently linked by a sugar-phosphate backbone or other equivalent covalent chemistry.
- cDNA is a typical example of a synthetic polynucleotide.
- Polypeptide or “protein” refers to a molecule that comprises at least two amino acid residues linked by a peptide bond to form a polypeptide. Small polypeptides of less than 50 amino acids may be referred to as "peptides”.
- Variant refers to a polypeptide or a polynucleotide that differs from a reference polypeptide or a reference polynucleotide by one or more modifications, for example one or more substitutions, insertions or deletions.
- Value refers to the presence of a specified number of binding sites specific for an antigen in a molecule.
- hexavalent refer to the presence of one, two, four and six binding sites, respectively, specific for an antigen in a molecule.
- Protein A ligand refers to a naturally occurring or modified Staphylococcal Protein A, and includes engineered Protein A domains.
- Engineered Protein A may be, for example, Z- domain, variants of Z-domain, Y-domain, or an engineered Protein A that lacks D and E domains.
- Engineered Protein A domains may be unable to bind (or bind with very low affinity if at all) to the VH3 domain of an immunoglobulin, but can still bind to the CH2-CH3 region of IgGl, IgG2 and IgG4.
- Z-domain is a synthetic engineered variant of B domain of Staphylococcus aureus protein A having mutations Al V and G29A when compared to the wild-type B domain of protein A.
- Z-domain comprises the amino acid sequence of SEQ ID NO: 1.
- Additional Z-domain variants are variants having the amino acid sequences of SEQ ID NOs: 99, 100 and 101, and those described in US2006/0194950.
- FNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDD The numbering of amino acid residues in the antibody constant region throughout the specification is according to the EU Index as described in Kabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991), unless otherwise explicitly stated. Correspondence between various constant domain numbering systems is available at International ImMunoGeneTics (IMGT) database; Web resources, http://www_imgt_org).
- IMGT International ImMunoGeneTics
- compositions of matter multispecific antibodies
- the invention provides multispecific antibodies and other multimeric CH2-CH3 region containing proteins having asymmetric mutations in the CH2-CH3 region which facilitate their purification using protein A ligand chromatography, polynucleotides encoding them, vectors and host cells, and methods of making and using them.
- Production and purification of full length bispecific therapeutic antibodies require efficient separation of the bispecific antibodies from excess parental and/or intermediate molecules.
- Fc mutations have been identified herein which reduce binding of the mutated heavy chain to protein A ligand.
- Bispecific antibodies having these Fc mutations in asymmetric manner can therefore be purified from the parental antibodies based on their differential elution profile from protein A ligand affinity columns.
- FcRn is responsible for the transfer of maternal IgG to the fetus and for protecting serum IgG from lysosomal degradation. Both of these processes depend on the ability of FcRn to bind with K D -600 nM to IgG at acidic pH ( ⁇ 6.5) in the recycling endosome and to dissociate at neutral pH, releasing the IgG back into the serum (Roopenian and Akilesh, Nat Rev Immunol 7: 715-725, 2007). IgG binds FcRn at the CH2-CH3 interface, such that a single Fc contains two identical FcRn binding sites.
- Efforts to modulate protein A ligand binding characteristics of Abs are often associated with significantly decreased serum half -lives since both protein A and the neonatal Fc receptor (FcRn) share a binding site on the Fc.
- the mutations introduced herein do not reduce binding of the Fc to FcRn and therefore do not reduce serum half -life of the engineered antibodies.
- One of the introduced mutations, Q311R resulted in slightly enhanced binding to FcRn and increased serum half-life of the antibody.
- the invention provides for an isolated multispecific antibody comprising a first CH2- CH3 region comprising a mutation Q311R, Q31 IK, T307P/L309Q, T307P/V309Q,
- the isolated multispecific antibody with asymmetric Q311R, Q31 IK, T307P/L309Q, T307P/V309Q, T307P L309Q/Q311R or T307P/V309Q/Q311R mutations can be efficiently purified from parental antibodies using protein A ligand affinity chromatography.
- the introduced Q31 IK, T307P/L309Q and T307P/L309Q/Q311R mutations do not reduce binding of the engineered antibodies to FcRn or FcyR, and hence are not expected to alter antibody half-life or effector functions.
- the introduced Q311R mutation enhanced binding to FcRn and serum half-life of the antibody.
- the invention also provides for an isolated multispecific antibody comprising a first CH2-CH3 region comprising a mutation Q311R and a second CH2-CH3 region comprising a wild-type amino acid residue at position 311, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated multispecific antibody comprising a first CH2-CH3 region comprising a mutation Q31 IK and a second CH2-CH3 region comprising a wild-type amino acid residue at position 311, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated multispecific antibody comprising a first
- CH2-CH3 region comprising a mutation T307P/L309Q and a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307 and 309, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated multispecific antibody comprising a first
- CH2-CH3 region comprising a mutation T307P/V309Q and a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307 and 309, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated multispecific antibody comprising a first CH2-CH3 region comprising a mutation T307P/L309Q/Q311R and a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated multispecific antibody comprising a first
- the first CH2-CH3 region comprising a mutation T307P/V309Q/Q311R and a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311, wherein residue numbering is according to the EU Index.
- the first CH2-CH3 region has reduced binding to protein A ligand when compared to the second CH2-CH3 region.
- Binding to protein A ligand may be determined experimentally using any suitable method. Such methods may utilize ProteOn XPR36, Biacore 3000 or KinExA instrumentation. The measured affinity may vary if measured under different conditions (e.g., osmolality, pH). Thus, measurements of affinity and other binding parameters (e.g., K D , k on , k 0 ff) are typically made with standardized conditions and a standardized buffer, such as the buffer described herein. Alternatively, binding to protein A ligand may be assessed directly using protein A ligand chromatography using a pH gradient. Molecules with reduced binding to protein A ligand elute at higher pH. An exemplary protein A ligand chromatography may use mAbSelect Sure column (GE Healthcare) and the samples are eluted in 3 steps using buffers containing 50 niM citrate at pH of about pH4.7, pH 4.2 or pH 3.4.
- protein A ligand comprises Staphylococcal Protein A.
- protein A ligand comprises Z-domain.
- Z-domain comprises an amino acid sequence of SEQ ID NO: 1.
- protein A ligand comprises Y-domain.
- protein A ligand comprises an amino acid sequence of SEQ ID NO: 1
- protein A ligand comprises an amino acid sequence of SEQ ID NO: 100.
- protein A ligand comprises an amino acid sequence of SEQ ID NO: 101.
- Staphylococcal protein A contains 5 homologous helical IgG-binding domains, denoted E, D, A, B, and C (Uhlen, Guss et al. 1984). Each of these domains is sufficient to bind to the Fc region however spA also binds to the VH region of human VH3 -family members (Romagnani et al, J Immunol 129:596-602, 1982; Sasso et al, J Immunol 147: 1877-1883, 1991). Stability -enhancing mutations introduced into the spA B domain or C domain led to a synthetic Z-domain and Y-domain, respectively, which are resistant to high pH treatment and bind only Fc.
- Tandem or tetrameric Z-domains, tetrameric Y-domains or native spA have been incorporated into commercial affinity resins such as MabSelect SuRe (GE), TOYOPEARL AF- rProtein A HC-650F and MabSelect Xtra.
- the multispecific antibody is an IgGl isotype.
- the multispecific antibody is an IgG2 isotype.
- the multispecific antibody is an IgG4 isotype.
- binding of the multispecific antibody to FcyR is comparable to that of the parental antibody without the mutation.
- FcyR is FcyRI, FcyRIIa, FcyRIIb. and/or FcyRIIIa.
- FcyR is FcyRI
- FcyR is FcyRIIa.
- FcyR is FcyRIIb.
- FcyR is FcyRIIIa.
- Exemplary multispecific antibodies with comparable binding to FcyR are multispecific antibodies with Q31 IR or T307P L309Q/Q31 IR mutations.
- binding of the multispecific antibody to FcRn is comparable to that of the parental antibody without the mutation.
- Exemplary multispecific antibodies with comparable binding to FcRn are multispecific antibodies with Q31 IK or T307P/L309Q/Q31 IR mutations.
- binding of the multispecific antibody to FcRn is enhanced when compared to binding of the parental antibody without the mutation to FcRn.
- Exemplary multispecific antibodies with enhanced binding to FcRn are antibodies with Q311R mutation.
- the invention also provides for an isolated multispecific antibody comprising a first CH2-CH3 region comprising a mutation Q31 IR, Q31 IK, T307P L309Q, T307P/V309Q, T307P/L309Q/Q31 IR or T307P/V309Q/Q31 IR and a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311, wherein residue numbering is according to the EU Index, wherein the multispecific antibody further comprises asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are
- F405W/Y407A and T366W/T394S respectively; L351Y/F405A/Y407V and T394W, respectively;
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are F405L and K409R, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are wild-type and F405L/R409K, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are T366W and T366S/L368A/Y407V, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are T366Y/F405A and T394W/Y407T, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are T366W/F405W and T394S/Y407A, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are F405W/Y407A and T366W/T394S, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are L351Y/F405A/Y407V and T394W, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are T366I/ 392M/T394W and F405A/Y407V, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are T366L/ 392M/T394W and F405A/Y407V, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are L351Y/Y407A and T366A/ 409F, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are L351Y/Y407A and T366V 409F, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are Y407A and T366A/K409F, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are D399K/E356K and K409D/ 392D, respectively.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are D399K/E356K/E357K and K409D/K392D/K370, respectively.
- Asymmetric stabilizing mutations may be introduced into bispecific or multispecific antibodies to facilitate downstream processes of separating them from excess parental or intermediate molecules.
- Exemplary asymmetric stabilizing mutations are those that promote Fab arm exchange (e.g., half molecule exchange, exchanging on heavy chain - light chain pair) between two parental antibodies.
- mutations that favor heterodimer formation of two parental antibody half -molecules either in vitro in cell-free environment or using co-expression are introduced to the heavy chain CH3 interface in each parental antibody.
- mutations F405L in a first parental antibody and K409R in a second parental antibody may be used to promote Fab arm exchange of IgGl.
- a wild-type first parental antibody and F405L/R409K mutation in the second parental antibody may be used.
- knob-in-hole mutations (Genentech) or mutations that introduce electrostatically -matched residues (Chugai, Amgen, NovoNordisk, Oncomed).
- Exemplary knob-in-hole mutations (expressed as mutated position in the first parental antibody /mutated position in the second parental antibody) are T366Y/F405A,
- Mutations are typically made at the DNA level to a molecule such as the constant domain of the antibody using standard methods.
- the multispecific antibody comprises Q311R/F405L mutation in the first CH2-CH3 region and K409R mutation in the second CH2-CH3 region.
- the multispecific antibody comprises Q311K/F405L mutation in the first CH2-CH3 region and K409R mutation in the second CH2-CH3 region.
- the multispecific antibody comprises T307P/L309Q/F405L mutation in the first CH2-CH3 region and K409R mutation in the second CH2-CH3 region.
- the multispecific antibody comprises
- the multispecific antibody comprises Q311R/ 409R mutation in the first CH2-CH3 region and F405L mutation in the second CH2-CH3 region.
- the multispecific antibody comprises Q31 IK/ K409R mutation in the first CH2-CH3 region and F405L mutation in the second CH2-CH3 region.
- the multispecific antibody comprises T307P/L309Q/ K409R mutation in the first CH2-CH3 region and F405L mutation in the second CH2-CH3 region.
- the multispecific antibody comprises T307P/L309Q/Q311R/ K409R mutation in the first CH2-CH3 region and F405L mutation in the second CH2-CH3 region.
- the multispecific antibody comprises Q311R mutation in the first
- the multispecific antibody comprises Q31 IK mutation in the first CH2-CH3 region and F405L/R409K mutation in the second CH2-CH3 region.
- the multispecific antibody comprises T307P/V309Q mutation in the first CH2-CH3 region and F405L/R409K mutation in the second CH2-CH3 region.
- the multispecific antibody comprises T307P/V309Q/Q311R mutation in the first CH2-CH3 region and F405L/R409K mutation in the second CH2-CH3 region.
- the multispecific antibody comprises Q311R/T366W mutation in the first CH2-CH3 region and T366S/L368A/Y407V mutation in the second CH2-CH3 region. In some embodiments, the multispecific antibody comprises Q311K/T366W mutation in the first CH2-CH3 region and T366S/L368A/Y407V mutation in the second CH2-CH3 region.
- the multispecific antibody comprises T307P/L309Q/T366W mutation in the first CH2-CH3 region and T366S/L368A/Y407V mutation in the second CH2- CH3 region.
- the multispecific antibody comprises
- the multispecific antibody comprises
- the multispecific antibody comprises
- the multispecific antibody comprises
- the multispecific antibody comprises
- amino acid sequences of exemplary CH2-CH3 regions in the multispecific antibodies of the invention are shown in Table 2 and Table 3.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 2 and 22, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 3 and 22, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 4 and 22, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 5 and 22, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 6 and 23, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 7 and 23, respectively.
- first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 8 and 23, respectively. In some embodiments, the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 9 and 23. respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 10 and 24, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 11 and 24, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 12 and 24. respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 13 and 24, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 14 and 25, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 15 and 25. respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 16 and 25, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 17 and 25, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 18 and 26. respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 19 and 26, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 20 and 26, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 21 and 26. respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 52 and 54, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 52 and 55, respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 53 and 54. respectively.
- the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 53 and 55, respectively.
- first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 56 and 54, respectively. In some embodiments, the first CH2-CH3 region and the second CH2-CH3 region comprise an amino acid sequence of SEQ ID NOs: 56 and 55, respectively.
- the multispecific antibodies of the invention may further comprise a common light chain to further facilitate downstream processes of separating them from excess parental or intermediate molecules.
- the multispecific antibody comprises a first light chain and a second light chain.
- the first light chain and the second light chain have identical amino acid sequences.
- the multispecific antibody is a bispecific antibody.
- IgGl CH2-CH3 25 PELLGGPSVFLFPPKPKDTLMISRTPEVTCWV
- T366S/L368A/Y407 DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ
- the mutations may be transferred to IgG2 and IgG4 isotypes as positions 307, 309 and 311 are conserved across the isotypes except that IgG2 has valine at positon 309. Positions 366, 368 and 407 are also conserved across antibody isotypes. F405L is conserved, however IgG4 has R at position 409. In order to promote Fab arm exchange of human IgG4 antibody, one parental antibody will be engineered to have F405L/R409K mutation and the other parental antibody is wild-type.
- the multispecific antibody binds at least two antigens.
- the antigen is ABCF1, ACVR1, ACVR1B, ACVR2, ACVR2B, ACVRLl, ADORA2A, Aggrecan, AGR2, AICDA, AIF1, AIG1, AKAP1, AKAP2, albumin, AMH, AMHR2, ANGPT1, ANGPT2, ANGPTL3, ANGPTL4, ANPEP, APC, APOC1, APOE, AR, AZGP1 (zinc-a-glycoprotein), B7.1, B7.2, BAD, BAFF, BAG1, BAI1, BCL2, BCL6, BDNF, BLNK, BLRl (MDR15), BlyS, BMPl, BMP2, BMP3B (GDF10), BMP4, BMP6, BMP8, BMPRIA, BMPRIB, BMPR2, BPAGl (plectin), BRCAl, BTLA, C19orfl0 (IL27w), C3, C
- CD123 CD137, CD164, CD16a, CD16b, CD19, CD1C, CD20, CD200, CD-22, CD24, CD28, CD3, CD30, CD32a, CD32b,CD37, CD38, CD39, CD3E, CD3G, CD3Z, CD4, CD40, CD40L, CD44, CD45RB, CD47, CD52, CD69, CD72, CD73, CD74, CD79A, CD79B, CD8, CD80, CD81, CD83, CD86, CD89, CD96, CDHl (E-cadherin), CDHIO, CDH12, CDH13, CDHl 8, CDHl 9, CDH20, CDH5, CDH7, CDH8, CDH9, CDK2, CDK3, CDK4, CDK5, CDK6, CDK7
- TDGF1, TEK, TF transferrin receptor
- TGFA TGFB1, TGFB 111, TGFB2, TGFB3, TGFBI
- TGFBR1, TGFBR2, TGFBR3, TH1L THBS1 (thrombospondin-1), THBS2, THBS4, THPO, TIE (Tie-1), TIGIT, TIM-3, TIMP3, tissue factor, TLR10, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TNF, TNF-a, TNFAIP2 (B94), TNFAIP3, TNFRSF11A, TNFRSF1A, TNFRSF1B, TNFRSF21, TNFRSF5, TNFRSF6 (Fas), TNFRSF7, TNFRSF8, TNFRSF9, TNFSF10 (TRAIL), TNFSF11 (TRANCE), TNFSF12 (AP03L), TNFSF13 (April), TNFSF13B,
- the multispecific antibody binds CD3.
- the multispecific antibody binds CD3 and a tumor antigen.
- the multispecific antibody binds two antigens wherein the two antigens are any two of PDl, CD27, CD28, NKP46, ICOS, GITR, OX40, CTLA4, LAG3, TIM3, KIRa, CD73, CD39, IDO, BTLA, VISTA, TIGIT, CD96, CD30, HVEM, DNAM-l, LFA, tumor antigen, EGFR, cMet, FGFR, ROR1, CD123, IL1RAP, FGFR, mesothelin, CD3, T cell receptor, CD32b, CD32a, CD 16a, CD 16b, NKG2D, NKP46, CD28, CD47, DLL, CD8, CD89, HLA, B cell receptor or CD 137.
- the two antigens are any two of PDl, CD27, CD28, NKP46, ICOS, GITR, OX40, CTLA4, LAG3, TIM3, KIRa, CD73, CD39,
- Additional Fc mutations may be made to the multispecific antibodies of the invention to modulate effector functions and pharmacokinetic properties.
- effector functions such as antibody -dependent cytotoxicity and phagocytosis
- immunomodulatory signals such as regulating lymphocyte proliferation and antibody secretion. All of these interactions are initiated through the binding of the Fc region of antibodies or immune complexes to specialized cell surface receptors.
- FcyRI CD64
- FcyRIIA CD32A
- FcyRIII CD16
- FcyRIIB CD32B
- Binding to the FcRn receptor modulates antibody half-life.
- the multispecific antibody of the invention further comprises at least one mutation that modulates binding of the antibody to FcyR. In some embodiments, the multispecific antibody of the invention further comprises at least one mutation that modulates binding of the antibody to or FcRn.
- Exemplary mutations that increase half-life of the multispecific antibody are mutations M428L/N434S, M252Y/S254T/T256E, T250Q/M428L, N434A and T307A/E380A/N434A.
- Exemplary mutations that reduce half -life of the multispecific antibody are mutations H435A, P257I/N434H, D376V/N434H, M252Y/S254T/T256E/H433K/N434F, T308P/N434A and H435R.
- the multispecific antibody of the invention comprises at least one mutation that reduces binding of the antibody to an activating Fey receptor (FcyR) and/or reduces Fc effector functions such as Clq binding, complement dependent cytotoxicity (CDC), antibody- dependent cell-mediated cytotoxicity (ADCC) or phagocytosis (ADCP).
- FcyR activating Fey receptor
- CDC complement dependent cytotoxicity
- ADCC antibody- dependent cell-mediated cytotoxicity
- ADCP phagocytosis
- Exemplary mutations that reduce binding of the multispecific antibody of the invention to activating FcyR and/or minimize antibody effector functions are L234A/L235A on IgGl, V234A,/G237A/ P238S/H268A/V309L/A330S/P33 IS on IgG2, F234A/L235A on IgG4, S228P/F234A/ L235A on IgG4, N297A on all Ig isotypes, V234A/G237A on IgG2,
- H268Q/V309L/ A330S/P33 IS on IgG2, S267E L328F on IgGl, L234F L235E D265A on IgGl, L234A/L235A/G237A/P238S/H268A/A330S/P331S on IgGl,
- Exemplary mutations that increase binding of the multispecific antibody of the invention to an activating Fey and/or enhance antibody effector functions are S239D/I332E,
- Well-known S228P may be made in IgG4 antibodies to enhance IgG4 stability.
- Antibody -dependent cellular cytotoxicity is a mechanism for inducing cell death that depends upon the interaction of antibody -coated target cells with effector cells possessing lytic activity, such as natural killer cells, monocytes, macrophages and neutrophils via Fc gamma receptors (FcyR) expressed on effector cells.
- effector cells possessing lytic activity such as natural killer cells, monocytes, macrophages and neutrophils via Fc gamma receptors (FcyR) expressed on effector cells.
- FcyR Fc gamma receptors
- NK cells express FcyRIIIa
- monocytes express FcyRI, FcyRII and FcyRIIIa.
- Death of the antibody -coated target cells occurs as a result of effector cell activity through the secretion of membrane pore-forming proteins and proteases.
- the antibodies may be added to cells expressing the desired antigen in combination with immune effector cells, which may be activated by the antigen antibody complexes resulting in cytolysis of the target cell. Cytolysis may be detected by the release of label (e.g. radioactive substrates, fluorescent dyes or natural intracellular proteins) from the lysed cells.
- label e.g. radioactive substrates, fluorescent dyes or natural intracellular proteins
- exemplary effector cells for such assays include peripheral blood mononuclear cells (PBMC) and NK cells.
- PBMC peripheral blood mononuclear cells
- target cells include cells expressing the desired antigen either endogenously or recombinantly. In an exemplary assay, target cells are used with a ratio of 1 target cell to 50 effector cells.
- Target cells are pre-labeled with BATDA (PerkinElmer) for 20 minutes at 37°C, washed twice and resuspended in DMEM, 10% heat-inactivated FBS, 2mM L-glutamine (all from Invitrogen).
- Target (lxlO 4 cells) and effector cells (0.5xl0 6 cells) are combined and ⁇ of cells are added to the wells of 96-well U- bottom plates. An additional 100 ⁇ is added with or without the test antibodies. The plates are centrifuged at 200g for 3 minutes, incubated at 37°C for 2 hours, and then centrifuged again at 200g for 3 minutes.
- ADCP Antibody -dependent cellular phagocytosis
- phagocytic cells such as macrophages or dendritic cells.
- ADCP may be evaluated by using monocyte-derived macrophages as effector cells and Daudi cells (ATCC ® CCL-213TM) or B cell leukemia or lymphoma or tumor cells expressing the desired antigen as target cells engineered to express GFP or other labeled molecule.
- Effectontarget cell ratio may be for example 4: 1. Effector cells may be incubated with target cells for 4 hours with or without the antibody of the invention. After incubation, cells may be detached using accutase.
- Macrophages may be identified with anti-CD 1 lb and anti-CD 14 antibodies coupled to a fluorescent label, and percent phagocytosis may be determined based on % GFP fluorescence in the CD 11 + CD 14 + macrophages using standard methods.
- “Complement-dependent cytotoxicity” refers to a mechanism for inducing cell death in which the Fc effector domain of a target-bound antibody binds and activates complement component Clq which in turn activates the complement cascade leading to target cell death. Activation of complement may also result in deposition of complement components on the target cell surface that facilitate ADCC by binding complement receptors (e.g., CR3) on leukocytes.
- complement receptors e.g., CR3
- CDC may be measured for example by plating Daudi cells at 1 ⁇ 10 5 cells/well (50 ⁇ /well) in RPMI-B (RPMI supplemented with 1% BSA), adding 50 ⁇ of test antibodies to the wells at final concentration between 0-100 ⁇ g/ml, incubating the reaction for 15 min at room temperature, adding 11 ⁇ of pooled human serum to the wells, and incubation the reaction for 45 min at 37° C. Percentage (%) lysed cells may be detected as % propidium iodide stained cells in FACS assay using standard methods.
- Additional mutations may further be made to the multispecific antibodies of the invention that enhance binding of the antibody to FcyRIIb.
- Exemplary such mutations are mutations S267E, S267D, S267E/I332E, S267E/L328F, G236D/S267E and
- mutations enhancing binding to activating FcyR and reducing binding to inhibitory FcyRIIb may be engineered into antibodies to be used to enhance immune responses in a subject, such as for the treatment of cancers and infections.
- Mutations reducing binding to activating FcyR or enhancing binding to the inhibitory FcyRIIb may be engineered into antibodies which are used to dampen immune responses in a subject, such as for the treatment of inflammatory or autoimmune disease.
- Mutations enhancing binding to inhibitory FcyRIIb may also be introduced into agonistic antibodies that bind TNFR superfamily members to enhance their agonistic activity.
- the ability of the multispecific antibodies of the invention to induce ADCC may be enhanced by engineering their oligosaccharide component.
- Human IgGl is N-glycosylated at Asn297 with the majority of the glycans in the well-known biantennary GO, GOF, Gl, GIF, G2 or G2F forms.
- Antibodies produced by non-engineered CHO cells typically have a glycan fucose content of about at least 85%. The removal of the core fucose from the biantennary complex- type oligosaccharides attached to the Fc regions enhances the ADCC of antibodies via improved FcyRIIIa binding without altering antigen binding or CDC activity.
- Such mAbs may be achieved using different methods reported to lead to the successful expression of relatively high defucosylated antibodies bearing the biantennary complex-type of Fc oligosaccharides such as control of culture osmolality, application of a variant CHO line Lecl3 as the host cell line, application of a variant CHO line EB66 as the host cell line, application of a rat hybridoma cell line YB2/0 as the host cell line, introduction of small interfering RNA specifically against the a 1,6-fucosyltrasferase ( FUT8) gene, or coexpression of P-l,4- -acetylglucosaminyltransferase III and Golgi a-mannosidase II or a potent alpha-mannosidase I inhibitor, kifunensine.
- FUT8 1,6-fucosyltrasferase
- the multispecific antibodies of the invention have a biantennary glycan structure with fucose content of about between 0% to about 15%, for example 15%, 14%, 13%, 12%, 11% 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1% or 0%.
- the multispecific antibodies of the invention have a biantennary glycan structure with fucose content of about 50%, 40%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 14%, 13%, 12%, 11% 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1% or 0%.
- “Fucose content” means the amount of the fucose monosaccharide within the sugar chain at Asn297. The relative amount of fucose is the percentage of fucose-containing structures related to all glycostructures.
- N-glycosidase F treated sample e.g. complex, hybrid and oligo- and high-mannose structures
- MALDI-TOF MALDI-TOF of N-glycosidase F treated sample
- UPLC HPLC
- UPLC-MS fluorescence detection and/or HPLC-MS
- digestion of the mAb to constituent peptides by enzymatic digestion (e.g., trypsin or endopeptidase Lys-C), and subsequent separation, detection and quantitation by HPLC-MS (UPLC-MS) or 5) separation of the mAb
- the oligosaccharides released may be labeled with a fluorophore, separated and identified by various complementary techniques which allow fine characterization of the glycan structures by matrix-assisted laser desorption ionization (MALDI) mass spectrometry by comparison of the experimental masses with the theoretical masses, determination of the degree of sialylation by ion exchange HPLC (GlycoSep C), separation and quantification of the oligosaccharide forms according to hydrophilicity criteria by normal-phase HPLC (GlycoSep N), and separation and quantification of the oligosaccharides by high performance capillary electrophoresis-laser induced fluorescence (HPCE-LIF).
- MALDI matrix-assisted laser desorption ionization
- Low fucose or “low fucose content” refers to antibodies with fucose content of about 0% - 15%.
- Normal fucose or 'normal fucose content refers to antibodies with fucose content of about over 50%, typically about over 60%, 70%, 80% or over 85%.
- the multispecific antibodies of the invention may be post-translationally modified by processes such as glycosylation, isomerization, deglycosylation or non-naturally occurring covalent modification such as the addition of polyethylene glycol moieties (pegylation) and lipidation. Such modifications may occur in vivo or in vitro.
- the antibodies of the invention described herein may be conjugated to polyethylene glycol (PEGylated) to improve their pharmacokinetic profiles. Conjugation may be carried out by techniques known to those skilled in the art. Conjugation of therapeutic antibodies with PEG has been shown to enhance pharmacodynamics while not interfering with function.
- Multispecific antibodies of the invention may be modified to improve stability, selectivity, cross-reactivity, affinity, immunogenicity or other desirable biological or biophysical property are within the scope of the invention.
- Stability of an antibody is influenced by a number of factors, including (1) core packing of individual domains that affects their intrinsic stability, (2) protein/protein interface interactions that have impact upon the HC and LC pairing, (3) burial of polar and charged residues, (4) H-bonding network for polar and charged residues; and (5) surface charge and polar residue distribution among other intra- and inter-molecular forces (Worn and Pluckthun 2001).
- Potential structure destabilizing residues may be identified based upon the crystal structure of the antibody or by molecular modeling in certain cases, and the effect of the residues on antibody stability may be tested by generating and evaluating variants harboring mutations in the identified residues.
- One of the ways to increase antibody stability is to raise the thermal transition midpoint (T m ) as measured by differential scanning calorimetry (DSC).
- T m thermal transition midpoint
- DSC differential scanning calorimetry
- the protein T m is correlated with its stability and inversely correlated with its susceptibility to unfolding and denaturation in solution and the degradation processes that depend on the tendency of the protein to unfold.
- Formulation studies suggest that a Fab T m has implication for long-term physical stability of a corresponding mAb.
- CTL C-terminal lysine
- CTL removal may be controlled to less than the maximum level by control of concentration of extracellular Zn 2+ , EDTA or EDTA - Fe 3+ as described in U.S. Patent Publ. No. US20140273092.
- CTL content in antibodies can be measured using known methods.
- the multispecific antibodies of the invention have a C-terminal lysine content of about 10% to about 90%, about 20% to about 80%, about 40% to about 70%, about 55% to about 70%, or about 60%.
- the multispecific antibodies of the invention have a C-terminal lysine content of about 0%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%.
- the invention also provides for an isolated antibody comprising two heavy chains having identical amino acid sequences and two light chains, wherein the two identical heavy chains comprises a mutation Q311R, Q31 IK, T307P/L309Q, T307P/V309Q, T307P/L309Q/Q311R or T307P/V309Q/Q311R, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated antibody comprising two heavy chains having identical amino acid sequences and two light chains, wherein the two identical heavy chains comprises a mutation Q311R, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated antibody comprising two heavy chains having identical amino acid sequences and two light chains, wherein the two identical heavy chains comprises a mutation Q31 IK, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated antibody comprising two heavy chains having identical amino acid sequences and two light chains, wherein the two identical heavy chains comprises a mutation T307P L309Q, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated antibody comprising two heavy chains having identical amino acid sequences and two light chains, wherein the two identical heavy chains comprises a mutation T307P/V309Q, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated antibody comprising two heavy chains having identical amino acid sequences and two light chains, wherein the two identical heavy chains comprises a mutation T307P/L309Q/Q311R, wherein residue numbering is according to the EU Index.
- the invention also provides for an isolated antibody comprising two heavy chains having identical amino acid sequences and two light chains, wherein the two identical heavy chains comprises a mutation T307P/V309Q/Q311R, wherein residue numbering is according to the EU Index.
- the isolated antibody is useful as a parental antibody for generating the multispecific antibodies of the invention.
- the isolated antibody further comprises a mutation F405L, K409R, F405L/R409K, T366W or T366S/L368A/Y407V.
- the isolated antibody is an IgGl, an IgG2 or an IgG4 isotype.
- the engineered multispecific antibodies of the invention that have altered amino acid sequences when compared to the parental multispecific antibodies may be generated using standard cloning and expression technologies. For example, site-directed mutagenesis or PCR- mediated mutagenesis may be performed to introduce the mutation(s) and the effect on antibody binding or other property of interest, may be evaluated using well known methods and the methods described herein in the Examples.
- Immunogenicity of therapeutic antibodies is associated with increased risk of infusion reactions and decreased duration of therapeutic response (Baert et al, (2003) N EnglJ Med 348:602-08).
- the extent to which therapeutic antibodies induce an immune response in the host may be determined in part by the allotype of the antibody (Stickler et al, (2011) Genes and
- Antibody allotype is related to amino acid sequence variations at specific locations in the constant region sequences of the antibody.
- Table 4 shows select IgGl, IgG2 and IgG4 allotypes.
- the multispecific antibodies of the invention are of G2m(n), G2m(n-), G2m(n)/(n-), nG4m(a), Glm(17) or Glm(17,l) allotype. Table 4.
- the multispecific antibodies of the invention may be generated using standard molecular biology techniques and promoting Fab arm exchange of the parental antibodies.
- the multispecific antibodies of the invention may be purified using protein A ligand affinity chromatography.
- the invention also provides for a method of making an isolated multispecific antibody comprising a first heavy chain or fragment thereof comprising a mutation Q31 IR, Q31 IK,
- a first parental antibody comprising the first heavy chain or fragment thereof comprising the mutation Q31 IR, Q31 IK, T307P L309Q, T307P/V309Q, T307P/L309Q/Q31 IR or T307P/V309Q/Q31 IR and a first light chain;
- the invention also provides for a method of making an isolated multispecific antibody comprising a first heavy chain or fragment thereof comprising a mutation T307P/L309Q and a second heavy chain or fragment thereof comprising wild-type amino acid residue at positions 307 and 309, comprising
- the invention also provides for a method of making an isolated multispecific antibody comprising a first heavy chain or fragment thereof comprising a mutation T307P/V309Q and a second heavy chain or fragment thereof comprising wild-type amino acid residue at positions 307 and 309, comprising
- the invention also provides for a method of making an isolated multispecific antibody comprising a first heavy chain or fragment thereof comprising a mutation T307P/L309Q/Q311R and a second heavy chain or fragment thereof comprising wild-type amino acid residue at positions 307, 309 and 311, comprising
- the invention also provides for a method of making an isolated multispecific antibody comprising a first heavy chain or fragment thereof comprising a mutation T307P/V309Q/Q311R and a second heavy chain or fragment thereof comprising wild-type amino acid residue at positions 307, 309 and 311, comprising
- the VH and the VL regions of the multispecific antibodies may be derived from existing VH/VL regions of antibodies specific to a desired antigen, or from VH/VL domains of parental antibodies generated de novo.
- the parental antibodies may be generated de novo using various technologies. For example, the hybridoma method of Kohler and Milstein, Nature 256:495, 1975 may be used to generate them.
- a mouse or other host animal such as a hamster, rat or monkey, is immunized with an antigen followed by fusion of spleen cells from immunized animals with myeloma cells using standard methods to form hybridoma cells (Goding,
- Colonies arising from single immortalized hybridoma cells are screened for production of antibodies with desired properties, such as specificity of binding, cross-reactivity or lack thereof, and affinity for the antigen.
- Transgenic mice carrying human immunoglobulin (Ig) loci in their genome may be used to generate the parental antibodies against a desired antigen, and are described in for example Int. Pat. Publ. No. WO90/04036, U.S. Pat. No. 6150584, Int. Pat. Publ. No. W099/45962, Int. Pat. Publ. No. WO02/066630, Int. Pat. Publ. No. WO02/43478, Lonberg et al, Nature 368:856-9, 1994; Green et al, Nature Genet 7: 13-21, 1994; Green & Jakobovits, Exp. Med.
- the endogenous immunoglobulin loci in such mice may be disrupted or deleted, and at least one complete or partial human immunoglobulin locus may be inserted into the mouse genome using homologous or non-homologous recombination, using transchromosomes, or using minigenes. Companies such as Regeneron
- the parental antibodies may also be selected from a phage display library, where the phage is engineered to express human immunoglobulins or portions thereof such as Fabs, single chain antibodies (scFv), or unpaired or paired antibody variable regions.
- the parental antibodies may be isolated for example from phage display library expressing antibody heavy and light chain variable regions as fusion proteins with bacteriophage pIX coat protein as described in Shi et al, JMol Biol 397:385-96, 2010 and Int. Pat. Publ. No. WO09/085462).
- the libraries may be screened for phage binding to the desired antigen and the obtained positive clones may be further characterized, the Fabs isolated from the clone lysates, and expressed as full length IgGs.
- phage display methods for isolating human antibodies are described in for example: U.S. Patent Nos. 5,223,409; 5,403,484, 5,571,698, 5,427,908, 5, 580,717, 5,969,108, 6,172,197, 5,885,793; 6,521,404; 6,544,731; 6,555,313; 6,582,915 and 6,593,081.
- the isolated VH/VL regions may be cloned as any Ig isotype or a portion of antibody constant domain, such as a CH2-CH3 region using standard cloning methods. Fc mutations may be introduced to the parental antibodies using standard methods.
- the first parental antibody and the second parental antibody are provided as purified antibodies.
- the first parental antibody and the second parental antibody are provided in a cell culture medium collected from cells expressing the first parental antibody and the second parental antibody.
- the first parental antibody and the second parental antibody are co-expressed in a cell.
- an incubation step is performed.
- incubation is performed at a temperature of about 20°C to about
- incubation is performed at a temperature of about 25°C to about
- incubation is performed at a temperature of about 25°C to about 37°C about ninety minutes to about six hours.
- a reducing agent is added during the incubation step.
- the reducing agent is 2-mercaptoethylamine (2-MEA).
- the reducing agent is dithiothreitol (DTT).
- the reducing agent is dithioerythritol (DTE).
- the reducing agent is glutathione.
- the reducing agent is tris(2-carboxyethyl)phosphine (TCEP). In some embodiments, the reducing agent is L-cysteine.
- the reducing agent is beta-mercaptoethanol.
- the reducing agent is present at a concentration of about 10 mM to about 100 mM.
- 2-MEA is present at a concentration of about 10 mM to about 100 mM.
- 2-MEA is present at a concentration of about 25 mM to about 75 mM.
- incubation for at least 90 min at a temperature of at least 20°C in the presence of at least 25 mM 2-MEA or in the presence of at least 0.5 mM dithiothreitol at a pH of from 5-8, for example at pH of 7.0 or at pH of 7.4 may be used.
- protein A ligand chromatography employs a pH gradient.
- the pH gradient is from about pH 7.0 to about pH 3.0.
- the pH gradient is from about pH 4.6 to about pH 3.4.
- the multimeric antibody elutes between about pH 4.4 to about pH
- the pH gradient is a step gradient of pH 4.6, pH 4.1 and pH 3.4.
- protein A ligand chromatography employs a citrate buffer. In some embodiments, protein A ligand chromatography employs a 50 mM citrate buffer.
- protein A ligand chromatography employs an acetate buffer. In some embodiments, protein A ligand chromatography employs a 40 mM acetate buffer.
- Protein A chromatography may be carried out using mAb Select Sure columns (GE Healthcare) or in batch mode. Culture supernatants are loaded onto the column directly without additional processing, according to the manufacturer's column specifications. Antibodies are eluted using pH step gradient using buffers containing 50 mM citrate pH 4.7, pH 4.2 or pH 3.4. Elution fractions are collected and concentrated to > 1 mg/mL prior to analysis. Purity of the isolated multimeric antibody can be assessed using hydrophobic interaction chromatography (HIC).
- HIC hydrophobic interaction chromatography
- compositions of matter multimeric proteins of the invention
- the mutations identified herein may be used to isolate any multimeric protein from its parental proteins as long as the multimeric protein has at least two polypeptide chains each having a CH2-CH3 region with asymmetrical Q311R, Q31 IK, T307P/L309Q, T307P/V309Q, T307P/L309Q/Q311R or T307P/V309Q/Q311R mutations.
- the invention also provides for a multimeric protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises a first CH2-CH3 region comprising a mutation Q311R, Q31 IK, T307P/L309Q, T307P/V309Q, T307P/L309Q/Q311R or
- T307P/V309Q/Q311R and the second polypeptide comprises a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311, wherein residue numbering is according to the EU Index.
- the invention also provides for a multimeric protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises a first CH2-CH3 region comprising a mutation Q311R and the second polypeptide comprises a second CH2-CH3 region comprising a wild-type amino acid residue at position 311, wherein residue numbering is according to the EU Index.
- the invention also provides for a multimeric protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises a first CH2-CH3 region comprising a mutation Q31 IK and the second polypeptide comprises a second CH2-CH3 region comprising a wild-type amino acid residue at position 311, wherein residue numbering is according to the EU Index.
- the invention also provides for a multimeric protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises a first CH2-CH3 region comprising a mutation T307P/L309Q and the second polypeptide comprises a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307 and 309, wherein residue numbering is according to the EU Index.
- the invention also provides for a multimeric protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises a first CH2-CH3 region comprising a mutation T307P/V309Q and the second polypeptide comprises a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307 and 309, wherein residue numbering is according to the EU Index.
- the invention also provides for a multimeric protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises a first CH2-CH3 region comprising a mutation T307P/L309Q/Q311R and the second polypeptide comprises a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311, wherein residue numbering is according to the EU Index.
- the invention also provides for a multimeric protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises a first CH2-CH3 region comprising a mutation T307P/V309Q/Q311R and the second polypeptide comprises a second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311, wherein residue numbering is according to the EU Index.
- the first CH2-CH3 region and the second CH2-CH3 region are an IgGl isotype.
- the first CH2-CH3 region and the second CH2-CH3 region are an IgG2 isotype.
- the first CH2-CH3 region and the second CH2-CH3 region are an IgG4 isotype.
- the first CH2-CH3 region has reduced binding to protein A ligand when compared to the second CH2-CH3 region.
- protein A ligand comprises Staphylococcal Protein A.
- protein A ligand comprises Z-domain.
- protein A ligand comprises Y-domain.
- Z-domain comprises an amino acid sequence of SEQ ID NO: 1.
- protein A ligand comprises an amino acid sequence of SEQ ID Nos: 99, 100 or 101.
- the multimeric protein further comprises asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region.
- the asymmetric stabilizing mutations in the first CH2-CH3 region and in the second CH2-CH3 region or in the second CH2-CH3 region and in the first CH2-CH3 region are
- T366L/ 392M/T394W and F405A/Y407V respectively; L351Y/Y407A and T366A/K409F, respectively;
- the first CH2-CH3 region and the second CH2-CH3 comprise an amino acid sequence of
- the first CH2-CH3 region and/or the second CH2-CH3 region is coupled to a heterologous protein.
- the heterologous protein is a peptide. In some embodiments, the heterologous protein is an extracellular domain of a receptor. In some embodiments, the heterologous protein is an extracellular domain of a ligand. In some embodiments, the heterologous protein is a secreted protein.
- the heterologous protein is a scFv.
- the heterologous protein is a heavy chain variable region (VH). In some embodiments, the heterologous protein is a light chain variable region (VL). In some embodiments, the heterologous protein is a fibronectin type III domain.
- the heterologous protein is a fynomer.
- the heterologous protein is coupled to the N-terminus of the first CH2-CH3 region and/or the second CH2-CH3 region, optionally via a linker.
- the heterologous protein is coupled to the C-terminus of the first CH2-CH3 region and/or the second CH2-CH3 region, optionally via a linker.
- the linker comprises an amino acid sequence of SEQ ID NOs: 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 92, 93, 94, 95, 96, 97 or 98.
- the multimeric protein is an antibody.
- the antibody is multispecific.
- the antibody is bispecific.
- the antibody is monospecific.
- the multimeric protein contains two polypeptide chains.
- the multimeric protein contains three polypeptide chains.
- the multimeric protein contains four polypeptide chains.
- peptide (P) may be an extracellular domain of a receptor, an extracellular domain of a ligand, a secreted protein, a scFv, a Fab, a heavy chain variable region (VH), a light chain variable region (VL), a fibronectin type III domain or a fynomer.
- linker (L) may optionally be absent.
- Exemplary linkers are shown in Table 6.
- Asterix (*) in the table indicates that the two CH2-CH3 domains harbor asymmetrical mutations as have been described herein.
- the multimeric proteins of the invention may be further modified as described herein for multispecific antibodies using standard methods.
- the multimeric proteins of the invention may be made using standard cloning methods.
- the invention also provides for an isolated polynucleotide encoding any of the CH2- CH3 regions, antibody heavy chains, antibody light chains or polypeptides of the multimeric proteins of the invention.
- the invention also provides for an isolated polynucleotide
- T307P/V309Q/Q311R and the second CH2-CH3 region comprising a wild-type amino acid residue at positions 307, 309 and 311;
- polynucleotide sequences of the invention may be operably linked to one or more regulatory elements, such as a promoter or enhancer, that allow expression of the nucleotide sequence in the intended host cell.
- the polynucleotide may be a cDNA.
- the invention also provides for a vector comprising the polynucleotide of the invention.
- vectors may be plasmid vectors, viral vectors, vectors for baculovirus expression, transposon based vectors or any other vector suitable for introduction of the synthetic polynucleotide of the invention into a given organism or genetic background by any means.
- the polynucleotides of the invention may be operably linked to control sequences in the expression vector(s) that ensure the expression of the CH2-CH3 regions the polynucleotides encode.
- control sequences include signal sequences, promoters (e.g. naturally associated or heterologous promoters), enhancer elements, and transcription termination sequences, and are chosen to be compatible with the host cell chosen to express the antibody.
- the vector comprises the polynucleotides of SEQ ID Nos: 27, and 47.
- the vector comprises the polynucleotides of SEQ ID Nos: 28 and
- the vector comprises the polynucleotides of SEQ ID Nos: 29 and 47.
- the vector comprises the polynucleotides of SEQ ID NOs: 30 and 47. In some embodiments, the vector comprises the polynucleotides of SEQ ID NOs: 31 and
- the vector comprises the polynucleotides of SEQ ID Nos: 32 and
- the vector comprises the polynucleotides of SEQ ID NOs: 33 and
- the vector comprises the polynucleotides of SEQ ID Nos: 34 and
- the vector comprises the polynucleotides of SEQ ID Nos: 35 and 49.
- the vector comprises the polynucleotides of SEQ ID Nos: 36 and
- the vector comprises the polynucleotides of SEQ ID Nos: 37 and
- the vector comprises the polynucleotides of SEQ ID Nos: 38 and
- the vector comprises the polynucleotides of SEQ ID Nos: 39 and
- the vector comprises the polynucleotides of SEQ ID Nos: 40 and 50.
- the vector comprises the polynucleotides of SEQ ID Nos: 41 and
- the vector comprises the polynucleotides of SEQ ID Nos: 42 and
- the vector comprises the polynucleotides of SEQ ID Nos: 43 and
- the vector comprises the polynucleotides of SEQ ID Nos: 44 and
- the vector comprises the polynucleotides of SEQ ID Nos: 45 and 51.
- the vector comprises the polynucleotides of SEQ ID NOs: 46 and
- the vector comprises the polynucleotides of SEQ ID NOs: 87 and
- the vector comprises the polynucleotides of SEQ ID Nos: 87 and
- the vector comprises the polynucleotides of SEQ ID NOs: 88 and
- the vector comprises the polynucleotides of SEQ ID NOs: 88 and
- the vector comprises the polynucleotides of SEQ ID NOs: 92 and
- the vector comprises the polynucleotides of SEQ ID Nos: 92 and
- Table 7 shows the cDNA sequences of exemplary CH2-CH3 regions. Table 7.
- IgGl CH2- 29 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 31 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 32 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 33 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 35 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 36 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 37 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 38 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 39 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA Q311K/ CCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCC T366W ACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGG
- IgGl CH2- 40 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 41 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 42 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 43 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 44 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- IgGl CH2- 45 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
- T307P L30 CCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCC 9Q/ ACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGG
- T366S L36 ACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGC 8A/Y407V GGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCA
- IgGl CH2- 46 CCTGAACTGCTGGGGGGACCGTCAGTCTTCCTCTTCC CH3 CCCCAAAACCCAAGGACACCCTCATGATCTCCCGGA
Abstract
Priority Applications (9)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2018281045A AU2018281045A1 (en) | 2017-06-05 | 2018-06-04 | Engineered multispecific antibodies and other multimeric proteins with asymmetrical CH2-CH3 region mutations |
KR1020197038922A KR20200014379A (ko) | 2017-06-05 | 2018-06-04 | 비대칭 ch2-ch3 영역 돌연변이를 갖는 조작된 다중특이성 항체 및 다른 다량체 단백질 |
JP2019566965A JP2020522266A (ja) | 2017-06-05 | 2018-06-04 | 非対称なch2−ch3領域の変異を有する、操作された多重特異性抗体及び他の多量体タンパク質 |
BR112019025583-4A BR112019025583A2 (pt) | 2017-06-05 | 2018-06-04 | Anticorpos multiespecíficos geneticamente modificados e outras proteínas multiméricas com mutações assimétricas na região ch2-ch3 |
CN201880037442.XA CN110785185A (zh) | 2017-06-05 | 2018-06-04 | 具有非对称ch2-ch3区突变的工程化多特异性抗体和其他多聚体蛋白 |
EP18814314.3A EP3634486A4 (fr) | 2017-06-05 | 2018-06-04 | Anticorps multispécifiques modifiés et autres protéines multimères avec des mutations de région ch2-ch3 asymétriques |
CA3065171A CA3065171A1 (fr) | 2017-06-05 | 2018-06-04 | Anticorps multispecifiques modifies et autres proteines multimeres avec des mutations de region ch2-ch3 asymetriques |
RU2019144115A RU2804031C2 (ru) | 2017-06-05 | 2018-06-04 | Сконструированные мультиспецифические антитела и другие мультимерные белки с асимметричными мутациями в области ch2-ch3 |
MX2019014576A MX2019014576A (es) | 2017-06-05 | 2018-06-04 | Anticuerpos multiespecíficos manipulados genéticamente y otras proteínas multiméricas con mutaciones asimétricas en la región ch2-ch3. |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201762515316P | 2017-06-05 | 2017-06-05 | |
US62/515,316 | 2017-06-05 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2018224951A2 true WO2018224951A2 (fr) | 2018-12-13 |
WO2018224951A3 WO2018224951A3 (fr) | 2019-02-14 |
Family
ID=64458754
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/IB2018/053997 WO2018224951A2 (fr) | 2017-06-05 | 2018-06-04 | Anticorps multispécifiques modifiés et autres protéines multimères avec des mutations de région ch2-ch3 asymétriques |
Country Status (10)
Country | Link |
---|---|
US (1) | US11149094B2 (fr) |
EP (1) | EP3634486A4 (fr) |
JP (1) | JP2020522266A (fr) |
KR (1) | KR20200014379A (fr) |
CN (1) | CN110785185A (fr) |
AU (1) | AU2018281045A1 (fr) |
BR (1) | BR112019025583A2 (fr) |
CA (1) | CA3065171A1 (fr) |
MX (1) | MX2019014576A (fr) |
WO (1) | WO2018224951A2 (fr) |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2020259535A1 (fr) * | 2019-06-25 | 2020-12-30 | 南京金斯瑞生物科技有限公司 | Anticorps bispécifique anti-cd47/anti-tigit, son procédé de préparation et son application |
CN114787186A (zh) * | 2019-09-27 | 2022-07-22 | 艾吉纳斯公司 | 异二聚体蛋白 |
EP4028426A4 (fr) * | 2019-09-13 | 2023-10-11 | The University of Chicago | Méthodes et compositions pour traiter des infections à staphylocoques |
Families Citing this family (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA2837527C (fr) | 2011-06-02 | 2019-05-28 | Dyax Corp. | Proteines liant le recepteur de fc |
KR102398736B1 (ko) | 2011-10-31 | 2022-05-16 | 추가이 세이야쿠 가부시키가이샤 | 중쇄와 경쇄의 회합이 제어된 항원 결합 분자 |
US10982008B2 (en) * | 2014-12-05 | 2021-04-20 | Merck Patent Gmbh | Domain-exchanged antibody |
KR20180050321A (ko) * | 2015-08-07 | 2018-05-14 | 이미지냅 인코포레이티드 | 분자를 표적화하기 위한 항원 결합 구조체 |
CA3010027A1 (fr) * | 2015-12-28 | 2017-07-06 | Massachusetts Institute Of Technology | Anticorps bispecifiques ayant des mutations de region constante et leurs utilisations |
WO2018147960A1 (fr) | 2017-02-08 | 2018-08-16 | Imaginab, Inc. | Séquences d'extension pour dianticorps |
JOP20190248A1 (ar) | 2017-04-21 | 2019-10-20 | Amgen Inc | بروتينات ربط مولد ضد trem2 واستخداماته |
EP3638697A4 (fr) | 2017-06-12 | 2021-07-07 | Bluefin Biomedicine, Inc. | Anticorps anti-il1rap et conjugués anticorps-médicament |
BR112019025105A2 (pt) * | 2017-06-30 | 2020-10-20 | Zymeworks Inc. | fabs quiméricos estabilizados |
WO2021007439A1 (fr) * | 2019-07-09 | 2021-01-14 | Tavotek Biotherapeutics (Hong Kong) Limited | Anticorps bispécifiques se liant au tnf-alpha et à il-1bêta et utilisations associées |
MX2022000657A (es) * | 2019-07-17 | 2022-05-18 | Bioinvent Int Ab | Combinaciones de anticuerpos para el tratamiento del cancer en pacientes especificos. |
WO2021143826A1 (fr) * | 2020-01-17 | 2021-07-22 | 信达生物制药(苏州)有限公司 | Protéine de mort cellulaire 1 anti-programmée recombinante et préparation d'anticorps bispécifique anti-cluster d'antigène de différenciation 137 et son utilisation |
CN115768454A (zh) * | 2020-02-07 | 2023-03-07 | 安万托特性材料股份有限公司 | 多肽亲和配体及其应用方法 |
WO2021207242A2 (fr) * | 2020-04-07 | 2021-10-14 | Fred Hutchinson Cancer Research Center | Molécules de liaison à l'antigène anti-mésothéline et leurs utilisations |
US11739137B2 (en) * | 2020-10-30 | 2023-08-29 | The Government Of The United States Of America, As Represented By The Secretary Of The Navy | Single domain antibodies to SARS-CoV-2 nucleocapsid protein |
CN116178546A (zh) * | 2022-10-13 | 2023-05-30 | 深圳市百士通科技开发有限公司 | 一种多功能重组抗体及其制备方法和应用 |
Family Cites Families (53)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE3785186T2 (de) | 1986-09-02 | 1993-07-15 | Enzon Lab Inc | Bindungsmolekuele mit einzelpolypeptidkette. |
US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
GB8823869D0 (en) | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
US6255458B1 (en) | 1990-08-29 | 2001-07-03 | Genpharm International | High affinity human antibodies and human antibodies against digoxin |
ATE463573T1 (de) | 1991-12-02 | 2010-04-15 | Medimmune Ltd | Herstellung von autoantikörpern auf phagenoberflächen ausgehend von antikörpersegmentbibliotheken |
EP0672142B1 (fr) | 1992-12-04 | 2001-02-28 | Medical Research Council | Proteines de liaison multivalentes et multispecifiques, leur fabrication et leur utilisation |
AUPO591797A0 (en) | 1997-03-27 | 1997-04-24 | Commonwealth Scientific And Industrial Research Organisation | High avidity polyvalent and polyspecific reagents |
US7951917B1 (en) | 1997-05-02 | 2011-05-31 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
US6596541B2 (en) | 2000-10-31 | 2003-07-22 | Regeneron Pharmaceuticals, Inc. | Methods of modifying eukaryotic cells |
ES2295228T3 (es) | 2000-11-30 | 2008-04-16 | Medarex, Inc. | Roedores transcromosomicos transgenicos para la preparacion de anticuerpos humanos. |
JP2008504002A (ja) * | 2003-11-12 | 2008-02-14 | バイオジェン・アイデック・エムエイ・インコーポレイテッド | 新生児Fcレセプター(FcRn)結合ポリペプチド改変体、ダイマーFc結合タンパク質、およびそれらに関連する方法 |
CN101189028B (zh) * | 2004-07-12 | 2013-05-29 | 马克罗基因公司 | 具有变异Fc区的抗体的鉴定和工程化以及使用方法 |
ES2426817T3 (es) * | 2004-08-04 | 2013-10-25 | Mentrik Biotech, Llc | Regiones Fc variantes |
US8802820B2 (en) * | 2004-11-12 | 2014-08-12 | Xencor, Inc. | Fc variants with altered binding to FcRn |
EP2325207B1 (fr) * | 2004-11-12 | 2017-03-15 | Xencor, Inc. | Variants de fc avec une liaison altérée à fcrn |
US20110123440A1 (en) * | 2005-03-29 | 2011-05-26 | Genevieve Hansen | Altered Antibody FC Regions and Uses Thereof |
AU2006232287B2 (en) | 2005-03-31 | 2011-10-06 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
DE102005028778A1 (de) | 2005-06-22 | 2006-12-28 | SUNJÜT Deutschland GmbH | Mehrlagige Folie mit einer Barriere- und einer antistatischen Lage |
MX2008015138A (es) * | 2006-06-02 | 2009-01-28 | Aveo Pharmaceuticals Inc | Proteinas de union al factor de crecimiento de hepatocitos (fch). |
JP2009541275A (ja) | 2006-06-22 | 2009-11-26 | ノボ・ノルデイスク・エー/エス | 二重特異性抗体の生産 |
US20080112961A1 (en) * | 2006-10-09 | 2008-05-15 | Macrogenics, Inc. | Identification and Engineering of Antibodies with Variant Fc Regions and Methods of Using Same |
EP2087111A2 (fr) * | 2007-03-19 | 2009-08-12 | Medimmune Limited | Variants polypeptidiques |
ES2564523T3 (es) | 2007-12-19 | 2016-03-23 | Janssen Biotech, Inc. | Diseño y generación de bibliotecas de presentación en fago por pIX de novo humanas mediante fusión con pIX o pVII, vectores, anticuerpos y métodos |
CN102459346B (zh) | 2009-04-27 | 2016-10-26 | 昂考梅德药品有限公司 | 制造异源多聚体分子的方法 |
KR101747103B1 (ko) * | 2009-06-26 | 2017-06-14 | 리제너론 파마슈티칼스 인코포레이티드 | 천연 면역글로불린 포맷을 가지는 용이하게 분리된 이중특이성 항체 |
CA2766166A1 (fr) | 2009-07-08 | 2011-01-13 | Amgen Inc. | Conception de molecules fc d'anticorps exemptes d'agregation et stable par ingenierie de l'interface du domaine ch3 |
TWI667346B (zh) * | 2010-03-30 | 2019-08-01 | 中外製藥股份有限公司 | 促進抗原消失之具有經修飾的FcRn親和力之抗體 |
MX352929B (es) | 2010-11-05 | 2017-12-13 | Zymeworks Inc | DISEÑO DE ANTICUERPOS HETERODIMÉRICOS ESTABLES CON MUTACIONES EN EL DOMINIO Fc. |
AU2011337704B2 (en) * | 2010-11-30 | 2017-06-15 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly |
KR102147548B1 (ko) * | 2011-02-25 | 2020-08-24 | 추가이 세이야쿠 가부시키가이샤 | FcγRIIb 특이적 Fc 항체 |
BR112014007353B1 (pt) * | 2011-09-30 | 2022-09-13 | Chugai Seiyaku Kabushiki Kaisha | Biblioteca de anticorpos dependentes de concentração de íon |
EP3939996A1 (fr) * | 2011-09-30 | 2022-01-19 | Chugai Seiyaku Kabushiki Kaisha | Molécule se liant à l'antigène favorisant la disparition des antigènes ayant une pluralité d'activités biologiques |
DK2773671T3 (da) | 2011-11-04 | 2021-11-15 | Zymeworks Inc | Udformning af stabilt heterodimert antistof med mutationer i fc-domænet |
CN113416256A (zh) * | 2011-11-30 | 2021-09-21 | 中外制药株式会社 | 包含进入细胞内以形成免疫复合体的搬运体(载体)的药物 |
US9815909B2 (en) * | 2012-03-13 | 2017-11-14 | Novimmune S.A. | Readily isolated bispecific antibodies with native immunoglobulin format |
US20150353630A1 (en) * | 2012-05-30 | 2015-12-10 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule for eliminating aggregated antigens |
MX2014014678A (es) * | 2012-05-30 | 2015-02-10 | Chugai Pharmaceutical Co Ltd | Molecula de union al antigeno especifico para el tejido objetivo. |
PT2970980T (pt) | 2013-03-15 | 2018-11-19 | Janssen Biotech Inc | Métodos de produção para controlor o teor de lisina c-terminal, galactose e ácido siálico em proteínas recombinantes |
JP6236948B2 (ja) * | 2013-07-17 | 2017-11-29 | 東ソー株式会社 | 抗体精製用溶出液および当該溶出液を用いた抗体精製方法 |
US10208094B2 (en) * | 2013-09-04 | 2019-02-19 | Protenova Co., Ltd. | Multimeric immunoglobulin-binding domain |
AU2014343636A1 (en) * | 2013-11-04 | 2016-06-02 | Glenmark Pharmaceuticals S.A. | Production of T cell retargeting hetero-dimeric immunoglobulins |
MX2016010951A (es) * | 2014-03-05 | 2016-11-29 | Ucb Biopharma Sprl | Proteinas de fc multimericas. |
RU2711485C2 (ru) * | 2014-04-11 | 2020-01-17 | МЕДИММЬЮН, ЭлЭлСи | Конъюгированные соединения, содержащие сконструированные с цистеином антитела |
AU2015248785A1 (en) * | 2014-04-16 | 2016-11-24 | Ucb Biopharma Sprl | Multimeric Fc proteins |
MA41294A (fr) * | 2014-12-19 | 2017-11-08 | Chugai Pharmaceutical Co Ltd | Anticorps anti-myostatine, polypeptides contenant des variants de régions fc, et procédés d'utilisation |
CN114773470A (zh) * | 2015-02-05 | 2022-07-22 | 中外制药株式会社 | 包含离子浓度依赖性的抗原结合结构域的抗体,fc区变体,il-8-结合抗体及其应用 |
US20180194861A1 (en) * | 2015-07-10 | 2018-07-12 | Abbvie Inc. | IgM- or IgE-Modified Binding Proteins and Uses Thereof |
BR112017026543A2 (pt) | 2015-08-26 | 2018-08-14 | Bison Therapeutics Inc | plataforma de anticorpo multiespecífico e métodos relacionados |
GB201515745D0 (en) * | 2015-09-04 | 2015-10-21 | Ucb Biopharma Sprl | Proteins |
-
2018
- 2018-06-04 US US15/997,222 patent/US11149094B2/en active Active
- 2018-06-04 CN CN201880037442.XA patent/CN110785185A/zh active Pending
- 2018-06-04 WO PCT/IB2018/053997 patent/WO2018224951A2/fr unknown
- 2018-06-04 KR KR1020197038922A patent/KR20200014379A/ko not_active Application Discontinuation
- 2018-06-04 CA CA3065171A patent/CA3065171A1/fr active Pending
- 2018-06-04 AU AU2018281045A patent/AU2018281045A1/en active Pending
- 2018-06-04 EP EP18814314.3A patent/EP3634486A4/fr active Pending
- 2018-06-04 BR BR112019025583-4A patent/BR112019025583A2/pt unknown
- 2018-06-04 JP JP2019566965A patent/JP2020522266A/ja active Pending
- 2018-06-04 MX MX2019014576A patent/MX2019014576A/es unknown
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2020259535A1 (fr) * | 2019-06-25 | 2020-12-30 | 南京金斯瑞生物科技有限公司 | Anticorps bispécifique anti-cd47/anti-tigit, son procédé de préparation et son application |
CN114007646A (zh) * | 2019-06-25 | 2022-02-01 | 南京金斯瑞生物科技有限公司 | 抗cd47/抗tigit双特异抗体及其制备方法和应用 |
EP3991744A4 (fr) * | 2019-06-25 | 2023-08-16 | Nanjing GenScript Biotech Co., Ltd. | Anticorps bispécifique anti-cd47/anti-tigit, son procédé de préparation et son application |
EP4028426A4 (fr) * | 2019-09-13 | 2023-10-11 | The University of Chicago | Méthodes et compositions pour traiter des infections à staphylocoques |
CN114787186A (zh) * | 2019-09-27 | 2022-07-22 | 艾吉纳斯公司 | 异二聚体蛋白 |
EP4034570A4 (fr) * | 2019-09-27 | 2023-10-25 | Agenus Inc. | Protéines hétérodimères |
Also Published As
Publication number | Publication date |
---|---|
AU2018281045A1 (en) | 2019-12-12 |
BR112019025583A2 (pt) | 2020-06-16 |
WO2018224951A3 (fr) | 2019-02-14 |
US20180346605A1 (en) | 2018-12-06 |
EP3634486A4 (fr) | 2021-03-31 |
JP2020522266A (ja) | 2020-07-30 |
MX2019014576A (es) | 2020-07-29 |
RU2019144115A (ru) | 2021-07-09 |
CN110785185A (zh) | 2020-02-11 |
KR20200014379A (ko) | 2020-02-10 |
EP3634486A2 (fr) | 2020-04-15 |
US11149094B2 (en) | 2021-10-19 |
RU2019144115A3 (fr) | 2022-02-10 |
CA3065171A1 (fr) | 2018-12-13 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11149094B2 (en) | Engineered multispecific antibodies and other multimeric proteins with asymmetrical CH2-CH3 region mutations | |
JP7218396B2 (ja) | 二重特異性抗体 | |
TWI798179B (zh) | 多特異性抗體之純化 | |
CA3175576A1 (fr) | Anticorps anti-dectine-2 | |
US20200190200A1 (en) | Methods of Producing Heterodimeric Antibodies | |
RU2804031C2 (ru) | Сконструированные мультиспецифические антитела и другие мультимерные белки с асимметричными мутациями в области ch2-ch3 | |
TWI796563B (zh) | 製造抗體之方法 | |
US20230220114A1 (en) | Purification of multispecific antibodies | |
WO2022042673A1 (fr) | Peptide signal pour réduire l'hétérogénéité finale d'un polypeptide hétérologue | |
EP4034244A1 (fr) | Modules de liaison comprenant des domaines ehd2 modifiés |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18814314 Country of ref document: EP Kind code of ref document: A2 |
|
ENP | Entry into the national phase |
Ref document number: 3065171 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 2019566965 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019025583 Country of ref document: BR |
|
ENP | Entry into the national phase |
Ref document number: 2018281045 Country of ref document: AU Date of ref document: 20180604 Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 20197038922 Country of ref document: KR Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2018814314 Country of ref document: EP Effective date: 20200107 |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18814314 Country of ref document: EP Kind code of ref document: A2 |
|
ENP | Entry into the national phase |
Ref document number: 112019025583 Country of ref document: BR Kind code of ref document: A2 Effective date: 20191203 |