WO2018167104A1 - Fc-optimized anti-cd25 for tumour specific cell depletion - Google Patents

Fc-optimized anti-cd25 for tumour specific cell depletion Download PDF

Info

Publication number
WO2018167104A1
WO2018167104A1 PCT/EP2018/056312 EP2018056312W WO2018167104A1 WO 2018167104 A1 WO2018167104 A1 WO 2018167104A1 EP 2018056312 W EP2018056312 W EP 2018056312W WO 2018167104 A1 WO2018167104 A1 WO 2018167104A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
cells
amino acid
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2018/056312
Other languages
English (en)
French (fr)
Inventor
Anne Goubier
Pascal Merchiers
Josephine SALIMU
Beatriz GOYENECHEA
Kevin Moulder
Sergio Quezada
Karl PEGGS
Fred Arce VARGAS
Isabelle SOLOMON
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cancer Research Technology Ltd
Tusk Therapeutics Ltd
Original Assignee
Cancer Research Technology Ltd
Tusk Therapeutics Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=61655786&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2018167104(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority claimed from GBGB1710879.6A external-priority patent/GB201710879D0/en
Priority claimed from GBGB1714429.6A external-priority patent/GB201714429D0/en
Priority to US16/494,962 priority Critical patent/US11879014B2/en
Application filed by Cancer Research Technology Ltd, Tusk Therapeutics Ltd filed Critical Cancer Research Technology Ltd
Priority to EP18711313.9A priority patent/EP3596123B1/en
Priority to CN201880018976.8A priority patent/CN110869388B/zh
Priority to AU2018233976A priority patent/AU2018233976B2/en
Priority to SI201831085T priority patent/SI3596123T1/sl
Priority to MX2019010974A priority patent/MX2019010974A/es
Priority to MYPI2019005313A priority patent/MY208220A/en
Priority to LTEPPCT/EP2018/056312T priority patent/LT3596123T/lt
Priority to RS20240376A priority patent/RS65351B1/sr
Priority to ES18711313T priority patent/ES2975063T3/es
Priority to PE2019001847A priority patent/PE20191812A1/es
Priority to SG11201908578Y priority patent/SG11201908578YA/en
Priority to CR20190477A priority patent/CR20190477A/es
Priority to JP2019550705A priority patent/JP2020514363A/ja
Priority to KR1020197030283A priority patent/KR20190130137A/ko
Priority to PL18711313.9T priority patent/PL3596123T3/pl
Priority to NZ756984A priority patent/NZ756984B2/en
Priority to BR112019017017-0A priority patent/BR112019017017A2/pt
Priority to MA49881A priority patent/MA49881B1/fr
Priority to CA3056506A priority patent/CA3056506A1/en
Priority to FIEP18711313.9T priority patent/FI3596123T3/fi
Priority to DK18711313.9T priority patent/DK3596123T3/da
Priority to HRP20240469TT priority patent/HRP20240469T1/hr
Publication of WO2018167104A1 publication Critical patent/WO2018167104A1/en
Priority to MA051997A priority patent/MA51997A/fr
Priority to PCT/EP2019/056248 priority patent/WO2019175216A1/en
Priority to AU2019233581A priority patent/AU2019233581B2/en
Priority to JP2020547332A priority patent/JP7565797B2/ja
Priority to BR112020016499-2A priority patent/BR112020016499A2/pt
Priority to AU2019233576A priority patent/AU2019233576A1/en
Priority to CN201980019247.9A priority patent/CN112020513B/zh
Priority to US16/352,709 priority patent/US10752691B2/en
Priority to US16/979,931 priority patent/US11851494B2/en
Priority to PCT/EP2019/056256 priority patent/WO2019175222A1/en
Priority to CR20200465A priority patent/CR20200465A/es
Priority to US16/979,932 priority patent/US11873341B2/en
Priority to CN201980019257.2A priority patent/CN112218891B/zh
Priority to EP19709955.9A priority patent/EP3765503B1/en
Priority to EP19709956.7A priority patent/EP3765504B1/en
Priority to SG11202008733YA priority patent/SG11202008733YA/en
Priority to CN201980019256.8A priority patent/CN112020516B/zh
Priority to RU2020128108A priority patent/RU2020128108A/ru
Priority to CR20200467A priority patent/CR20200467A/es
Priority to PCT/EP2019/056260 priority patent/WO2019175226A1/en
Priority to MA051992A priority patent/MA51992A/fr
Priority to PCT/EP2019/056247 priority patent/WO2019175215A1/en
Priority to RU2020128081A priority patent/RU2843220C2/ru
Priority to PCT/EP2019/056252 priority patent/WO2019175220A1/en
Priority to PE2020001292A priority patent/PE20210287A1/es
Priority to AU2019233575A priority patent/AU2019233575A1/en
Priority to CN201980019249.8A priority patent/CN112020515B/zh
Priority to JP2020547363A priority patent/JP7451414B2/ja
Priority to JP2020547333A priority patent/JP7510348B2/ja
Priority to TW108108467A priority patent/TW202003034A/zh
Priority to CN201980019235.6A priority patent/CN112041345B/zh
Priority to CR20200466A priority patent/CR20200466A/es
Priority to MX2020008769A priority patent/MX2020008769A/es
Priority to ES19709955T priority patent/ES2992392T3/es
Priority to CA3088246A priority patent/CA3088246A1/en
Priority to CN201980019248.3A priority patent/CN112020514B/zh
Priority to MX2020008768A priority patent/MX2020008768A/es
Priority to BR112020016501-8A priority patent/BR112020016501A2/pt
Priority to KR1020207029221A priority patent/KR102909650B1/ko
Priority to EP19709958.3A priority patent/EP3765506B1/en
Priority to US16/979,930 priority patent/US11814434B2/en
Priority to TW108108452A priority patent/TW201940515A/zh
Priority to JP2020547415A priority patent/JP2021515568A/ja
Priority to US16/979,929 priority patent/US11802161B2/en
Priority to CA3088659A priority patent/CA3088659A1/en
Priority to MX2020008770A priority patent/MX2020008770A/es
Priority to UAA202006342A priority patent/UA129536C2/uk
Priority to US16/979,933 priority patent/US11919960B2/en
Priority to CA3088671A priority patent/CA3088671A1/en
Priority to EP19710416.9A priority patent/EP3765507B1/en
Priority to PE2020001320A priority patent/PE20210289A1/es
Priority to JP2020547371A priority patent/JP7474701B2/ja
Priority to PCT/EP2019/056258 priority patent/WO2019175224A1/en
Priority to TW108108451A priority patent/TW201938588A/zh
Priority to EP19709954.2A priority patent/EP3765502B1/en
Priority to BR112020016519-0A priority patent/BR112020016519A2/pt
Priority to EP19711315.2A priority patent/EP3765511B1/en
Priority to EP19709957.5A priority patent/EP3765505B1/en
Priority to SG11202008784RA priority patent/SG11202008784RA/en
Priority to KR1020207029229A priority patent/KR20200131862A/ko
Priority to SG11202008699WA priority patent/SG11202008699WA/en
Priority to PE2020001299A priority patent/PE20210288A1/es
Priority to PCT/EP2019/056257 priority patent/WO2019175223A1/en
Priority to US16/352,717 priority patent/US10745485B2/en
Priority to JP2020547326A priority patent/JP7563978B2/ja
Priority to JP2020547399A priority patent/JP7451415B2/ja
Priority to EP19711075.2A priority patent/EP3765510A1/en
Priority to PCT/EP2019/056249 priority patent/WO2019175217A1/en
Priority to CN201980019234.1A priority patent/CN112074536B/zh
Priority to MYPI2020004660A priority patent/MY207237A/en
Priority to CN201980019241.1A priority patent/CN112020512B/zh
Priority to US16/979,935 priority patent/US11697688B2/en
Priority to KR1020207029205A priority patent/KR20200131286A/ko
Priority to US16/352,703 priority patent/US10738125B2/en
Priority to JP2020547331A priority patent/JP7563979B2/ja
Priority to ZA2019/04980A priority patent/ZA201904980B/en
Priority to IL269081A priority patent/IL269081B1/en
Anticipated expiration legal-status Critical
Priority to US16/782,461 priority patent/US11787866B2/en
Priority to US16/782,440 priority patent/US11802160B2/en
Priority to CONC2020/0009476A priority patent/CO2020009476A2/es
Priority to CONC2020/0009758A priority patent/CO2020009758A2/es
Priority to CONC2020/0009743A priority patent/CO2020009743A2/es
Priority to IL276995A priority patent/IL276995A/en
Priority to IL276992A priority patent/IL276992A/en
Priority to IL276997A priority patent/IL276997A/en
Priority to CL2020002339A priority patent/CL2020002339A1/es
Priority to CL2020002340A priority patent/CL2020002340A1/es
Priority to CL2020002338A priority patent/CL2020002338A1/es
Priority to PH12020551453A priority patent/PH12020551453A1/en
Priority to PH12020551454A priority patent/PH12020551454A1/en
Priority to PH12020551451A priority patent/PH12020551451A1/en
Priority to CL2021002603A priority patent/CL2021002603A1/es
Priority to ZA2021/08422A priority patent/ZA202108422B/en
Priority to US18/470,875 priority patent/US20240309101A1/en
Priority to JP2024009215A priority patent/JP2024050684A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/55IL-2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention is in the field of cancer immunotherapy, and relates to a method of treating cancer, including a method of treating solid tumours, wherein the method involves the use of an antibody to CD25.
  • Cancer immunotherapy involves the use of a subject's own immune system to treat or prevent cancer.
  • Immunotherapies exploit the fact that cancer cells often have subtly different molecules on their surface that can be detected by the immune system. These molecules, or cancer antigens, are most commonly proteins, but also include molecules such as carbohydrates. Immunotherapy thus involves provocation of the immune system into attacking tumour cells via these target antigens.
  • malignant tumours in particular solid tumours, or haematological cancers can escape immune surveillance by means of various mechanisms both intrinsic to the tumour cell and mediated by components of the tumour
  • Treg cells tumour infiltration by regulatory T cells (Treg cells or Tregs) and, more specifically, an unfavorable balance of effector T cells (Teff) versus Tregs (i.e. a low ratio of Teff to Treg), have been proposed as critical factors (Smyth M et al., 2014, Immunol Cell Biol. 92, 473-4).
  • Tregs have been found to be critical in mediating immune homeostasis and promoting the establishment and maintenance of peripheral tolerance.
  • their role is more complex.
  • cancer cells express both self- and tumour-associated antigens, the presence of Tregs, which seek to dampen effector cell responses, can contribute to tumour progression.
  • the infiltration of Tregs in established tumours therefore represents one of the main obstacles to effective anti-tumour responses and to treatment of cancers in general.
  • Suppression mechanisms employed by Tregs are thought to contribute significantly to the limitation or even failure of current therapies, in particular immunotherapies that rely on induction or potentiation of anti-tumour responses (Onishi H et al, 2012 Anticanc. Res. 32, 997-1003).
  • Tregs Depletion of Tregs as a therapeutic approach for treating cancer is an approach that is supported by studies having shown the contribution of Tregs to tumour establishment and progression in murine models. Moreover, tumour infiltration by Tregs has also been associated with worse prognosis in several human cancers (Shang B et al., 2015, Sci Rep. 5: 15179). It has been demonstrated that Treg cells contribute to the establishment and progression of tumours in murine models and that their absence results in delay of tumour progression (Elpek et al., 2007 J Immunol. 178(1 1 ):6840-8; Golgher et al., 2002; Eur J Immunol. 32(1 1 ):3267-75, Jones et al., 2002 Cancer Immun.
  • CD25 is one of the potential molecular targets for achieving depletion of Tregs.
  • CD25 also known as the interleukin-2 high-affinity receptor alpha chain (IL-2Ra), is constitutively expressed at high-levels on Treg cells, and it is absent or expressed at low-levels on T effector cells and is thus a promising target for Treg depletion.
  • IL-2Ra interleukin-2 high-affinity receptor alpha chain
  • the IL-2/CD25 interaction has been the object of several studies in murine models, most of them involving the use of PC61 , a rat anti-murine CD25 mouse antibody (Setiady Y et al., 2010. Eur J Immunol.
  • Basiliximab and Daclizumab are anti-human CD25 antibodies that inhibit the binding of IL-2 to CD25 and have been developed to reduce activation of T-effector cells.
  • Basiliximab is a chimeric mouse-human CD25 antibody currently approved for graft versus host diseases and Daclizumab is a humanized CD25 antibody approved for the treatment of multiple sclerosis.
  • anti-CD25 antibodies still allow the binding of IL-2 to CD25, such as the clone 7D4 (anti-mouse CD25), clone MA251 (anti-human CD25) or 7G7B6 (anti-human CD25) (Rubin et al, 1985, Hybridoma 4(2) 91-102, Tanaka et al, 1986, Microbiol. Immunol 30(4), 373-388).
  • 7G7B6 has been used as a research antibody and suggested as a target moiety to targeting radionuclide to CD25-expressing lymphomas (Zhang et al, 2009, Cancer Biother Radiopharm 24(3), 303-309).
  • 7D4 is a rat IgM anti-mouse CD25 antibody that has been extensively used to detect CD25- positive cells in the presence of or following the treatment with PC61 or of antibodies having similar binding properties (Onizuka S et al., 1999. Cane Res. 59, 3128 -3133). Very few documents disclose any functional property of 7D4-lgM antibody, alone or in comparison with PC61 (Kohm A et al., 2006, J Immunol. 176: 3301-5; Hallett W et al., 2008. Biol Blood Marrow Transplant 14: 1088-1099; Fecci P et al., 2006 Clin Cancer Res. 12:4294-4305; McNeill A et al., 2007.
  • CD25 is the alpha subunit of the receptor for IL-2 and IL-2 is a key cytokine for Teff responses.
  • the present inventors have now found that such a blockade of IL-2 signalling limits Teff responses and that an anti-CD25 antibody that does not block the IL2 signalling can effectively deplete Treg cells, whilst still allowing IL-2 to stimulate Teff cells, providing antibodies that exhibit a strong anti-cancer effect.
  • the present invention provides anti-CD25 antibodies and uses of anti-CD25 antibodies that are characterized by structural elements that allow both binding CD25 without substantially blocking the binding of Interleukin 2 (IL-2) to CD25 or signalling of IL-2 via CD25, and depleting efficiently Tregs, in particular within tumours.
  • IL-2 Interleukin 2
  • the structural and functional features of 7D4-lgM have been modified in order to provide antibodies that present surprisingly improved features in terms of use for depleting Tregs and efficacy against tumours, alone or in combination with other anti-cancer agents.
  • the present invention provides a method of treating a human subject who has cancer comprising the step of administering an anti-CD25 antibody to a subject, wherein said subject has a tumour (preferably a solid tumour), wherein said antibody does not inhibit the binding of lnterleukin-2 (IL- 2) to CD25.
  • a tumour preferably a solid tumour
  • references to "does not block”, “non-blocking”, “non-IL-2 blocking”, “without blocking” and similar terminology herein include embodiments wherein the anti-CD25 antibody does not block the signalling of IL- 2 via CD25. That is, the anti-CD25 antibody of the invention inhibits less than 50% of IL-2 signalling via CD25 compared to IL-2 signalling in the absence of the antibodies. Preferably the anti-CD25 antibody inhibits less than about 40%, 35%, 30%, preferably less than about 25% of IL-2 signalling compared to IL- 2 signalling in the absence of the antibodies.
  • the anti-CD25 antibody competes with the antibody 7G7B6 for binding to human CD25; and/or competes with the antibody MA251 for binding to human CD25. In one embodiment, the anti-CD25 antibody binds to the same epitope recognised by antibody 7G7B6 and/or binds to the same epitope recognised by antibody MA251.
  • the anti-CD25 antibody specifically binds to an epitope of human CD25 wherein the epitope comprises one or more amino acid residues comprised in one or more of the amino acid stretches selected from amino acids 150-163 of SEQ ID NO:1 (YQCVQGYRALHRGP), amino acids 166- 186 of SEQ ID NO:1 (SVCKMTHGKTRWTQPQLICTG), amino acids 42-56 of SEQ ID NO: 1
  • the epitope comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, at least thirteen, at least fourteen, at least fifteen, at least sixteen, at least seventeen, at least eighteen or more amino acid residues comprised in one of more the amino acid stretches selected from amino acids 150-163 of SEQ ID NO: 1 (YQCVQGYRALHRGP), amino acids 166-186 of SEQ ID NO: 1
  • the anti-CD25 antibody specifically binds to an epitope of human CD25 wherein the epitope comprises at least one sequence selected from: amino acids 150-158 of SEQ ID NO: 1
  • YQCVQGYRA amino acids 176-180 of SEQ ID NO: 1 (RWTQP), amino acids 42-56 of SEQ ID NO: 1 (KEGTMLNCECKRGFR) and amino acids 74-84 of SEQ ID NO: 1 (SSWDNQCQCTS).
  • the anti-CD25 antibody specifically binds to an epitope of human CD25 wherein the epitope comprises at least one sequence selected from amino acids wherein the epitope comprises at least one sequence selected from: amino acids 150-158 of SEQ ID NO: 1 (YQCVQGYRA), amino acids 166-180 of SEQ ID NO: 1 (SVCKMTHGKTRWTQP), amino acids 176-186 of SEQ ID NO:1
  • RWTQPQLICTG amino acids 42-56 of SEQ ID NO:1 (KEGTMLNCECKRGFR) and amino acids 74-84 of SEQ ID NO: 1 (SSWDNQCQCTS).
  • the anti-CD25 antibody specifically binds to an epitope of human CD25 wherein the epitope comprises at least one sequence selected from: amino acids 42-56 of SEQ ID NO: 1
  • KEGTMLNCECKRGFR amino acids 70 to 84 of SEQ ID NO: 1 (NSSHSSWDNQCQCTS) and amino acids 150 to 158 of SEQ ID NO: 1 (YQCVQGYRA
  • the anti-CD25 antibody binds to an epitope comprising the sequence of amino acids 42-56 of SEQ ID NO:1 (KEGTMLNCECKRGFR). In one embodiment the anti-CD25 antibody binds to an epitope comprising the sequence of amino acids 42-56 of SEQ ID NO: 1 (KEGTMLNCECKRGFR) and amino acids 150-160 of SEQ ID NO:1 (YQCVQGYRALH). In another embodiment, the anti-CD25 antibody binds to an epitope comprising the sequence of amino acids 42-56 of SEQ ID NO:1
  • the anti-CD25 antibody binds to an epitope comprising the sequence of amino acids 150- 163 of SEQ ID NO:1 (YQCVQGYRALHRGP), amino acids 166-180 of SEQ ID NO:1 (SVCKMTHGKTRWTQP), amino acids 42-56 of SEQ ID NO: 1 (KEGTMLNCECKRGFR) and amino acids 74-88 of SEQ ID NO: 1 (SSWDNQCQCTSSATR)
  • the anti-CD25 antibody binds to an epitope comprising the sequence of amino acids 176-180 of SEQ ID NO: 1 (RWTQP). In one embodiment, the anti-CD-25 antibody binds to an epitope comprising the sequence of amino acids 166-180 of SEQ ID NO: 1 (SVCKMTHGKTRWTQP). In one embodiment, the anti-CD-25 antibody binds to an epitope comprising the sequence of amino acids 176- 186 of SEQ ID NO: 1 (RWTQPQLICTG).
  • the anti-CD25 antibody specifically binds to an epitope comprising the sequence of amino acids 150-158 of SEQ ID NO: 1 (YQCVQGYRA) and amino acid 176-180 of SEQ ID NO: 1
  • the anti-CD25 antibody specifically binds to an epitope comprising the sequence of amino acids 150-158 of SEQ ID NO: 1 (YQCVQGYRA) and amino acids 176-186 of SEQ ID NO: 1 (RWTQPQLICTG). In one embodiment the anti-CD25 antibody specifically binds to an epitope comprising the sequence of amino acids 150-163 of SEQ ID NO: 1 (YQCVQGYRALHRGP) and amino acids 166-180 of SEQ ID NO: 1 (SVCKMTHGKTRWTQP).
  • the anti-CD25 antibody binds to an epitope comprising the sequence of amino acids 74-84 of SEQ ID NO: 1 (SSWDNQCQCTSSATR). In one embodiment, the anti-CD25 antibody binds to an epitope comprising the sequence of amino acids 70-84 of SEQ ID NO: 1 (NSSHSSWDNQCQCTS).
  • the present inventors having surprisingly found that antibodies that bind to particular epitopes of CD25, including those that compete with 7G7B6 and/or MA251 for binding to CD25, are useful in the treatment of cancer, in particular solid tumours. Such antibodies still permit signalling of IL-2 via the CD25 bound by the antibody, and the inventors have discovered for the first time that in addition to depleting Treg cells, the antibodies used in the present invention allow Teff cells to optimally exert their anti-cancer effects, at least in part by allowing the binding of IL-2 to, and signalling through, CD25 expressed on the Teff cells.
  • Such antibodies preferably have a dissociation constant (Kd) for CD25 of less than 10 -7 M and/or a
  • the antibody has a dissociation constant (K d ) for CD25 in the 10 8 or 10 9 or 10 " 0 or 10 1 or 10 2 or 10 3 range or below.
  • K d dissociation constant
  • it is a human lgG1 antibody that binds to at least one activating Fey receptor with high affinity and depletes tumour-infiltrating regulatory T cells.
  • the anti- CD25 is characterized by other features related to Fey receptors, in particular:
  • the anti-CD25 antibody is preferably a monoclonal antibody, in particular a human, chimeric, or humanized antibody.
  • the antibody may be an affinity matured variant thereof, optionally a humanised or affinity matured variant of 7G7B6 or MA251 .
  • the anti-CD25 antibody may further elicit an enhanced CDC, ADCC and/or ADCP response, preferably an increased ADCC and/or ADCP response, more preferably an increased ADCC response, as compared to existing anti-human CD25 clinical antibodies, Daclizumab and Basiliximab.
  • the anti-CD25 antibody may elicit a decreased CDC response, as compared to existing anti-human CD25 clinical antibodies, Daclizumab and Basiliximab, more preferably the anti-CD25 antibody does not elicit a CDC response.
  • the anti-CD25 antibody of the present invention can be used in methods of treating a human subject wherein said anti-CD25 antibody is administered to a subject.
  • the subject has cancer.
  • the subject has an established, solid tumour (preferably in a method further comprising the step of identifying a subject who has a solid tumour).
  • Such methods may further comprise administering a further therapeutic agent to said subject.
  • the further agent may be an immune checkpoint inhibitor to said subject, for example in the form of an antibody binding and inhibiting an immune checkpoint protein.
  • a preferred immune checkpoint inhibitor is a PD-1 antagonist, which can be an anti-PD-1 antibody or an anti-PD-L1 antibody.
  • an anti-CD25 antibody can be used in methods of depleting regulatory T cells in a solid tumour in a subject comprising the step of administering said anti-CD25 antibody to said subject.
  • the anti-CD25 antibody of the invention can be used for the manufacture of a medicament for the treatment of cancer in a human subject, preferably wherein said subject has a tumour, preferably a solid tumour.
  • Said antibody may be administered in combination with a further therapeutic agent, preferably a further cancer therapeutic agent for example with an immune checkpoint inhibitor, preferably a PD-1/PD-L1 pathway antagonist, a cancer vaccine, and/or used in combination with standard of care therapies such as chemotherapy or radiotherapy.
  • the present invention provides a combination of an anti-CD25 antibody as defined above with another anti-cancer compound (preferably an immune checkpoint inhibitor or other compounds as indicated in the Detailed Description) for use in the treatment of cancer in a human subject, preferably wherein said subject has a solid tumour and the anti-cancer compound (for example, an immune checkpoint inhibitor such a PD-1 antagonist or a cytokine such as Interleukin 2) can be administered simultaneously, separately or sequentially.
  • the present invention also provides a kit for use in the treatment of cancer comprising an anti- CD25 antibody, as defined above, and an anticancer compound (for example, an immune checkpoint inhibitor such a PD-1 antagonist).
  • the present invention also provides a pharmaceutical composition
  • a pharmaceutical composition comprising an anti- CD25 antibody as defined above in a pharmaceutically acceptable medium.
  • Such composition may also comprise an anti-cancer compound (for example, an immune checkpoint inhibitor such a PD-1 antagonist).
  • the present invention also provides a bispecific antibody comprising:
  • the anti-CD25 antibody does not inhibit the binding of lnterleukin-2 (IL-2) to CD25, and preferably the bispecific antibody is an lgG1 antibody that binds to at least one activatory Fey receptor with high affinity and depletes tumour-infiltrating regulatory T cells.
  • the bispecific antibody is an lgG1 antibody that binds to at least one activatory Fey receptor with high affinity and depletes tumour-infiltrating regulatory T cells.
  • such second antigen binding moiety binds to an antigen selected from an immune checkpoint protein, or a tumour-associated antigen, or may be, or be based on, an anti-human activatory Fc Receptor antibody (anti-FcgRI, anti-FcgRlla, anti- FcgRIII), or an antagonistic anti-human FcyRllb antibody.
  • the second antigen binding moiety may bind to FcRllb. It may alternatively bind to FcgRI, FcgRlla, and/or F
  • such bispecific antibody comprises a second antigen binding moiety that binds an immune checkpoint protein that is selected from the group consisting of PD-1 , CTLA-4, BTLA, KIR, LAG 3, VISTA, TIGIT, TIM3, PD-L1 , B7H3, B7H4, PD-L2, CD80, CD86, HVEM, LLT1 , GAL9, GITR, OX40, CD137, and ICOS.
  • Such immune checkpoint protein is preferably expressed on a tumour cell.
  • the immune checkpoint protein is selected from PD-1 , PD-L1 , and CTLA-4.
  • the second antigen binding moiety that binds to an immune checkpoint protein can be comprised in a commercially available antibody that acts as an immune checkpoint inhibitor, for example:
  • the anti-PD-1 antibody in the case of PD-1 , can be Nivolumab or Pembrolizumab.
  • the anti-PD-L1 is Atezolizumab
  • CTLA-4 the anti-CTLA-4 is Ipilimumab.
  • Such bispecific antibody can be provided in any commercially available format, including Duobody, BiTE DART, CrossMab, Knobs-in-holes, Triomab, or other appropriate molecular format of bispecific antibody and fragments thereof.
  • such bispecific antibody comprises a second antigen binding moiety that binds to tumour- associated antigen.
  • antigens and corresponding antibodies include, without limitation CD22 (Blinatumomab), CD20 (Rituximab, Tositumomab), CD56 (Lorvotuzumab), CD66e/CEA (Labetuzumab), CD152/CTLA-4 (Ipilimumab), CD221/IGF1 R (MK-0646), CD326/Epcam (Edrecolomab), CD340/HER2 (Trastuzumab, Pertuzumab), and EGFR (Cetuximab, Panitumumab).
  • the combination of anti-CD25 antibody of the invention with another anti-cancer compound, as well as the bispecific antibodies as defined above, can be used in a method of treating cancer, comprising the step of administering said combination or said bispecific antibody to a subject, in particular when the subject has a solid tumour, and for use in the treatment of cancer in a subject.
  • the present invention provides a method of treating or preventing cancer, in a subject, preferably when the subject has a solid tumour, comprising the step of administering an antibody that binds to CD25 to said subject, whereby the anti-CD25 antibodies are characterized by structural elements that allow both binding CD25 without interfering in interleukin 2 binding or the signalling via CD25 and depleting efficiently Tregs, in particular within tumours.
  • the antibody that binds to CD25 as defined in the present invention can be used in the treatment or prevention of cancer, preferably of a solid tumour.
  • the present invention provides the use of an antibody that binds to CD25 and allow both binding CD25 without interfering in interleukin 2 binding to CD25 and efficient depletion of Tregs for the manufacture of a medicament for the treatment or prevention of cancer, preferably, a solid tumour.
  • the invention also provides the use of an antibody that binds CD25 and that allow both binding CD25 without substantially interfering in interleukin 2 binding to CD25 and depletion of Tregs in the treatment or prevention of cancer, preferably a solid tumour.
  • CD25 can be targeted using an anti-CD25 antibody that does not inhibit (or does not substantially inhibit) the binding of interleukin 2 to CD25 or the signalling of IL-2 via CD25 for depletion of regulatory T cells in the therapeutic context, for example in an established solid tumour.
  • non-IL-2 blocking anti-CD25 antibodies having an isotype that enhances their binding to activatory Fc gamma receptors leads to effective depletion of tumour-infiltrating regulatory T cells while still allowing an optimal Teff response, a therapeutic approach that could, for example, be associated (in combination with or within bispecific antibodies) with other cancer-targeting compounds, such as those targeting an immune checkpoint protein, a tumour- associated antigen, or an inhibitory Fey receptor.
  • CD25 is the alpha chain of the IL-2 receptor, and is found on activated T cells, regulatory T cells, activated B cells, some NK T cells, some thymocytes, myeloid precursors and oligodendrocytes. CD25 associates with CD122 and CD132 to form a heterotrimeric complex that acts as the high-affinity receptor for IL-2.
  • the consensus sequence of human CD25 is shown below in SEQ ID NO: 1 (Uniprot accession number P01589; the extracellular domain of mature human CD25, corresponding to amino acids 22-240, is underlined and is presented as SEQ ID NO:2):
  • an antibody that binds CD25 refers to an antibody that is capable of binding to the
  • CD25 subunit of the IL-2 receptor This subunit is also known as the alpha subunit of the IL-2 receptor.
  • Such an antibody is also referred to herein as an "anti-CD25 antibody”.
  • An anti-CD25 antibody is an antibody capable of specific binding to the CD25 subunit (antigen) of the IL-2 receptor.
  • “Specific binding”, “bind specifically”, and “specifically bind” are understood to mean that the antibody has a dissociation constant (Kd) for the antigen of interest of less than about 10 -6 M, 10 -7 M, 10 -8 M, 10 "9 M, 10 "10 M, 10 "11 M, 10 12 M or 10 13 M.
  • the dissociation constant is less than 10 8 M, for instance in the range of 10 9 M, 10 10 M, 10 11 M, 10 12 M or 10 13 M.
  • antibody refers to both intact immunoglobulin molecules as well as fragments thereof that include the antigen-binding site, and includes polyclonal, monoclonal, genetically engineered and otherwise modified forms of antibodies, including but not limited to chimeric antibodies, humanised antibodies, heteroconjugate and/or multispecific antibodies (e.g., bispecific antibodies, diabodies, tribodies, and tetrabodies), and antigen binding fragments of antibodies, including e.g. Fab', F(ab')2, Fab, Fv, rlgG, polypeptide-Fc fusions, single chain variants (scFv fragments, VHHs, Trans-bodies®,
  • an antibody may lack a covalent modification (e.g., attachment of a glycan) that it would have if produced naturally.
  • an antibody may contain a covalent modification (e.g., attachment of a glycan, a detectable moiety, a therapeutic moiety, a catalytic moiety, or other chemical group providing improved stability or administration of the antibody, such as poly-ethylene glycol).
  • the antibody may be in the form of a masked antibody (e.g. Probodies ®).
  • a masked antibody can comprise a blocking or "mask" peptide that specifically binds to the antigen binding surface of the antibody and interferes with the antibody's antigen binding.
  • the mask peptide is linked to the antibody by a cleavable linker (e.g. by a protease). Selective cleavage of the linker in the desired environment, i.e. in the tumour environment, allows the masking/blocking peptide to dissociate, enabling antigen binding to occur in the tumour, and thereby limiting potential toxicity issues.
  • Antibody may also refer to camelid antibodies (heavy-chain only antibodies) and antibody-like molecules such as anticalins (Skerra (2008) FEBS J 275, 2677-83).
  • an antibody is polyclonal or oligoclonal, that is generated as a panel of antibodies, each associated to a single antibody sequence and binding more or less distinct epitopes within an antigen (such as different epitopes within human CD25 extracellular domain that are associated to different reference anti-human CD25 antibodies).
  • Polyclonal or oligoclonal antibodies can be provided in a single preparation for medical uses as described in the literature (Kearns JD et al., 2015. Mol Cancer Ther. 14: 1625-36).
  • the antibody is monoclonal.
  • the antibody may additionally or alternatively be humanised or human.
  • the antibody is human, or in any case an antibody that has a format and features allowing its use and administration in human subjects.
  • the antibodies may be humanised variants of affinity matured 7G7B6 or MA251.
  • the affinity matured antibody has at least 10% higher affinity to CD25 and/or the CDR sequences are at least 80% identical, preferably 90% identical to the CDRs of the parental sequence (across all sequences).
  • An affinity matured antibodies is an antibody with one of more altered amino acids in one or more CDRs which results in an antibody with improved affinity for CD25 compared to the parental strain not having the altered amino acids.
  • Antibodies (Abs) and immunoglobulins (Igs) are glycoproteins having the same structural characteristics.
  • Immunoglobulins may be from any class such as IgA, IgD, IgG, IgE or IgM.
  • Immunoglobulins can be of any subclass such as IgGi , lgG2, lgG3, or lgG4.
  • the anti-CD25 antibody is from the IgG class, preferably the lgG1 subclass.
  • the anti-CD25 antibody is from the human lgG1 subclass.
  • the anti-CD25 antibody is from the human lgG2 subclass.
  • the Fc region of IgG antibodies interacts with several cellular Fey receptors (FcyR) to stimulate and regulate downstream effector mechanisms.
  • FeyR Fey receptors
  • FcyRI CD64
  • FcyRlla CD32a
  • FcyRllc CD32c
  • FcyRllla CD16a
  • FcyRlllb CD16b
  • CD32b inhibitory receptor FcyRllb
  • IgG subclasses vary in their ability to bind to FcyR and this differential binding determines their ability to elicit a range of functional responses.
  • FcyRllla is the major receptor involved in the activation of antibody-dependent cell-mediated cytotoxicity (ADCC) and lgG3 followed closely by lgG1 display the highest affinities for this receptor, reflecting their ability to potently induce ADCC.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • lgG2 have been shown to have weak binding for this receptor anti-CD25 antibody having the human lgG2 isotype have also been found to efficiently deplete Tregs.
  • the antibody binds FcyR with high affinity, preferably an activating receptor with high affinity.
  • the antibody binds FcyRI and/or FcyRlla and/or FcyRllla with high affinity.
  • the antibody binds to at least one activatory Fey receptor with a dissociation constant of less than about 10 "6 ⁇ , 10 "7 M, 10 "8 ⁇ , 10 "9 M or 10- 0 M.
  • the antibody is an lgG1 antibody, preferably a human lgG1 antibody, which is capable of binding to at least one Fc activating receptor.
  • the antibody may bind to one or more receptor selected from FcyRI, FcyRlla, FcyRllc, FcyRllla and FcyRlllb.
  • the antibody is capable of binding to FcyRl lla.
  • the antibody is capable of binding to FcyRllla and FcyRlla and optionally FcyRI.
  • the antibody is capable of binding to these receptors with high affinity, for example with a dissociation constant of less than about 10 7 M, 10 8 M, 10 9 M or 10 " 0 M.
  • the antibody binds an inhibitory receptor, FcyRllb, with low affinity. In one aspect, the antibody binds FcyRllb with a dissociation constant higher than about 10 ⁇ 7 M, higher than about 10 ⁇ 6 M or higher than about 10 5 M.
  • the anti-CD25 antibody is from the lgG1 subclass and preferably has ADCC and/or ADCP activity, as discussed herein, in particular with respect to cells of human origin.
  • the mlgG2a isotype (which corresponds human lgG1 isotype) binds to all FcyR subtypes with a high activatory to inhibitory ratio (A/I), that is at least superior to 1.
  • rlgG1 isotype bind with a similar affinity to a single activatory FcyR only (FCYRI I I), as well as the inhibitory FcyRllb, resulting in a low A/I ratio ( ⁇ 1 ).
  • This lower A/I ratio can correlate with a lower in intra-tumoral Treg depletion and lower anti-tumour therapeutic activity of the isotype.
  • FcyR binding profile for antibodies of the human lgG2 isotype significant Treg depletion can also be achieved with human lgG2 isotype of an anti-CD25 antibody. Therefore in one embodiment the anti-CD25 antibody is from the lgG2 subclass
  • the anti-CD25 antibody as described herein binds human CD25, preferably with high affinity. Still preferably, the anti-CD25 antibody binds to the extracellular region of human CD25, as shown above.
  • the invention provides an anti-CD25 antibody as described herein.
  • the Examples provide experimental data generated with the antibody that is secreted by the 7D4 hybridoma. As indicated in the Background of the Invention, this antibody is specific for mouse CD25 which, as shown by comparing panel of monoclonal antibodies (including PC61 ), binds to one of the three epitopes within mouse CD25 that is distinct from the IL-2 binding site and does not block binding of IL-2 to CD25.
  • 7D4 has been shown to bind mouse CD25 at an epitope comprising amino acid 184 to 194 (REHHRFLASEE) in [Uniprot sequence P01590]).
  • the assays involving 7D4 and mouse CD25 in the literature for example Setiady Y et al., 2010. Eur. J. Immunol. 40: 780-6; McNeill A et al.,2007.
  • the antibodies compete with the antibody 7G7B6 for binding to human CD25; and/or binds to the same epitope or epitopes recognised by antibody 7G7B6.
  • 7G7B6 is a monoclonal antibody having a mouse lgG2a isotype that recognises human CD25.
  • 7G7B6 comprises a variable heavy chain region having the sequence:
  • variable light chain region having the sequence: QIVLSQSPAILSASPGERVTMTCRASSSVSFMHWLQQKPGSSPKPWIYATSNLASGVSARFSGS
  • the antibody comprises a heavy chain comprising the amino acid sequence
  • variable heavy chain CDR1 variable heavy chain CDR1 ; the amino acid sequence
  • GVTSSGGSAYYADSV (SEQ ID NO:8) as variable heavy chain CDR2, the amino acid sequence DRYVYTGGYLYHYGMDL (SEQ ID NO:9) as variable heavy chain CDR3, and comprises a light chain comprising the amino acid sequence RASQSISDYLA (SEQ ID NO:1 1 ) as variable light chain CDR1 ; the amino acid sequence YAASTLPF (SEQ ID NO: 12) as variable light chain CDR2, the amino acid sequence QGTYDSSDWYWA (SEQ ID NO:13) as variable light chain CDR3.
  • the antibody may compete with 7G7B6 for binding to human CD25.
  • the antibody comprises a heavy chain comprising a variable heavy chain region comprising the sequence:
  • variable light chain region comprising the sequence:
  • the antibody comprises a heavy chain comprising the amino acid sequence SGFSVDIYDMS (SEQ ID NO:15) as variable heavy chain CDR1 ; the amino acid sequence
  • YISSSLGATYYADSV (SEQ ID NO:16) as variable heavy chain CDR2, the amino acid sequence ERIYSVYTLDYYAMDL (SEQ ID NO:17) as variable heavy chain CDR3, and comprise a light chain comprising the amino acid sequence QASQGITNNLN (SEQ ID NO:19) as variable light chain CDR1 ; the amino acid sequence YAASTLQS (SEQ ID NO:20) as variable light chain CDR2, the amino acid sequence QQGYTTSNVDNA (SEQ ID NO:21 ) as variable light chain CDR3.
  • the antibody may compete with 7G7B6 for binding to human CD25.
  • the antibody comprises a heavy chain comprising a variable heavy chain region comprising the sequence:
  • the antibody that may compete with 7G7B6 for binding to human CD25 comprises a heavy chain comprising the amino acid sequence of: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLELVSTINGYGDTTYYPDS VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRDYGNSYYYALDYWGQGTLVTVSS
  • the antibodies compete with the antibody MA251 for binding to human CD25; and/or bind to the same epitope or epitopes recognised by antibody MA251.
  • MA251 is a monoclonal antibody having a mouse isotype that recognises human CD25.
  • MA251 comprises a variable heavy chain region having the sequence:
  • variable light chain region having the sequence:
  • the antibody that may compete with MA251 for binding to human CD25 comprises a heavy chain comprising a variable heavy chain region comprising the amino acid sequence of:
  • the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 23 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 25. In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 23 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 26. In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 24 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 25; In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 24 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 26.
  • the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:27 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30. In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 27 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 31. In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 27 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 32. In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 27 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 33.
  • the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 28 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30. In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 28 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 31. In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 28 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 32. In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 28 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 33.
  • the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 29 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30. In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:29 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 31. In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:29 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 32. In another embodiment the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:29 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 33. In one aspect, the antibodies compete with both the antibody 7G7B6 and the antibody MA251 for binding to human CD25. In one aspect, the antibodies bind to the same epitope or epitopes recognised by 7G7B6 and recognised by MA251.
  • competition between the 7G7B6 antibody or MA251 antibody and a further antibody can be measured for example as discussed in the Examples and known in the art.
  • competition between two antibodies, such as 7G7B6 or MA251 and a further antibody is determined by adding the further antibody to an assay and measuring the interaction between the 7G7B6 or MA251 antibody and human CD25.
  • One such assay is an Octet based assay into which the simultaneous binding of the 7G7B6 or MA251 antibody, the further antibody and recombinant human CD25 is determined. If binding of the 2 antibodies to recombinant human CD25 is detected, the antibodies are non-competing.
  • one such assay is an enzyme linked immunosorbent assay (ELISA) into which the binding of the 7G7B6 or MA251 antibodies to recombinant human CD25 is detected. If the observed signal decreases upon addition of the further antibody (for example decreases by at least 75%), the latter antibody is a competitor for the 7G7B6 or MA251 antibodies.
  • the simultaneous binding of the 7G7B6 or MA251 antibodies and the further antibody to human CD25 expressing cells can also be detected using flow cytometry.
  • the invention provides an anti-CD25 antibody that specifically binds to an epitope of human CD25, wherein the epitope comprises one or more amino acid residues from one or more of the amino acid stretches selected from amino acids 150-163 of SEQ ID NO: 1 ( YQCVQG YRALH RG P) , amino acids 166-186 of SEQ ID NO: 1 (SVCKMTHGKTRWTQPQLICTG), amino acids 42-56 of SEQ ID NO: 1
  • the epitope comprises at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine or more residues from the selected amino acids stretches. More preferably the epitope comprises a sequence selected from: amino acids 150-158 of SEQ ID NO: 1 (YQCVQGYRA), amino acids 176-180 of SEQ ID NO: 1 (RWTQP), amino acids 42-56 of SEQ ID NO: 1 (KEGTMLNCECKRGFR) and amino acids 74-84 of SEQ ID NO: 1 (SSWDNQCQCTS) and combinations thereof.
  • These epitopes are distinct from the IL-2 binding site in human CD25 and antibodies binding to such an epitope, as described in the Examples, do not block the binding of IL-2 to CD25.
  • the method of treating a human subject who has a cancer comprises the step of administering an anti-CD25 antibody of the invention to a subject, wherein said subject preferably has a solid tumour, and wherein the anti-CD25 antibody preferably a human lgG1 antibody that does not inhibit the binding of interleukin 2 to CD25 and that binds to at least one activating Fey receptor selected from FcyRI (CD64), FcyRllc (CD32c), and FcyRllla (CD16a) with high affinity, and depletes tumour- infiltrating regulatory T cells depletes tumour-infiltrating regulatory T cells.
  • FcyRI CD64
  • FcyRllc CD32c
  • FcyRllla CD16a
  • the anti-CD25 antibody has a dissociation constant (Kd) for CD25 of less than 10 -7 M, preferably less than 10 _8 M. More preferably, the anti-CD25 antibody binds human CD25 providing effects on IL-2 binding and Treg depletion similar to those on of 7D4 on mouse CD25 or of 7G7B6 and MA251 on human CD25.
  • Kd dissociation constant
  • the anti-CD25 antibody binds to Fey receptors with an activatory to inhibitory ratio (A/I) superior to 1 and/or binds to FCYRI (CD64), FCYRI IC (CD32C), FcYRIIIa (CD16a) and/or FcYRIIa (CD32a) with higher affinity than it binds to FCYRI lb (CD32b).
  • A/I activatory to inhibitory ratio
  • the CD25 binding domain of 7D4 antibody has been cloned and expressed as a recombinant protein in fusion with an appropriate constant region.
  • the sequence of the CD25 binding domain of 7D4 antibody, as well its specificity for distinct epitopes within the extracellular domain of CD25 and/or its other functional activities, can be used for comparing candidate anti-CD25 antibodies that are generated and screened by any appropriate technique (e.g. by raising panels of hybridomas from CD25-immunized rodents or generating libraries of recombinant antibodies and then screening these antibody repertoires with CD25 fragments for characterizing functionally as described herein).
  • the anti-CD25 antibodies that are consequently identified can be produced also as recombinant antibodies, in particular as full antibodies or as fragments or variants that are described herein.
  • Native antibodies and immunoglobulins are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each heavy chain has at the amino terminus a variable domain (VH) followed by a number of constant domains. Each light chain has a variable domain at the amino terminus (VL) and a constant domain at the carboxy terminus.
  • variable regions are capable of interacting with a structurally complementary antigenic target and are characterized by differences in amino acid sequence from antibodies of different antigenic specificity.
  • the variable regions of either H or L chains contain the amino acid sequences capable of specifically binding to antigenic targets. Within these sequences are smaller sequences dubbed “hypervariable” because of their extreme variability between antibodies of differing specificity. Such hypervariable regions are also referred to as “complementarity determining regions" or "CDR" regions.
  • CDR regions account for the basic specificity of the antibody for a particular antigenic determinant structure.
  • the CDRs represent non-contiguous stretches of amino acids within the variable regions but, regardless of species, the positional locations of these critical amino acid sequences within the variable heavy and light chain regions have been found to have similar locations within the amino acid sequences of the variable chains.
  • the variable heavy and light chains of all antibodies each have 3 CDR regions, each non-contiguous with the others (termed L1 , L2, L3, H1 , H2, H3) for the respective light (L) and heavy (H) chains.
  • the accepted CDR regions have been described previously (Kabat ef a/. , 1977. J Biol Chem 252, 6609-6616).
  • the antibodies of the present invention may function through complement-dependent cytotoxicity (CDC) and/or antibody-dependent cell-mediated cytotoxicity (ADCC) and/or antibody-dependent cell-mediated phagocytosis (ADCP), as well as any other mechanism that allows targeting, blocking proliferation, and/or depleting Treg cells.
  • CDC complement-dependent cytotoxicity
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • ADCP antibody-dependent cell-mediated phagocytosis
  • Complement-dependent cytotoxicity refers to lysis of antigen-expressing cells by an antibody of the invention in the presence of complement.
  • Antibody-dependent cell-mediated cytotoxicity refers to a cell-mediated reaction in which nonspecific cytotoxic cells that express Fc receptors (FcRs) (e.g. Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and thereby lead to lysis of the target cell.
  • FcRs Fc receptors
  • NK Natural Killer
  • ADCP antibody-dependent cell-mediated phagocytosis
  • phagocytes such as macrophages
  • FcRs Fc receptors
  • CDC, ADCC and ADCP can be measured using assays that are known and available in the art (Clynes ef a/. (1998) Proc Natl Acad Sci USA 95, 652-6), and as discussed in the examples.
  • the constant region of an antibody is important in the ability of an antibody to fix complement and mediate cell-dependent cytotoxicity and phagocytosis.
  • the isotype of an antibody may be selected on the basis of whether it is desirable for the antibody to mediate cytotoxicity/phagocytosis.
  • an anti-CD25 antibody that does not inhibit the binding of interleukin 2 and that leads to the depletion of Treg cells is used.
  • an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25 and elicits a strong CDC response and/or a strong ADCC and/or a strong ADCP response may be used.
  • Methods to increase CDC, ADCC and/or ADCP are known in the art.
  • CDC response may be increased with mutations in the antibody that increase the affinity of C1 q binding (Idusogie ef a/. (2001 ) J Immunol 166, 2571-5).
  • references herein to "does not inhibit the binding of lnterleukin-2 to CD25" may alternatively be expressed as the anti-CD25 antibody is a non-IL-2 blocking antibody or a "non-blocking" antibody (with respect to the non-blocking of IL-2 binding to CD25 in the presence of the anti-CD25 antibody), i.e. the antibody does not block the binding of lnterleukin-2 to CD25 and in particular does not inhibit lnterleukin-2 signalling in CD25-expressing cells.
  • references to "non-blocking" “non-IL2 blocking”, “does not block”, or “without blocking” and the like include embodiments wherein the anti-CD25 antibody of the invention does not block the signalling of IL-2 via CD25. That is the anti-CD25 antibody inhibits less than 50% of IL-2 signalling compared to IL-2 signalling in the absence of the antibodies. In particular embodiments of the invention as described herein, the anti-CD25 antibody inhibits less than about 40%, 35%, 30%, preferably less than about 25% of IL-2 signalling compared to IL-2 signalling in the absence of the antibodies.
  • Anti-CD25 non-IL-2 blocking antibodies allow binding to CD25 without interfering with IL-2 binding to CD25, or without substantially interfering with IL-2 binding to CD25.
  • References herein to a non-IL-2 blocking antibody may alternatively be expressed as an anti-CD25 antibody that "does not inhibit the binding of lnterleukin-2 to CD25" or as an anti-CD25 antibody that "does not inhibit the signalling of IL- 2".
  • Some anti-CD25 antibodies may allow binding of IL-2 to CD25, but still block signalling via the CD25 receptor. Such anti-CD25 antibodies are not within the scope of the present invention. Instead, the non- IL-2 blocking anti-CD25 antibodies allow binding of IL-2 to CD25 to facilitate at least 50% of the level of signalling via the CD25 receptor compared to the signalling in the absence of the anti-CD25 antibody.
  • IL-2 signalling via CD25 may be measured by methods as discussed in the Examples and as known in the art. Comparison of IL-2 signalling in the presence and absence of the anti-CD25 antibody agent can occur under the same or substantially the same conditions.
  • IL-2 signalling can be determined by measuring by the levels of phosphorylated STAT5 protein in cells, using a standard Stat-5 phosphorylation assay.
  • a Stat-5 phosphorylation assay For example a Stat-5
  • phosphorylation assay to measure IL-2 signalling may involve culturing PMBC cells in the presence of the anti-CD25 antibody at a concentration of 10ug/ml for 30 mins and then adding varying concentrations of IL-2 (for example 10U/ml or vary concentrations of 0.25U/ml, 0.74U/ml, 2.22U/ml, 6.66U/ml or 20U/ml) for 10 mins. Cells may then be permeabilized and levels of STAT5 protein can then be measured with a fluorescent labelled antibody to a phosphorylated STAT5 peptide analysed by flow cytometry.
  • ADCC may be increased by methods that eliminate the fucose moiety from the antibody glycan, such as by production of the antibody in a YB2/0 cell line, or though the introduction of specific mutations on the Fc portion of human lgG1 (e.g., S298A/E333A/K334A, S239D/I332E/A330L,
  • ADCP may also be increased by the introduction of specific mutations on the Fc portion of human lgG1 (Richards ef al. (2008) Mol Cancer Ther 7, 2517-27).
  • the antibody is optimised to elicit an ADCC response, that is to say the ADCC response is enhanced, increased or improved relative to other anti-CD25 antibodies, including those that do not inhibit the binding of interleukin 2 to CD25 and, for example unmodified anti-CD25 monoclonal antibodies.
  • the antibody is optimised to elicit an ADCP response, that is to say the ADCP response is enhanced, increased or improved relative to other anti-CD25 antibodies, including those that do not inhibit the binding of interleukin 2 to CD25 and, for example unmodified anti-CD25 monoclonal antibodies.
  • a "chimeric antibody” can refer to an antibody having variable sequences derived from an immunoglobulin from one species, such as rat or mouse antibody, and immunoglobulin constant regions from another species, such as from a human antibody.
  • the chimeric antibody may have a constant region which is enhanced for inducing ADCC.
  • the antibodies according to the invention may also be partly or wholly synthetic, wherein at least part of the polypeptide chains of the antibodies are synthesized and, possibly, optimized for binding to their cognate antigen.
  • Such antibodies may be chimeric or humanised antibodies and may be fully tetrameric in structure, or may be dimeric and comprise only a single heavy and a single light chain.
  • Antibodies of the present invention may also be monoclonal antibodies.
  • “monoclonal antibody” is not limited to antibodies produced through hybridoma technology.
  • the term “monoclonal antibody” refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
  • Antibodies of the present invention may also be human antibodies.
  • "human antibody” refers to antibodies having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
  • the human antibodies of the invention may include amino acid residues not encoded by human germline
  • immunoglobulin sequences e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo.
  • an anti-CD25 antibody presenting the features as described herein represents a further object of the invention.
  • the anti-CD25 antibody can be used in medicine.
  • the invention provides a method for treating a disease in a subject comprising administering an anti-CD25 antibody that does not inhibit the binding of lnterleukin-2 (IL-2) to CD25 or signalling of IL-2 via CD25.
  • IL-2 lnterleukin-2
  • the disease is a cancer, in particular for the treatment of solid tumours.
  • the present invention provides nucleic acid molecules encoding anti-CD25 antibodies as defined herein.
  • such provided nucleic acid molecules may contain codon-optimized nucleic acid sequences, and/or may be included in expression cassettes within appropriate nucleic acid vectors for the expression in host cells such as, for example, bacterial, yeast, insect, piscine, murine, simian, or human cells.
  • host cells comprising heterologous nucleic acid molecules (e.g. DNA vectors) that express the desired antibody.
  • the present invention provides methods of preparing an isolated anti-CD25 antibody as defined above.
  • such methods may comprise culturing a host cell that comprises nucleic acids (e.g., heterologous nucleic acids that may comprise and/or be delivered to the host cell via vectors).
  • nucleic acids e.g., heterologous nucleic acids that may comprise and/or be delivered to the host cell via vectors.
  • the host cell (and/or the heterologous nucleic acid sequences) is/are arranged and constructed so that the antibody or antigen-binding fragment or variant thereof is secreted from the host cell and isolated from cell culture supernatants.
  • the antibodies of the present invention may be monospecific, bispecific, or multispecific.
  • Multispecific antibodies may be specific for different epitopes of one target antigen or polypeptide, or may contain antigen-binding domains specific for more than one target antigen or polypeptide (Kufer ef al. (2004) Trends Biotechnol 22, 238-44).
  • the antibody is a monospecific antibody.
  • the antibody is a bispecific antibody.
  • bispecific antibody refers to an antibody having the capacity to bind to two distinct epitopes either on a single antigen or polypeptide, or on two different antigens or polypeptides.
  • Bispecific antibodies of the present invention as discussed herein can be produced via biological methods, such as somatic hybridization; or genetic methods, such as the expression of a non-native DNA sequence encoding the desired antibody structure in cell line or in an organism; chemical methods (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise to one or more molecular entities such as another antibody or antibody fragment); or a combination thereof.
  • epitopes refers to a site on an antigen to which an antibody binds.
  • epitopes can be formed both from contiguous amino acids (linear epitope) or non-contiguous amino acids juxtaposed by tertiary folding of a protein (conformational epitopes). Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation.
  • Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-D nuclear magnetic resonance. See, for example, Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed (1996).
  • an antibody of the invention may recognise a conformational epitope to which the antibodies 7G7B6 or MA251 bind.
  • the conformational epitope comprises at least two sequences selected from amino acids 150-158 of SEQ ID NO:1 (YQCVQGYRA), amino acids 176-180 of SEQ ID NO: 1 (RWTQP), amino acids 42-56 of SEQ ID NO:1 (KEGTMLNCECKRGFR) and amino acids 74-84 of SEQ ID NO:1 (SSWDNQCQCTS).
  • the anti-CD25 antibody can be included in an agent that further comprises a conjugated payload such as a therapeutic or diagnostic agent, in particular for cancer therapy or diagnosis.
  • a conjugated payload such as a therapeutic or diagnostic agent, in particular for cancer therapy or diagnosis.
  • Anti-CD25 antibody conjugates with radionuclides or toxins may be used. Examples of commonly used radionuclides are, for example, 90 Y, 3 1, and 67 Cu, among others, and examples of commonly used toxins are doxorubicin and calicheamicin.
  • the anti-CD25 antibody may be modified to have an altered half-life. Methods for achieving an altered half-life are known in the art.
  • the anti-CD25 antibody is not conjugated to another therapeutic or diagnostic agent.
  • the anti-CD25 antibody is not conjugated to a radionuclide, i.e. in some embodiments the anti-CD25 antibody is not radiolabeled.
  • the subject of any of the aspects of the invention as described herein is a mammal, preferably a cat, dog, horse, donkey, sheep, pig, goat, cow, hamster, mouse, rat, rabbit or guinea pig, but most preferably the subject is a human.
  • the subject is preferably a human.
  • cancer cancer
  • cancer cancer
  • cancer cancer
  • cancer cancer
  • cancer cancer
  • cancer cancer
  • cancer cancer
  • cancer cancer
  • cancer cancer
  • cancer examples include but are not limited to, carcinoma, lymphoma, leukemia, blastoma, and sarcoma. More particular examples of such cancers include squamous cell carcinoma, myeloma, small- cell lung cancer, non-small cell lung cancer, glioma, hepatocellular carcinoma (HCC), hodgkin's lymphoma, non- hodgkin's lymphoma, acute myeloid leukemia (AML), multiple myeloma, gastrointestinal (tract) cancer, renal cancer, ovarian cancer, liver cancer, lymphoblastic leukemia, lymphocytic leukemia, colorectal cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, melanoma, chondrosarcoma, neuroblastoma, pancreatic cancer, glioblastoma multiforme, cervical cancer, brain cancer, stomach cancer, bladder cancer, hepatoma, breast cancer, colon carcinoma, and head and neck cancer.
  • HCC
  • the cancer involves a solid tumour.
  • solid tumours are sarcomas (including cancers arising from transformed cells of mesenchymal origin in tissues such as cancellous bone, cartilage, fat, muscle, vascular, hematopoietic, or fibrous connective tissues), carcinomas (including tumours arising from epithelial cells), mesothelioma, neuroblastoma, retinoblastoma, etc.
  • Cancers involving solid tumours include, without limitations, brain cancer, lung cancer, stomach cancer, duodenal cancer, esophagus cancer, breast cancer, colon and rectal cancer, renal cancer, bladder cancer, kidney cancer, pancreatic cancer, prostate cancer, ovarian cancer, melanoma, mouth cancer, sarcoma, eye cancer, thyroid cancer, urethral cancer, vaginal cancer, neck cancer, lymphoma, and the like.
  • the cancers involve CD25 expressing tumours, including but not limited to lymphomas, such as Hodgkin lymphomas, and lymphocytic leukemias, such as chronic lymphocytic leukemia (CLL).
  • lymphomas such as Hodgkin lymphomas
  • lymphocytic leukemias such as chronic lymphocytic leukemia (CLL).
  • CLL chronic lymphocytic leukemia
  • the cancer is identified by the presence of specific tumor-relevant markers and antigens such as CD20, HER2, PD-1 , PD-L1 , SLAM7F, CD47, CD137, CD134, TIM3, CD25, GITR, CD25, EGFR, etc or is a cancer that has been identified as having a biomarker referred to as microsatellite instability-high (MSI-H) or mismatch repair deficient (dMMR).
  • MSI-H microsatellite instability-high
  • dMMR mismatch repair deficient
  • the antibodies can be used when the identification of the specific tumour-relevant marker, antigen, or biomarkers has been used in defining pre-cancerous, non-invasive states of the above cancers in a patient, such as cancer in-situ, smouldering myeloma, monoclonal gammopathy of undetermined significance, cervical intra-epithelial neoplasia, MALTomas/GALTomes and various lymphoproliferative disorders.
  • the subject being treated has a solid tumor.
  • the cancer is selected from melanoma, non-small cell lung cancer, renal cancer, ovarian cancer, bladder cancer, sarcoma and colon cancer.
  • the cancer is selected from melanoma, ovarian, non-small cell lung cancer and renal cancer.
  • the cancer is not melanoma, ovarian cancer, or breast cancer.
  • the cancer is sarcoma, colon, melanoma or colorectal cancer, or more generally any human cancer for which the 4T1 , MCA205, B16, CT26 or MC38 cell line may represent preclinical models for validating compounds as being useful for their therapeutic management.
  • tumor refers to a malignant or potentially malignant neoplasm or tissue mass of any size, and includes primary tumours and secondary neoplasms.
  • cancer malignancy
  • neoplasm neoplasm
  • tumor tumor cells
  • cancer malignancy
  • neoplasm tumor cells
  • tumor cells of interest for detection or treatment include precancerous (e.g., benign), malignant, pre-metastatic, metastatic, and non-metastatic cells.
  • precancerous e.g., benign
  • malignant pre-metastatic, metastatic, and non-metastatic cells.
  • the teachings of the present disclosure may be relevant to any and all cancers.
  • solid tumours are an abnormal growth or mass of tissue that usually does not contain cysts or liquid areas, in particular, tumours and/or metastasis (wherever located) other than leukaemia or non-solid lymphatic cancers. Solid tumours may be benign or malignant. Different types of solid tumours are named for the type of cells that form them and/or the tissue or organ in which they are located.
  • solid tumours examples include sarcomas (including cancers arising from
  • transformed cells of mesenchymal origin in tissues such as cancellous bone, cartilage, fat, muscle, vascular, hematopoietic, or fibrous connective tissues), carcinomas (including tumours arising from epithelial cells), melanomas, lymphomas, mesothelioma, neuroblastoma, and retinoblastoma.
  • cancers in accordance with the present invention include those characterized by the presence of a solid tumour, that is to say the subject does not have a non-solid tumour.
  • the cancer is a solid tumour, i.e. that the subject has a solid tumour (and does not have a non-solid tumour).
  • Reference to "treat” or “treating” a cancer as used herein defines the achievement of at least one positive therapeutic effect, such as for example, reduced number of cancer cells, reduced tumour size, reduced rate of cancer cell infiltration into peripheral organs, or reduced rate of tumour metastasis or tumour growth.
  • T/C ⁇ 42% is the minimum level of anti-tumour activity.
  • the treatment achieved by a therapeutically effective amount is any of progression free survival (PFS), disease free survival (DFS) or overall survival (OS).
  • PFS also referred to as "Time to Tumour Progression” indicates the length of time during and after treatment that the cancer does not grow, and includes the amount of time patients have experienced a complete response or a partial response, as well as the amount of time patients have experienced stable disease.
  • DFS refers to the length of time during and after treatment that the patient remains free of disease.
  • OS refers to a prolongation in life expectancy as compared to naive or untreated individuals or patients.
  • prevention refers to delaying or preventing the onset of the symptoms of the cancer. Prevention may be absolute (such that no disease occurs) or may be effective only in some individuals or for a limited amount of time.
  • the subject has an established tumour, that is the subject already has a tumour, e.g. that is classified as a solid tumour.
  • the invention as described herein can be used when the subject already has a tumour, such as a solid tumour.
  • the invention provides a therapeutic option that can be used to treat an existing tumour.
  • the subject has an existing solid tumour.
  • the invention may be used as a prevention, or preferably as a treatment in subjects who already have a solid tumour. In one aspect the invention is not used as a preventative or prophylaxis.
  • tumour regression may be enhanced, tumour growth may be impaired or reduced, and/or survival time may be enhanced using the invention as described herein, for example compared with other cancer treatments (for example standard-of care treatments for the a given cancer).
  • the method of treating or preventing cancer as described herein further comprises the step of identifying a subject who has cancer, preferably identifying a subject who has a tumour such as a solid tumour.
  • the method can include identifying a subject who has a haematological cancer.
  • the dosage regimen of a therapy described herein that is effective to treat a cancer patient may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the therapy to elicit an anti-cancer response in the subject. Selection of an appropriate dosage will be within the capability of one skilled in the art. For example 0.01 , 0.1 , 0.3, 0.5, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, or 50 mg/kg. In some embodiments, such quantity is a unit dosage amount (or a whole fraction thereof) appropriate for administration in accordance with a dosing regimen that has been determined to correlate with a desired or beneficial outcome when administered to a relevant population (i.e., with a therapeutic dosing regimen).
  • the antibody according to any aspect of the invention as described herein may be in the form of a
  • compositions which additionally comprises a pharmaceutically acceptable carrier, diluent or excipient.
  • a pharmaceutically acceptable carrier e.g., injectable and infusible solutions
  • dispersions or suspensions e.g., dispersions or suspensions, tablets, pills, or liposomes.
  • a preferred form may depend on the intended mode of
  • compositions containing the antibody can be administered by any appropriate method known in the art, including, without limitation, oral, mucosal, by-inhalation, topical, buccal, nasal, rectal, or parenteral (e.g. intravenous, infusion, intratumoural, intranodal, subcutaneous, intraperitoneal, intramuscular, intradermal, transdermal, or other kinds of administration involving physical breaching of a tissue of a subject and administration of the
  • Such a formulation may, for example, be in a form of an injectable or infusible solution that is suitable for intradermal, intratumoural or subcutaneous administration, or for intravenous infusion.
  • the administration may involve intermittent dosing.
  • administration may involve continuous dosing (e.g., perfusion) for at least a selected period of time, simultaneously or between the administration of other compounds.
  • the antibody can be prepared with carriers that protect it against rapid release and/or degradation, such as a controlled release formulation, such as implants, transdermal patches, and microencapsulated delivery systems.
  • a controlled release formulation such as implants, transdermal patches, and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used.
  • route of delivery e.g., oral vs intravenous vs subcutaneous vs intratumoural, etc
  • dose amount may impact route of delivery.
  • route of delivery e.g., oral vs intravenous vs subcutaneous vs intratumoural, etc
  • required dose amount may impact route of delivery.
  • focused delivery e.g., in this example, intratumoural delivery
  • intratumoural delivery may be desired and/or useful.
  • Other factors to be considered when optimizing routes and/or dosing schedule for a given therapeutic regimen may include, for example, the particular cancer being treated (e.g., type, stage, location, etc.), the clinical condition of a subject (e.g., age, overall health, etc.), the presence or absence of combination therapy, and other factors known to medical practitioners.
  • compositions typically should be sterile and stable under the conditions of
  • composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
  • Sterile injectable solutions can be prepared by incorporating the antibody in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable formulations as discussed herein.
  • Sterile injectable formulations may be prepared using a non-toxic parenterally acceptable diluent or solvent.
  • compositions for use in accordance with the present invention may include pharmaceutically acceptable dispersing agents, wetting agents, suspending agents, isotonic agents, coatings, antibacterial and antifungal agents, carriers, excipients, salts, or stabilizers are nontoxic to the subjects at the dosages and concentrations employed.
  • a composition can further comprise a pharmaceutically acceptable carrier or excipient for use in the treatment of cancer that that is compatible with a given method and/or site of administration, for instance for parenteral (e.g. subcutaneous, intradermal, or intravenous injection), intratumoral, or peritumoral administration.
  • an embodiment of the treatment method or compositions for use according to the present invention may not be effective in achieving a positive therapeutic effect in every subject, it should do so in a using pharmaceutical compositions and dosing regimens that are consistently with good medical practice and statistically significant number of subjects as determined by any statistical test known in the art such as the Student's t-test, the x 2 -test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H- test), Jonckheere-Terpstra test and the Wilcoxon-test.
  • any statistical test known in the art such as the Student's t-test, the x 2 -test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H- test), Jonckheere-Terpstra test and the Wilcoxon-test.
  • metastasis in the original organ or tissue and/or in any other location are implied alternatively or in addition, whatever the location of the tumour and/or metastasis is.
  • the present invention relates to depleting regulatory T cells (Tregs).
  • the anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25 also depletes or reduces tumour-infiltrating regulatory T cells.
  • the depletion is via ADCC.
  • the depletion is via ADCP.
  • the invention provides a method for depleting regulatory T cells in a tumour in a subject
  • Tregs are depleted in a solid tumour.
  • depleted it is meant that the number, ratio or percentage of Tregs is decreased relative to when an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25, is not administered.
  • over about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 99% of the tumour-infiltrating regulatory T cells are depleted.
  • Regulatory T cells refer to a lineage of CD4+ T
  • Tregs are usually identified by the expression of the biomarkers CD4, CD25 and Foxp3.
  • Naturally occurring Treg cells normally constitute about 5-10% of the peripheral CD4+ T lymphocytes.
  • a tumour microenvironment i.e. tumour-infiltrating Treg cells
  • they can make up as much as 20-30% of the total CD4+ T lymphocyte population.
  • Activated human Treg cells may directly kill target cells such as effector T cells and APCs through
  • Treg cells induce indoleamine 2,3-dioxygenase (IDO) expression by APCs, and these in turn suppress T- cell activation by reducing tryptophan; Treg cells, may release interleukin-10 (IL-10) and transforming growth factor ( ⁇ ) in vivo, and thus directly inhibit T-cell activation and suppress APC function by inhibiting expression of MHC molecules, CD80, CD86 and IL-12. Treg cells can also suppress immunity by expressing high levels of CTLA4 which can bind to CD80 and CD86 on antigen presenting cells and prevent proper activation of effector T cells.
  • CTLA4+ cytotoxic T-lymphocyte-associated antigen 4
  • IDO indoleamine 2,3-dioxygenase
  • the ratio of effector T cells to regulatory T cells in a solid tumour is increased. In some embodiments, the ratio of effector T cells to regulatory T cells in a solid tumour is increased to over 5, 10, 15, 20, 40 or 80.
  • An immune effector cell refers to an immune cell which is involved in the effector phase of an immune response.
  • Exemplary immune cells include a cell of a myeloid or lymphoid origin, e.g., lymphocytes (e.g., B cells and T cells including cytolytic T cells (CTLs)), killer cells, natural killer cells, macrophages, monocytes, eosinophils, neutrophils, polymorphonuclear cells, granulocytes, mast cells, and basophils.
  • lymphocytes e.g., B cells and T cells including cytolytic T cells (CTLs)
  • killer cells e.g., natural killer cells, macrophages, monocytes, eosinophils, neutrophils, polymorphonuclear cells, granulocytes, mast cells, and basophils.
  • CTLs cytolytic T cells
  • Immune effector cells involved in the effector phase of an immune response express specific Fc receptors and carry out specific immune functions.
  • An effector cell can induce antibody-dependent cell-mediated cytotoxicity (ADCC), e.g., a neutrophil capable of inducing ADCC.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • monocytes e.g., monocytes
  • antibodies according to the present invention may be optimised for ability to induce ADCC.
  • a different agent against cancer may be administered in combination with the antibody via the same or different routes of delivery and/or according to different schedules.
  • one or more doses of a first active agent is administered substantially simultaneously with, and in some embodiments via a common route and/or as part of a single composition with, one or more other active agents.
  • combination therapies provided in accordance with the present invention achieve synergistic effects; in some such embodiments, dose of one or more agents utilized in the combination may be materially different (e.g., lower) and/or may be delivered by an alternative route, than is standard, preferred, or necessary when that agent is utilized in a different therapeutic regimen (e.g., as monotherapy and/or as part of a different combination therapy).
  • dose of one or more agents utilized in the combination may be materially different (e.g., lower) and/or may be delivered by an alternative route, than is standard, preferred, or necessary when that agent is utilized in a different therapeutic regimen (e.g., as monotherapy and/or as part of a different combination therapy).
  • agents can be administered simultaneously or sequentially.
  • administration of one agent is specifically timed relative to administration of another agent.
  • a first agent is administered so that a particular effect is observed (or expected to be observed, for example based on population studies showing a correlation between a given dosing regimen and the particular effect of interest).
  • desired relative dosing regimens for agents administered in combination may be assessed or determined empirically, for example using ex vivo, in vivo and/or in vitro models; in some embodiments, such assessment or empirical determination is made in vivo, in a patient population (e.g., so that a correlation is established), or alternatively in a particular patient of interest.
  • an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25 has improved therapeutic effects when combined with an immune checkpoint inhibitor.
  • a combination therapy with an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25 and an immune checkpoint inhibitor can have synergistic effects in the treatment of established tumours.
  • the data in respect of PD-1/PD-L1 in the present Examples relates to interfering with PD- 1/PD-L1 interaction. As such, the interaction between the PD-1 receptor and the PD- L1 ligand may be blocked, resulting in "PD-1 blockade".
  • the combination may lead to enhanced tumour regression, enhanced impairment or reduction of tumour growth, and/or survival time may be enhanced using the invention as described herein, for example compared with either anti-CD25 antibodies or PD-1/PD-L1 blockade alone (directly, using an anti-PD1 antibody, or indirectly, using an anti-PD-L1 antibody).
  • a combination therapy with an anti-CD25 antibody and immune checkpoint inhibitor may also further include the administration of lnterleukin-2 at a dosage that is appropriate for the treatment of cancer.
  • immuno checkpoint or “immune checkpoint protein” refer to proteins belonging to
  • immune checkpoints are crucial to preventing autoimmunity, especially during a response to a pathogen. Cancer cells can alter the regulation of the expression of immune checkpoint proteins in order to avoid immune surveillance.
  • immune checkpoint proteins include but are not limited to PD-1 , CTLA-4, BTLA, KIR, LAG3, TIGIT, CD155, B7H3, B7H4, VISTA and TIM3, and also OX40, GITR, ICOS, 4-1 BB and HVEM.
  • Immune checkpoint proteins may also refer to proteins which bind to other immune checkpoint proteins. Such proteins include PD-L1 , PD-L2, CD80, CD86, HVEM, LLT1 , and GAL9.
  • Immuno checkpoint protein inhibitors refer to any protein that can interfere with the signalling and/or protein-protein interactions mediated by an immune checkpoint protein.
  • the immune checkpoint protein is PD-1 or PD-L1.
  • the immune checkpoint inhibitor interferes with PD-1/PD-L1 interactions via anti-PD-1 or anti PD-L1 antibodies.
  • the present invention also provides a method of treating cancer, comprising administering an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25 and a further therapeutic agent, preferably a checkpoint inhibitor, to a subject.
  • a further therapeutic agent preferably a checkpoint inhibitor
  • the invention also provides an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25 and a further therapeutic agent, preferably an immune checkpoint inhibitor, for use in the treatment of cancer.
  • the present invention additionally provides the use of an anti-CD25 antibody that does not inhibit the binding of interleukin-2 to CD25, and a further therapeutic agent, preferably an immune checkpoint inhibitor, for the manufacture of a medicament for the treatment of cancer.
  • a further therapeutic agent preferably an immune checkpoint inhibitor
  • Administration of the anti- CD25 antibody that does not inhibit the binding of interleukin-2 to CD25 and further therapeutic agent, such as the immune checkpoint inhibitor may be simultaneous, separate or sequential.
  • the present invention provides a combination of an anti-CD25 that does not inhibit the binding of
  • a anti-human CD25 antibody that does not inhibit the binding of interleukin-2 to CD25 and present the human lgG1 isotype can be used specifically in combination with antibodies targeting immune checkpoints but lacking sequences that allow ADCC, ADCP, and/or CDC.
  • the invention provides an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25 for use in the treatment of cancer, wherein said antibody is for administration in combination with a further therapeutic agent, preferably an immune checkpoint inhibitor.
  • the invention also provides the use of an anti-CD25 that does not inhibit the binding of interleukin 2 to CD25 in the manufacture of a medicament for treating cancer, wherein said medicament is for administration in combination with a further therapeutic agent, preferably an immune checkpoint inhibitor.
  • the present invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25, and optionally a further therapeutic agent, preferably an immune checkpoint inhibitor, in a pharmaceutically acceptable medium.
  • the immune checkpoint inhibitor may be an inhibitor of PD-1 , i.e. a PD-1 antagonist.
  • PD-1 Programmed cell Death protein 1
  • CD279 is a cell surface receptor expressed on activated T cells and B cells. Interaction with its ligands has been shown to attenuate T-cell responses both in vitro and in vivo.
  • PD-1 binds two ligands, PD-L1 and PD-L2.
  • PD-1 belongs to the immunoglobulin superfamily. PD-1 signalling requires binding to a PD-1 ligand in close proximity to a peptide antigen presented by major histocompatibility complex (MHC) (Freeman (2008) Proc Natl Acad Sci USA 105, 10275-6). Therefore, proteins, antibodies or small molecules that prevent co-ligation of PD-1 and TCR on the T cell membrane are useful PD-1 antagonists.
  • MHC major histocompatibility complex
  • the PD-1 receptor antagonist is an anti-PD-1 antibody, or an antigen binding
  • the anti-PD- 1 antibody may be a monoclonal antibody.
  • the anti-PD-1 antibody may be a human or humanised antibody.
  • An anti-PD-1 antibody is an antibody capable of specific binding to the PD-1 receptor.
  • Anti-PD-1 antibodies known in the art include Nivolumab and Pembrolizumab.
  • PD-1 antagonists of the present invention also include compounds or agents that either bind to and/or block a ligand of PD-1 to interfere with or inhibit the binding of the ligand to the PD-1 receptor, or bind directly to and block the PD-1 receptor without inducing inhibitory signal transduction through the PD-1 receptor.
  • PD-1 antagonists include small molecules inhibitors of the PD-1/PD-L1 signalling pathway.
  • the PD-1 receptor antagonist can bind directly to the PD-1 receptor without triggering inhibitory signal transduction and also binds to a ligand of the PD-1 receptor to reduce or inhibit the ligand from triggering signal transduction through the PD-1 receptor.
  • the PD-1 receptor antagonist is an anti-PD-L1 antibody, or an antigen binding fragment thereof, which specifically binds to PD-L1 and blocks the binding of PD-L1 to PD-1 .
  • the anti- PD-L1 antibody may be a monoclonal antibody.
  • the anti-PD-L1 antibody may be a human or humanised antibody, such as Atezolizumab (MPDL3280A).
  • the present invention also provides a method of treating cancer, comprising administering an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25 and an antibody which is an agonist of a T cell activating costimulatory pathway to a subject.
  • Antibody agonists of a T cell activating costimulatory pathway include, without limitation, agonist antibodies against ICOS, GITR, OX40, CD40, LIGHT and 4- 1 BB.
  • a further method of treating cancer comprises administering an anti-CD25 antibody that does not inhibit the binding of interleukin 2 to CD25 and a compound that decreases, blocks, inhibits, and/or antagonizes FcyRllb (CD32b).
  • FcyRllb antagonist can be a small molecule interfering for FcyRI lb-induced intracellular signalling, modified antibodies that do not engage inhibitory FcyRllb receptor, or an anti- human FcyRllb (anti-CD32b antibody.
  • antagonistic anti-human FcyRllb antibodies have been characterized also for their anti-tumour properties (Roghanian A et al., 2015, Cancer Cell. 27, 473- 488; Rozan C et al., 2013, Mol Cancer Ther. 12: 1481-91 ; WO2015173384; WO2008002933).
  • the present invention provides a bispecific antibody comprising:
  • a second antigen binding moiety that binds to an immune checkpoint protein, a tumour- associated antigen, an anti-human activatory Fc Receptor antibody (FcgRI, FcgRlla, FcgRIII), or an antagonistic anti-human FcyRllb antibody;
  • the anti-CD25 antibody does not inhibit the binding of lnterleukin-2 (IL-2) to CD25, and preferably is an lgG1 bispecific antibody that binds to at least one activatory Fey receptor with high affinity, and depletes tumour-infiltrating regulatory T cells.
  • the second antigen binding moiety binds to PD-L1.
  • tumour-associated antigen refers to antigens expressed on tumour cells, making them distinguishable from non-cancer cells adjacent to them, and include, without limitation, CD20, CD38, PD- L1 , EGFR, EGFRV3, CEA, TYRP1 and HER2.
  • Various review articles have been published that describe relevant tumour-associated antigens and the corresponding therapeutically useful antitumor antibody agents (see, for example, Sliwkowski & Mellman (2013) Science 341 , 192-8).
  • antigens and corresponding antibodies include, without limitation CD22 (Blinatumomab), CD20 (Rituximab,
  • CD56 (Lorvotuzumab), CD66e/CEA (Labetuzumab), CD152/CTLA-4 (Ipilimumab), CD221/IGF1 R (MK-0646), CD326/Epcam (Edrecolomab), CD340/HER2 (Trastuzumab, Pertuzumab), and EGFR (Cetuximab, Panitumumab).
  • the bispecific antibody according to the invention as described herein leads to ADCC, or, in one aspect, enhanced ADCC.
  • the bispecific antibody may bind to a specific epitope on CD25 that does not affect the binding of IL-2 to CD25, and a specific epitope on the immune checkpoint protein or tumour-associated antigen as defined herein.
  • the second antigen binding moiety binds to PD-L1.
  • the present invention provides a bispecific antibody comprising:
  • the immune checkpoint protein expressed on a tumour cell is PD-L1 , VISTA, GAL9, B7H3 or B7H4.
  • the anti-CD25 antibody an lgG1 antibody that does not affect the binding of IL-2 to CD25 and that binds to at least one activatory Fey receptors with high affinity, and depletes tumour-infiltrating regulatory T cells.
  • the anti-CD25 antibody is a human lgG2 antibody that depletes tumour-infiltrating regulatory T cells.
  • the anti-CD25 antibody is a human lgG2 antibody that binds to at least one activatory Fey receptors with high affinity, preferably FcyRlla.
  • bispecific antibody may be used in any of the aspects of the invention as described herein.
  • the second antigen binding moiety within the bispecific antibody according to the invention binds to human PD-1 , human PD-L1 , or human CTLA-4.
  • the bispecific antibody may bind to CD25 and to immune modulatory receptors expressed at high levels on tumour infiltrating Tregs, for example CTLA4, ICOS, GITR, 4-1 BB or OX40.
  • the present invention also provides a kit which comprises an anti-CD25 antibody as described herein, and a further therapeutic agent, preferably an immune checkpoint inhibitor, preferably a PD-1 antagonist (directly, using an anti-PD1 antibody, or indirectly, using an anti-PD-L1 antibody) as discussed herein.
  • an immune checkpoint inhibitor is anti-PD-L1.
  • the kit comprises an anti-CD25 antibody as described herein, and an antibody which is an agonist of a T cell activating costimulatory pathway.
  • the kit may comprise instructions for use.
  • the anti-CD25 antibody and, optionally, the immune checkpoint inhibitor according to the present invention may be administered in combination with co-stimulatory antibodies, chemotherapy and/or radiotherapy (by applying irradiation externally to the body or by administering radio-conjugated compounds), cytokine-based therapy, targeted therapy, monoclonal antibody therapy, a vaccine, or an adjuvant, or any combination thereof.
  • a chemotherapeutic entity as used herein refers to an entity which is destructive to a cell, that is the entity reduces the viability of the cell.
  • the chemotherapeutic entity may be a cytotoxic drug.
  • chemotherapeutic agent contemplated includes, without limitation, alkylating agents, anthracyclines, epothilones, nitrosoureas, ethylenimines/methylmelamine, alkyl sulfonates, alkylating agents, antimetabolites, pyrimidine analogs, epipodophylotoxins, enzymes such as L-asparaginase; biological response modifiers such as IFNa, IFN- ⁇ , IL-2, IL-12, G-CSF and GM-CSF; platinum coordination complexes such as cisplatin, oxaliplatin and carboplatin, anthracenediones, substituted urea such as hydroxyurea, methylhydrazine derivatives including N-methylhydrazine (MIH) and procarbazine, adrenocortical suppressants such as mitotane ( ⁇ , ⁇ '-DDD) and aminoglutethimide; hormones and antagonists including adrenoc
  • dexamethasone and aminoglutethimide aminoglutethimide
  • progestin such as hydroxyprogesterone caproate
  • medroxyprogesterone acetate and megestrol acetate include estrogen such as diethylstilbestrol and ethinyl estradiol equivalents; antiestrogen such as tamoxifen; androgens including testosterone propionate and fluoxymesterone/equivalents; antiandrogens such as flutamide, gonadotropin-releasing hormone analogs and leuprolide; and non-steroidal antiandrogens such as flutamide.
  • the additional cancer therapy may also include the administration of a cancer vaccine.
  • cancer vaccines refer to therapeutic cancer vaccines administrated to cancer patients and designed to eradicate cancer cells through strengthening patient's own immune responses.
  • Cancer vaccines include tumour cell vaccines (autologous and allogenic), dendritic cell vaccines (ex vivo generated and peptide-activated), protein/peptide-based cancer vaccines and genetic vaccines (DNA, RNA and viral based vaccines). Accordingly, therapeutic cancer vaccines, in principle, may be utilized to inhibit further growth of advanced cancers and/or relapsed tumours that are refractory to conventional therapies, such as surgery, radiation therapy and chemotherapy.
  • Tumour cell based vaccines include those genetically modified to secrete soluble immune stimulatory agents such as cytokines (IL-2, IFN-g, IL12, GMCSF, FLT3L), single chain Fv antibodies against immune modulatory receptors (PD-1 , CTLA-4, GITR, ICOS, OX40, 4-1 BB) and/or to express on their membrane the ligand for immune-stimulatory receptors such as ICOS-ligand, 4-1 BB ligand, GITR-ligand, and/or OX40 ligand amongst others.
  • the cancer vaccine may be a GVAX anti-tumour vaccine.
  • the additional cancer therapy may be other antibodies or small molecule reagents that reduce immune regulation in the periphery and within the tumour microenvironment, for example molecules that target TGFbeta pathways, IDO (indoleamine deoxigenase), Arginase, and/or CSF1 R.
  • TGFbeta pathways for example molecules that target TGFbeta pathways, IDO (indoleamine deoxigenase), Arginase, and/or CSF1 R.
  • [150] 'In combination' may refer to administration of the additional therapy before, at the same time as or after administration of any aspect according to the present invention.
  • FIG. 1 - shows the characterization of 7D4 and PC61 anti-mouse CD25 antibodies as used in the Examples. Effect on IL-2 binding was performed using a tandem format cross-blocking assay. Biotinylated mouse CD25 was loaded onto SA sensors. The sensors were then exposed to 100 nM mouse IL-2 followed by either anti-mouse CD25 antibody at time 150sec. Additional binding by the antibody after IL-2 association indicates an anti-mouse CD25 that does not block IL-2 binding, while no further binding indicates ligand blocking.
  • PC-61 mlgG2a shows interference of the mouse IL-2 - mouse CD25 interaction, in contrast the 7D4 (A).
  • mice IL-2 / mouse CD25 interaction in presence of the recombinant anti-mouse CD25 7D4(mlgG1 ) was evaluated using a standard sandwich format cross- blocking assay. 7D4(mlgG1 ) was loaded onto AHQ sensors and unoccupied Fc-binding sites on the sensor were blocked with an irrelevant human lgG1 antibody. The sensors were then exposed to 100 nM of recombinant mouse CD25 (R&D Systems; cat. no. 2438-RM- 050) followed by recombinant mouse IL-2 (Peprotech; cat. no. 212-12).
  • Binding to mouse CD25 was determined using CHO cells expressing mouse CD25 for the anti-human CD25-binding antibodies Daclizumab (DAC), the PC61 (mlgG2a) antibody (the original anti-CD25 obtained from clone PC-61 with murine lgG2a and ⁇ constant regions that are associated with ADCC) and a7D4(mlgG1 ) antibody (an anti- D25 obtained from clone 7D4 with murine lgG1 and ⁇ constant regions), anti-mouse CD25 IgG bind to cellular expressed mCD25.
  • DAC Daclizumab
  • the PC61 (mlgG2a) antibody the original anti-CD25 obtained from clone PC-61 with murine lgG2a and ⁇ constant regions that are associated with ADCC
  • a7D4(mlgG1 ) antibody an anti- D25 obtained from clone 7D4 with murine lgG1 and ⁇ constant regions
  • CHO-mCD25 were aliquoted in 96-well assay plates (50000 cells/well) and incubated with 0.1 mL antibody-containing solution (antibody at 100nM concentration in PBS + 0.1 % bovine serum albumin) at 25°C for 15 minutes. The cells were washed three times with ice- cold PBS + 0.1 % bovine serum albumin) and then labeled with goat Anti-Human IgG ( ⁇ chain specific) R- PE (Southern Biotech, catalog number 2040-09) and analyzed using a flow cytometry (propidium iodide was used to distinguish dead cells).
  • FIG. 2 - shows the effect of anti-mouse CD25 antibodies on the induction of Granzyme B expression by CD4 T cells upon stimulation with anti-CD3 and anti- CD28, Total CD4-positive T cells were isolated using CD4 MicroBeads from mouse lymph nodes and spleen and labelled with CellTraceTM Violet dyes (ThermoFisher) for measuring cell proliferation.
  • the labeled T cells (105 ) have been seeded with feeder cells (105 ; CD90.2negative fraction, using mouse pan T Dynabeads kit) in 96-well plate.
  • Anti-CD3 (clone 145-2C1 1 , BioXcell Cat No. BE0001-1 ; l Mg/ml) and anti-CD28 (clone 37.51 Cat No. BioXcell BE0015-1 ; 0.5 g/ml) were added to the wells (with the exception of the control sample of unstimulated, labeled T cells) to activate the CD4 T cells and induce proliferation and Granzyme B production.
  • the following antibodies were then further added (at 25 g/mL) to the wells containing labelled CD4 T cells and anti- CD3 and anti-CD28 antibodies (wells containing labelled T cells and anti-CD3 and anti-CD28 antibodies only were used as negative control): PC61 (mlgG2a), 7D4(mlgG1 ), or a neutralizing anti-mouse IL-2 antibody (clone Jes6-1A12, BioXcell 6032988564) used as a positive control, to show the impact of blocking the interaction between IL-2 and its receptor on T cell activation.
  • the samples of labeled T cells were then incubated for approx. 84hrs.
  • FIG. 3 - shows the in vivo effect of anti-mouse CD25 antibodies having the same isotype (mouse
  • mice administered in presence or not of anti-mouse PD1 (aPD1 ; clone RMP1-14), on immune cells.
  • aPD1 anti-mouse PD1
  • clone RMP1-14 anti-mouse PD1
  • mice Six groups of mice were injected sub-cutaneously with MCA205 tumor cells (5x10 5 15 ) at DayO and treated separately as indicated in the graphs.
  • the anti-mouse CD25 antibody either aPC61 mlgG2a or a7D4 mlgG2a; 200 g
  • aPD1 100 g
  • Day6 IntraPD1 (100 g) is injected intra-peritoneally at Day6 and Day9.
  • the tumors and Lymph Nodes are harvested at Day12 and then processed for staining cells according to the desired type and analysed by flow cytometry as indicated in each panel, using the following antibodies: anti-CD3 (clone 17A2, Biolegend), anti-CD4 (clone RM4-5, BD biosciences), anti-CD8 (clone 53-6.7, Biolegend) and anti-FoxP3 (Clone FJK-16s, eBiosciences). Intranuclear staining of FoxP3 was performed using the FoxP3 Transcription Factor Staining Buffer Set (eBioscience).
  • FIG. 4 - shows the effect of anti-mouse CD25 antibodies having the same isotype (lgG2a) that are either blocking or non-blocking the interaction between CD25 and IL-2, in presence or not of anti-mouse PD1 (aPD1 ; clone RMP1-14) on the production of Granzyme B by proliferating T cells in vivo.
  • Sample of cells were generated using the MCA205-based model in six treatment groups as indicated in the Figure 3.
  • Tumour cells were stained according to the desired type and analysed by flow cytometry as indicated in each panel, using the following antibodies: anti-CD3 (PeCy7, clone 145-2C1 1 , Ebioscience, 25003182), anti-CD4 (V500, clone RM4-5, BD biosciences, 560782), anti-CD8 (BV785, clone 53-6.7, Biolegend, 100750), anti-Granzyme B (APC, clone GB1 1 ; Invitrogen, grb05) and Ki67 (V450, Clone SolA15;
  • FIG. 5 - shows the effect of anti-mouse CD25 (lgG2a isotype) that is administered with or without the combination with an anti-PD-1 (clone RMP1-14) on the eradication of established tumours in the CT26 mouse model.
  • Both 7D4m2a and PC61 m2a are anti-mouse CD25, Treg-depleting antibodies but either non-IL-2 blocking (7D4m2a) or IL-2 blocking (PC61 m2).
  • Growth curves of individual mice were established for each treatment group over time. The number of tumour-free survivors after 50 days is indicated in each graph.
  • CT26 cells used for implantation were harvested during log phase growth and resuspended in cold PBS.
  • each mouse was injected subcutaneously in the right flank with 3 x 10 5 cells (0.1 mL cell suspension).
  • the anti-mouse CD25 was injected i.p. (10mg/kg) at Day 6 (when palpable tumors were detected).
  • the anti-mouse PD1 was injected i.p. (l OO g/injection) at Day 7, Day 10, Day 14, and Day 17.
  • Tumors were calipered in two dimensions twice weekly to monitor growth.
  • the study endpoint was a tumor volume of 4000 mm 3 or 50 days, whichever came first (data point stopping at different, earlier days are due to death of mice; the number of animal surviving at the end of the experiment is indicated within each panel).
  • Figure 6 shows CT26 tumour growth curves of individual mice not treated (PBS, vehicle only) or treated with anti-mouse CD25 lgG2a antibodies, both Treg depleting but either non-IL-2 blocking (7D4m2a) or IL- 2 blocking (PC61 m2), and further combined or not with anti-mouse PD-L1 clone 10F.9G2 (aPDL1 ; clone 10F.9G2).
  • Model, regimen, and data analysis are the same as for Figure 5.
  • Figure 7 - shows the effect of anti-mouse CD25 (lgG2a isotype) that is administered with or without the combination with an anti-PD-1 (clone RMP1 -14) on the eradication of established tumours in the MC38 mouse model.
  • the tested antibodies are those described in Figure 5.
  • Growth curves of individual mice were established for each treatment group over time. The number of tumour-free survivors after 35 days is indicated in each graph.
  • the MC38 colon carcinoma cells used for implantation were harvested during log phase growth and re-suspended in cold PBS. Each mouse was injected subcutaneously in the right flank with 5 x 10 5 tumor cells (0.1 mL cell suspension). Tumors were monitored as their volumes approached the target range of 100 to 150 mm 3 .
  • Treatments began on Day 1 in mice bearing established MC38 tumors. The effects of each treatment were compared to a vehicle-treated control group that received PBS intraperitoneally (i.p.) on Day 1 , Day 2, Day 5, Day 9, and Day 12.
  • Anti-PD1 was administered i.p. at 100 g/animal, twice weekly for two weeks (biwk x 2) beginning on Day 2.
  • 7D4m2a and PC61 m2a were administered i.p. once on Day 1 at 200 g/animal.
  • Figure 8 - shows MC38 tumour growth curves of individual mice not treated (PBS, vehicle only), treated with anti-mouse CD25 lgG2a antibodies, both Treg depleting but either non-IL-2 blocking (7D4m2a) or IL- 2 blocking (PC61 m2), and further combined or not with anti-mouse PD-L1 clone 10F.9G2 (aPDL1 ; clone 10F.9G2).
  • Model, regimen, and data analysis are the same of Figure 7.
  • Figure 9 Evaluation of the therapeutic activity of 7D4 m lgG2a, an anti-mouse CD25 non-IL-2 blocking, Treg depleting antibody alone (D) and in combination with an IL-2 neutralizing antibody (ThermoFisher; JES6-1 A12) (E), or an IL-2 blocking non depleting anti-mouse CD25 antibody of the mouse lgG1 isotype (PC61 mouse lgG1 ) (F), in mice bearing CT26 syngeneic colon tumors in female BALB/c mice.
  • the activity of mouse lgG2s control (A), an IL-2 neutralizing antibody alone (B), and an IL-2 blocking anti- CD25 antibody alone (C) were tested for comparison.
  • Figure 10 shows the consensus sequence of human CD25 (Uniprot code P01589), referred to as SEQ ID NO: 1 herein.
  • SEQ ID NO: 1 The extracellular domain of mature CD25, corresponding to amino acids 22-240, is underlined.
  • epitopes 1 full and short epitopes
  • epitope 2 full and short epitopes
  • epitope 3 and epitope 4 full and short epitopes
  • the position of the basiliximab and daclizumab epitope is also identified.
  • Figure 11 Characterization of (A) 7D4, (B) PC61 and (C) 2E4 binding to CD25 expressed on CHO cells expressing CD25 at increasing antibody concentrations and comparing with mouse lgG2a isotype control.
  • Figure 12 SPR based analysis of purified antibodies (mlgG2a) to rmCD25 his tagged on the Biacore 2000, (A) 7D4, (B) 2E4.
  • Figure 14 Characterization of 7D4, PC61 and 2E4 compared to mouse lgG2a isotype control or in
  • Figure 15 In vivo depletion of Treg in 4T1 tumour bearing balb/c mice after dosing with mouse anti- mouse CD25 (7D4) antibody.
  • A -(C): % non-CD4, CD4+ and CD25+FoxP3+ cells, respectively in whole blood at day 3 post-dose.
  • D -(F): % non-CD4, CD4+ and CD25+FoxP3+ cells, respectively in tumour at day 3 post-dose.
  • G -(l): % non-CD4, CD4+ and CD25+FoxP3+ cells, respectively in whole blood at day 9 post-dose.
  • J -(L): % non-CD4, CD4+ and CD25+FoxP3+ cells, respectively in tumour at day 9 post-dose.
  • Figure 16 Characterization of mouse (B) or chimeric (A, C and D) anti-human CD25 clone 7G7B6
  • Figure 17 Characterization of 7G7B6 compared to mouse lgG2a isotype control, human lgG1 isotype control, Daclizumab, or in absence of a primary antibody in respect to blocking IL-2 signalling in a STAT5 phosphorylation assay using PBMCs of human origin. Cells were incubated with l O g/ml antibody followed by increasing concentrations of IL-2 (as shown in the Figures). Analysis was restricted to percentage of CD3-positive cells phosphorylating STAT5. [169] Figure 18: Functional characterization of chimeric 7G7B6 compared to human IgGI isotype control,
  • Daclizumab or commercially available mouse anti-human IL-2 neutralizing antibody as a positive control, (clone: AB12-3G4) using Pan T cells. Cells were incubated with 10ug/ml antibody then activated with CD3/CD28 beads for 72 hours before flow cytometry analysis. Results show percentage of granzyme B positive proliferating CD4 T cells.
  • Figure 19 Functional characterization of chimeric 7G7B6 compared to human IgGI isotype control in respect to killing of CD25-positive cell lines in an ADCC assay.
  • Target cell lysis was measured by calcein release into the supernatant at four hours post addition to NK cells. Data was normalised to saponin treated controls.
  • Figure 20 Functional characterization of chimeric 7G7B6 compared to human IgGI isotype control in respect to phagocytosis of in-vitro differentiated Treg cells in an ADCP assay.
  • Tregs were co-cultured with MCSF differentiated Macrophages in the presence of varying concentrations of antibodies (as shown in the Figures).
  • Two colour flow cytometric analysis was performed with CD14+ stained Macrophages and eFluor450-dye labelled Tregs.
  • Residual target cells were defined as cells that were eFluor450- dye + /CD14 " .
  • Dual-labelled cells eFluor450-dye+/CD14+
  • Phagocytosis of target cells was calculated with the following equation:
  • %Phagocytosis 100 * [(percent dual positive)/(percent dual positive + percent residual targets)].
  • Figure 21 Characterization of MA-251 binding to CD25 expressed on Karpas 299 cells at increasing antibody concentrations and comparing with mouse IgGI isotype control.
  • Figure 22 Characterization of MA-251 compared to mouse IgGI isotype control, human IgGI isotype control, Daclizumab, or in absence of a primary antibody. Blocking of IL-2 signalling in a STAT5 phosphorylation assay was assessed using PBMCs of human origin. Cells were incubated with l O g/ml antibody followed by increasing concentrations of IL-2 (as shown in the Figures). Analysis was restricted to percentage of CD3-positive cells phosphorylating STAT5.
  • Figure 23 Characterization of MA-251 and IL2 binding to CD25. Interference with IL2 Ligand binding to CD25 was performed on a Forte Bio Octet Red384 system (Pall Forte Bio Corp., USA) using a standard sandwich binning assay. The MA251 antibody was loaded onto AHQ sensors and unoccupied Fc-binding sites on the sensor were blocked with a non-relevant human IgGI antibody. Sensors were exposed to 100nM human CD25 followed by 100nM human IL-2. Data was processed using Forte Bio Data Analysis Software 7.0. Additional binding by human IL2 after antigen association indicates an unoccupied epitope (non-competitor), while no binding indicates epitope blocking (competitor).
  • mAbs which are non blockers of IL-2 signal compete with each other or with 7G7B6 and MA251 and do not compete with research Daclizumab or research Basiliximab ( Figures 24 (A) to (N)).
  • mAbs which are IL-2 signalling blockers (TSK031 ) do compete with the research Daclizumab and research Basiliximab and not compete with 7G7B6 ( Figures 24 (O) to (Q).
  • Figure 25 In vivo model showing suppression of tumour growth after dosing with: vehicle (A) and (C); or Antibody 1 (B), (D) and (E).
  • Figure 26 Affinity determination by SPR based analysis of purified antibodies (lgG1 ) to rhCD25 his tagged on the Biacore 2000.
  • Figure 27 Characterization of Antibody 1 binding to CD25 expressed on human in vitro differentiated Treg cells (A), SU-DHL-1 cells (B), or SR-786 cells (C) at increasing antibody concentrations and comparing with human lgG1 isotype control.
  • Figure 28 Characterization of Antibody 1 binding to CD25 expressed on CD3/CD28 bead activated Human (A) and (B) Pan T cells, then gated on CD4 + and CD8 + T cells, at increasing antibody concentration and comparing with human lgG1 isotype control.
  • Figure 29 Shows non-competitive binding of Antibody 1 and IL-2 (A) and competitive binding of a IL-2 competing antibody with IL-2 (B) by biolayer interferometry on the Octet Red384 using a standard sandwich format binning assay.
  • the anti-human CD25 antibody, Antibody 1 was loaded onto AHQ sensors. The sensors were then exposed to 100 nM human CD25 followed by human IL-2. Additional binding by human IL2 after antigen association indicates an unoccupied epitope (non-competitor), while no binding indicates epitope blocking (competitor).
  • Figure 30 Shows non-competitive binding of Antibody 1 and Daclizumab to CD25 by biolayer
  • Figure 31 characterization of Antibody 1 compared to human lgG1 isotype control, Daclizumab, or in absence of a primary antibody in respect to blocking IL-2 signalling in a STAT5 phosphorylation assay using PBMCs of human origin. Cells were incubated with l O g/ml antibody followed by increasing concentrations of IL-2 (as shown in the Figures). Analysis was restricted to percentage of CD3-positive cells phosphorylating STAT5.
  • Figure 32 Functional characterization of Antibody 1 compared to human IgGI isotype control,
  • Daclizumab or commercially available mouse anti-human IL-2 neutralizing antibody as a positive control, (clone: AB12-3G4) using Pan T cells. Cells were incubated with 10ug/ml antibody then activated with CD3/CD28 beads for 72 hours before flow cytometry analysis. Results show percentage of granzyme B positive proliferating CD4 (A) or CD8 (B) T cells.
  • Figure 33 Functional characterization of Antibody 1 compared to human IgGI isotype control in respect to killing of CD25-positive cell lines in an ADCC assay.
  • Target cell lysis was measured by calcein release into the supernatant at four hours post addition to NK cells. Data was normalised to saponin treated controls.
  • Figure 34 Functional characterization of Antibody 1 compared to human IgGI isotype control in respect to phagocytosis of in-vitro differentiated Treg cells in an ADCP assay.
  • Tregs were co-cultured with MCSF differentiated Macrophages in the presence of varying concentrations of antibodies (as shown in the Figures).
  • Two colour flow cytometric analysis was performed with CD14+ stained Macrophages and eFluor450-dye labelled Tregs.
  • Residual target cells were defined as cells that were eFluor450- dye + /CD14 " .
  • Dual-labelled cells eFluor450-dye+/CD14+
  • Phagocytosis of target cells was calculated with the following equation:
  • %Phagocytosis 100 * [(percent dual positive)/(percent dual positive + percent residual targets)].
  • Figure 35 Characterization of Antibody 3 binding to CD25 expressed on human in vitro differentiated Treg cells (A), SU-DHL-1 cells (B), or SR-786 cells (C) at increasing antibody concentrations and comparing with human IgGI isotype control
  • Figure 36 Characterization of Antibody 3 binding to CD25 expressed on CD3/CD28 bead activated Human (A) and (B) or Cynomolgus Monkey (C) and (D) Pan T cells, then gated on CD4 + and CD8 + T cells, at increasing antibody concentration and comparing with human IgGI isotype control.
  • Figure 37 Shows non-competitive binding of Antibody 3 and IL-2 by biolayer interferometry on the Octet Red384 using a standard sandwich format binning assay.
  • the anti-human CD25 antibody, Antibody 3 was loaded onto AHQ sensors. The sensors were then exposed to 100 nM human CD25 followed by human IL-2. Additional binding by human IL2 after antigen association indicates an unoccupied epitope (non-competitor).
  • Figure 38 Shows non-competitive binding of Antibody 3 and Daclizumab to CD25 by biolayer
  • FIG. 39 characterization of Antibody 3 compared to human IgGI isotype control, Daclizumab, or in absence of a primary antibody in respect to blocking IL-2 signalling in a STAT5 phosphorylation assay using PBMCs of human origin. Cells were incubated with l O g/ml antibody followed by increasing concentrations of IL-2 (as shown in the Figures). Analysis was restricted to percentage of CD3-positive cells phosphorylating STAT5.
  • Figure 40 Functional characterization of Antibody 3 compared to human IgGI isotype control
  • Daclizumab or commercially available mouse anti-human IL-2 neutralizing antibody as a positive control, (clone: AB12-3G4) using Pan T cells. Cells were incubated with 10ug/ml antibody then activated with CD3/CD28 beads for 72 hours before flow cytometry analysis. Results show percentage of granzyme B positive proliferating CD4 (A) or CD8 (B) T cells.
  • Figure 41 Functional characterization of Antibody 3 compared to human IgGI isotype control in respect to killing of CD25-positive cell lines in an ADCC assay.
  • Target cell lysis was measured by calcein release into the supernatant at four hours post addition to NK cells. Data was normalised to saponin treated controls.
  • Figure 42 Functional characterization of Antibody 3 compared to human IgGI isotype control in respect to phagocytosis of in-vitro differentiated Treg cells in an ADCP assay.
  • Tregs were co-cultured with MCSF differentiated Macrophages in the presence of varying concentrations of antibodies (as shown in the Figures).
  • Two colour flow cytometric analysis was performed with CD14+ stained Macrophages and eFluor450-dye labelled Tregs.
  • Residual target cells were defined as cells that were eFluor450- dye + /CD14 " .
  • Dual-labelled cells eFluor450-dye+/CD14+
  • Phagocytosis of target cells was calculated with the following equation:
  • %Phagocytosis 100 * [(percent dual positive)/(percent dual positive + percent residual targets)].
  • Figure 43 Characterization of Antibody 4 binding to CD25 expressed on human in vitro differentiated Treg cells (A), SU-DHL-1 cells (B), or SR-786 cells (C) at increasing antibody concentrations and comparing with human IgGI isotype control.
  • Figure 44 Characterization of Antibody 4 binding to unmodified CHO-S cells, (negative control) (A), or cyno-CD25-CHO-S cells (B), at 100nM antibody concentration and comparing with human IgGI isotype control.
  • Figure 45 Shows non-competitive binding of Antibody 4 and IL-2 by biolayer interferometry on the Octet Red384 using a standard sandwich format binning assay.
  • the anti-human CD25 antibody, Antibody 4 was loaded onto AHQ sensors.
  • the sensors were then exposed to 100 nM human CD25 followed by human IL-2. Additional binding by human IL2 after antigen association indicates an unoccupied epitope (non-competitor).
  • Figure 46 Shows non-competitive binding of Antibody 4 and Daclizumab to CD25 by biolayer interferometry on the Octet Red384 system using a standard sandwich format binning assay.
  • the reference monoclonal anti-human CD25 antibody Daclizumab was loaded onto AHQ sensors.
  • the sensors were then exposed to 100nM human CD25 antigen followed by the anti-human CD25 antibody (Antibody 4). Additional binding by the second antibody after antigen association indicates an unoccupied epitope (non-competitor), while no binding indicates epitope blocking (competitor).
  • Figure 47 characterization of Antibody 4 compared to human lgG1 isotype control, Daclizumab, or in absence of a primary antibody in respect to blocking IL-2 signalling in a STAT5 phosphorylation assay using PBMCs of human origin. Cells were incubated with l O g/ml antibody followed by increasing concentrations of IL-2 (as shown in the Figures). Analysis was restricted to percentage of CD3-positive cells phosphorylating STAT5.
  • Daclizumab or commercially available mouse anti-human IL-2 neutralizing antibody as a positive control, (clone: AB12-3G4) using Pan T cells. Cells were incubated with 10ug/ml antibody then activated with CD3/CD28 beads for 72 hours before flow cytometry analysis. Results show percentage of granzyme B positive proliferating CD4 (A) or CD8 (B) T cells.
  • Figure 49 Functional characterization of Antibody 4 compared to human lgG1 isotype control in respect to killing of CD25-positive cell lines in an ADCC assay.
  • Target cell lysis was measured by calcein release into the supernatant at four hours post addition to NK cells. Data was normalised to saponin treated controls.
  • Figure 50 Functional characterization of Antibody 4 compared to human lgG1 isotype control in respect to inducing ADCP in a Reporter Bioassay.
  • CD25 expressing SU-DHL-1 cells were co-cultured with Jurkat T cells genetically engineered to express FcvRlla and an NFAT-response element that drives luciferase expression (NFAT-RE-luc2) in the presence of varying concentrations of antibodies (as shown in the Figures).
  • Figure 51 Characterization of Antibody 2 binding to CD25 expressed on human in vitro differentiated Treg cells (A), SU-DHL-1 cells (B), or SR-786 cells (C) at increasing antibody concentrations and comparing with human lgG1 isotype control.
  • Figure 52 Characterization of Antibody 2 binding to CD25 expressed on CD3/CD28 bead activated Human (A) and (B) or Cynomolgus Monkey (C) and (D) Pan T cells, then gated on CD4 + and CD8 + T cells, at increasing antibody concentration and comparing with human lgG1 isotype control.
  • Figure 53 Shows non-competitive binding of Antibody 2 and IL-2 (A) and competitive binding of a IL-2 competing antibody with IL-2 (B) by biolayer interferometry on the Octet Red384 using a standard sandwich format binning assay. The anti-human CD25 antibody, Antibody 2, was loaded onto AHQ sensors. The sensors were then exposed to 100 nM human CD25 followed by human IL-2. Additional binding by human IL2 after antigen association indicates an unoccupied epitope (non-competitor).
  • Figure 54 Shows non-competitive binding of Antibody 2 and Daclizumab to CD25 by biolayer
  • Figure 55 Characterization of Antibody 2 compared to human lgG1 isotype control, Daclizumab, or in absence of a primary antibody in respect to blocking IL-2 signalling in a STAT5 phosphorylation assay using PBMCs of human origin. Cells were incubated with l O g/ml antibody followed by increasing concentrations of IL-2 (as shown in the Figures). Analysis was restricted to percentage of CD3-positive cells phosphorylating STAT5.
  • Figure 56 Functional characterization of Antibody 2 compared to human lgG1 isotype control in respect to killing of CD25-positive cell lines in an ADCC assay.
  • Target cell lysis was measured by calcein release into the supernatant at four hours post addition to NK cells. Data was normalised to saponin treated controls.
  • FIG. 57 Functional characterization of Antibody 2 compared to human lgG1 isotype control in respect to phagocytosis of in-vitro differentiated Treg cells in an ADCP assay.
  • Tregs were co-cultured with MCSF differentiated Macrophages in the presence of varying concentrations of antibodies (as shown in the Figures).
  • Two colour flow cytometric analysis was performed with CD14+ stained Macrophages and eFluor450-dye labelled Tregs.
  • Residual target cells were defined as cells that were eFluor450- dye + /CD14 " .
  • Dual-labelled cells eFluor450-dye+/CD14+
  • Phagocytosis of target cells was calculated with the following equation:
  • %Phagocytosis 100 * [(percent dual positive)/(percent dual positive + percent residual targets)].
  • Figure 58 Characterization of Antibody 5 binding to CD25 expressed on Karpas 299 cells at increasing antibody concentrations and comparing with human lgG1 isotype control.
  • Figure 59 Characterization of Antibody 5 in respect to blocking IL-2 signalling in a STAT5
  • phosphorylation assay using PBMCs of human origin The mouse anti-human antibody MA-251 was used as a non-blocking control while the clinical Daclizumab High Yield Process (DAC HYP) was used as a blocking control compared to mouse lgG1 isotype control, human lgG1 isotype controls or in absence of a primary antibody, respectively.
  • DAC HYP clinical Daclizumab High Yield Process
  • Cells were incubated with l O g/ml antibody followed by 10U/ml IL-2. Analysis was restricted to percentage of CD3-positive cells phosphorylating STAT5.
  • FIG. 60 Competition assays in the Octet. Binding Antibody 1 to the immobilized rhCD25 followed by either the first Ab again (Antibody 1 as control) or a second Ab, either an IL-2 competitor e.g. Daclizumab and Basiliximab research or an IL-2 no competitor e.g. 7G7B6). Antibody 1 does not compete with the IL- 2 signal blockers research Basiliximab (A) Daclizumab (B) while it does compete with 7G7B6 (non-IL-2 blocker) (C).
  • Figure 61 Characterization of Antibody 5 compared to an anti-human CD25 Fc silent control antibody in respect to inducing ADCC in a Reporter Bioassay.
  • CD25 expressing SR-786 cells were co-cultured with Jurkat T cells genetically engineered to express FcYRIIIa and an NFAT-response element that drives luciferase expression (NFAT-RE-luc2) in the presence of varying concentrations of antibodies (as shown in the Figures).
  • Figure 62 Functional characterization of Antibody 5 compared to human IgGI isotype control in respect to phagocytosis of in-vitro differentiated Treg cells in an ADCP assay.
  • Tregs were co-cultured with MCSF differentiated Macrophages in the presence of varying concentrations of antibodies (as shown in the Figures).
  • Two colour flow cytometric analysis was performed with CD14+ stained Macrophages and eFluor450-dye labelled Tregs.
  • Residual target cells were defined as cells that were eFluor450- dye + /CD14 " .
  • Dual-labelled cells eFluor450-dye+/CD14+
  • Phagocytosis of target cells was calculated with the following equation:
  • %Phagocytosis 100 * [(percent dual positive)/(percent dual positive + percent residual targets)].
  • Figure 64 Competition assays in the Octet. Binding the first Ab (Antibody 7) to the immobilized rhCD25 followed by either the first Ab again (as control) or a second Ab Daclizumab (A) or Basiliximab (B).
  • Figure 65 Characterization of Antibody 7 compared to human IgGI isotype control, Daclizumab-Hyp, or in the absence of a primary antibody in respect to blocking IL-2 signalling in a STAT5 phosphorylation assay using PBMCs of human origin. Cells were incubated with 10 g/ml antibody followed by 10U/ml of IL-2. Analysis was restricted to percentage of CD3-positive cells phosphorylating STAT5.
  • Figure 66 Functional characterization of Antibody 7 compared to an anti-human CD25 Fc silent control antibody in respect to inducing ADCC in a Reporter Bioassay.
  • CD25 expressing SR-786 cells were co- cultured with Jurkat T cells genetically engineered to express FcvRllla and an NFAT-response element that drives luciferase expression (NFAT-RE-luc2) in the presence of varying concentrations of antibodies (as shown in the Figures).
  • Figure 67 Functional characterization of Antibody 7 compared to an anti-human CD25 Fc silent control antibody in respect to phagocytosis of in-vitro differentiated Treg cells in an ADCP assay.
  • Figure 68 Characterization of Antibody 10, Antibody 1 1 , Antibody 12, Antibody 12, Antibody 13, Antibody 14, Antibody 15, Antibody 16 , Antibody 17, antibody 18, Antibody 19, Antibody 20 and Antibody 21 , binding to CD25 expressed on Karpas 299 cells at increasing antibody concentrations and comparing with human lgG1 isotype control.
  • Figure 69 Competition assays in the Octet. Binding the first Ab (Antibody 19) to the immobilized rhCD25 followed by either the first Ab again (as control) or a second Ab Daclizumab (A) or Basiliximab (B).
  • Figure 70 Characterization of Antibody 10, Antibody 1 1 , Antibody 12, Antibody 12, Antibody 13, Antibody 14, Antibody 15, Antibody 16, Antibody 17, antibody 18, Antibody 19, Antibody 20 and Antibody 21 compared to human lgG1 isotype control, Daclizumab-Hyp, or in the absence of a primary antibody in respect to blocking IL-2 signalling in a STAT5 phosphorylation assay using PBMCs of human origin. Cells were incubated with l O g/ml antibody followed by 10U/ml of IL-2. Analysis was restricted to percentage of CD3-positive cells phosphorylating STAT5.
  • Figure 71 Functional characterization of Antibody 19 compared to an anti-human CD25 Fc silent control antibody in respect to inducing ADCC in a Reporter Bioassay.
  • CD25 expressing SR-786 cells were co- cultured with Jurkat T cells genetically engineered to express FcvRllla and an NFAT-response element that drives luciferase expression (NFAT-RE-luc2) in the presence of varying concentrations of antibodies (as shown in the Figures).
  • Figure 72 Functional characterization of Antibody 19 compared to an anti-human CD25 Fc silent control antibody in respect to phagocytosis of in-vitro differentiated Treg cells in an ADCP assay.
  • Tregs were co- cultured with MCSF differentiated Macrophages in the presence of varying concentrations of antibodies (as shown in the Figures).
  • Two colour flow cytometric analysis was performed with CD14+ stained Macrophages and eFluor450-dye labelled Tregs. Residual target cells were defined as cells that were eFluor450-dye + /CD14 " .
  • Figure 73 Functional characterization of Antibody19, Antibody 12 and Antibody 20 compared to an anti- human CD25 Fc silent control antibody in respect to phagocytosis of in-vitro differentiated Treg cells in an ADCP assay. Tregs were co-cultured with MCSF differentiated Macrophages in the presence of varying concentrations of antibodies (as shown in the Figures).
  • %Phagocytosis 100 * [(percent dual positive)/(percent dual positive + percent residual targets)].
  • Figure 74 Therapeutic activity of non-IL-2 blocking anti-CD25 antibody, 7D4 mouse lgG2a, in
  • mice were treated with Gvax alone or in combination with, 7D4.
  • Figure 75 Therapeutic activity of non-IL-2 blocking anti-CD25 antibodies (7D4 and 2E4) compared to an IL-2 blocking antibody (PC61 ) in a CT26 tumour model using female BALB/c mice.
  • Anti-CD25 non- blocking antibodies 7D4 and 2E4 exert potent therapeutic activity against solid tumours. Both 7D4 and 2E4 are more potent than the IL-2 blocking antibody, PC61
  • Figure 76 Evaluation of therapeutic activity of non-IL-2 blocking anti-CD25 antibody 7D4 mlgG2a in an MCA205 model, at single and repeated injections in combination with anti-mouse PD-L1. * indicates mice alive at the end of the experiment.
  • Example 1 In vitro characterization and preparation of recombinant anti- mouse CD25, Treg- depleting antibodies that are either non-IL-2 blocking or IL-2 blocking.
  • variable regions of the heavy and light chains of rat anti-murine CD25 PC61 were resolved from PC-61.5.3 hybridoma (ATCC cat no. TIB-222) by rapid amplification of cDNA ends (RACE) and then cloned into the constant regions of murine lgG2a and ⁇ chains (or corresponding mouse lgG1 sequences that were isolated from the commercial plasmids (Invivogen).
  • Each antibody chain was then sub-cloned into a murine leukemia virus (MLV)-derived retroviral vector.
  • MLV murine leukemia virus
  • antibody was produced using K562 cells transduced with vectors encoding both the heavy and the light chains.
  • the antibody was purified from supernatants using a protein G HiTrap MabSelect column (GE Healthcare), dialyzed in phosphate-buffered saline (PBS), concentrated and filter-sterilized.
  • PBS phosphate-buffered saline
  • the re-cloned, anti-mouse CD25 heavy variable chain DNA sequence from PC-61 .5.3 antibody (mouse lgG2a) encodes for the following protein sequence:
  • 7D4-lgM sequencing was performed on the 7D4 hybridoma (ECACC, 881 1 1402).
  • Total RNA or mRNA was extracted and reverse transcription performed to obtain cDNA for the antibody heavy and light chains.
  • the variable heavy and variable light chains were amplified using degenerate forward primers that bound either in the signal peptide or framework region 1 and a reverse primer that bound in the antibody constant region.
  • the amplified genes were cloned and sequenced following a standard approach.
  • cDNA was generated by reverse transcription and a homopolymeric tail added to the 3' end of the cDNA.
  • the antibody variable domain genes were then amplified using gene specific primers followed by a standard cloning and sequencing approach. DNA was sequenced by conventional Sanger sequencing and data analysed using DNASTAR Lasergene software. Signal peptide and variable domain sequences were identified by comparison with known sequences in the IMGT database.
  • variable heavy and variable light domains were codon optimized for expression in a human cell line and synthesised with Nhel and Aval restriction sites 5' and 3' of the gene. Restriction digest cloning was performed to insert 7D4 variable heavy domain gene into separate expression vectors containing mouse lgG1 and lgG2a constant domains. Restriction digest cloning was performed to insert the 7F4 variable light domain gene into an expression vector containing the mouse kappa constant domain. Suspension HEK293 cells cultured in serum-free media were chemically co-transfected with heavy and light chain expression vector and cultured for a further 6 days at 37°C in a 5% C02 environment and with shaking at 140 rpm.
  • 2E4 was generated from the 2E4 hybridoma (Gift from Dr Ethan M. Shevach, National Institute of Health).
  • Hybridoma sequencing was performed by proprietary next generation sequencing (NGS) based technology to. RNA samples were used to generate a cDNA library. Libraries were sequenced on an lllumina platform. De novo assembly was used to reconstruct the sample transcriptome from raw data. Variable domain sequences were identified by comparison with known sequences.
  • NGS next generation sequencing
  • variable heavy domain protein sequence for anti-mouse CD25 2E4 antibody (mouse lgG1 ) has the following protein sequence:
  • variable light domain protein sequence for anti-mouse CD25 2E4 (mlg1 ) has the following protein sequence:
  • ForteBio affinity measurements were performed on an Octet RED384 generally as previously described (see, e.g., Estep P et al., 2013. Mabs. 5(2), 270-8). Briefly, ForteBio affinity measurements were performed by loading IgGs on-line onto AHQ sensors. Sensors were equilibrated off-line in assay buffer for 30 min and then monitored on-line for 60 seconds for baseline establishment. Sensors with loaded IgGs were exposed to 100 nM antigen for 3 minutes, and afterwards were transferred to assay buffer for 3 min for off-rate measurement. All kinetics were analyzed using the 1 :1 binding model.
  • Two mouse hybridomas have been selected as reference antibody for evaluating CD25 binding and Treg depleting properties of anti-mouse CD25, that are either non-IL-2 blocking or IL-2 blocking: 7D4 (mouse IgM isotype) and PC61 (mouse lgG1 isotype), respectively.
  • the IL-2 binding-related properties that were described in the literature have been preliminarily confirmed using the original, non-recombinant antibodies and recombinant mouse IL-2 (Fig. 1A).
  • the recombinant variants of such antibodies have been produced for testing antibodies in which the isotype is more active and relevant for functional studies (such as for Treg depletion or effects on other immune cells).
  • the change of isotype is required since the antibody aggregation properties of IgM antibodies may affect the results of the assays.
  • the recombinant 7D4(mlgG1 ) as the original non-recombinant IgM isotype antibody, still allows the binding mouse IL-2 to mouse CD25 (Fig. 1 B).
  • 7D4(mlgG1 ) also binds mouse CD25 on cell surface, similarly to recombinant PC61 (lgG2a) while a reference anti-human CD25 antibody does not bind (Fig. 1 C).
  • the different isotype (mouse lgG2a or mouse lgG1 ) does not affect this property since the Kd is similar between 7D4- based recombinant antibodies (around 1 nM) and comparable to the one of PC61 (mlgG2a), that is measured as 4.6 nM.
  • Granzyme B is a serine proteinase expressed by memory T cells and NK cells as well as activated CD4 and CD8 T cells, which strongly express and secrete GnzB during immunological reactions. This enzyme is an important mediator of cell death, tissue pathology and disease.
  • the in vitro stimulation and proliferation of T cells with anti-CD3 and anti-CD28 antibodies can be affected by cytokines and antibodies.
  • EXAMPLE 2 Treg depleting and anti-cancer properties of recombinant anti-mouse CD25, Treg- depleting antibodies that are either non-IL-2 blocking or IL-2 blocking.
  • mice Female BALB/c mice (BALB/c AnNcrl , Charles River) and Female C57BL/6 mice
  • CR Discovery Services specifically complies with the recommendations of the Guide for Care and Use of Laboratory Animals with respect to restraint, husbandry, surgical procedures, feed and fluid regulation, and veterinary care.
  • the animal care and use program at CR Discovery Services is accredited by the Association for Assessment and Accreditation of Laboratory Animal Care International, which assures compliance with accepted standards for the care and use of laboratory animals.
  • MCA205 tumour cells (3-methylcholanthrene-induced weakly immunogenic fibrosarcoma cells; from G. Kroemer, Gustave Roussy Cancer Institute) were cultured in Dulbecco's modified Eagle medium (DMEM, Sigma) supplemented with 10% fetal calf serum (FCS, Sigma), 100 U/mL penicillin, 100 pg/mL streptomycin and 2 mM L- glutamine (all from Gibco).
  • MC38 murine colon carcinoma cells were grown to mid-log phase in Dulbecco's Modified Eagle's Medium (DMEM) containing 10% fetal bovine serum, 2 mM glutamine, 100 units/mL, penicillin G, 100 pg/mL streptomycin sulphate and 25 Mg/mL gentamicin.
  • CT26 murine colon carcinoma cells were grown in RPMI-1640 medium containing 10% fetal bovine serum, 2 mM glutamine, 100 units/mL penicillin G sodium, 100 Mg/mL streptomycin sulphate, and 25 pg/mL gentamicin.
  • IMDM phenol red-free Iscove modified Dulbecco medium
  • Cultured tumour cells were trypsinized (MCA205) or not (MC38 and CT26), washed and resuspended in PBS and injected subcutaneously s.c.) in the flank (5 x 10 5 cells for MCA205 and MC38 models in C57BL/6 mice; 3 x 10 5 15 cells for CT26 models in BALB/c mice).
  • Antibodies were injected
  • tumours were measured twice weekly and volumes calculated as the product of three orthogonal diameters.
  • BD LSR II Fortessa (BD Biosciences). The following antibodies were used: anti-CD3 (clone 145-2C1 1 , ebioscience,25003182), anti-CD4 (clone RM4-5, BD biosciences, 560782), anti-CD8 (clone 53-6.7, Biolegend, 100750), anti-Granzyme B (clone GB1 1 , Invitrogen), anti- FoxP3 (Clone FJK-16s, eBiosciences) and Ki67 (Clone SolA15, eBiosciences, 48569882).
  • Lymph nodes (inguinal, axillary, and brachial) and tumors from mice were dissected into serum-free RPMI. Lymph nodes were dispersed through a 70- ⁇ filter whereas tumors were mechanically disrupted using gentleMACS (Miltenyl Biotech) and digested with a mixture of 0.33 mg/ml DNase (Sigma-Aldrich) and 0.27 mg/ml Liberase TL (Roche) in serum-free RPMI for 30 min at 37C. Tumours were filtered through a 70- ⁇ filter and the resulting tumour single cell suspensions were enriched for leukocytes by passage through a Ficoll-paque (GE Healthcare) gradient.
  • Tumours and LN were washed in complete RPMI, re- suspended in FACS buffer (500mL PBS, 2% FCS, 2mM EDTA) and placed in round-bottomed 96 well plates.
  • a mastermix of surface antibodies was prepared at the manufacturer's recommended dilution: anti-CD3 (clone 145-2C1 1 , ebioscience, 25003182), anti-CD4 (clone RM4-5, BD biosciences, 560782), anti-CD8 (clone 53-6.7, Biolegend, 100750).
  • a fixable viability dye eFlour780, eBioscience was also included the surface mastermix.
  • an intracellular staining panel was applied consisting of the following antibodies used at the manufacturers recommended dilution: anti-Granzyme B (clone GB1 1 , Invitrogen), anti-FoxP3 (Clone FJK-16s, eBiosciences) and Ki67 (Clone SolA15, eBiosciences, 48569882).
  • the MCA205 sarcoma murine model allows generating mice in which the immunological response and overall efficacy against a solid tumour can be evaluated for a panel of immunomodulatory compounds in a short time.
  • the recombinant, mouse lgG2a-based anti-mouse CD25 antibodies were tested for evaluating the changes in the T cell sub-populations that present as Tumour-infiltrating lymphocytes or within peripheral lymph nodes, as well as the tumour growth and viability of mice exposed to MCA205.
  • a further antibody (anti-mouse PD1 ) is included in the study as negative control for immunological effects on Treg.
  • MCA205 model mice that are treated with 7D4 show also a higher percentage of GnzB-positive cells, such as proliferating CD4-positive and CD8-positive T cells, with respect not only to anti-PD1 treatment but also 11-2 blocking PC61 (mlg2a).
  • PC61 mlg2a
  • 7D4(mlg2a) does not affect Teff cells, but it also increases the frequency of Teff cells as compared to PC61 (mlg2a), suggesting an even higher anti-tumour activity of an anti-human CD25 antibody that would not block the IL-2/CD25 interaction (Fig. 4).
  • lgG2a, anti-mouse CD25 antibodies show therapeutic activity against established CT26 tumours when administered in combination with anti-PD1 antibodies.
  • the non-IL-2 blocking 7D4(mlg2a) antibody shows a clearly higher therapeutic activity than the PC61-based antibody having the same isotype.
  • human lgG1 can be validated by using Duobody technology that allow the efficient association of single heavy and light chain from two distinct monospecific antibodies that are produced separately and contain single matching point mutations in the CH3 domain, thus allowing Fab exchange within a single heteromeric protein (Labrijn AF et al., Nat Protoc. 2014, 9:2450- 63).
  • the functional properties of such 7D4-based Duobody products (for example including an anti-PD1 or an anti-PD-L1 ) can be evaluated by using models of cell interaction and depletion that were used for validating 7D4-based antibodies and antibody combinations as described above.
  • Humax-TAC Humax-TAC, Basiliximab or Daclizumab, all having Kd in the nanomolar range for human CD25, but all blocking the binding of human IL-2 to human CD25 (using clone M-A251 as potential reference non-IL-2 blocking, anti-human CD25 to be included in the selection of anti-human CD25 of the invention).
  • Example 3 Further In vivo mouse model experiments with non IL2 blocking anti-mouse CD25 antibodies
  • each antibody mouse lgG2a isotype, IL-2 neutralizing antibody, PC61 mlgG1 , an anti-mouse CD25 blocking IL-2 signalling of mouse lgG1 isotype, and 7D4 mlgG2a, an anti-mous
  • the anti-CD25 depleting non-IL-2 blocking antibody 7D4 mlgG2a induced tumour rejection in treated mice, while the other antibodies showed no effect as monotherapy when compared to the isotype control mouse lgG2a.
  • Epitope binning of the antibodies was performed on a Forte Bio Octet Red384 system (Pall Forte Bio Corporation, Menlo Park, CA) using a standard sandwich format binning assay.
  • Anti-mouse CD25 PC61 antibody was loaded onto AMC sensors and unoccupied Fc-binding sites on the sensor were blocked with a non-relevant mouse lgG1 antibody. The sensors were then exposed to 15 nM target antigen followed by the 7D4 antibody. Data was processed using ForteBio's Data Analysis Software 7.0.
  • the color development was guantified with a charge coupled device (CCD) - camera and an image processing system.
  • CCD charge coupled device
  • the values obtained from the CCD camera range from 0 to 3000 mAU, similar to a standard 96-well plate ELISA-reader.
  • a separate set of positive and negative control peptides was synthesized in parallel and screened with irrelevant, control antibodies.
  • Epitope binning was performed to determine whether the antibodies bind to epitopes overlapping with those of the commercially available mouse anti-human non-IL-2 blocking CD25 antibody, 7G7B6. The antibodies were further characterised to determine the epitopes for the non-IL-2 blocking antibodies. The epitope of the anti-mouse CD25 blocking antibody, PC61 , was determined for comparison a control. The results of the epitope mapping are shown in Table 1 for anti-human CD25 antibodies and Table 2 for anti- mouse CD25 antibodies:
  • amino acid (aa) sequence numbering is based on human CD25 taken from the sequence published under the Uniprot accession number P01589.
  • the amino acid (aa) sequence numbering is based on mouse CD25 taken from the sequence published under the Uniprot accession number P01590.
  • the epitope mapping study that has been performed using Pepscan technology indicates that the anti- human antibodies bind human CD25 at an epitope that does not overlap with the IL-2 binding site on CD25.
  • the anti-human antibodies bind to a different epitope than basiliximab and dadizumab.
  • the epitope for Basiliximab and Dadizumab comprises residues in the region of amino acids 137-143 (of SEQ ID NO: 1 ), which overlaps with interaction side of CD25 to IL-2 (Binder M et al, Cancer Res 2007 vol 67(8): 3518-23).
  • Binding to CD25 expressing CHO cells was examined by staining test articles (anti-CD25 primary antibodies, 7D1 , PC61 and 2E4) with 30mg/ml antibodies followed by semi-log dilution series (7-point) for 30 minutes on ice. This was followed by staining with a secondary antibody (Alexa Fluor 647-AffiniPure Fab Fragment Goat Anti-Human IgG (H+L) - (Jackson ImmunoResearch)) concentration of 1 mg/ml for 30 minutes on ice. All samples were stained in duplicates. Live cells were gated using FSC vs SSC parameters by flow cytometry during sample acquisition.
  • Mean fluorescence intensity (MFI) of stained cells were plotted on an XY chart, graphing MFI against the log of the concentration, and the data fit to a non-linear regression curve from which the EC50 is calculated.
  • the results as shown in Figure 1 1 confirmed that the anti-mouse CD25 antibodies bind to CHO cells expressing mouse CD25.
  • the affinity for the anti-mouse CD25 antibodies, 7D4, PC61 and 2E4, was determined by measuring their KD by SPR in a Biacore 2000 using a CM-5 Sensor chip with an ambient experiment temperature of 25°C.
  • Anti-mouse antibody was initially immobilised across all flow cells in a analysis buffer (pH 7.4, 10mM HEPES, 150mM NaCI, 3mM EDTA, 0.05% Tween 20) to an RU of between 16,000-18,000 over 10 minutes.
  • the ligand (antibody test articles) was sub sequentially loaded to a capture level between 1 19- 163RU.
  • the analyte (recombinant mouse CD25 his tagged) was then associated in analysis buffer from a 2-fold dilution starting at 800nM with a lowest concentration of 3.13nM for 6 minutes. Dissociation was performed in analysis buffer over 10 minutes. Regeneration steps between sample concentrations were performed in 10 mM Glycin pH1.7 for 10 minutes. A flow rate of 25 ⁇ / ⁇ was maintained throughout the process. Kinetics data were fit using a global model bivalent analyte analysis software provided by Biacore with reference subtraction. The SPR based analysis is shown in Figure 12.
  • the Kd values that were established in this assay for the anti-mouse CD25 antibodies are the following: for 7D4, 2.6x10 _9 M; for 2E4 1 14 x10 9 M, and for PC61 3.6x10 9 M (result not shown).
  • Antibody competitions were performed on a Forte Bio Octet Red96 system (Pall Forte Bio Corp., USA) using a standard sandwich binning assay. 10nM anti-mouse CD25 antibody was be loaded onto AMC sensors for 900s and unoccupied Fc-binding sites on the sensor were blocked with a non-relevant mouse lgG2a antibody. Sensors were exposed to 15 nM target antigen (mouse CD25 his tagged) for 600s followed by a second anti-CD25 antibody (also at 10nM). Data was processed using Forte Bio Data Analysis Software 9.0. Additional binding by a second antibody after antigen association indicates an unoccupied epitope, while no binding indicates epitope blocking.
  • Pan T cells were isolated from splenocytes using the Dynabeads® FlowCompTM Mouse Pan T (CD90.2) kit from Invitrogen (Cat: 1 1465D). 200,000 cells were plated and rested for 2 hours at 37°C. Antibodies were added at 50ug/ml and incubated with the cells for 30 mins at 37°C, following which cells were stimulated with IL2 (50U/ml) for 10 mins at 37°C.
  • IL2 50U/ml
  • IL-2 induced STAT5 phosphorylation was stopped when the cells were fixed and permeabilized with the eBioscienceTM Foxp3 / Transcription Factor Staining Buffer Set (Invitrogen) and treated with the BD Phosflow Perm Buffer III (BD Biosciences). Cells were then simultaneously stained with surface and intracellular fluorochrome labelled antibodies (STAT5-Alexa Fluor 647 clone 47/stat5/pY694 BD
  • CD3 + T cells were defined using a CD3 PerCP-Cy5.5-A versus FCS-A plot and a gate was drawn on a histogram showing count versus STAT5 Alexa Fluor 647-A to determine the population of STAT5 + CD3 + T cells.
  • Further analysis of STAT5 phosphorylation by different T cell subsets (CD4 + , CD8 + , CD4 + FoxP3-) was also be assessed by gating on the respective subsets and analysed as above. Graphs and statistical analysis was performed using GraphPad Prism v7 (results not shown). The results are shown in Figure 14.
  • the anti-mouse antibodies, 7D4 and 2E4 were further evaluated with respect to its ability to bind CD25 and to not interfere with IL-2 signalling of CD25 expressing target cells.
  • 7D4 and 2E4 non IL-2 blockers, compete for the binding to CD25 while PC61 (an IL-2 signalling blocker) does not compete with 2E4 or 7D4 to bind CD25 ( Figure 12).
  • tumours 1 x10 5 4T1 cells in 200 ⁇ RPMI 1640 media were implanted in the 2 nd thoracic fat pad tissue of Balb/c mice.
  • tumours reached 50-100mm 3 the mice were randomised and a single intraperitoneal flat dose of either 2 g, 20 g or 200 g mouse anti-mouse CD25 (7D4) antibody was administered per mouse.
  • tumour tissues and whole blood was isolated for immunophenotyping.
  • Antibody 7D4 exhibited Treg depleting activity in both whole blood and tumour tissue based on day 3 and day 9 post-dose analysis by immunophenotyping ( Figure 15).
  • Binding of anti-CD25 Antibodies to human CD25-expressing cells The 7G76B is evaluated by binding to lymphoma human cell lines, Karpas 299, SU-DHL-1 and SR-786 and the in-vitro differentiated Tregs cells. Binding to CD25 expressing human cell lines (SU-DHL-1 and SR-786) was examined by firstly blocking the cells with Trustain (Biolegend) prior to incubation with anti- CD25 antibodies titrated in a semi-log dilution series from a top concentration of 20 g/ml, for 30mins at 4°C before being washed and incubated with PE conjugated anti-human IgG Fc antibody (Biolegend).
  • Mean fluorescence intensity (MFI) of stained cells were plotted on an XY chart, graphing MFI against the log of the concentration, and the data fit to a non-linear regression curve from which the EC50 is calculated.
  • the results as shown in Figure 16 and Figure 21 confirmed that the anti-CD25 antibodies binds to CD25 expressing cells.
  • IL-2-blocking was characterised using a STAT5 phosphorylation assay, in which IL-2 signalling was examined.
  • Previously frozen PBMC (Stemcell Technologies) were cultured in 96-U-bottom well plates in the presence of l O g/ml anti-CD25 antibodies for 30 minutes before adding IL-2 (Peprotech) at varying concentrations of 0.1 U/ml, 1 U/ml, or 10U/ml for 10 minutes in RPMI 1640 (Life Technologies) containing 10% FBS (Sigma), 2mM L-Glutamine (Life Technologies) and 10,000 U/ml Pen-Strep (Sigma).
  • IL-2 induced STAT5 phosphorylation was stopped when the cells were fixed and permeabilized with the eBioscienceTM Foxp3 / Transcription Factor Staining Buffer Set (Invitrogen) and treated with the BD Phosflow Perm Buffer III (BD Biosciences). Cells were then simultaneously stained with surface and intracellular fluorochrome labelled antibodies (STAT5-Alexa Fluor 647 clone 47/stat5/pY694 BD
  • CD3 + T cells were defined using a CD3 PerCP-Cy5.5-A versus FCS-A plot and a gate was drawn on a histogram showing count versus STAT5 Alexa Fluor 647-A to determine the population of STAT5 + CD3 + T cells.
  • ADCC assays Antibody-dependent cell-mediated cytotoxicity assays (ADCC assays) were performed for the characterization of anti-human CD25 antibodies using SU-DHL-1 , or SR-786 (CD25 positive) human cell lines as target cells with human NK cells as the source of effector cells.
  • NK cells were isolated from PBMCs of healthy donors using NK cell negative isolation kit (Stemcell Technologies). NK cells were cultured overnight in the presence of and 2 ng/mL IL-2 (Peprotech).
  • SU-DHL-1 , or SR-786 target cells were loaded with Calcein-AM (Thermofisher) and plated, 4 replicates per condition, in the presence of anti-CD25 or isotype antibodies for 30mins at 37°C 5% CO2.
  • NK cells were added to wells at a Target: Effector (T:E) ratio of 1 :10 (10,000 target cells and 100,000 effector cells) and incubated for 4hrs at 37°C 5% CO2. Readout of calcein fluorescence in the supernatant was performed on BMG Fluostar plate reader. The percentage of specific lysis was calculated relative to target cells alone (0% lysis) and target cells treated with 0.1 % Saponin (100% lysis). Graphs of the raw data were produced using Graphpad Prism v7 to generate dose response curves.
  • ADCP antibody-dependent cell-mediated phagocytosis
  • Treg Regulatory T cells
  • the anti-CD25 antibodies were then added at a top concentration of 1 g/ml followed by a log series (7 points) in duplicates. Cells and antibodies were incubated for 4 hours at 37°C 5% CO2. To assess ADCP, cells were placed on ice, stained with the cell surface marker CD14 (CD14-PerCP-Cy5.5 clone MfP9 BD Biosciences) and fixed with the eBioscience fixation buffer. Two colour flow cytometric analysis was performed using the Fortessa LSR X20. Residual target cells were defined as cells that were eFluor450-dye + /CD14 " . Macrophages were defined as CD14 + .
  • Interference with IL2 Ligand binding to CD25 was performed on a Forte Bio Octet Red384 system (Pall Forte Bio Corp., USA) using a standard sandwich binning assay.
  • the MA251 antibody was loaded onto AHQ sensors and unoccupied Fc-binding sites on the sensor were blocked with a non-relevant human lgG1 antibody.
  • Sensors were exposed to 100nM human CD25 followed by 100nM human IL-2.
  • Data was processed using Forte Bio Data Analysis Software 7.0. Additional binding by human IL2 after antigen association indicates an unoccupied epitope (non-competitor), while no binding indicates epitope blocking (competitor).
  • the 7G7B6 antibody was further evaluated with respect to its ability to not interfere with IL-2 signalling and its capacity to kill CD25 expressing target cells.
  • 7G7B6 did not block IL-2 signalling regardless of IL-2 concentrations tested while IL-2 signalling was completely blocked by the reference antibody Daclizumab ( Figure 17).
  • Daclizumab which has been shown to block the interaction of CD25 with IL-2 via the so-called "Tac" epitope (Queen C et al, 1989, PNAS.
  • 7G7B6 as a chimeric antibody has been characterized and demonstrates potent killing of CD25 positive cells (Tregs or cancer cell lines) and does not interfere with IL-2 signalling and consequently does not inhibit T effector responses. 7G7B6 is thus a Treg depleting antibody which could be applied for the treatment of cancer, as monotherapy or in combination.
  • the MA-251 antibody was further evaluated with respect to its ability to not interfere with IL-2 signalling.
  • the MA251 antibody was assessed in the IL2-CD25 Octet competition assay. Simultaneous IL2 binding and MA251 binding to CD25 was observed ( Figure 23), showing that the MA251 binds in a noncompetitive manner. In the STAT5 assay, MA-251 did not block IL-2 signalling regardless of IL-2 concentrations tested while IL-2 signalling was completely blocked by the reference antibody Daclizumab ( Figure 22).
  • Daclizumab which has been shown to block the interaction of CD25 with IL-2 via the so- called “Tac” epitope (Queen C et al, 1989 and Bielekova B, 2013) binds to a different epitope than MA- 251 ( Figure 10 and Figure 24 (E)), which can explain why Daclizumab blocks IL-2 signalling and the MA- 251 does not block the IL-2 signalling in the STAT5 phosphorylation assay ( Figure 22).
  • Non blockers of IL-2 signal mAbs (Antibody 1 and Antibody 3) compete with each other or with 7G7B6 and MA251 while they do not compete with research Daclizumab or research Basiliximab (examples (A) to (N), Figure 24).
  • IL-2 signalling blockers i.e. TSK031
  • Example 9 Therapeutic analysis of a non-blocking antibody
  • mice with palpable tumours were randomised into either treatment with vehicle or Antibody 1 at 2mg/kg, twice weekly.
  • mice with a tumour size of 100-200mm 3 were randomised and dosed with either vehicle, Antibody 1 at 2mg/kg, twice weekly or a single dose of antibody 1 at 10mg/kg.
  • Antibody 1 prevented growth in 9/10 mice with palpable tumours dosed at 2mg/kg, twice weekly ( Figure 25 (A)-(B)). In mice with a tumour size of 100-200mm 3 , Antibody 1 also prevented tumour growth at doses of 2mg/kg, twice weekly and 10mg/kg single dose ( Figure 25 (C)-(E)).
  • the affinity for the anti-human CD25 antibodies was determined by measuring their KD by SPR in a Biacore 2000 using a CM-5 Sensor chip with an ambient experiment temperature of 25°C.
  • Anti-human antibody was initially immobilised across all flow cells in analysis buffer (pH 7.4, 10mM HEPES, 150mM NaCI, 3mM EDTA, 0.05% Tween 20) to an RU of between 12,000-14,000 over 10 minutes.
  • the ligand (antibody test articles) was sub sequentially loaded to a capture level between 145-190RU.
  • the analyte (recombinant human CD25 his tagged) was then associated in analysis buffer from a 2-fold dilution starting at 400nM with a lowest concentration of 3.13nM for 6 minutes.
  • the affinity for the antihuman CD25 antibodies was determined by measuring their KD by biolayer interferometry on the Octet Red 96 system (Pall Forte Bio Corp., USA). Sensors were equilibrated off-line in kinetic buffer for 10 minutes and then monitored on-line for 60 seconds for baseline establishment. 13.32nM of antibody was loaded to the AHC biosensor for 200s followed by varying concentrations of the rhCD25his tagged (1 : 3 serial dilutions, from 50nM to 0.54nM) for 600s and let them to dissociate in kinetics buffer for 400s. Kinetics data were fit using a global 1 : 1analysis software provided by Pall Forte Bio with reference subtraction. Results are shown in Figure 26 (F).
  • the results are shown Figure 26.
  • the Kd values that were established in this assay for the anti-CD25 antibodies are the following: for Antibody 1 , 3.2x10 -9 M; for Antibody 3, 3.8x10 -9 M, and for Daclizumab 0.61x10- 9 M.
  • the candidate hits are evaluated by binding to lymphoma human cell lines such as Karpas 299, SU-DHL- 1 and SR-786 cells, in-vitro differentiated Tregs cells, activated human or cyno PBMC, the HSC-F Cynomolgus monkey T cell line, and CHO cells.
  • lymphoma human cell lines such as Karpas 299, SU-DHL- 1 and SR-786 cells, in-vitro differentiated Tregs cells, activated human or cyno PBMC, the HSC-F Cynomolgus monkey T cell line, and CHO cells.
  • Binding to CD25 expressing human cell lines was examined by firstly blocking the cells with Trustain (Biolegend) prior to incubation with anti-CD25 antibodies titrated in a semi-log dilution series from a top concentration of 20 g/ml, for 30mins at 4°C before being washed and incubated with PE conjugated anti-human IgG Fc antibody (Biolegend). Cells were washed again and resuspended in FACS buffer containing DAPI and acquired on the Intellicyt iQue. Live cells were gated using FSC vs SSC parameters by flow cytometry during sample acquisition. Geo Mean Intensity of stained cells were plotted on an XY chart, graphing Geo Mean Intensity against the log of the concentration, and the data fit to a non-linear regression curve from which the EC50 is calculated.
  • Live cells were gated using FSC vs SSC parameters by flow cytometry during sample acquisition.
  • Mean fluorescence intensity (MFI) of stained cells were plotted on an XY chart, graphing MFI against the log of the concentration, and the data fit to a non-linear regression curve from which the EC50 is calculated.
  • Binding to CD25 expressing activated human and Cynomolgus monkey PMBC was examined by staining test articles (anti-CD25 primary antibodies) with 20mg/ml antibodies followed by semi-log dilution series (7-point) for 30 minutes on ice. This was followed by staining with a secondary antibody (rabbit anti- human Fcg F(ab')2- (Jackson ImmunoResearch)) concentration of 5mg/ml for 30 minutes on ice. All samples were stained in triplicates. To minimize cross-linking induced cell death mediated by binding of the secondary antibody, cell lines were examined in staining cohorts of 4 test articles at a time.
  • Live lymphocytes were gated using FSC vs SSC parameters by flow cytometry during sample acquisition.
  • Mean fluorescence intensity (MFI) of gated CD4 + and CD8 + T cell subsets were plotted on an XY chart, graphing MFI against the log of the concentration, and the data fit to a non-linear regression curve from which the EC50 was calculated.
  • Binding to CD25 expressing CHO cells was also examined. Approximately 100,000 cells overexpressing the antigen were washed with wash buffer and incubated with 100 ⁇ 100 nM IgG for 15 minutes at room temperature. Cells were then washed twice with wash buffer and incubated with 100 ⁇ of 1 :100 Human- PE for 15 minutes on ice. Cells were then washed twice with wash buffer and analyzed on a FACS Canto II analyzer (BD Biosciences.) An unmodified CHO cell line was also used as a negative control
  • IL-2-blocking was characterised using a STAT5 phosphorylation assay, in which IL-2 signalling was examined.
  • Previously frozen PBMC (Stemcell Technologies) were cultured in 96-U-bottom well plates in the presence of l O g/ml anti-CD25 antibodies for 30 minutes before adding IL-2 (Peprotech) at varying concentrations of 10U/ml or 0.25U/ml, 0.74U/ml, 2.22U/ml, 6.66U/ml or 20U/ml for 10 minutes in RPMI 1640 (Life Technologies) containing 10% FBS (Sigma), 2mM L-Glutamine (Life Technologies) and 10,000 U/ml Pen-Strep (Sigma).
  • IL-2 induced STAT5 phosphorylation was stopped when the cells were fixed and permeabilized with the eBioscienceTM Foxp3 / Transcription Factor Staining Buffer Set (Invitrogen) and treated with the BD Phosflow Perm Buffer III (BD Biosciences). Cells were then simultaneously stained with surface and intracellular fluorochrome labelled antibodies (STAT5-Alexa Fluor 647 clone
  • CD3+ T cells were defined using a CD3 PerCP-Cy5.5-A versus FCS-A plot and a gate was drawn on a histogram showing count versus STAT5 Alexa Fluor 647-A to determine the population of STAT5+CD3+ T cells.
  • ADCC assays Antibody-dependent cell-mediated cytotoxicity assays (ADCC assays) were performed for the characterization of anti-human CD25 antibodies using SU-DHL-1 , or SR-786 (CD25 positive) human cell lines as target cells with human NK cells as the source of effector cells.
  • NK cells were isolated from PBMCs of healthy donors using NK cell negative isolation kit (Stemcell Technologies). NK cells were cultured overnight in the presence of and 2 ng/mL IL-2 (Peprotech).
  • SU-DHL-1 , or SR-786 target cells were loaded with Calcein-AM (Thermofisher) and plated, 4 replicates per condition, in the presence of anti-CD25 or isotype antibodies for 30mins at 37°C 5% CO2.
  • NK cells were added to wells at a Target: Effector (T:E) ratio of 1 :10 (10,000 target cells and 100,000 effector cells) and incubated for 4hrs at 37°C 5% CO2. Readout of calcein fluorescence in the supernatant was performed on BMG Fluostar plate reader. The percentage of specific lysis was calculated relative to target cells alone (0% lysis) and target cells treated with 0.1 % Saponin (100% lysis). Graphs of the raw data were produced using Graphpad Prism v7 to generate dose response curves. Percentage target cell lysis was plotted on an XY chart, graphing normalized Calcein AM percentage release against the log of the concentration, and the data fit to a no-linear regression curve from which the EC50 was calculated.
  • T:E Target: Effector
  • ADDC was also determined in a luciferase reporter system assay.
  • CD25-expressing SR786 cells herein called target (T) cells, are incubated for 20 minutes at 37oC with different concentrations of mAbs against CD25 (or control IgG) in a low-lgG FBS-supplemented medium (4% FBS in RPMI).
  • ADCC effector (E) cells are then added to the cell-mAbs mixture at an E:T ratio of 1 : 1.
  • the effector cells are Jurkat cells stably transfected with a luciferase reporter system and over-expressing CD16/FcgammaRIIIA
  • luciferase activity is measured by mean of luminescence release from the hydrolysis of a specific luciferase substrate, following manufacturer instruction (Promega Bio-Glow protocol).
  • ADCP antibody-dependent cell-mediated phagocytosis
  • Treg Regulatory T cells
  • the anti-CD25 antibodies were then added at a top concentration of 1 g/ml followed by a log series (7 points) in duplicates. Cells and antibodies were incubated for 4 hours at 37°C 5% CO2. To assess ADCP, cells were placed on ice, stained with the cell surface marker CD14 (CD14- PerCP-Cy5.5 clone MfP9 BD Biosciences) and fixed with the eBioscience fixation buffer. Two colour flow cytometric analysis was performed using the Fortessa LSR X20. Residual target cells were defined as cells that were eFluor450-dye+/CD14-. Macrophages were defined as CD14+. Dual-labelled cells (eFluor450-dye+/CD14+) were considered to represent phagocytosis of targets by Macrophages.
  • 5,000 cells/well of SUDHL-1 target cells were plated (25 ⁇ / ⁇ ) using a 96 well white polystyrene plate (Costar; Cat# 3917).
  • Test antibodies were serially diluted using 3 fold dilutions and 25 ⁇ added to the cells.
  • 50,000 effector cells were added per well in 25 ⁇ volume to result in a 10: 1 ratio of effector and target cells. All target cells, antibodies, and effector cells were plated using cell culture media. The plate was incubated for 18 hours at 37°C. Plates were then removed from the incubator and kept at room temperature for 20 minutes. 60 ⁇ of Bio-Glo Luciferase assay Substrate buffer was added to each well followed by 30 minutes incubation and Luminescence was measured using the GloMax Multi Detection System (Promega).
  • the Antibody 1 antibody was evaluated with respect to its ability to not interfere with IL-2 signalling and its capacity to kill CD25 expressing target cells.
  • the results of the binding to rhCD25, and IL-2 competitive binding analysis are shown in Figures 27 and 28.
  • the ligand binding assay using the Octet showed that Antibody 1 does not affect IL-2 binding to CD25 ( Figure 29). This was confirmed in the STAT5 assay where Antibody 1 did not block IL-2 signalling regardless of IL-2 concentrations tested while IL-2 signalling was completely blocked by the reference antibody Daclizumab ( Figure 31 ).
  • Daclizumab which has been shown to block the interaction of CD25 with IL-2 via the so-called "Tac" epitope (Queen C et al, 1989 and Bielekova B, 2013) binds to a different epitope than Antibody 1 ( Figure 30), which can explain why Daclizumab blocks IL-2 signalling and the Antibody 1 does not block the IL-2 signalling in the STAT5 phosphorylation assay ( Figure 31 ). Additionally, Daclizumab reduces effector responses of activated T cells, probably due to its blocking of IL-2 signalling, while Antibody 1 , which does not block IL-2 signalling, does not have a negative impact on T cell responses (Figure 32). Finally, Antibody 1 kills CD25 expressing cells, tumor cells or regulatory T cells, via ADCC ( Figure 33) and ADCP ( Figure 34) when compared to the lgG1 isotype antibody.
  • Antibody 1 has been characterized and demonstrates potent killing of CD25 positive cells (Tregs or cancer cell lines) and does not interfere with IL-2 signalling and consequently does not inhibit T effector responses.
  • Antibody 1 is thus a Treg depleting antibody which could be applied for the treatment of cancer, as monotherapy or in combination.
  • the Antibody 3 antibody was evaluated with respect to its ability to not interfere with IL-2 signalling and its capacity to kill of CD25 expressing target cells.
  • the results of the binding to rhCD25, and IL-2 competitive binding analysis are shown in Figures 35 and 36.
  • the ligand binding assay using the Octet showed that Antibody 3 does not affect IL-2 binding to CD25 ( Figure 37). This was confirmed in the STAT5 assay where Antibody 3 did not block IL-2 signalling regardless of IL-2 concentrations tested while IL-2 signalling was completely blocked by the reference antibody Daclizumab ( Figure 39).
  • Daclizumab which has been shown to block the interaction of CD25 with IL-2 via the so-called "Tac" epitope binds to a different epitope than Antibody 3 ( Figure 38), which can explain why Daclizumab blocks IL-2 signalling and the Antibody 3 does not block the IL-2 signalling in the STAT5 phosphorylation assay ( Figure 39). Additionally, Daclizumab reduces effector responses of activated T cells, probably due to its blocking of IL-2 signalling, while Antibody 3, which does not block IL-2 signalling, has only minimal impact, if any, on T cell responses when compared to the condition without antibody or with isotype control (Figure 40). Finally, Antibody 3 kills CD25 expressing cells, tumor cells or regulatory T cells, via ADCC ( Figure 41 ) and ADCP ( Figure 42) when compared to the lgG1 isotype antibody.
  • Antibody 3 has been characterized and demonstrates potent killing of CD25 positive cells (Tregs or cancer cell lines) and does not interfere with IL-2 signalling and consequently does not inhibit T effector responses.
  • Antibody 3 is thus a Treg depleting antibody which could be applied for the treatment of cancer, as monotherapy or in combination.
  • Daclizumab which has been shown to block the interaction of CD25 with IL-2 via the so-called "Tac" epitope binds to a different epitope than Antibody 4 ( Figure 46), which can explain why Daclizumab blocks IL-2 signalling and the Antibody 4 does not block the IL-2 signalling in the STAT5 phosphorylation assay ( Figure 47). Additionally, Daclizumab reduces effector responses of activated T cells, probably due to its blocking of IL-2 signalling, while Antibody 4, which does not block IL-2 signalling, does not have a negative impact on T cell responses (Figure 48). Finally, Antibody 4 kills CD25 expressing cells, tumor cells or regulatory T cells, via ADCC ( Figure 49) and ADCP ( Figure 50) when compared to the lgG1 isotype antibody.
  • Antibody 4 has been characterized and demonstrates potent killing of CD25 positive cells (Tregs or cancer cell lines) and does not interfere with IL-2 signalling and consequently does not inhibit T effector responses.
  • Antibody 4 is thus a Treg depleting antibody which could be applied for the treatment of cancer, as monotherapy or in combination.
  • the Antibody 2 antibody was evaluated with respect to its ability to not interfere with IL-2 signalling and its capacity to kill CD25 expressing target cells.
  • the results of the binding to rhCD25, and IL-2 competitive binding analysis are shown in Figures 51 and 52.
  • the ligand binding assay using the Octet showed that Antibody 2 does not affect IL-2 binding to CD25 ( Figure 53). This was confirmed in the STAT5 assay where Antibody 2 did not block IL-2 signalling regardless of IL-2 concentrations tested while IL-2 signalling was completely blocked by the reference antibody Daclizumab ( Figure 55).
  • Daclizumab which has been shown to block the interaction of CD25 with IL-2 via the so-called "Tac" epitope binds to a different epitope than Antibody 2 ( Figure 54), which can explain why Daclizumab blocks IL-2 signalling and the Antibody 2 does not block the IL-2 signalling in the STAT5 phosphorylation assay ( Figure 55).
  • Antibody 2 kills CD25 expressing cells, tumor cells or regulatory T cells, via ADCC ( Figure 56) and ADCP ( Figure 57) when compared to the lgG1 isotype antibody.
  • Antibody 2 has been characterized and demonstrates potent killing of CD25 positive cells (Tregs or cancer cell lines) and does not interfere with IL-2 signalling and consequently does not inhibit T effector responses.
  • Antibody 2 is thus a Treg depleting antibody which could be applied for the treatment of cancer, as monotherapy or in combination.
  • the Antibody 5 antibody is characterised as comprising a heavy chain variable region comprising the sequence of:
  • variable light chain comprising the sequence:
  • CDRs complementarity determining regions
  • FRs framework regions
  • the Antibody 5 was evaluated with respect to its ability to not interfere with IL-2 signalling and its capacity to kill of CD25 expressing target cells.
  • the STAT5 assay showed that Antibody 5 did not block IL-2 signalling tested while IL-2 signalling was completely blocked by the antibody Daclizumab ( Figure 59).
  • the competition assay showed that Antibody 5 does not compete with the IL-2 signal blockers Daclizumab or Basiliximab Figure 60 (A) and (B) while it does compete with 7G7B6 (non-IL-2 blocker) ( Figure 60(C)).
  • Antibody5 kills CD25 expressing cells, tumor cells or regulatory T cells, via ADCC ( Figure 61 ) and ADCP ( Figure 61 ) when compared to an anti-human CD25 Fc silent control antibody.
  • Antibody 5 has been characterized and demonstrates potent killing of CD25 positive cells (Tregs or cancer cell lines) and does not interfere with IL-2 signalling and consequently does not inhibit T effector responses.
  • Antibody 5 is thus a Treg depleting antibody which could be applied for the treatment of cancer, as monotherapy or in combination.
  • the Antibody 6, Antibody 7, Antibody 8 and Antibody 9 antibodies are characterised as comprising the following sequences:
  • Antibody 6 comprises a heavy chain variable region comprising the sequence of:
  • variable light chain comprising the sequence:
  • Antibody 7 comprises a heavy chain variable region comprising the sequence of:
  • variable light chain comprising the sequence:
  • Antibody 8 comprises a heavy chain variable region comprising the sequence of:
  • variable light chain comprising the sequence:
  • Antibody 9 comprises a heavy chain variable region comprising the sequence of:
  • variable light chain comprising the sequence:
  • CDRs complementarity determining regions
  • FRs framework regions
  • Daclizumab or Basiliximab Figure 64 (A) and (B).
  • Antibody 7 kills CD25 expressing cells, tumor cells or regulatory T cells, via ADCC ( Figure 66) and ADCP ( Figure 67) when compared to an anti-human CD25 Fc silent control antibody.
  • Treg depleting antibodies demonstrates potent killing of CD25 positive cells (Tregs or cancer cell lines) and does not interfere with IL-2 signalling and consequently does not inhibit T effector responses.
  • the antibodies are thus a Treg depleting antibodies which could be applied for the treatment of cancer, as monotherapy or in combination.
  • Antibody 10 Antibody 1 1 , Antibody 12, Antibody 12, Antibody 13, Antibody 14, Antibody 15, Antibody 16 Antibody 17, antibody 18, Antibody 19, Antibody 20, Antibody 21 , antibodies are characterised as comprising a heavy chain variable region comprising the sequence of:
  • CDRs complementarity determining regions
  • FRs framework regions
  • Antibody 10 Antibody 1 1 , Antibody 12, Antibody 12, Antibody 13, Antibody 14, Antibody 15, Antibody 16, Antibody 17, antibody 18, Antibody 19, Antibody 20, Antibody 21 have been characterized and demonstrates potent killing of CD25 positive cells (Tregs or cancer cell lines) and does not interfere with IL-2 signalling and consequently does not inhibit T effector responses.
  • the Antibodies are thus Treg depleting antibodies which could be applied for the treatment of cancer, as monotherapy or in combination.
  • Example 12 Therapeutic analysis in combination with a cancer vaccine The therapeutic activity of a non-IL-2 blocking anti-CD25 antibody, 7D4 mouse lgG2a, in combination with GVAX in a B16BI6 immune therapy resistant mice model was determined. At day 0, 50x 10 3 B16BI6 cells were implanted i.d. At day 5, 200 g non-IL-2 blocking anti-CD25 antibody was dosed i.p, or not. At days 6, 9 and 12 mice were treated, or not, with 1x10 6 irradiated (150 Gy) B16BI6 cells adjuvanted with GM- CSF (GVAX). Tumour growth and mice survival was monitored until day 33. The results are shown in Figure 74.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Public Health (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Steroid Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/EP2018/056312 2017-03-17 2018-03-13 Fc-optimized anti-cd25 for tumour specific cell depletion Ceased WO2018167104A1 (en)

Priority Applications (118)

Application Number Priority Date Filing Date Title
US16/494,962 US11879014B2 (en) 2017-03-17 2018-03-03 Method of treating cancer or depleting regulatory T cells in a subject by administering a human IGG1 anti-CD25 antibody
EP18711313.9A EP3596123B1 (en) 2017-03-17 2018-03-13 Fc-optimized anti-cd25 for tumour specific cell depletion
CN201880018976.8A CN110869388B (zh) 2017-03-17 2018-03-13 用于肿瘤特异性细胞消耗的Fc优化的抗CD25
AU2018233976A AU2018233976B2 (en) 2017-03-17 2018-03-13 Fc-optimized anti-CD25 for tumour specific cell depletion
SI201831085T SI3596123T1 (sl) 2017-03-17 2018-03-13 Fc optamizirana protitelesa anti-cd25, za tumorsko specifično razgradnjo celic
MX2019010974A MX2019010974A (es) 2017-03-17 2018-03-13 Compuestos y metodos para la reduccion celular especifica de tumor.
MYPI2019005313A MY208220A (en) 2017-03-17 2018-03-13 Fc-optimized anti-cd25 for tumour specific cell depletion
LTEPPCT/EP2018/056312T LT3596123T (lt) 2017-03-17 2018-03-13 Fc atžvilgiu optimizuotas anti-cd25 navikui specifinių ląstelių populiacijos sumažinimui
RS20240376A RS65351B1 (sr) 2017-03-17 2018-03-13 Fc-optimizovana anti-cd25 antitela za tumor-specifičnu depleciju ćelija
ES18711313T ES2975063T3 (es) 2017-03-17 2018-03-13 Anti-CD25 optimizado para FC para el agotamiento celular específico de tumores
PE2019001847A PE20191812A1 (es) 2017-03-17 2018-03-13 Compuestos y metodos para la reduccion celular especifica de tumor
SG11201908578Y SG11201908578YA (en) 2017-03-17 2018-03-13 Fc-optimized anti-cd25 for tumour specific cell depletion
CR20190477A CR20190477A (es) 2017-03-17 2018-03-13 Versión optimizada para fc de anticuerpo anti-cd25 para la reducción celular específica de tumor
JP2019550705A JP2020514363A (ja) 2017-03-17 2018-03-13 腫瘍特異的細胞枯渇のためのFc最適化抗CD25
KR1020197030283A KR20190130137A (ko) 2017-03-17 2018-03-13 종양 특이적 세포 고갈을 위한 fc-최적화된 항-cd25
PL18711313.9T PL3596123T3 (pl) 2017-03-17 2018-03-13 Anty-cd25 zoptymalizowane pod względem fc do specyficznego zmniejszania liczby komórek nowotworu
NZ756984A NZ756984B2 (en) 2018-03-13 Fc-optimized anti-cd25 for tumour specific cell depletion
BR112019017017-0A BR112019017017A2 (pt) 2017-03-17 2018-03-13 método de tratamento de um indivíduo humano que tem câncer, anticorpo anti-cd25, uso de um anticorpo anti-cd25, combinação de um anticorpo anti-cd25, kit para o uso no tratamento de câncer, composição farmacêutica, combinação, anticorpo biespecífico, método de tratamento de câncer, e método de depleção de células t regulatórias em um indivíduo
MA49881A MA49881B1 (fr) 2017-03-17 2018-03-13 Anticoprs anti cd25 optimisés dans leur partie fc impliquant la déplétion de cellules spécifiques aux tumeurs
CA3056506A CA3056506A1 (en) 2017-03-17 2018-03-13 Fc-optimized anti-cd25 for tumour specific cell depletion
FIEP18711313.9T FI3596123T3 (fi) 2017-03-17 2018-03-13 Fc-optimoitu anti-cd25 kasvainspesifistä solujen poistoa varten
DK18711313.9T DK3596123T3 (da) 2017-03-17 2018-03-13 FC-optimeret anti-CD25 til tumorspecifik celledepletering
HRP20240469TT HRP20240469T1 (hr) 2017-03-17 2018-03-13 Fc-optimizirana anti-cd25 antitijela za tumor-specifično istrošenje stanica
CA3088246A CA3088246A1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
EP19710416.9A EP3765507B1 (en) 2018-03-13 2019-03-13 Anti-cd25 antibody agents
AU2019233581A AU2019233581B2 (en) 2018-03-13 2019-03-13 Anti-CD25 for tumour specific cell depletion
JP2020547332A JP7565797B2 (ja) 2018-03-13 2019-03-13 腫瘍特異的細胞枯渇のための抗cd25
BR112020016499-2A BR112020016499A2 (pt) 2018-03-13 2019-03-13 anticorpo ou fragmento de ligação a antígeno do mesmo, anticorpo ou um fragmento de ligação a antígeno que se ligam especificamente a um epótipo de cd25 humano, variante amadurecida por afinidade, molécula e vetor de ácido nucleico, célula hospedeira, método para produzir um anticorpo ou fragmento de ligação a antígeno do mesmo, composição, composição farmacêutica, uso de um anticorpo ou fragmento de ligação a antígeno do mesmo, método para tratar câncer em um indivíduo, método para esgotar células t reguladoras em um tumor em um indivíduo, anticorpo ou fragmento de ligação a antígeno que compete com um anticorpo, kit, método para preparar um anticorpo anti-cd25 e método para preparar uma composição farmacêutica
AU2019233576A AU2019233576A1 (en) 2018-03-13 2019-03-13 Anti-CD25 for tumour specific cell depletion
CN201980019247.9A CN112020513B (zh) 2018-03-13 2019-03-13 用于肿瘤特异性细胞清除的抗-cd25
US16/352,709 US10752691B2 (en) 2018-03-13 2019-03-13 Anti-CD25 antibody agents
US16/979,931 US11851494B2 (en) 2018-03-13 2019-03-13 Anti-CD25 for tumour specific cell depletion
PCT/EP2019/056256 WO2019175222A1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
CR20200465A CR20200465A (es) 2018-03-13 2019-03-13 Agentes anticuerpos anti-cd25
US16/979,932 US11873341B2 (en) 2018-03-13 2019-03-13 Anti-CD25 for tumour specific cell depletion
CN201980019257.2A CN112218891B (zh) 2018-03-13 2019-03-13 抗-cd25抗体剂
EP19709955.9A EP3765503B1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
EP19709956.7A EP3765504B1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
SG11202008733YA SG11202008733YA (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
CN201980019256.8A CN112020516B (zh) 2018-03-13 2019-03-13 用于肿瘤特异性细胞清除的抗-cd25
RU2020128108A RU2020128108A (ru) 2018-03-13 2019-03-13 Антитело против cd25 для опухоль-специфической клеточной деплеции
CR20200467A CR20200467A (es) 2018-03-13 2019-03-13 Agentes anticuerpos anti-cd25
PCT/EP2019/056260 WO2019175226A1 (en) 2018-03-13 2019-03-13 Anti-cd25 antibody agents
MA051992A MA51992A (fr) 2018-03-13 2019-03-13 Anticorps anti-cd25 pour la déplétion de cellules spécifiques d'une tumeur
PCT/EP2019/056247 WO2019175215A1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
RU2020128081A RU2843220C2 (ru) 2018-03-13 2019-03-13 Антитело против cd25 для опухоль-специфической клеточной деплеции
PCT/EP2019/056252 WO2019175220A1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
PE2020001292A PE20210287A1 (es) 2018-03-13 2019-03-13 Anti-cd25 para el agotamiento de celulas tumorales especificas
AU2019233575A AU2019233575A1 (en) 2018-03-13 2019-03-13 Anti-CD25 for tumour specific cell depletion
CN201980019249.8A CN112020515B (zh) 2018-03-13 2019-03-13 用于肿瘤特异性细胞清除的抗-cd25
JP2020547363A JP7451414B2 (ja) 2018-03-13 2019-03-13 抗cd25抗体剤
JP2020547333A JP7510348B2 (ja) 2018-03-13 2019-03-13 腫瘍特異的細胞枯渇のための抗cd25
TW108108467A TW202003034A (zh) 2018-03-13 2019-03-13 抗-cd25抗體藥劑
CN201980019235.6A CN112041345B (zh) 2018-03-13 2019-03-13 用于肿瘤特异性细胞清除的抗-cd25
CR20200466A CR20200466A (es) 2018-03-13 2019-03-13 Agentes anticuerpos anti-cd25
MX2020008769A MX2020008769A (es) 2018-03-13 2019-03-13 Agentes anticuerpos anti-cd25.
ES19709955T ES2992392T3 (es) 2018-03-13 2019-03-13 Anti-CD25 para el agotamiento de células específicas de tumor
MA051997A MA51997A (fr) 2018-03-13 2019-03-13 Anticorps anti-cd25 pour la déplétion de cellules spécifiques d'une tumeur
CN201980019248.3A CN112020514B (zh) 2018-03-13 2019-03-13 用于肿瘤特异性细胞清除的抗-cd25
MX2020008768A MX2020008768A (es) 2018-03-13 2019-03-13 Agentes anticuerpos anti-cd25.
BR112020016501-8A BR112020016501A2 (pt) 2018-03-13 2019-03-13 anticorpo ou fragmento de ligação a antígeno do mesmo, anticorpo ou um fragmento de ligação a antígeno que se ligam especificamente a um epótipo de cd25 humano, variante amadurecida por afinidade de um anticorpo ou seu fragmento de ligação a antígeno, molécula de ácido nucleico, vetor de ácido nucleico, célula hospedeira, método para produzir um anticorpo ou fragmento de ligação a antígeno do mesmo, composição farmacêutica, uso de um anticorpo ou fragmento de ligação a antígeno do mesmo, método para tratar câncer em um indivíduo, método para esgotar células t reguladoras em um tumor em um indivíduo, anticorpo ou fragmento de ligação a antígeno que compete com um anticorpo, kit, método para preparar um anticorpo anti-cd25 e método para preparar uma composição farmacêutica
KR1020207029221A KR102909650B1 (ko) 2018-03-13 2019-03-13 종양 특이적 세포 고갈에 대한 항-cd25
EP19709958.3A EP3765506B1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
US16/979,930 US11814434B2 (en) 2018-03-13 2019-03-13 Anti-CD25 for tumour specific cell depletion
TW108108452A TW201940515A (zh) 2018-03-13 2019-03-13 抗-cd25抗體藥劑
JP2020547415A JP2021515568A (ja) 2018-03-13 2019-03-13 腫瘍特異的細胞枯渇のための抗cd25
US16/979,929 US11802161B2 (en) 2018-03-13 2019-03-13 Anti-CD25 for tumour specific cell depletion
CA3088659A CA3088659A1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
MX2020008770A MX2020008770A (es) 2018-03-13 2019-03-13 Agentes anticuerpos anti-cd25.
UAA202006342A UA129536C2 (uk) 2018-03-13 2019-03-13 Анти-cd25 для виснаження пухлиноспецифічних клітин
US16/979,933 US11919960B2 (en) 2018-03-13 2019-03-13 Anti-CD25 antibody agents
CA3088671A CA3088671A1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
PCT/EP2019/056248 WO2019175216A1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
PE2020001320A PE20210289A1 (es) 2018-03-13 2019-03-13 Anti-cd25 para el agotamiento de celulas tumorales especificas
JP2020547371A JP7474701B2 (ja) 2018-03-13 2019-03-13 腫瘍特異的細胞枯渇のための抗cd25抗体
PCT/EP2019/056258 WO2019175224A1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
TW108108451A TW201938588A (zh) 2018-03-13 2019-03-13 抗-cd25抗體藥劑
EP19709954.2A EP3765502B1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
BR112020016519-0A BR112020016519A2 (pt) 2018-03-13 2019-03-13 Anticorpo ou fragmento de ligação a antígeno do mesmo, anticorpo ou um fragmento de ligação a antígeno que se liga especificamente a um epótipo de cd25 humano, variante amadurecida por afinidade, molécula de ácido nucleico, vetor de ácido nucleico, célula hospedeira, método para produzir um anticorpo ou fragmento de ligação a antígeno do mesmo, composição farmacêutica, uso de um anticorpo ou fragmento de ligação a antígeno do mesmo, método para tratar câncer em um indivíduo, método para esgotar células t reguladoras em um tumor em um indivíduo, anticorpo ou fragmento de ligação a antígeno que compete com um anticorpo, kit, método para preparar um anticorpo anti-cd25 e método para preparar uma composição farmacêutica
EP19711315.2A EP3765511B1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
EP19709957.5A EP3765505B1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
SG11202008784RA SG11202008784RA (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
KR1020207029229A KR20200131862A (ko) 2018-03-13 2019-03-13 종양 특이적 세포 고갈에 대한 항-cd25
SG11202008699WA SG11202008699WA (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
PE2020001299A PE20210288A1 (es) 2018-03-13 2019-03-13 Anti-cd25 para el agotamiento de celulas tumorales especificas
PCT/EP2019/056257 WO2019175223A1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
US16/352,717 US10745485B2 (en) 2018-03-13 2019-03-13 Anti-CD25 antibody agents
JP2020547326A JP7563978B2 (ja) 2018-03-13 2019-03-13 腫瘍特異的細胞枯渇のための抗cd25
JP2020547399A JP7451415B2 (ja) 2018-03-13 2019-03-13 腫瘍特異的細胞枯渇のための抗cd25
EP19711075.2A EP3765510A1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
PCT/EP2019/056249 WO2019175217A1 (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
CN201980019234.1A CN112074536B (zh) 2018-03-13 2019-03-13 用于肿瘤特异性细胞清除的抗-cd25
MYPI2020004660A MY207237A (en) 2018-03-13 2019-03-13 Anti-cd25 for tumour specific cell depletion
CN201980019241.1A CN112020512B (zh) 2018-03-13 2019-03-13 用于肿瘤特异性细胞清除的抗-cd25
US16/979,935 US11697688B2 (en) 2018-03-13 2019-03-13 Anti-CD25 for tumour specific cell depletion
KR1020207029205A KR20200131286A (ko) 2018-03-13 2019-03-13 종양 특이적 세포 고갈에 대한 항-cd25
US16/352,703 US10738125B2 (en) 2018-03-13 2019-03-13 Anti-CD25 antibody agents
JP2020547331A JP7563979B2 (ja) 2018-03-13 2019-03-13 腫瘍特異的細胞枯渇のための抗cd25
ZA2019/04980A ZA201904980B (en) 2017-03-17 2019-07-29 Fc-optimized anti-cd25 for tumour specific cell depletion
IL269081A IL269081B1 (en) 2017-03-17 2019-09-02 Fc-optimal anti-CD25 for specific cell depletion of the
US16/782,461 US11787866B2 (en) 2018-03-13 2020-02-05 Anti-CD25 antibody agents
US16/782,440 US11802160B2 (en) 2018-03-13 2020-02-05 Anti-CD25 antibody agents
CONC2020/0009476A CO2020009476A2 (es) 2018-03-13 2020-07-29 Anti-cd25 para depleción de células específicas de tumor
CONC2020/0009758A CO2020009758A2 (es) 2018-03-13 2020-08-06 Agentes anticuerpos anti–cd25
CONC2020/0009743A CO2020009743A2 (es) 2018-03-13 2020-08-06 Agentes anticuerpos anti–cd25
IL276995A IL276995A (en) 2018-03-13 2020-08-30 Anti-CD25 to deplete specific cells of you
IL276992A IL276992A (en) 2018-03-13 2020-08-30 Anti-CD25 to deplete specific cells of yours
IL276997A IL276997A (en) 2018-03-13 2020-08-30 Anti-CD25 to deplete specific cells of yours
CL2020002339A CL2020002339A1 (es) 2018-03-13 2020-09-10 Anti–cd25 para el agotamiento de células específicas de tumores
CL2020002338A CL2020002338A1 (es) 2018-03-13 2020-09-10 Anti–cd25 para el agotamiento de células específicas de tumores
CL2020002340A CL2020002340A1 (es) 2018-03-13 2020-09-10 Anti–cd25 para el agotamiento de células específicas de tumores
PH12020551453A PH12020551453A1 (en) 2018-03-13 2020-09-11 Anti-cd25 for tumour specific cell depletion
PH12020551454A PH12020551454A1 (en) 2018-03-13 2020-09-11 Anti-cd25 for tumour specific cell depletion
PH12020551451A PH12020551451A1 (en) 2018-03-13 2020-09-11 Anti-cd25 for tumour specific cell depletion
CL2021002603A CL2021002603A1 (es) 2018-03-13 2021-10-05 Anti–cd25 para el agotamiento de células específicas de tumores (divisional de la solicitud no. 202002340)
ZA2021/08422A ZA202108422B (en) 2018-03-13 2021-10-29 Anti-cd25 for tumour specific cell depletion
US18/470,875 US20240309101A1 (en) 2018-03-13 2023-09-20 Anti-cd25 antibody agents
JP2024009215A JP2024050684A (ja) 2017-03-17 2024-01-25 腫瘍特異的細胞枯渇のためのFc最適化抗CD25

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
EP17161717.8 2017-03-17
EP17161717 2017-03-17
GB1710879.6 2017-07-06
GBGB1710879.6A GB201710879D0 (en) 2017-07-06 2017-07-06 Methods and compounds for tumour-specific cell depletion
GBGB1714429.6A GB201714429D0 (en) 2017-09-07 2017-09-07 Compounds and methods for tumour-specific cell depletion
GB1714429.6 2017-09-07

Publications (1)

Publication Number Publication Date
WO2018167104A1 true WO2018167104A1 (en) 2018-09-20

Family

ID=61655786

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2018/056312 Ceased WO2018167104A1 (en) 2017-03-17 2018-03-13 Fc-optimized anti-cd25 for tumour specific cell depletion

Country Status (26)

Country Link
US (1) US11879014B2 (https=)
EP (1) EP3596123B1 (https=)
JP (2) JP2020514363A (https=)
KR (1) KR20190130137A (https=)
CN (1) CN110869388B (https=)
AU (1) AU2018233976B2 (https=)
BR (1) BR112019017017A2 (https=)
CA (1) CA3056506A1 (https=)
CL (1) CL2019002624A1 (https=)
CR (1) CR20190477A (https=)
DK (1) DK3596123T3 (https=)
ES (1) ES2975063T3 (https=)
FI (1) FI3596123T3 (https=)
HR (1) HRP20240469T1 (https=)
HU (1) HUE065999T2 (https=)
IL (1) IL269081B1 (https=)
LT (1) LT3596123T (https=)
MX (1) MX2019010974A (https=)
MY (1) MY208220A (https=)
PE (1) PE20191812A1 (https=)
PL (1) PL3596123T3 (https=)
RS (1) RS65351B1 (https=)
SG (1) SG11201908578YA (https=)
SI (1) SI3596123T1 (https=)
WO (1) WO2018167104A1 (https=)
ZA (1) ZA201904980B (https=)

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019175217A1 (en) * 2018-03-13 2019-09-19 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
WO2020102603A1 (en) * 2018-11-14 2020-05-22 Rubryc Therapeutics, Inc. Engineered cd25 polypeptides and uses thereof
WO2020234399A1 (en) * 2019-05-20 2020-11-26 INSERM (Institut National de la Santé et de la Recherche Médicale) Novel anti-cd25 antibodies
WO2020248938A1 (zh) * 2019-06-10 2020-12-17 山东博安生物技术有限公司 抗cd25抗体及其应用
WO2021228218A1 (zh) 2020-05-14 2021-11-18 江苏恒瑞医药股份有限公司 抗cd25抗体、其抗原结合片段及其医药用途
CN113677359A (zh) * 2018-11-14 2021-11-19 鲁比克治疗股份有限公司 Cd25抗体
WO2022106663A1 (en) * 2020-11-20 2022-05-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-cd25 antibodies
WO2022106665A1 (en) * 2020-11-20 2022-05-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-cd25 antibodies
WO2022117572A2 (en) 2020-12-02 2022-06-09 Oncurious Nv An ltbr agonist in combination therapy against cancer
WO2022182483A1 (en) * 2021-02-02 2022-09-01 Rakuten Medical, Inc. Methods for local and systemic treatment of cancers, tumors and tumor cells
WO2022184615A1 (en) 2021-03-01 2022-09-09 F. Hoffmann-La Roche Ag Novel biomarkers and uses thereof
US11466158B2 (en) 2020-04-10 2022-10-11 Rakuten Medical, Inc. Phthalocyanine dye compounds, conjugates and methods of use thereof
WO2023031403A1 (en) 2021-09-02 2023-03-09 F. Hoffmann-La Roche Ag Antibodies for the treatment of aml
WO2023208990A1 (en) 2022-04-26 2023-11-02 F. Hoffmann-La Roche Ag Combination therapy for the treatment of cancer comprising a fas axis antagonist and a t-reg cell depleting agent antagonist,
WO2024006965A1 (en) * 2022-06-30 2024-01-04 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Cd25-specific antibodies and uses thereof
WO2024088987A1 (en) 2022-10-26 2024-05-02 F. Hoffmann-La Roche Ag Combination therapy for the treatment of cancer
WO2024165454A1 (en) 2023-02-06 2024-08-15 F. Hoffmann-La Roche Ag Combination therapy and uses thereof
EP4199951A4 (en) * 2020-08-19 2024-09-18 Vitruviae LLC CD3/CD25 ANTIBODIES FOR NEURO-IMMUNE DISEASES

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11371066B2 (en) 2015-07-13 2022-06-28 Modular Genetics, Inc. Generation of acyl alcohols
US11879014B2 (en) 2017-03-17 2024-01-23 Tusk Therapeutics Ltd. Method of treating cancer or depleting regulatory T cells in a subject by administering a human IGG1 anti-CD25 antibody
CN115181182B (zh) * 2022-06-13 2024-03-29 南京融捷康生物科技有限公司 一种人源化的抗cd25的单域抗体及其应用
CN119451978A (zh) 2022-07-01 2025-02-14 神经基因治疗公司 Neo-2/15变体及其用于优先刺激T调节细胞的用途
CN118240080A (zh) * 2022-12-22 2024-06-25 深圳市福元生物科技有限公司 一种cd25单域抗体、人源化抗体、及制备方法
CN116087499B (zh) * 2023-02-20 2023-10-31 深圳裕康医学检验实验室 一种癌样本的染色方法及试剂盒
CN120314588B (zh) * 2025-05-21 2025-10-17 成都蓉生药业有限责任公司 一种人免疫球蛋白抗体依赖性细胞介导的吞噬作用生物学活性的检测方法和检测试剂盒

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1990007861A1 (en) 1988-12-28 1990-07-26 Protein Design Labs, Inc. CHIMERIC IMMUNOGLOBULINS SPECIFIC FOR p55 TAC PROTEIN OF THE IL-2 RECEPTOR
WO1993011238A1 (en) 1991-12-06 1993-06-10 Sumitomo Pharmaceuticals Company, Limited Humanized b-b10, an anti-il2 receptor antibody
WO2004045512A2 (en) 2002-11-15 2004-06-03 Genmab A/S Human monoclonal antibodies against cd25
WO2005115451A2 (en) * 2004-04-30 2005-12-08 Isis Innovation Limited Methods for generating improved immune response
WO2006108670A2 (en) 2005-04-15 2006-10-19 Novartis Ag Use of cd25 antibodies in immunotherapy
WO2008002933A2 (en) 2006-06-26 2008-01-03 Macrogenics, Inc. Combination of fcgammariib antibodies and cd20-specific antibodies and methods of use thereof
WO2014145907A1 (en) * 2013-03-15 2014-09-18 Xencor, Inc. Targeting t cells with heterodimeric proteins
WO2015173384A1 (en) 2014-05-15 2015-11-19 Bioinvent International Ab Medicaments, uses and methods
WO2017174331A1 (en) 2016-04-07 2017-10-12 Cancer Research Technology Limited Anti cd25 fc gamma receptor bispecific antibodies for tumor specific cell depletion
EP3596123A1 (en) 2017-03-17 2020-01-22 Tusk Therapeutics Ltd Fc-optimized anti-cd25 for tumour specific cell depletion

Family Cites Families (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4208479A (en) 1977-07-14 1980-06-17 Syva Company Label modified immunoassays
WO2004063355A2 (en) 2003-01-10 2004-07-29 Protein Design Labs, Inc. Novel methods of diagnosis of metastatic cancer, compositions and methods of screening for modulators of matastatic cancer
AU2007271398B2 (en) 2006-07-06 2013-06-20 Merck Patent Gmbh Compositions and methods for enhancing the efficacy of IL-2 mediated immune responses
AR064801A1 (es) 2006-08-18 2009-04-29 Xoma Technology Ltd Anticuerpo especifico prlr (receptor de prolactina) y sus usos
RU2391401C2 (ru) 2008-02-12 2010-06-10 Общество с ограниченной ответственностью "Лаборатория клеточного мониторинга" СПОСОБ ПОЛУЧЕНИЯ ПОПУЛЯЦИИ CD4+CD25+Foxp3+ Т-ЛИМФОЦИТОВ ЧЕЛОВЕКА ex vivo, СПОСОБ ЛЕЧЕНИЯ ЗАБОЛЕВАНИЯ
CA2742969A1 (en) 2008-11-07 2010-05-14 Fabrus Llc Anti-dll4 antibodies and uses thereof
EP2480671B8 (en) 2009-09-22 2015-10-28 ProBioGen AG Process for producing molecules containing specialized glycan structures
CA2784953C (en) * 2009-12-21 2018-05-22 Regeneron Pharmaceuticals, Inc. Humanized fc.gamma.r mice
AR079944A1 (es) 2010-01-20 2012-02-29 Boehringer Ingelheim Int Anticuerpo neutralizante de la actividad de un anticoagulante
EP2595657A4 (en) 2010-07-22 2015-09-23 Univ California ANTI-TUMOR ANTIGEN ANTIBODIES AND USE PROCESSES
MX2015012563A (es) 2013-03-15 2016-10-26 Abbvie Biotechnology Ltd Anticuerpos anti-cd25 y sus usos.
HK1220470A1 (zh) 2013-03-15 2017-05-05 Abbvie Biotechnology Ltd. 抗cd25抗体及其用途
US20170204154A1 (en) 2016-01-20 2017-07-20 Delinia, Inc. Molecules that selectively activate regulatory t cells for the treatment of autoimmune diseases
EP3538548A4 (en) 2016-11-08 2020-08-19 Delinia, Inc. IL-2 VARIANTS FOR THE TREATMENT OF AUTOIMMUNE DISEASES
UA129536C2 (uk) 2018-03-13 2025-05-28 Туск Терап'Ютікс Лтд Анти-cd25 для виснаження пухлиноспецифічних клітин

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1990007861A1 (en) 1988-12-28 1990-07-26 Protein Design Labs, Inc. CHIMERIC IMMUNOGLOBULINS SPECIFIC FOR p55 TAC PROTEIN OF THE IL-2 RECEPTOR
WO1993011238A1 (en) 1991-12-06 1993-06-10 Sumitomo Pharmaceuticals Company, Limited Humanized b-b10, an anti-il2 receptor antibody
WO2004045512A2 (en) 2002-11-15 2004-06-03 Genmab A/S Human monoclonal antibodies against cd25
WO2005115451A2 (en) * 2004-04-30 2005-12-08 Isis Innovation Limited Methods for generating improved immune response
WO2006108670A2 (en) 2005-04-15 2006-10-19 Novartis Ag Use of cd25 antibodies in immunotherapy
WO2008002933A2 (en) 2006-06-26 2008-01-03 Macrogenics, Inc. Combination of fcgammariib antibodies and cd20-specific antibodies and methods of use thereof
WO2014145907A1 (en) * 2013-03-15 2014-09-18 Xencor, Inc. Targeting t cells with heterodimeric proteins
WO2015173384A1 (en) 2014-05-15 2015-11-19 Bioinvent International Ab Medicaments, uses and methods
WO2017174331A1 (en) 2016-04-07 2017-10-12 Cancer Research Technology Limited Anti cd25 fc gamma receptor bispecific antibodies for tumor specific cell depletion
EP3596123A1 (en) 2017-03-17 2020-01-22 Tusk Therapeutics Ltd Fc-optimized anti-cd25 for tumour specific cell depletion

Non-Patent Citations (61)

* Cited by examiner, † Cited by third party
Title
"Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996
"Uniprot", Database accession no. P01589
"Uniprot", Database accession no. P01590
BIELEKOVA B, NEUROTHERAPEUTICS, vol. 10, no. 1, 2013, pages 55 - 67
BINDER M ET AL., CANCER RES, vol. 67, no. 8, 2007, pages 3518 - 23
CLYNES ET AL., PROC NATL ACAD SCI USA, vol. 95, 1998, pages 652 - 6
COUPER K ET AL., J IMMUNOL., vol. 178, 2007, pages 4136 - 4146
DANTAL J ET AL., TRANSPLANTATION, vol. 52, 1991, pages 110 - 5
ELPEK ET AL., J IMMUNOL., vol. 178, no. 11, 2007, pages 6840 - 8
ESTEP P ET AL., MABS, vol. 5, no. 2, 2013, pages 270 - 8
FAN G ET AL., J HEMATOL ONCOL, vol. 8, 2015, pages 130
FECCI P ET AL., CLIN CANCER RES., vol. 12, 2006, pages 4294 - 4305
FREEMAN, PROC NATL ACAD SCI USA, vol. 105, 2008, pages 10275 - 6
GOLGHER ET AL., EUR J IMMUNOL., vol. 32, no. 11, 2002, pages 3267 - 75
HALLETT W ET AL., BIOL BLOOD MARROW TRANSPLANT, vol. 14, 2008, pages 1088 - 1099
HAYES J ET AL., J INFLAMM RES, vol. 9, 2016, pages 209 - 219
HODI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 105, 2008, pages 3005 - 3010
IDUSOGIE ET AL., J IMMUNOL, vol. 166, 2001, pages 2571 - 5
JOHN H. SAMPSON ET AL: "A Pilot Study of IL-2R[alpha] Blockade during Lymphopenia Depletes Regulatory T-cells and Correlates with Enhanced Immunity in Patients with Glioblastoma", PLOS ONE, vol. 7, no. 2, 27 February 2012 (2012-02-27), pages e31046, XP055476722, DOI: 10.1371/journal.pone.0031046 *
JONES ET AL., CANCER IMMUN., vol. 22, no. 2, 2002, pages 1
KABAT, J BIOL CHEM, vol. 252, 1977, pages 6609 - 6616
KEARNS JD ET AL., MOL CANCER THER., vol. 14, 2015, pages 1625 - 36
KOHM A ET AL., J IMMUNOL., vol. 176, 2006, pages 3301 - 5
KUFER ET AL., TRENDS BIOTECHNOL, vol. 22, 2004, pages 238 - 44
LABRIJN AF ET AL., NAT PROTOC., vol. 9, 2014, pages 2450 - 63
LANGEDIJK JP ET AL., ANALYTICAL BIOCHEMISTRY, vol. 417, 2011, pages 149 - 155
LAZAR ET AL., PROC NATL ACAD SCI USA, vol. 103, 2006, pages 2005 - 2010
LOWENTHAL J.W ET AL., J. IMMUNOL., vol. 135, 1985, pages 3988 - 3994
MCNEILL A ET AL., SCAND J IMMUNOL, vol. 65, 2007, pages 63 - 9
MCNEILL A ET AL., SCAND J IMMUNOL., vol. 65, 2007, pages 63 - 9
MOREAU, J.-L ET AL., EUR. J. IMMUNOL., vol. 17, 1987, pages 929 - 935
NICOLAS GOUDIN ET AL: "Depletion of Regulatory T Cells Induces High Numbers of Dendritic Cells and Unmasks a Subset of Anti-Tumour CD8+CD11c+ PD-1lo Effector T Cells", PLOS ONE, vol. 11, no. 6, 24 June 2016 (2016-06-24), pages e0157822, XP055393805, DOI: 10.1371/journal.pone.0157822 *
NIMMERJAHN F ET AL., SCIENCE, vol. 310, 2005, pages 1510 - 2
ONISHI H ET AL., ANTICANC. RES., vol. 32, 2012, pages 997 - 1003
ONIZUKA ET AL., CANCER RES., vol. 59, no. 13, 1999, pages 3128 - 33
ONIZUKA S ET AL., CANC RES., vol. 59, 1999, pages 3128 - 3133
QUEEN C ET AL., PNAS, vol. 86, no. 24, 1989, pages 10029 - 10033
QUEZADA ET AL., J CLIN INVEST., vol. 116, no. 7, 2006, pages 1935 - 45
RICHARDS ET AL., MOL CANCER THER, vol. 7, 2008, pages 2517 - 27
ROGHANIAN A ET AL., CANCER CELL, vol. 27, 2015, pages 473 - 488
ROZAN C ET AL., MOL CANCER THER., vol. 12, 2013, pages 1481 - 91
RUBIN ET AL., HYBRIDOMA, vol. 4, no. 2, 1985, pages 91 - 102
SETIADY Y ET AL., EUR J IMMUNOL., vol. 40, 2010, pages 780 - 6
SETIADY Y ET AL., EUR. J. IMMUNOL., vol. 40, 2010, pages 780 - 6
SHANG B ET AL., SCI REP., vol. 5, 2015, pages 15179
SHIMIZU ET AL., J IMMUNOL., vol. 163, no. 10, 1999, pages 5211 - 8
SIMPSON ET AL., J EXP MED, vol. 210, 2013, pages 1695 - 710
SKERRA, FEBS J, vol. 275, 2008, pages 2677 - 83
SLIWKOWSKI; MELLMAN, SCIENCE, vol. 341, 2013, pages 192 - 8
SMITH ET AL., PROC NATL 25 ACAD SCI USA, vol. 109, 2012, pages 6181 - 6
SMYTH M ET AL., IMMUNOL CELL BIOL., vol. 92, 2014, pages 473 - 4
SPEISS C ET AL., MOLECULAR IMMUNOLOGY, vol. 67, 2015, pages 95 - 106
TANAKA ET AL., MICROBIOL. IMMUNOL, vol. 30, no. 4, 1986, pages 373 - 388
TEEGE S ET AL., SCI REP, vol. 5, 2015, pages 8959
TILLER K; TESSIER P, ANNU REV BIOMED ENG., vol. 17, 2015, pages 191 - 216
TIMMERMANN P ET AL., J. MOL. RECOGNIT., vol. 20, 2007, pages 283 - 99
VARGAS A ET AL., IMMUNITY, vol. 48, no. 6, 2017, pages 577 - 586
VOLK HD ET AL., CLIN. EXP. IMMUNOL., vol. 76, 1989, pages 121 - 5
WEBER, J NUCL MED, vol. 50, 2009, pages 15 - 105
WEINER G, NAT REV CANCER, vol. 15, 2015, pages 361 - 370
ZHANG ET AL., CANCER BIOTHER RADIOPHARM, vol. 24, no. 3, 2009, pages 303 - 309

Cited By (61)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11697688B2 (en) 2018-03-13 2023-07-11 Tusk Therapeutics Ltd. Anti-CD25 for tumour specific cell depletion
WO2019175220A1 (en) * 2018-03-13 2019-09-19 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
WO2019175215A1 (en) * 2018-03-13 2019-09-19 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
WO2019175216A1 (en) * 2018-03-13 2019-09-19 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
WO2019175226A1 (en) * 2018-03-13 2019-09-19 Tusk Therapeutics Ltd Anti-cd25 antibody agents
WO2019175223A1 (en) * 2018-03-13 2019-09-19 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
WO2019175222A1 (en) * 2018-03-13 2019-09-19 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
WO2019175224A1 (en) * 2018-03-13 2019-09-19 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
EP3765502B1 (en) * 2018-03-13 2024-08-07 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
US10738125B2 (en) 2018-03-13 2020-08-11 Tusk Therapeutics Ltd. Anti-CD25 antibody agents
US10745485B2 (en) 2018-03-13 2020-08-18 Tusk Therapeutics Ltd. Anti-CD25 antibody agents
US10752691B2 (en) 2018-03-13 2020-08-25 Tusk Therapeutics Ltd. Anti-CD25 antibody agents
EP3765511B1 (en) * 2018-03-13 2024-07-24 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
EP3765503B1 (en) * 2018-03-13 2024-05-01 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
EP3765510A1 (en) * 2018-03-13 2021-01-20 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
WO2019175217A1 (en) * 2018-03-13 2019-09-19 Tusk Therapeutics Ltd Anti-cd25 for tumour specific cell depletion
US11919960B2 (en) 2018-03-13 2024-03-05 Tusk Therapeutics Ltd. Anti-CD25 antibody agents
US11873341B2 (en) 2018-03-13 2024-01-16 Tusk Therapeutics Ltd. Anti-CD25 for tumour specific cell depletion
US11851494B2 (en) 2018-03-13 2023-12-26 Tusk Therapeutics Ltd. Anti-CD25 for tumour specific cell depletion
US11814434B2 (en) 2018-03-13 2023-11-14 Tusk Therapeutics Ltd. Anti-CD25 for tumour specific cell depletion
US11802160B2 (en) 2018-03-13 2023-10-31 Tusk Therapeutics Ltd. Anti-CD25 antibody agents
US11802161B2 (en) 2018-03-13 2023-10-31 Tusk Therapeutics Ltd. Anti-CD25 for tumour specific cell depletion
US11787866B2 (en) 2018-03-13 2023-10-17 Tusk Therapeutics Ltd. Anti-CD25 antibody agents
CN113646330A (zh) * 2018-11-14 2021-11-12 鲁比克治疗股份有限公司 工程化cd25多肽及其用途
JP2022507487A (ja) * 2018-11-14 2022-01-18 ルーブリック・セラピューティクス・インコーポレイテッド Cd25抗体
WO2020102603A1 (en) * 2018-11-14 2020-05-22 Rubryc Therapeutics, Inc. Engineered cd25 polypeptides and uses thereof
JP7619941B2 (ja) 2018-11-14 2025-01-22 アイバイオ, インク. Cd25抗体
CN113677359A (zh) * 2018-11-14 2021-11-19 鲁比克治疗股份有限公司 Cd25抗体
US12215163B2 (en) * 2018-11-14 2025-02-04 Ibio, Inc. CD25 antibodies
US12441803B2 (en) 2018-11-14 2025-10-14 Ibio, Inc. Engineered CD25 polypeptides and uses thereof
JP2024175003A (ja) * 2018-11-14 2024-12-17 アイバイオ, インク. Cd25抗体
EP3880227A4 (en) * 2018-11-14 2022-11-09 RubrYc Therapeutics, Inc. ANTI-CD25 ANTIBODIES
JP2025026923A (ja) * 2018-11-14 2025-02-26 アイバイオ, インク. 操作されたcd25ポリペプチドおよびその使用
JP7695881B2 (ja) 2018-11-14 2025-06-19 アイバイオ, インク. 操作されたcd25ポリペプチドおよびその使用
JP2022513043A (ja) * 2018-11-14 2022-02-07 ルーブリック・セラピューティクス・インコーポレイテッド 操作されたcd25ポリペプチドおよびその使用
US20230220102A1 (en) * 2018-11-14 2023-07-13 Rubryc Therapeutics, Inc. Cd25 antibodies
CN114630838A (zh) * 2019-05-20 2022-06-14 法国国家健康和医学研究院 新的抗cd25抗体
JP2022538733A (ja) * 2019-05-20 2022-09-06 インセルム(インスティチュート ナショナル デ ラ サンテ エ デ ラ リシェルシェ メディカル) 新規抗cd25抗体
WO2020234399A1 (en) * 2019-05-20 2020-11-26 INSERM (Institut National de la Santé et de la Recherche Médicale) Novel anti-cd25 antibodies
WO2020248938A1 (zh) * 2019-06-10 2020-12-17 山东博安生物技术有限公司 抗cd25抗体及其应用
US12325751B2 (en) 2019-06-10 2025-06-10 Shandong Boan Biotechnology Co., Ltd. Anti-CD25 antibody and application thereof
KR102789146B1 (ko) * 2019-06-10 2025-04-01 샨동 보안 바이오테크놀로지 컴퍼니, 리미티드 항-cd25 항체 및 이의 적용
JP7245358B2 (ja) 2019-06-10 2023-03-23 山東博安生物技術股▲ふん▼有限公司 抗cd25抗体及びその適用
KR20220007120A (ko) * 2019-06-10 2022-01-18 샨동 보안 바이오테크놀로지 컴퍼니, 리미티드 항-cd25 항체 및 이의 적용
JP2022527651A (ja) * 2019-06-10 2022-06-02 山東博安生物技術股▲ふん▼有限公司 抗cd25抗体及びその適用
EP3932949A4 (en) * 2019-06-10 2022-06-29 Shandong Boan Biotechnology Co., Ltd. Anti-cd25 antibody and application thereof
US11466158B2 (en) 2020-04-10 2022-10-11 Rakuten Medical, Inc. Phthalocyanine dye compounds, conjugates and methods of use thereof
US12448518B2 (en) 2020-04-10 2025-10-21 Rakuten Medical, Inc. Phthalocyanine dye compounds, conjugates and methods of use thereof
WO2021228218A1 (zh) 2020-05-14 2021-11-18 江苏恒瑞医药股份有限公司 抗cd25抗体、其抗原结合片段及其医药用途
CN115397860A (zh) * 2020-05-14 2022-11-25 江苏恒瑞医药股份有限公司 抗cd25抗体、其抗原结合片段及其医药用途
EP4199951A4 (en) * 2020-08-19 2024-09-18 Vitruviae LLC CD3/CD25 ANTIBODIES FOR NEURO-IMMUNE DISEASES
WO2022106663A1 (en) * 2020-11-20 2022-05-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-cd25 antibodies
WO2022106665A1 (en) * 2020-11-20 2022-05-27 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-cd25 antibodies
WO2022117572A2 (en) 2020-12-02 2022-06-09 Oncurious Nv An ltbr agonist in combination therapy against cancer
WO2022182483A1 (en) * 2021-02-02 2022-09-01 Rakuten Medical, Inc. Methods for local and systemic treatment of cancers, tumors and tumor cells
WO2022184615A1 (en) 2021-03-01 2022-09-09 F. Hoffmann-La Roche Ag Novel biomarkers and uses thereof
WO2023031403A1 (en) 2021-09-02 2023-03-09 F. Hoffmann-La Roche Ag Antibodies for the treatment of aml
WO2023208990A1 (en) 2022-04-26 2023-11-02 F. Hoffmann-La Roche Ag Combination therapy for the treatment of cancer comprising a fas axis antagonist and a t-reg cell depleting agent antagonist,
WO2024006965A1 (en) * 2022-06-30 2024-01-04 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Cd25-specific antibodies and uses thereof
WO2024088987A1 (en) 2022-10-26 2024-05-02 F. Hoffmann-La Roche Ag Combination therapy for the treatment of cancer
WO2024165454A1 (en) 2023-02-06 2024-08-15 F. Hoffmann-La Roche Ag Combination therapy and uses thereof

Also Published As

Publication number Publication date
HUE065999T2 (hu) 2024-06-28
CN110869388B (zh) 2024-09-20
PL3596123T3 (pl) 2024-06-24
HRP20240469T1 (hr) 2024-07-19
CR20190477A (es) 2020-01-07
SI3596123T1 (sl) 2024-05-31
MX2019010974A (es) 2020-08-03
PE20191812A1 (es) 2019-12-26
ES2975063T3 (es) 2024-07-03
US20200010554A1 (en) 2020-01-09
CN110869388A (zh) 2020-03-06
EP3596123B1 (en) 2024-01-10
NZ756984A (en) 2025-08-29
LT3596123T (lt) 2024-03-25
IL269081B1 (en) 2026-01-01
ZA201904980B (en) 2026-03-25
DK3596123T3 (da) 2024-02-26
KR20190130137A (ko) 2019-11-21
AU2018233976A1 (en) 2019-10-31
CA3056506A1 (en) 2018-09-20
BR112019017017A2 (pt) 2020-04-14
IL269081A (en) 2019-11-28
US11879014B2 (en) 2024-01-23
AU2018233976B2 (en) 2025-03-20
JP2020514363A (ja) 2020-05-21
RS65351B1 (sr) 2024-04-30
CL2019002624A1 (es) 2020-04-03
JP2024050684A (ja) 2024-04-10
MY208220A (en) 2025-04-24
EP3596123A1 (en) 2020-01-22
SG11201908578YA (en) 2019-10-30
FI3596123T3 (fi) 2024-04-17

Similar Documents

Publication Publication Date Title
EP3596123B1 (en) Fc-optimized anti-cd25 for tumour specific cell depletion
US11814434B2 (en) Anti-CD25 for tumour specific cell depletion
WO2019008386A1 (en) COMPOUNDS AND METHODS FOR DEPLOYING SPECIFIC CELLS FROM A TUMOR
EP4255929A2 (en) An ltbr agonist in combination therapy against cancer
RU2839380C1 (ru) Fc-оптимизированные антитела к cd25 для истощения опухолеспецифических клеток
HK40016585A (en) Fc-optimized anti-cd25 for tumor specific cell depletion
HK40016585B (zh) 用於肿瘤特异性细胞消耗的fc优化的抗cd25

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18711313

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 139850140003003997

Country of ref document: IR

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019017017

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2019550705

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3056506

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20197030283

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2019125548

Country of ref document: RU

ENP Entry into the national phase

Ref document number: 2018711313

Country of ref document: EP

Effective date: 20191017

ENP Entry into the national phase

Ref document number: 2018233976

Country of ref document: AU

Date of ref document: 20180313

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112019017017

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190815

WWE Wipo information: entry into national phase

Ref document number: P-2024/0376

Country of ref document: RS

WWG Wipo information: grant in national office

Ref document number: 2019125548

Country of ref document: RU

WWG Wipo information: grant in national office

Ref document number: 756984

Country of ref document: NZ